5DNDA

Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
354
structure length
353
Chain Sequence
ERHLLLIYTGGTLGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGADTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental Data in Support of a Direct Displacement Mechanism for Type I/II l-Asparaginases.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 115
structure length 353
sequence length 354
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dndA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 5dndA01
1HFWA 1JSLA 2GVNA 2WT4A 4Q0MA 2P2DA 1HO3A 2D6FA 1HG1A 3ECAA 4RA6B 4R8KA 4NJEB 4RA6A 1ZQ1A 5K3OA 2OCDA 5I3ZA 1JAZA 5DNCA 1O7JA 5K4HA 5I4BA 5CBPA 5HW0A 5K4GA 1HG0A 4RA9B 5I48A 5K45A 2JK0A 4R8LA 1IHDA 1HFJA 2WLTA 1DJOA 3PGA1 1JJAA 4ECAA 5DNDA 5DNEA 3NTXA 1JSRA 1DJPA 4RA9A 2P2NA 1AGXA 1NNSA 5CBPB 1WNFA 1WLSA 4NJEA 1WSAA 5F52A 1HFKA 1ZCFA 2HLNA 3NXKA 4PGAA 2HIMA
chains in the Genus database with same CATH superfamily
2OXTA 1ENPA 3L7NA 2RAFA 2YMPA 2EFCB 1UXHA 1DC4A 3ZDQA 5CX1A 1GYPA 1XAHA 4RW0A 4F7DA 1T1RA 1QHHB 4UULA 4HEJA 1JG1A 4G0XA 4MIEA 3PFGA 4WNAB 1UBLS 2BR4A 2XMRA 2ZRHA 3GPDG 2VUUA 5A3JA 1EVYA 3SM9A 3PITA 1L3BA 5AOBA 1ZVVA 1KC3A 4GP9A 3UXYA 1OFTA 4G5GA 4ZU1X 5KVQA 4K6FA 2PKYX 3VNSA 1IXSB 2NQ8A 4OSOA 4H17A 1D2HA 1GILA 1QB8A 3MINB 3AETB 1Z6GA 4B44A 1M34E 1AF4A 1WF6A 2JAHA 3A4VA 3G8YA 3MXTA 3SQOA 3V4LA 3VJLA 2F55A 2Y1FA 5LD2C 4K0KB 4MHOA 1WPRA 1DIGA 3W9SA 5IM4A 1A7KA 3GYBA 3OH8A 4M1EA 2H5EA 3R7AA 1X19A 1ADCA 5CDGA 3JQFA 3CCFA 1DIHA 1GPJA 2R8OA 5FTLA 3QKIA 2NP7A 5AP9A 3TXXA 2DEUA 4W1PA 1PE0A 4PONA 3AZPA 4S1NA 3WY9A 4IYJA 4P4NA 1OXMA 1U0TA 4E21A 1XCMA 2FDXA 4OQEA 3DNFA 3QV2A 1SUCA 1TCVA 3IDAA 5FP0A 6ADHA 2OB1A 4L07A 1CUBA 1CVRA 3IULA 4UNRA 3C3AA 1V4BA 1XCLA 2WKRA 5GONB 2PUGA 1RM5A 3OT5A 1KK3A 4G25A 4UQPA 4MDYA 5BRJA 3OA2A 2H08A 2NZJA 3TF5A 3KQKA 1RIIA 1GZ4A 1RC0A 4XYGA 1W44A 4G0PA 4UNNA 2COUA 1BQEA 1XKLA 1CVLA 3KD3A 2NVUB 1RHQA 4HH3C 1G7TA 4XJTA 1XAJA 1PHRA 1UEJA 3KSAC 2YZKA 1H85A 2GD0A 1QAQA 2FY8A 3WKAA 3NUZA 1JH9A 1XWIA 4OI2A 4OSEA 4ZCLA 5CDFE 1FUIA 1ZICA 1FFCA 2F6RA 3BIFA 4BMZA 2FPMA 5G0VA 3DGEC 1JB1A 4L72A 1AXGA 3HM2A 5ECDA 1V5IA 1BD3A 3H8SA 2YV2A 2NYAA 4KPUA 3H75A 1FJGB 1WABA 2ZSIA 4G37A 2X86A 4QPNA 5ITVA 1PFGA 3K9BA 3WGGA 2VF5X 1YBHA 3ON5A 4KQJA 3KSDO 4ZI7A 1J0XO 3IAAA 4OV6B 2LKDA 4PSVA 2Y0BA 4UHBA 4KR9A 3S5JA 3MT9A 2FLVA 2IOYA 3TM5A 2JFGA 4FR5A 5CA1A 4Y1FA 3EVCA 4ZI7B 4UNPA 3IBYA 2VK1A 5BR7A 4R2LA 4NYMR 4YAKA 2AD5A 4BNIA 2QTVA 1ZUWA 4MQ4A 1XAIA 4E4TA 2JPDA 1DTWA 2OC4A 4EF4A 1F12A 4KO8A 1I9GA 2Q3JA 2D0OB 3LH5A 2QZSA 3CN9A 2W48A 3TAUA 3WV4A 3WYCA 1KO7A 4RELA 1G291 4J7AA 3LLSA 3ESRA 5AVSA 1SCDA 3CZQA 2L69A 1A9TA 4P4SA 3OY7A 3U4IA 2XTAA 1J0EA 1KARA 1YQUA 3A1WA 1Y5IA 3PIDA 4FQ5A 1E7YA 5GV7A 3RARA 3MFQA 4HWKA 3RG2A 4AN4A 1QH8A 3F9CA 2NV6A 3AQIA 3NHJA 3QI7A 4HLUA 4L7QA 2ZR0A 4MRAA 4RSGA 4RGBA 3TMYA 1FBNA 3U4QB 1NJ6A 3BREA 1EH5A 3IUMA 4BMNA 5JSZB 2JAXA 3RGWS 4B0PA 2WC1A 5KTMA 4QVIA 4B3GA 9LDTA 1QGDA 1QJ4A 2ZRJA 4FS8A 2H3EA 1Z6XA 4MS4B 3U7FB 3EXG1 1S3SA 4A7PA 5DHUA 1PR9A 2BTEA 4YB8A 3ZBUA 3WZMA 3UCEA 1KQFA 4YRBA 1DAPA 1K7FB 3EAQA 3KCNA 1MFPA 4F96A 3F97A 1RRPA 2DFTA 3K9GA 3GAMA 4ZAWA 3PYMA 2GHIA 2HMVA 4I19A 1O08A 3BGWA 1U28C 3EEFA 4GXTA 4MJ3A 5CB4F 2ANBA 3GA0A 1QPGA 1M5UA 2GCEA 2CNLA 4H60A 2NUTA 3VPDA 4TKVB 2V03A 3Q98A 4P3XA 4DMUB 1NMQA 4GLOA 4WD3A 4EG0A 4GQAA 3X2FA 5CCBA 2WM3A 3LQ2A 4WLEA 5AW0A 3I39X 3WWOA 4XUGB 1RWBA 5COQA 4XOIA 3IAS6 3W9UA 4CCYA 4RULA 4RYLA 4C6SA 5EHZA 3RHSA 4P4SB 5EY5B 2PZLA 3PKZA 1IY1A 4Q9IA 1TO2E 3MCVA 2QVYX 1QHYA 3F6RA 1I7NA 1VKJA 3PFNA 2WYWA 5EPOA 2GRUA 4L0DA 5DM4A 3WISA 5A06A 3R20A 3AIMA 5FDFA 4V3BA 3P2IA 1TZJA 4P7FA 1OFVA 1SG6A 1LW7A 1FDUA 2BEVA 4S0ZA 3LRPA 5B36A 5IJWA 3NHZA 3T7IA 1E1KA 1T36B 1XVLA 4GIBA 2PMEA 2P3OA 3E9RA 4LNUB 4MS1B 1M2VA 2I33A 2XD4A 3CSUA 2O0MA 5EP4A 1OPXA 1NW8A 3VISA 3KTDA 3HVKA 5IM4F 3LWBA 2RAPA 3ESYA 1OU4A 4PS0A 5K45A 3H5RA 5K0BA 4O4JB 5AMXA 4HAOA 2C4UA 4QDZA 3INGA 4DR2B 3CT4A 3EVEA 4NVRA 3L79A 2IYYA 3SBDA 4ZU6X 5LQJA 4DGSA 1E1QD 1I3OA 1XVIA 2C8JA 2HNAA 3AR3A 4RH3A 2JIMA 5FPTA 3FYUB 2VYVA 2NXJA 1PS8A 2Z58A 4KQMA 2JIOA 3TNLA 1LLUA 3IUYA 5REQB 5U9CA 2XWQA 5EJGA 1O1YA 4IS3A 4TMZA 3C24A 3K5IA 4KWIA 3UT0A 1QTNA 4RK7A 1XJWA 1HT1E 4QGBA 5JARA 4Y9TA 2PTGA 1PZHA 4A8TA 4LXTA 4UUAA 2NVBA 4JI5B 3WGHA 3N8NA 2CLCX 3S99A 2PTHA 4QLBA 3FVWA 3T5MA 2FSGA 4MPDA 4PLHA 3DDWA 3R4VA 3M9XA 1JJ7A 1MABB 1NOIA 2H59A 3L6UA 4IDOA 5JSHA 3AY3A 3P94A 3GPLA 2AWNA 3M2TA 4XD7D 5ALHA 5EFZA 3UC5A 1M1XB 1DTWB 4C30A 1W25A 1N5LA 3DL0A 3H65A 3F4KA 1FL9A 5ENVA 2POCA 1IBMB 1JVBA 1F14A 1R8YA 1YDGA 4UD2A 4BGUA 4WOPA 1MAWA 2E1RA 3ZPXA 4W5OA 2YJGA 2YV3A 2B6NA 1SQ0A 4KDEA 2HIMA 2P4HX 4RHXA 4ZO6A 4CM8B 4GKJB 1W29A 1P2VA 4CYMA 2YCLA 5IFKA 4CEHA 3B3AA 3BMOB 4NCJA 4LKRA 3RRZA 3TXYA 3P97A 4IFTA 3IKMB 4LECA 5DBEX 4JQOA 1GNQA 2R2GA 3BFXA 3WO0A 4CCAA 1MB2A 1ZSNA 2R4QA 4MVCA 3RK1A 1P1CA 5JS2A 3NI2A 2BONA 16PKA 4YDRA 1YL5A 2XNCA 3G89A 1EXVA 4JUCA 1U8UA 1T5SA 2WZQA 3MJ4A 4RKQA 3VZQA 3U31A 1TJNA 2BKUA 3CSSA 3NYWA 3O03A 1T5DX 2FW0A 5ESWA 4NHOA 2FTKE 1S1MA 1MOZA 4I55F 4ACAA 4ZVKA 1V96A 4IJMA 1MDBA 1L7EA 1PUIA 1TMKA 2OAEA 2W00A 5L3SB 1V3QE 1JQ5A 1MC1A 1UMBA 1NN3A 3GFOA 4P3KA 5KNBD 4XVHA 1QVRA 4WIAA 1F4VA 2OE2A 1IHYA 1S9DA 4ZICA 4W8GA 5F78A 4WUTA 5L8VA 2VH2A 4ND8B 1PFQA 3L6BA 1T9GR 3F5FA 3B1VA 2D0IA 2JAWA 1EGAA 3R77A 4R83A 3G6WA 4KAXA 5E1DA 3QSYA 2IPXA 3W5DA 4V0QA 1DFHA 4H3HB 4JC8A 1JR6A 3KOMA 4Y1EA 1NYRA 5FNZA 1ZJJA 1ZIOA 2JDID 4DQUA 4P0TA 2YOFA 4U5QA 2PSFA 3QKSA 1JHUA 3K2QA 2HMYB 1B0UA 2L2QA 4Z5XA 2VVTA 1LLCA 4O4IF 2E82A 4RMIA 3DZDA 2JGAA 3G0HA 4Y6GB 1GTSA 2XDAA 1AGRA 2ECPA 4GL4A 9MHTA 2JK1A 4QM7A 2WJZB 3WBFA 2Q0HA 3FFWA 5JECA 1JQLB 3LRTA 3RHTA 3QUCA 3QI2A 5F5XA 3LUCA 1R4AA 2X4DA 2RC5A 2HN9A 4J0JA 3CZCA 3Q8KA 1S2NA 5B53A 4ZAFA 3TJZA 3D1LA 3WOVA 3H9GA 1R0LA 3H17A 4JQYA 4D3FA 1C0EA 4CR8A 4V24A 3ZNNA 1VC2A 1HNZB 2ZIFA 5CVTA 4C3UA 7MDHA 3JATB 5EFOA 3GRCA 1VZ3A 2ZTHA 2GPBA 3C1OA 4LY3A 4RFVA 1L8AA 1I6KA 5ARBA 3PZBA 1BFUA 1PYDA 3KVNA 4TMXA 5IVIA 1PP4A 4L4XA 1K63A 1H2EA 2J9ZB 3FSRA 1IMOA 5E3HA 4UMVA 3PB3A 2AOXA 2VDLB 4HDMA 5BN3B 3EUFA 2PHZA 3VAZA 1I2MA 3HKDB 4E32A 4O6VA 1W9HA 1PDVA 4BRSA 1CYEA 3SKXA 4QHTA 1XDBA 2AEFA 1JMVA 4JBWA 4PSKA 4MV8A 4XDYA 2DHRA 4HDMB 5CW2A 2J46A 5JCJA 4BYGA 3RC3A 5BN3A 3NBXX 4DMMA 3COYA 2A88A 1TE2A 2IEYA 3P8ZA 2QRQA 1NW6A 3A25A 1A77A 1R6XA 3HEAA 4GMHA 2X41A 1P4AA 1V16A 4C88A 1TZCA 2V7TA 5ILOA 1SQGA 5AJTA 1M1UA 3QITA 2ZYVX 1GG2A 2DGDA 1C1DB 2JLRA 1Y1QA 2W5UA 4G3XA 4M0FA 3V2GA 2XZLA 2CWWA 3MJFA 3Q87B 3QMWA 1G64A 4NV0A 2PEYA 3F71A 1CNMA 1FX0A 3OUTA 4FMDB 5F4BA 3G0GA 3WTBA 1VBKA 3WGQA 4CLRA 4CTOA 2A9JA 1Y3IA 4DG9A 2Q9UA 1RYDA 3Q9NA 2GBCA 1VE1A 4IUYA 3STXA 4V2UA 4RWZA 5AI0A 5L3QA 4B83A 3O75A 4HY3A 1VHTA 1WU7A 3NBMA 4MGHA 3UT5B 2B92A 3O95A 3MILA 1ZI6A 4H18A 5D7BA 1XD2A 4I8DA 4M1QA 4OD0A 1KEEB 3LVQE 4OXRA 1A04A 3I32A 4QRIA 5BSRA 5JTTA 3DPIA 3IQHX 4DN6A 1PG2A 3ZD7A 4BDTA 1SVMA 5JC1A 1DVRA 2OD9A 3TMKA 3X1WA 1RE0A 5JAQA 2ECKA 4OXKA 4ZYVA 2GZHA 3ZTWA 2OSVA 5A5FA 2JBHA 1ISRA 1NASA 1X8JA 1MB0A 2MIIA 5B1DA 1IAVA 2B4QA 1YCDA 1NT4A 1QYRA 5DGXA 2AHOA 3I5MA 3NVMB 5AKLA 2C3MA 2BEJA 3OIFA 4YRMA 3FZNA 4W99A 3HS3A 4IDNA 5EWLB 2I6TA 2X0KA 2R65A 4FC7A 4NZ9A 5GONA 3MJTA 3QEMB 5IABA 3A4YA 4RIIA 1Z8NA 3UW3A 2Q5CA 3WQHA 5B5SA 5JH7A 3QLEA 3OEWA 3JASB 3FDIA 1P4JA 4Y67A 4UU0A 4A8HA 2VDVE 2H4WA 1K8XB 1Y6QA 1SWVA 2VF2A 4JXJA 3QEBZ 2HLPA 3R3ZA 1NG1A 1HUQA 1NU8A 4D8WA 2TMYA 4EW2A 1VLJA 4GEGA 3C2QA 5EMHA 3O8OB 2FP4A 2CFOA 2CVPA 3QZUA 4KRXA 5BQ5A 1NXVA 1RAAA 3C48A 1NN0A 3EXEA 3QFSA 2HJVA 1YMUA 3FPSA 3CRRA 4JHXA 1EX7A 4K3VA 4PPQA 5CG1A 5CB8A 1YRBA 4R0MA 5JRDS 5KINB 1V8ZA 3M6WA 1U1FA 2I3GA 1KOJA 1V8OA 2ATCA 5ICGA 5JADA 3O94A 3TDKA 5IUJC 2OG1A 2WAXA 1I4OA 1W47A 3ABRB 1LJ8A 2RGXA 3L93A 4W82A 4Z9XA 5HDQA 4AZVA 1BN7A 2PJZA 4RH0A 2QYOA 1O4VA 2ZDHA 4FEEA 3SYTA 1Z2AA 1WDTA 5LSAA 3ZEIA 4UBKA 4BX0A 2ZG6A 3GU3A 1CUSA 1AV7A 2H2GA 3A27A 2GPJA 4WT7A 2CV0A 1TUIA 2JGMA 1J33A 2I3BA 3CNEA 4WH0A 4GICA 1GGFA 4PZLA 4KQ9A 4PQEA 1BC5A 3M5DA 4P98A 3T3GA 4A6PA 2A5DA 3B1KA 4D8TA 1FP1D 4HTFB 2AL7A 3R3HA 4DCTA 2GMWA 3NBYC 1AUOA 3V7UA 2H7VA 3OZBA 4C06A 2C7RA 1IN4A 1CDDA 3CKKA 1VMKA 3UJBA 1UBTS 3ECAA 1TAUA 2OFOA 1KMHA 4DLVA 2IU3A 4ZVRA 4EF5A 3JQPA 3D4NA 3ZNOA 5IJ9B 4RJJA 4O2AF 2FA9A 3C3KA 2HLDA 4H7PA 5TE9A 1C8BA 2XSZD 2XR1A 3HKBB 3OPYB 3HABA 5T6MA 3D6AA 3DLAA 4K9SA 4YHHB 4L74A 3KEQA 3KEGA 2XGGA 1WMSA 3EVZA 2PZEA 4I4CA 4WLNA 3ELUA 3PWTA 3ZUGA 1IQUA 1YACA 5EINA 2XUOA 4DY6A 4FKBA 2JNWA 4ZYYA 1BCRA 2PLWA 1E2JA 3P52A 1OXBB 4K46A 1S2IA 4FLMA 3ZW8A 3NANA 4YACA 1POXA 1WQ1R 4LG1A 3D6UA 4KL8S 4PIVA 3UYKA 1KEEA 1OH5A 5JSKA 2A5JA 1NMYA 1FFEA 2C98A 1O96B 1V5EA 3NNDA 4QNNA 3O4FA 3OHPA 1K4KA 2FUEA 3SZ3A 3I6BA 3ZWPA 2XJ4A 4HDNA 2W6ZA 3NHAA 3NTLA 4LNHA 2OAGA 1FY2A 4TT8A 4UTVA 3D64A 4YT4A 2W4IA 4IOKA 4X1YB 2SICE 3P4YA 1X1QA 3B3JA 4IDCA 1X3SA 1XZKA 3R41A 4GO1A 5T3YA 5ALQA 4C08A 4DM4A 1P75A 2WAOA 2BMAA 4DG5A 3F7TA 3UK1A 4QGAA 4M8SA 4OHVA 4RF3A 1WZNA 1L7NA 3HP1A 5EXDA 1OV6A 3IRVA 5J5CA 2BC9A 1VJ1A 2DHCA 4D9KA 1E1RA 4PPYA 1R5BA 3ED1A 1L7OA 1SKMA 3BGIA 2ORVA 4JP5A 1ID1A 4H1VA 3BMNA 3C6QA 4YIKA 4DUGD 3JQ9A 1QAOA 1WAMA 2EF1A 3PUXA 4WZ6A 4Z3KA 3ENQA 3AVWA 5JALA 4JYMA 4DB2A 5IP5A 3RRYA 4Q4DA 3ZY4A 4MV0A 1N8KA 1UT5A 3C70A 2RB5A 3HUUA 4JBYA 3MRXA 1PF7E 1G2QA 1SUPA 5COBA 3WSWA 5IJZA 1G21E 2FETA 2Y99A 3SKVA 3FH0A 3JQGA 3KELA 4JB2A 3JQ9C 4FYWA 5MGBA 2AR7A 2PZ8A 1MD9A 3GI1A 4Y6RA 1KDZA 3HMKA 2GEDA 1NZJA 3ZS9A 4ER7A 3S8YA 3SMVA 2XGSA 2PWBA 3A6FA 4HDNB 2Q3CA 3F6CA 4TTAA 4WFKA 3ZBQA 3B6IA 3VZDA 3RG8A 3ZX4A 3HM9A 3GWZA 1YE3A 1U0LA 1UBFA 1JLRA 2O4CA 2VP4A 3AVOA 1WZCA 3FE2A 3IP8A 1HF3A 2W6JD 2WU8A 3PS9A 3P4UA 4C21A 2IEZA 1VHLA 3ENZA 2I2DA 4KBGA 3L8EA 3OM0A 3SDSA 4BP9A 1RADA 5BW5A 5AW2A 1ZRSA 2EW1A 3QFHA 2BJWA 4B3JA 3VKGA 1Q44A 3SJZA 5FEMA 4I9FA 1DBWA 4GP6A 2COKA 4FCCA 2PXXA 1RKVA 5D6OA 3PUVA 1O58A 3JW8A 4RM2A 3VPXA 1AQNA 3D5QA 4NZNA 5SZHB 3V4RA 2DWUA 1P74A 2OZVA 3SYLA 3LSYA 3E9NA 5JC8A 4TLMB 4D9HA 4FILA 5LP6F 4BDSA 3LUGA 3EXHB 2JLWA 5K9ZA 4O25A 3NAMA 4RVCA 2HU5A 4KSYA 2E4WA 3PFFA 2D06A 1QLWA 5JSUA 3Q6IA 1TK9A 2QTCA 2WSSA 2F67A 1PGPA 4HQRA 3TLKA 3SC3A 1CJTC 1XZCA 4L9SA 3UJ7A 4D4JA 5HFJA 4BE4A 2ZJ8A 4AMYA 4LJ6A 2QWXA 1C4XA 1UKEA 1TDJA 4KRGA 5TPZA 3WTCA 4G1VA 5BQFA 3MXOA 1NATA 4OHRA 4QUIA 3AY7A 4FFSA 5GJWC 2VEOA 4ZI7F 1ZZGA 3U3RA 1MNAA 3ZGNA 1V5GA 3ZQJA 5K99A 3DUFB 1HYEA 1FP6A 2XADA 3L8DA 3C8UA 3HADA 2FF5A 3MBKA 2QENA 5F33A 5ADHA 1VCIA 4EHJA 2XMSA 1QU3A 1Q6ZA 2N1BA 1Y42X 2EDCA 4V0RA 1GTG1 5L3ZA 2UAGA 1VMIA 1E2MA 2V3VA 5AOVA 5SICE 3RTAA 2G77B 2ODTX 4UTOA 1FLNA 1NW7A 2PBFA 4D3DA 4L4SA 5IPFA 3D59A 2V96A 5DM0A 3BFJA 3TW6A 5FBVB 3JWGA 5GGYA 4QA9A 5B3LA 2XUPA 1W52X 2D5LA 2Q3BA 3OPNA 1C3LA 3AFNA 3KTAB 2IHYA 3U26A 3ASYA 5DLEA 1BGWA 1C3EA 4LRWA 1JDZA 2Z8YA 5CXQA 3ASUA 4F3KA 4I5IA 4HSEA 1SB9A 1XB2A 1ZOLA 4MGZR 5DXFA 2OFWA 1XK6A 3DLIA 2IZ7A 1XEAA 3KUCA 2ENWA 4R84A 2IELA 4QFCA 3Q8LA 2EYQA 2FRVA 1O54A 2PG3A 2X77A 2FMIA 3C8DA 2OLJA 3CH5A 3NTQA 3PUJA 4BO1A 2BCJQ 1IJFA 2EU8A 2J45A 4NBKA 3DAGA 3ZN2A 4MVYA 4IDPA 4U7TB 2GAIA 3BH6A 1UOEA 1ZN2A 1JQJC 2Q29A 2DM6A 2R00A 3IHLA 2WMDA 5JHGB 3KUKA 2O2JA 3WJ2A 4DV6B 1EX1A 1PWZA 3PEVA 4D3YA 1IRXA 4ZT3A 1QU2A 4AMZA 1HRKA 3DP7A 4OUKX 4XM1A 6ABPA 2M9MA 1KA9H 4J0GA 3V7FA 3V1UA 1BE1A 5K0ZA 1Y4DE 3P9SA 3C6BA 3GRKA 3RWMB 3H84A 3K8QA 2ZITA 5K3BA 3WYAA 1ZIDA 3GQBB 4U7DA 3ZTTA 2A58A 3MAJA 1YTUA 4QOGA 4QEZA 1UC5B 2OFFA 1LGYA 4EKGA 2VTDA 3K1JA 3PJFA 3WE7A 3VOTA 2NO9A 1YR9A 4ZTBA 2O50A 3EYWA 2GKOA 3G17A 3QY9A 1FQOA 4RK1A 3ITEA 5J4VA 1TK3A 4AO8A 3PFWO 5CJPA 1ZM7A 2ZIXA 3C6MA 1V48A 2ZSUA 3CRNA 4AMUA 5I4KA 4CIDA 4ZKEA 2XUKA 3U4GA 4B3CA 3HEBA 4IICA 4P0QB 3ZNPA 1Z6TA 3IVXA 2GS9A 5TXGA 3LDGA 3EZ6A 3E58A 4IL5A 3S68A 4FMPA 3THSA 1N75A 4TVBA 2Z95A 5HE9A 5A9SB 4MK4A 1JFRA 1L4NA 2PKEA 3C8MA 3FNIA 4OHWA 1Q20A 4JVSB 2SECE 4HH0A 2NYVA 3RKSA 3ER9A 2BHTA 4IF6A 2JVKA 4G9GA 2DBRA 3DVAB 1U8EA 2HDOA 3LCVB 4QJ4A 5CU7A 4YS6A 5A5GA 1XV5A 2QP4A 5LFAA 3UFBA 2ZIAA 4LHXA 3TSZA 3AIKA 4RVNA 2G88A 2Z3ZA 1TQ8A 2NYUA 1TUBA 3FPCA 1T8SA 4GWGA 4R81A 3IUSA 1BRTA 2EC5A 3LP8A 4XEHA 4CW7A 1Z4OA 4Z9YA 1UQRA 1PCXA 3HV2A 3HXKA 3B8EA 3WYDA 4D9JA 4IDFA 2QX7A 1N7JA 3EDOA 2QG4A 4Q7QA 4DRXA 3T5GA 5HQ3B 1KQ3A 1IK6A 4UVGA 1XZGA 2WTXA 1KTVA 3ROFA 3T9DA 2R68A 4N5LA 4DQ0A 1DRKA 3RVDA 3RS4A 2PO5A 3CUEF 1DTSA 1QV7A 2FAXA 2CBXA 3B9BA 2B8TA 2OLKA 3UKJA 3WXMA 4EY8A 4UU1A 1QLHA 3RVKA 3EJ6A 1NJGA 1AKNA 3GFFA 2FQXA 1Z28A 4WZBB 1KXZA 1DS6A 4GL2A 2BFEA 3V8PA 2BGTA 2ZRMA 2CMFA 3KZVA 1KPIA 2QR5A 5P21A 4RDCA 1LY1A 1YR1A 1DKQA 2QLBA 1T2EA 1LBEA 3SF8A 3V4VB 4OGGA 4RSHA 4DWVA 3V8VA 2ZB3A 3VJMA 3IAM1 3ZI7A 1ZVKA 1ZD1A 2ZM6B 1FVOA 1OGIA 5ALZA 2PRZA 1E59A 2FMUA 4ZQFA 3ROKA 4PW0A 4DWOA 1JE1A 1I14A 4Q4HB 4BO6A 1Z29A 2WZCA 4JNCA 1Z2NX 3FJYA 3M1YA 4U6SA 1MC4A 5DNAA 2LE0A 3OHSX 5JPDA 1XZPA 1KJYA 1KORA 3CF6R 3RPEA 3TQHA 1V4NA 4DCJA 3E1KA 4GI7A 3Q11A 1X1CA 2JCYA 1N25A 2A0XA 4FXPA 1NQXA 2GHQA 2XUGA 1NJSA 4GPBA 4JHLA 4RMNA 3U7IA 4TV9A 5AKZA 1H05A 1T2CA 5BN1A 1FP4A 1E6MA 2FQQA 3EDQA 2QTVB 3BGDA 1FP7A 2PWAA 2E5WA 3DV9A 3N0WA 3EPLA 1KKMA 3OETA 2Z6QA 2NUAB 4P5DA 4WBNA 3LT5A 4MCJA 3Q5DA 5EESA 3KBOA 1QFZA 1OILA 1Y1KE 3N7AA 4JNKA 4F91B 3G9XA 3MGGA 2OO3A 1CETA 3R3UA 4XM2A 5LB4A 1YUBA 2XMPA 2W0SA 1QYCA 4LBZA 1PEYA 2C97A 2YTZA 4GM1A 1ONPA 2QBYB 3EXEB 2ZTMA 1O5OA 3E7DA 3NGLA 2B5WA 4OKNA 4JLSA 1FEZA 3B78A 5JS6A 3KJZA 3TL6A 1J97A 4CMIA 2D2EA 3FYUA 2YXEA 3P2MA 4GI3A 3GEPA 4OP2A 3WB0A 2VPIA 1TVKB 3KFXA 2D2FA 3RR2A 1AQYA 4JASB 4DLZA 1K88A 1N2BA 4IXDA 1PT5A 2H2WA 3NXKA 5B7GA 1U0OC 4DR3B 4G2TA 3P0RA 1FMTA 4YRIA 3A9RA 1J0CA 2PCJA 4BU1A 4D43A 5IRCD 2DWPA 4LYGA 1HWYA 4P53A 1YB5A 1VGRA 4ACBA 2CZGA 3BBLA 4MTCA 3WJ7A 3L6RA 4CT4B 3PDHA 1IZYA 2PV0A 2WDPA 1G0OA 1VZ2A 3ZE7A 1ZISA 1M8KA 1SUWA 1U1DA 4IIXA 4Z86A 3A3PA 3VDNB 2LR0A 4KMOA 4LSMA 1E9BA 1V1RA 2BRUC 2JEOA 4IMJB 2WIBA 1SUEA 2J59A 3M6UA 4DKJA 3PD7A 1WMAA 3L0DA 4OQXA 1NQ5A 1EB9A 4R9RA 2X19A 4ZV9A 1ZN8A 2EQ5A 4I6EA 4RLSA 1SZPA 3RHZA 1TT7A 2AOWA 3GMTA 4K9QA 4LWZA 4EIWA 4CKCA 1JR4A 4RJIA 2HHHB 3CF4G 5BSHA 2XOKA 2O9JA 2NU8A 1MGOA 1TX4B 2RGAA 5CCEA 1NAHA 4MR8B 1W8IA 4ETWA 3OPXA 4D0GA 3WL8A 4A6DA 1QAMA 4PAMA 4O4HF 2BMWA 2CWDA 3ZY3A 4QBKA 4EMBA 3UBMA 4OM7A 4Q9KA 3C6ZA 5FPKA 2NYRA 1ISMA 4S05A 3KYJB 1I0ZA 3L7YA 1PJTA 4TTPA 4D4MA 4ZT6A 4Z0NA 1A9XA 3VPSA 1MOQA 1XZ8A 1HA3A 4P86A 4QYMA 4GI1A 4JLMA 3WFIA 3OLVA 4HB0A 4TUYB 4JC5A 1T9GS 4BVJA 1IVNA 1H94A 1XI2A 4YV1A 3FBTA 4JFRA 1VYTA 3D4OA 2Y3IA 3VPGA 4Z1OA 1KJJA 3K2BA 4C2UA 3LW8A 2YVUA 1JIKA 1XRNA 2BHRA 3VVCA 1OAAA 3PFBA 2IP1A 4TLAA 1N0VC 3T6KA 4RA6A 1TLFA 2XCOA 4X1IB 3W5UA 2WF7A 2HT1A 4H6WA 4MA5A 3ZD9A 5FL3A 2IYTA 1T3TA 5C7OO 1H4VB 2DQYA 2DPLA 2HZ7A 2GAJA 3KAQA 4N3AA 3PUWA 4Y9DA 5HXAA 3SF0A 1RMQA 1SWWA 1U2DC 2IGBA 3WDMA 1L5OA 2OXRA 3TE7A 2PGXA 1GTZA 1RAHA 3QQ5A 1TGVA 1VI5A 2WKWA 3QX8A 4LVOA 3AZQA 2I4TA 1F2UB 4N1AA 3SIPA 3HA7A 1WR8A 3OFND 1R6BX 4MS1A 4RH1A 1SKQA 2C5GA 1EK1A 1Y9AA 1WKBA 3Q4GA 4NFYA 5ERGB 1NVVQ 2J9GA 1RHRA 3OZXA 5HCIA 4BVLA 4DR6B 1U5BB 1TW2A 3N0RA 5MFZA 2W6PA 1NGSA 3FNFA 4CEIB 1X15A 3H5TA 5EYPA 2O7VA 1LVHA 1CEYA 2QZ4A 4YJFA 4KLNA 2AJDA 2QX9A 2ZU6A 3IILA 1MV5A 4PNZA 1XZEA 3NGXA 3LGSA 3HA3A 4JJFA 5AM4A 1WCIB 1PDOA 2QTTA 4H59A 4JC0A 1ONNA 3T1NA 4ZO9A 5JY6A 3UPUA 2VLIA 1RZRA 3TXAA 1FDIA 1BHSA 3OHMA 5HRAA 2C58A 5G0SA 2FHSA 1SUAA 3ZXYA 1USIA 1GTJ1 2UVPA 1U1IA 2A59A 2R47A 1II9A 4Z7JA 4L9RA 5EKTA 1MO3A 1RAGA 1F7VA 3HV0A 4PLCA 2OUKA 3CZ5A 2A1UB 2Q5EA 1FDRA 1WVGA 2QAJA 3OJXA 4ANFA 2Y76A 5I7OA 2EKLA 4G5SA 3PJRA 1ZH8A 5EIAA 5FKJA 4TVOA 4XFJA 1QZTA 3EULA 2NM0A 3GJZA 4H16A 4B1FA 2ZAIA 3HYLA 3L1UA 1XCPA 2MOKA 4R8VA 4F21A 2OQ2A 1DOHA 2W6CX 1V9SA 2IHJA 3I05A 4H4CA 1W1IA 3PICA 1KYVA 1ND6A 1EM6A 3FFAA 2JVIA 3FUUA 1N4AA 2CXTA 2O1SA 3ORHA 3UKOA 3ZXIA 5CA0F 1WTCA 4W9NA 1XXHA 3W5AA 2JIZA 2XA9A 4ENRA 3KSUA 4D0RA 2IQIA 4H0NA 3AL0C 2AG1A 5ARDA 3D7RA 2ZUBA 3EVBA 1QUFA 3WGOA 1HL7A 1YUMA 3GMSA 2PUBA 1ISIA 2WUEA 1KPGA 4A2WA 4WA8A 4YLGA 4Z7QB 2VATA 4V0KA 2GI4A 4ZAZA 1S89A 5JYEA 1VM6A 1WCIA 3OE4A 1ZHOA 3H1EA 3L8GA 1E8NA 1NDHA 1SCUA 3PJGA 4TS9A 1C81A 3K9FC 1Z7EA 1RQLA 1P72A 2IU6A 3B38A 1B74A 2BEWA 3GBSA 5CDHA 4C3OB 2VS1A 3JCZA 3N05A 2A3RA 2X6RA 3IUQA 2OBMA 1Y1TA 3FSGA 4MR8A 3TAXA 3IBTA 3GEHA 1F0NA 2FP3A 3SD7A 4Q4AB 4WN9B 3FETA 4C0WA 5C1BA 2PKQO 5IT0A 3SN6A 3W5VA 3NMUF 1THTA 2B0JA 3P9CA 4F7WA 2J9RA 4MJ7A 4PFKA 4LZWA 5E6UA 1Y3AA 2ATXA 4HNTA 3I9KA 1QGZA 3BE6A 4FINA 3IVMA 2A8YA 2D4HA 2N3ZA 3KR1A 1KIMA 4GS5A 4N0EA 3QYAA 3S81A 2H1HA 4IZHA 1VIYA 4X6XA 3CW9A 1VGQA 2C9CA 4MUIA 3EGXA 4LK2A 1TFUA 4CKCB 2YWHA 3QYPA 4FPXA 1OPRA 1ZOIA 4WZAA 3U7QB 3VR6H 3O3MB 2FZKA 2QW0X 1O2DA 4QDTA 4L8GA 4C78A 2X76A 3WNVA 3RTGA 1LZLA 3NPAA 3PNOA 2XA1A 4DUPA 4ZDIA 3ZD8A 1IBCA 2ONCA 3D5TA 1Q1AA 3O3CA 3MK31 3CVYA 4LF8B 4ZAXA 3RABA 1W0CA 2Q0QA 1V9CA 3DBLB 5E4YA 2YFKA 3ZV6A 3FB1A 1NVAA 3ZZ1A 1M3SA 2NSHA 1J42A 2VZ8A 3MD0A 4XWTA 5JI3E 1UM8A 5JZMA 4D82A 3AUYA 2B4RO 1QCYA 2CLMB 1LSSA 2P9TA 4WVFA 3ZDAA 3JU3A 3GRVA 1TJ4A 1I80A 4OJMX 3AR6A 1NVFA 1QFYA 2Z4TA 4QTZA 1F4PA 4CR6A 1O0SA 4CEIA 1NF3A 1MO6A 3WGNA 3FFTA 2Z09A 3KT8A 1CQIA 2Y93A 4GI2A 1D2AA 3V00A 3UHOA 3GRPA 4AKEA 4F9EA 2G9VA 4XCVA 5AI9A 2DR0A 3HRKA 3WVNA 2UZ4A 2QT1A 4A23A 5DM1A 3RUCA 4K8OA 1PJQA 4DMHA 6LDHA 2ZB8A 4IWNA 4EQ6B 1WUIS 2X5NA 2DLDA 2RHBA 1KDOA 3X1ZA 3HJGA 3I5YA 4H15A 5JQGA 1LWOA 3AKDA 4AWBA 4JOBA 2E48A 4JKOA 5BT9A 1DQZA 5JS7A 3KLOA 1HTWA 3TIIA 2VRCA 3OT4A 1E6EA 1QFJA 3C39A 2DFPA 4MMZB 5FNVF 4IQ0A 3ANLA 3PU6A 2QXUA 4QARA 2XF2A 4N0MA 1UJ2A 3DHNA 3CPHA 1J2UA 4UUOA 3UOAB 3DBLA 3NEJA 1E1RD 5HEKA 4FGLA 2IZ0A 4L51A 3KWJA 5CM9C 1RRGA 1I5OA 1RBYA 2W42A 2OM6A 3GJ6A 2GK6A 4DUGA 3NALA 1NDQA 4RE5A 3VNQA 4F6CA 1VFPA 1GG9A 3GV0A 1EHCA 3V7NA 1OXUA 2QPTA 1KEVA 3VOAA 2WJ3A 2DFDA 3ONDA 3G2LA 3UG6A 1EFVB 4HNGA 3RU3A 2ZKLA 1PT7A 2VOEA 4GW3A 2IOQA 1E4OA 2Y2UA 1Q0RA 2JI8A 3CCBA 3GF4A 3FDZB 3EH1A 1EE2A 4EECA 2H57A 5DSXA 4CQLB 5LQUA 1DQNA 1T9AA 1PLJA 2RHMA 3AVQA 4RIFA 3SZUA 4WN3A 4DLKA 3TRKA 2XKJE 3RSSA 2OTCA 2P4UA 2VBGA 3A3NA 3V1LA 3A1EA 1J8QA 2O3SA 3A05A 2V4UA 3GD7A 4EP1A 2BEWB 4PY2A 3QA9A 1DPFA 1UAGA 4RE6A 5AUQA 1SKAA 2ZQYA 2FPRA 3EN0A 4PSAA 4UBJA 3FGOA 3FPEA 4OP1A 2P30A 4OAQA 1MQ9A 4QJ5A 5E8JA 5KQRA 2PE5A 4AM8A 1Y6JA 2I54A 4G01B 3RGGA 1HEUA 3ET5A 2G0TA 4DT1A 4RYDA 4LE0A 1WL8A 1ZA2A 3IE0A 4UCFA 3SDBA 2HMSA 5J43A 5DHQA 1JKXA 3JZAA 3TIXB 2A5GA 2QTRA 3IXMA 4IX1A 4YPVA 2AN5A 2HFKA 1UBEA 2B6HA 3ZJTA 4Y2SA 1CLEA 3COVA 1Q0TA 4YRZA 3ND8A 3WZLA 3A36A 2UUCB 1VPLA 5J2TF 1O96A 3GN1A 3ADCA 1F8XA 1XBTA 3AV0B 3T54A 4I66A 1JHAA 2C29D 3U48A 3AVPA 1RWVA 2Q0XA 3HDJA 2QN9A 4F9GA 3CW2A 3GHHA 1X8XA 1SUSA 4K81B 4MQFB 3PXBA 4WHMA 1RC8A 1BTOA 5DT2A 3PC6A 5IARA 3SIRA 1X94A 5A3RA 1H6BA 3LY9A 1FFXB 1W2HA 4HKTA 1U0RA 1J90A 1E1DA 1BWSA 4C3ZA 1WOMA 1OCEA 3FMOB 3C87A 5AJVB 5KC8A 4G0UA 1ZC3A 4OXYA 2WUGA 5IT5A 1L7BA 2BI8A 3HR8A 5BSUA 1J5EB 3NBFA 3PI7A 1B8OA 3IJ5A 3SS9X 1MJGM 5CR9A 3T5AA 2P78A 1PVOA 3VKFA 2BP7B 4Z4IA 3AF4A 4L02A 1ANKA 4WK6A 2AC7A 2XA2A 5K5EA 7YASA 2GPYA 3CNQS 2JFWA 4JROA 1GQSA 4CVNA 1KRWA 2C57A 3U60B 2Y0EA 3VTKA 3KYIB 1R7RA 5ECGC 1MENA 1DRWA 4LFBB 2OHVA 4GQIA 3ZVKA 4UNSA 4AN1A 1QCZA 3IL2A 3EEBA 4FI3F 4HQ6A 1O0BA 4N76A 4J0FA 2VJLA 5FULA 4GSYA 4HEA1 4QBTA 1CZUA 5H3HA 1V2GA 1VPDA 4G1EB 4BX9A 2RH5A 1O95D 1DBRA 3TJMA 3RJMA 4B4UA 5KNLA 2VDRB 4JL5A 1RFGE 5GZ6A 3GEGA 2RHCA 4YP5A 4LXIA 5CNMA 5DT9A 2BZGA 3IDSA 4ZT5A 1D4ZA 4YONB 4IIJA 4EKEA 3SGLA 2R25B 1PJAA 3PFHA 4IGEA 5E9JA 1N6PA 3SBEA 4D6XA 5JEDA 3L6CA 2Q49A 2WD7B 2XW6A 3G02A 4L08A 4M87A 1ETHA 2EKDA 1YDEA 1CQPA 2Q1WA 3H2KA 3OOHA 1S8FA 2HI0A 3OIUA 4ZXPA 3WQQA 2Q3FA 1RKBA 1Z75A 3TPFA 1W2WB 2WSSD 4X90A 3EZLA 3C3WA 4FYYA 4UBIA 4MQUA 3D7NA 4QOSA 4B85A 4J1TA 3HUFA 4QIHA 2GPWA 4CM8A 5JNVA 2BZ1A 4GE0A 2Q7OE 2H65A 5AR1A 3GGPA 1AGXA 4UVEA 1B0ZA 4IYRA 2YJTD 4LSWA 4DANA 3L8HA 3EQ6A 2XUFA 4MKRA 1MQ8B 4FKMA 4K87A 4O4LA 5DHRA 5L9AA 4ESOA 3OO1A 2R66A 3X1JA 1U2RA 2P3QA 2AFHB 3NHYA 4X71A 4MYHA 4B3FX 1M8JA 4EBFA 4JI7B 3E8MA 1J2RA 4XW2A 3NUGA 3WLKX 3IKTA 3PHLA 4HWTA 1O7JA 1JQDA 1TZMA 1YI1A 4FGSA 4MSUA 2PJRA 4CM4A 2NSYA 4LPKA 4I9UA 4YUZA 4AYXA 4ARIA 5AW6A 1N33B 2Y27A 4HCJA 1T5IA 4RIGA 3VBEA 3KWLA 4ZK6A 5LLSA 4R1LA 5F2EA 2YHBA 3MPUA 4C03A 4DABA 4DLLA 5CLFA 3HZOA 3OMXA 4IDBA 2AX4A 2E21A 4OU5A 2TMKA 3HVRA 5CUQA 1HTBA 2EL9A 5TVKA 4DV0B 5HSGA 2WABA 4DLTA 1X1BA 3O8QA 4EVRA 3QUQA 5ALXA 2AK3A 1MP0A 1R4NA 1Z7BA 4NJMA 4FDLA 4O4JF 3TNDA 5J2TB 3MT7A 4AJJA 2ODAA 1WW8A 4MUBA 1COZA 1VI2A 3DWIA 1IZ8A 3GDHA 4A15A 4J3JA 5B4VA 1U9YA 1L5VA 1TEXA 4QXAA 1SZDA 3EEQA 4IFIA 4KHPB 1OY1A 2FZ4A 4QFMA 1XMVA 3R75A 2OD7A 5IH3A 1C9JA 3S0JA 4HGNA 3IERA 5TX7A 1EWVA 1GXSB 1CUGA 3S40A 2WM8A 3NKVA 1CY8A 4KKVA 1YS2X 2Q4EA 2IH4A 2HT6A 4V3CA 2NSDA 2R8EA 1KY3A 3UN1A 2C95A 4M1KA 4C5BA 3UT6A 4L0CA 3A6PC 4XAQA 2VRBA 3BWDD 3DMYA 2VWQA 3LPAA 3H7AA 5TY0A 4AJOA 1N6NA 1IZ9A 4KQ2A 5ESDA 5H9VA 4DA7A 4Z1MD 1UJ4A 2B21A 1CEQA 1DC6A 3K92A 1J0AA 1CS0B 1WJGA 3L9XA 1NM5A 2H1FA 5HQ3A 4G09A 4HZGA 3BB3A 3KALA 5AT1A 1FLVA 1QWOA 3N59A 4TGLA 5CVEA 4ZHSA 3RS0A 1W5TA 2XZTA 1N5OX 4ZC8A 2YY5A 2MT9A 1J8DA 2VXOA 3CC8A 3LT1A 4KFTA 4DILA 2PKCA 5DASA 4IEEA 1NR7A 1Y37A 1MX3A 2QW1A 4TOIA 2G0NA 1ZC4A 2PBRA 4WECA 2C07A 1A82A 5H82A 2C4TA 3LNTA 3O8LA 4FUQA 3RT1A 4MP3A 2FRXA 1R16A 3O3OB 4QRDA 4HT3B 3N0TA 5H70A 2WW8A 1X7DA 2GCOA 2HWUA 1IEWA 4TLEA 4P7BA 2C9MA 1AKMA 3OU7A 4B2YA 1GXSA 1XWFA 4V03A 1RCUA 2WKSA 1M2GA 4O29A 2HB6A 3S29A 1M2OB 1DI0A 1W6RA 4C7KA 2V6IA 1KK2A 4JUFA 3FF1A 3IEMA 5EIWA 4YCLA 3V97A 2VA8A 1C9NA 1JB9A 2HMTA 3CVVA 3BXFA 2VQEB 1ENZA 3JVEA 3EFOB 3S8EA 3UBTA 1Q3KA 3BK7A 2QVBA 4RJTA 2VLBA 2H3HA 1M0SA 3TKYA 4I4IA 2BISA 3UMJA 1LDEA 4KOEC 1TL7C 1Z4JA 2K7ZA 4EUFA 1GFIA 1A8IA 1MVLA 4D26A 3FD8A 3T8YA 1FUUA 6YASA 1XKXA 4EATA 2VH1A 2H5LA 4F6RA 1P1FA 3IIEA 2ZWPA 3P19A 3CRZA 3QEMA 3QF7A 4NI5A 5FWXA 5A4FS 1BVHA 1HE8B 4WXMA 1RYMA 2CHGA 1LUAA 1CERA 2I66A 4I99A 5I4CA 2LP4Y 5G40A 1MH9A 1UKZA 4OP3A 3EZ2A 4G24A 5K3FB 1KWKA 1YZHA 3D6HA 4IQ4A 4HS4A 3IDQA 3AL3A 5KAPA 3D8SA 5AXBA 2CDBA 3ZHOA 4B6RA 4EH1A 1GFWA 1QTIA 2I0FA 4KACA 4IINA 2DFKB 3FLAA 1NY6A 1UMBB 2XNJA 3LPMA 2Q8QA 1KDTA 1GKKA 3A6DA 4R8KA 5FYDA 2IU0A 4OB7A 5LQCA 2CYBA 1VJRA 1GKLA 4NAUA 3TEMA 3LT2A 1JR3D 3H9EO 3QBEA 2JDIA 3LHFA 1WZIA 2ZP1A 5EIXA 3OOJA 3LC7O 4PAQA 5BWLA 4M8LA 1KFCB 5DH9A 1YR7A 5AIAA 1P80A 1XDGA 3MELA 4NATA 5CG2A 2Q5QA 5LDHA 4ZAVA 4V0LA 3TSCA 1NUUA 2IU4A 2XD9A 1GYRA 3ESZA 3TYXA 1X42A 4ZYXA 3PA8A 1IRIA 3HNPA 1K5DA 1FVHA 3AU9A 3MGAA 5IEJA 3LQ1A 1W35A 4TXMA 5LA6A 4AG6A 4F60A 3TRDA 3GJ7A 4H7HA 1KO1A 4MRVA 4BQPA 2J5RA 2VTBA 2UU9B 4RF4A 1J4AA 1YL6A 2W2LD 3D3QA 4F3RA 2R7KA 3LA8A 4E15A 2IE8A 1G20E 1E2UA 2BCGY 4HGPA 4BJ1A 2P62A 3CSDA 4PX5A 2J09A 1CFZA 1OLSB 3NEYA 4TZ0A 4RZ3A 3NJRA 5BSMA 4NYJR 3ADPA 5A0TA 2QRHA 1P4HA 3IKJA 5EIOA 1JHZA 1PWHA 2VHUA 4CMHA 1L4BA 1W8DA 4AD8A 1FMFA 2O7RA 2GHRA 3I58A 2P1ZA 5HIJA 1O94A 1XWWA 3SZOA 4WWHA 3E3AA 3RSGA 3SE7A 3ZZMA 4EGQA 1FMCA 3ZK9A 2MMGA 4IWXA 4PZZA 5E7QA 3SJCA 2HDNB 3LS2A 3STUA 4L2IA 5ITZB 3SFZA 3C6KA 2ESRA 4L1KA 1R8XA 3GJSA 1VHDA 3Q8WA 4AUKA 4MKZA 2ZYTX 4LPSA 3SC6A 4WUVA 2EGUA 2XTZA 2YN2A 4TKVA 7GPBA 4BQFA 1JFTA 3ZE1B 1H3EA 1I4EB 1P5ZB 1CR1A 3PDJA 2IPOA 5BPFA 2A5FA 2FEKA 2VDOB 2W2TA 2OYSA 3VR4A 2KLHA 3OEHD 2NUPA 5DHFA 1MPTA 1KU6A 1V1RB 3GRRA 3ZHCA 4EGSA 1JPVA 4ETIA 3F98A 4HHEA 3RBXA 1KFBB 2Q4RA 1M1ZA 1NVBA 2E9SA 2TYSB 3QFCA 3QFTA 4KN8A 1OI4A 1TQ4A 1T91A 4HPJB 5E6SA 1YRAA 2AQKA 2A35A 4KFSA 3BL6A 4KX5A 5AK0A 5K2MA 3SAJA 1U0GA 3VVMA 5JJBA 3DBHB 3ETJA 4QGFA 1MT0A 1RMYA 2BEVB 1GWNA 1L1RA 2A92A 2I8AA 4YLEA 1BMFD 4WV3A 5EA2A 1I6WA 2V6FA 4G63A 1GKUB 2CL6X 2AE1A 4R3NA 3WXBA 4EF6A 2DUMA 3S44A 4ZVSA 1ZI8A 2I99A 1GR0A 3TAHA 3AWDA 4EB6A 2VDJA 3QQPA 3MEQA 2ZBDA 1QIMA 1NSTA 2CK3D 2V58A 3MQ2A 4JOSA 1VKNA 1KJ9A 2QRVB 3LE8A 2NUAA 4M6WA 4WBNB 1Z0FA 4NMWA 2PT7A 3AR2A 3MCZA 3C41J 4MIOA 4G6ZA 1SHKA 3T1OA 3CQ9A 1J00A 4ND1A 4EOGA 3OZ7A 4Q9AA 5C1DA 2ZSFA 5KTYA 4FDUA 3GROA 1KEKA 4B31A 2QG9A 3A10A 1X13A 1ZK2A 3R0QA 3HDTA 2HW8A 1O6GA 1GPBA 3FCUB 2HQSA 4H7EA 4JT9A 3T3OA 2AMJA 1EGQA 2ZR8A 3CG4A 1JXQA 3G9QA 1SBHA 3KQPA 4BJ3A 4WFIA 2Q6TA 2L19A 3RYFA 4OKSA 1AHNA 2FMFA 4FU0A 1DOZA 3EGWA 3R9XA 1RD4A 1OI3A 3AKEA 4I1RA 5E6SB 1Z62A 3KB8A 2BI4A 2VHZA 2ZANA 1U2TA 3PG5A 5DN6A 1T2VA 3KZNA 4NBSA 4M0LA 1XTZA 5DGHA 4ZT7A 5DJ5A 4A82A 4BB9A 3KV1A 3HXTA 5DNEA 5C9ZA 1GQFA 1VP9A 1NTRA 3L0IB 4CNQA 5K0JA 2QN6A 5LZ9A 1ZEJA 5ALPA 3UFXB 3D31A 4LIPD 4UUMA 1G3QA 3C7DB 3GCZA 4NK5A 1NVVR 1VP3A 4DSOA 2RHOA 3LUDA 1UZMA 3JASA 3PHBE 3QKRB 4M49A 2IZZA 3RJZA 3AF6A 1OJ7A 5B64A 3ZDXB 1BXGA 1Q1QA 5TSDA 1YCFA 5JJIA 1OYWA 3WAGA 3PR1A 4AY4A 2DWQA 2V7PA 2RHTA 1AQUA 4P31A 3MRSA 1Y80A 4BWGA 2CJWB 3WLJA 3IMEA 1Y1RA 4OLFA 3C6YA 3HLKA 4RK4A 4WESA 1P6QA 4YLYA 2UXDB 2HL6A 3E9CA 4PTYA 4HDRB 4ZO8A 5KWJA 4OMFG 3TB4A 1LVUA 4IEFB 3RADC 1J09A 2VDPB 4MQLA 3VHRA 1RWPA 5HMMA 1DEOA 4DV3B 4NULA 2FZVA 4UM7A 1E0SA 4P81A 4GECA 3PF9A 4TT3A 5EZYB 1TLLA 2FW1A 1OXTA 1T2UA 3O4HA 4HN2A 4JYCA 3QKWA 3BZUA 1Q57A 4M7WA 4F4CA 4D98A 1CD5A 2Z2ZA 2DWOA 1D07A 4K6OA 3GLIE 4OQFA 3TIFA 1QB7A 1R6VA 4PGHA 3BWVA 4HC4A 3F74A 3BIWA 4V1CB 2C7PA 2DLCX 3N58A 1J1UA 1T2FA 1XXHB 2QNBA 1F5SA 3A26A 2HBYA 3DQQA 5EKXA 3JD2A 4HN9A 4A03A 3T1HB 2XV1A 1E0KA 2TECE 3QPWA 1BFKA 1U3DA 1FTSA 3WHIA 1NU6A 2FGJA 3PQCA 3ZKWA 3MJRA 1XPJA 3EMDA 4FZ3A 3KTAA 2GAAA 3A9WA 2XQFA 1PJCA 3FKSA 1EWYA 2FB9A 2ZXFA 4K86A 5H3LA 4ZMBA 1M0TA 5EGNA 4UUBA 2A9FA 2CN1A 4V0MA 3I6IA 2IYZA 3QV1A 1E94E 1G8FA 1SY7A 4NU0A 1GFSA 3HN7A 3DS8A 3L7CA 3W1EA 3WWDA 1FXWA 1K8ZB 3HKCB 2W2XA 3AMVA 1MEJA 4UUQA 5JMPA 4U2BA 2GBFA 5ICEA 2LUOA 5FBRB 3KQNA 2ZETA 3UCXA 2IXEA 5EZQA 5SY9A 2FR8A 1UR5A 2VZ9A 3B85A 2JCXA 1VPVA 2Y71A 5FBQB 1KS2A 3VX3A 1C9DB 4BWVA 3CURA 3CCCA 3VQTA 4TXHA 4ZCMA 3K71B 2PD3A 4DXHA 1ZRNA 1I4TD 5EYPB 4M36A 4EENA 1T1GA 4BO4A 4TN5A 1UEXC 3P9XA 2OESA 3O82A 4KJXA 2H92A 4NENB 5IVDA 4DJAA 4TS4A 2VPPA 2EZ4A 3DTVA 3EZYA 4LXYA 2DH5A 3RV3A 3SSAA 2OL4A 1G38A 2X8WA 4BE9A 4AYTA 1G8JA 1GL3A 3AR8A 1FUEA 2G76A 4G4SP 1L4LA 1QRSA 1WA5A 2N1MA 3IUNA 2H4YA 4TTSA 4U9HS 4LF6B 3OF2A 2BTQA 4QU9A 4DSAA 4L9AA 5T67A 5EJ7A 3IVRA 3W77A 3I9MA 1DBIA 3RBAA 1JHDA 3IP5A 2PUJA 1Q22A 2DX7A 3CU5A 4R05A 4OMCA 4DIKA 2CMKA 3CUUA 1QGOA 3KXIA 1XTBA 2P2ZA 3V9PA 2XQIA 2RGNA 1Z37A 3WWZA 3C3JA 5CW1A 1MQSA 1PQ4A 3IIMA 2R8YA 3VZCA 3WDKA 1RI1A 1BIFA 3LPLA 3I62A 5ILGA 2X0EA 3AFGA 1U9ZA 4J9UE 4UDNA 5BY2A 1ODCA 5FFNA 2F1OA 5EGSA 4KVGA 3TN7A 3WB9A 1I7PA 2ZE5A 4CKEA 3ERCA 4R0NA 1B8PA 5CX1B 2V4ZA 3IT3A 4LX0A 4QC2A 4WXPA 3UZUA 4E1BA 4EA7A 1QRTA 3WI7A 3AW8A 5KX5B 2B25A 4ZFNA 1KMMA 5A7FA 4QQNA 3TD2A 1JWLA 2OO5C 1MVOA 3E22B 3ONFA 4FN4A 5B1SA 4LDPA 4B6QA 1XMSA 1G3UA 1QTQA 3KLNA 2VP6A 2D3TA 5IW8A 2JANA 1EP1B 3JQ7B 4OYRA 1WZUA 3V7YA 5JH7F 5LCXA 3FZQA 5DP2A 4WCVA 4KPFC 1I0LA 5AKEA 1NBEA 3G9TA 4JB8A 2DT5A 2OT3B 4XX0B 2EBWA 4RADA 5EHNA 2QZ9A 1KYTA 4PRKA 2VYCA 2OLEA 2DBQA 3QE0A 1Q19A 3HDVA 5FHRA 2R84A 1KYIA 1QH0A 5K0EA 1YCHA 4UTRA 5LR6A 2GD6A 4I4NA 5IG2A 3QPUA 2YIMA 2GN6A 3J81k 2MJLA 1NLZA 5D5PA 3LF2A 4JA0A 2YHUA 4TRJA 1UOQA 1TJ3A 4XTRA 3V4SA 4UPEA 2MDTA 4DJTA 5D3QA 3RK0A 3N7TA 3FTPA 2HFJA 4GPAA 3C3YA 3QX7A 1A50B 1H23A 5CVJA 1RRVA 1I3CA 4JEHA 5IBPA 4BNYA 3O31A 4UKDA 2VHJA 3OJOA 1MIHA 5JAHA 3RS3A 2C5SA 1P4SA 1IN7A 1X0XA 1JNYA 2BJVA 2KPOA 2E4ZA 3ZU5A 4UHKA 1ZAKA 2P69A 1WULS 5BXYA 1EFRD 1KXJA 3T7SA 5K3AA 1CY0A 1XZMA 1RZ3A 2GWRA 2RK3A 4FXOA 1WP9A 2C78A 5I7AA 3UJ8A 3AXTA 5LZ5A 3AVTA 3CGGA 3LV8A 4PO9A 3OM1A 3WIUA 2CNDA 4E2FA 3L49A 2IBTA 5I4BA 3RNLA 2AFVA 3UHFA 4MDFA 3FTFA 2XOKD 2J6CA 4HMQA 4LXGA 3H9CA 3HB9A 4JLUA 3TW8B 2QXYA 2WYIA 1VLMA 3PQ3A 1B42A 3VZBA 1ACJA 1QX4A 4MUJA 5CDYA 2HJSA 5BN4A 1JDBC 4IMRA 2JLCA 4X8MA 4INOA 5CNJA 5AYVA 5K0GA 3NOVA 3D4PA 3DL7A 3VC7A 5F51A 3E9YA 2CLHB 1SCJA 3FNEA 1MVNA 2Q7XA 3WKEA 2R1TA 2PZMA 4YJGB 2I5PO 4DIFA 2FZGA 3RS5A 4I1SA 1UMCB 4WKGA 5IZCC 1CBUA 3KUDA 1G3MA 2R87A 1EG7A 2O0LA 2JGFA 3KFVA 4YMLA 2MU1A 1CNFA 2A1IA 2IHUA 2B3DA 2OHHA 4MYTA 3TQCA 5FI5A 1Z6QA 4GP7A 1OAOA 2V0NA 1ZW6A 3V8EA 4OHUA 4IJKA 5IU6A 2ZRKA 3LWNA 4WXRA 4LF7B 3BC1A 3OLWA 4K2HA 5HIMA 2P6PA 3S70A 1RCTE 3DTYA 3T7EA 3INTA 4EGFA 2OHJA 5IANA 4A0SA 1HDRA 1M6NA 2DBYA 3QW4B 3H6KA 2YH2A 4MV5A 1I3LA 4TXLA 4DYDA 1UJ5A 3KEMA 1SU6A 3L18A 2W83A 1U0HC 5T5QA 4FOTA 4NFHA 5C8YF 1C7IA 4KQCA 4N54A 1WPQA 2G17A 4B74A 5CM2Z 4E11A 5KSYA 3VPCA 1UXOA 3DVSX 3B12A 3WRWA 2RH8A 2Q3LA 3A4MA 4I8IA 3KJEA 1WQ4A 2E4XA 3DGFC 2UDPA 1HDZA 1NRXA 3VYTB 3EXFA 1AMOA 1E6LA 3CYFA 1LW6E 4GXQA 1YXMA 2CB9A 2FPXA 3QE2A 4CMIB 2PA3A 2R6DA 3PCRB 1JLSA 3E6AA 4F2HA 2Z30A 5JJCA 1CR2A 1WUYA 2PX8A 2VJYA 3FF4A 3IYLW 3OQNA 3U7JA 4DXDA 3LP6A 4BO8A 5EP3A 4QU5A 2RGYA 2P9JA 1H69A 1XTTA 1VLZA 4L5JA 4LMPA 1KTIA 4CM1A 5KOIA 2ZT7A 4TX1A 1G8YA 5CK4A 1H65A 3T3IA 1WETA 3IBGA 3ML1A 2CHEA 2NO0A 4FFRA 3UAXA 3E8XA 5TQVA 4R1OA 2FN9A 2Z1MA 1SN7A 4J4BA 3HZRA 3IR5A 1OWLA 3SWWA 1YWGO 2CV2A 1U5CA 4H6XA 1XTQA 3UAYA 2HWYA 2I65A 2GH1A 3HXMA 4H35A 3PHHA 5BSGA 3LCJA 5KMGA 3AUSA 4J0HA 3SJUA 2CXHA 4NXMB 1QCCA 4HWOA 2WPDA 3SHOA 3A1VA 3TR0A 1C2TA 3THWB 1QGAA 1GOTA 4OFZA 3KQTA 5A7HA 5AI6A 2ZAMA 3QYFA 2CUKA 2WNIA 5EJ5A 1IZ7A 3FPFA 4OVKA 3QLVC 1RQGA 1QNLA 2CEKA 1OIVA 4LYEA 4B7AA 1IY8A 4FQ7A 2DWCA 3DBVO 2HREA 4CKBA 4U3JB 4UXHA 1GTL1 1PL7A 1WXQA 4QHYA 4PLFA 1IFXA 3JAKB 2BIFA 1ZK0A 4WBSA 4EMSA 1Z2PX 1XQ9A 2PT9A 1L4FA 1PR1A 2X2EA 3QLVA 5ADVA 2DPHA 3CRMA 2GD1O 4PIMA 2R5FA 5BSTA 1AX9A 3QTTA 5EMMA 4A8JC 1IEQA 3MF4A 3PUYA 5DSZA 3GLTA 5BP7A 1HNXB 1XQ1A 2A9VA 2PLNA 5DBGA 1FDTA 1U90A 5DBIA 4C5CA 4WZBE 4AG5A 3VKHA 3FY4A 1ZINA 3GHYA 4UEKA 2GEUA 1XA4A 4J2HA 2EATA 1GLVA 3UH0A 2C00A 4A92A 4H1TA 2B8EA 4ALNA 3W2FA 2BFEB 5KOJA 5K6AC 1WV1A 2LIVA 2BGMA 4WY2A 4JI4B 1GHTA 3T3NA 3MJCA 1ZGZA 4HNQA 4G41A 5J40A 3DP9A 1VG1A 3OLCX 1MRSA 5HKAA 2V0GA 1E7WA 3FDJA 4WKNA 2NZVG 1RYHA 2QUAA 3FUVA 4D25A 2P6UA 3NUQA 4KDFA 4CWAA 3B6MA 1JEDA 3FUXA 2J30A 4RIHA 3UJCA 1IDN1 1QF6A 1OGJA 1SA0A 3H1PA 2Y66A 3ENKA 1UAYA 2C4MA 2YJ6A 1JZQA 4B3TB 3ZBPA 1JDPA 2BE9A 3Q3IA 1W34A 1J9GA 1SBZA 3V46A 4YCDA 1R10A 3D9QX 4CM5A 3N87A 3D8UA 4JAVC 1DCMA 3VR0A 1A8HA 2OEPA 4Z1MA 4RNCA 3O5AA 3WNDA 1Q74A 1V8PA 4JLNA 5H7XA 1F2DA 3LC2O 2I2FA 2WVJA 2YV4A 1RWXA 5EZ5A 2REOA 4AC9A 1AOXA 2PM8A 4H3SA 1MIOB 1OOEA 1XD8A 4M55A 3LC1O 4WKOA 5GVRA 3VNBA 1WKCA 5CLLA 5CM8B 4YQFA 2IHNA 4QYIB 3PE6A 1XRMA 3KOYA 1US8A 1MJNA 3I3OA 2P11A 3QTLA 2E89A 4BGVA 3UK0A 4L27A 5AHRA 3D0KA 3DZHA 5AKKA 1UAAA 1F0PA 4JR2A 2NXCA 1GPYA 3THXB 3QXXA 3BAFA 3HL0A 4KIFA 3MM4A 2QBYA 1EZZA 2Q5OA 4M37A 4Q1CA 2RGRA 4IIJF 1D5WA 4MHSA 1ZNYA 4CQJA 4OIMA 1KVSA 2Z5FA 4Y2HA 1TVCA 1XC7A 4P6VF 1GCGA 1QVZA 4H6PA 4IGKA 4RV5A 3U56A 3JAWA 1F3OA 1V7ZA 3CO5A 3EZFA 1GQRA 2JW5A 2PVCA 5FOUA 2V65A 2WWXA 1M66A 2IYNA 2F48A 5M7EA 5FTKA 1Y4AE 2FZLA 5F7OA 3ICWA 2B37A 1BHO1 1RYNA 1SZCA 2QD1A 2YOHA 4OY3A 1GZDA 3CKMA 4WOKA 4ZIRA 1XHLA 1A27A 2E5FA 2Q28A 3IDOA 2HR1A 2RHGB 1DUIA 3O38A 2P75A 1Y9EA 1TKAA 3I9FA 3TK1A 2C1XA 2PMCA 4DDUA 4D0NA 4HF7A 1JN0A 3VAAA 5J3JA 4ESVA 4OTZA 1S8OA 5JYCA 3KJIA 1IM2A 1T2NA 4MEJA 4ZXFA 4AO7A 3QE9Y 1A1VA 2EOAA 1JIVA 1NXSA 4N4AA 4R9SA 1XMJA 3UA3A 2GXSA 1G2OA 2GTIA 4J0DA 5KYUB 3EGOA 3F46A 5HTKA 1CDOA 2D7CA 2DH6A 3UHAA 4RY9A 4OBBA 5ALMA 4MVWA 1OBFO 2BMDA 1GQ2A 2FZ5A 1DG9A 1UDRA 1XTRA 2OBLA 1AHHA 3CLUD 3EGDB 5TEWA 4F6RB 3EASA 3ISJA 4LJ9A 1Z4QA 1D2RA 4L28A 5DKFA 2C59A 3GVIA 5KYUA 4LC1A 4TTJA 3C5VA 3WV5A 5EC8A 5FF9A 1PRYA 2LCQA 4BMCA 1Z0JA 4FFDA 1GNSA 1NBME 4EJSC 5JZOA 4UBNA 1QIGA 2IE0A 2H06A 4KH0A 2Q4BA 3CNLA 5EVCA 5KVVA 2J8ZA 5J2TA 2OA0A 3NHLA 3FROA 4LCEA 3ZHZA 4BFXA 3FTEA 3BA6A 1JU4A 1QOQB 4HDOB 3EH2A 4WCDA 3MMXA 2F43A 1GQQA 3JZFA 3EBOA 3K09A 4UHFA 4JUDX 1V35A 2ZJOA 2P2LA 4MZDA 4QYSA 2GFIA 4EHBA 4XJXA 3U0VA 2JB9A 5ITZA 1YVEI 5JIBA 3IKLA 2PX4A 3J81A 4R16A 3H6GA 4IHKA 2OP0A 3WNZA 4Q1DA 2FYTA 3KTFA 1TNDA 4X0EA 1ZITA 2ZSKA 4HYYA 2GN1A 2IYXA 1H2FA 5CT4A 3S1LA 5L6MB 1WXDA 2JHFA 1EJ6A 2I29A 3X1MA 1GSIA 1YFKA 2ECFA 3L0PA 1DADA 2HSDA 3DSRA 3MD9A 4INJA 3WG9A 2I2WA 3QVOA 3DYVA 4F93B 5B12A 1NW9B 2C83A 4ABTA 3LQ4A 1JRLA 4N6GA 5HWSA 4XWYA 1DBSA 3DHWC 2NV2B 5F1YA 1XMPA 3GR6A 4CETA 4EW1A 1W46A 1ZNXA 2ATIA 1BEUB 2UUOA 3IQIX 3K6JA 3MUOA 4QUDA 4BGDA 1RXWA 2AZXA 1IK4A 4R1TA 3A4IA 1PZNA 3H9JA 2IUFA 4YFYA 3AEUB 1XFDA 2F9FA 4KTTE 1C8KA 4M1TA 1FFDA 2FN3A 2KBFA 4ADSG 4IVRA 2L42A 2YWDA 2PRYA 1Z0ZA 1REQA 2DAPA 2Q1TA 3GVHA 5T8KA 2D62A 3M7IA 2IVZA 3ZR4B 4QTTB 5JQGB 3PQ8A 1OKKA 4EUEA 4OK6A 2C1ZA 4RKRA 3WMWA 4EJSB 2DHDA 1FJ2A 4FE3A 3LX6A 5IAJA 1QQTA 1FU4A 3BSSA 1HM5A 2EARA 1Q0QA 1JR3E 3HCDA 4HUQA 5E95A 3TOSA 3CJRA 5IVKA 2JJ1D 1M6EX 1K68A 1JQBA 1P2SA 2GCNA 2H48A 2HPAA 2ZAOA 3O9ZA 4BEJA 1D1QA 2Y0PA 1XDSA 2QMQA 5CVUA 2XQJA 3NYRA 2HC9A 2FCRA 1VRCA 2XXJA 1WMDA 1YT5A 4WNIA 3VU9B 2V6GA 3I0MA 2W4MA 1G63A 2YOGA 2FZCA 4EVSA 1FE8A 4PLTA 4C4OA 3OX2A 3MAAC 3TNYA 3Q9LA 3FSEA 5HW0A 2D2IA 1RS0A 4XQCA 1CDEA 3SR4A 1U0SY 3DEJA 3ZIAA 4NFSA 1Z35A 2ERCA 1RXUA 4G8BA 2KSQA 2ZGVA 5A6SA 1GSAA 1ZUIA 3P9RA 2R79A 5DZSA 1P19A 3QKUA 1XCOA 4EJMA 2E37A 2HA6A 1ZLYA 3QWIA 2R7LA 2JAOA 4J4HA 1YL7A 4AJ4A 5T57A 3GJTA 2WSYB 5J63A 5H3CA 1C50A 1SOVA 4DA8A 3P9PA 3GDOA 1JU3A 4US0R 4F9FA 3VR6D 3IUPA 4HAWA 1GA6A 4M21A 1GUBA 3A9VA 2FFBA 4AB1A 4PBSA 3COPA 2PCLA 3U17A 5D87A 2BWJA 1EGMB 4LFAB 1IJBA 2GVDC 1DLJA 2GN2A 3HCPA 1WHSB 3B89A 4M0DA 5F5NA 2ZJYA 1HDXA 2WIJA 3R5SA 4EKNB 4O1MA 5LL6P 3C7KA 1RI3A 3G6KA 3RC9A 4CRWB 2Q6LA 1T43A 3QVGA 2QTLA 3O2JA 1QX3A 2C3UA 3BHIA 4TYQA 1USKA 2G4LA 2I78A 2IZ6A 3GLHB 1GPAA 1K27A 3LX8A 4HAVA 4RDHA 1APBA 2AZDA 2R6CA 1YBFA 4EI9A 2GBLA 5CIWA 2IF0A 3MTDA 3DO8A 4XE5A 4YAJA 1NVDA 4RTKA 2J85A 2GOYA 2J0EA 3AR7A 3DDUA 3QU4A 5JYDA 1B8VA 5IK2A 5E4JA 4MJLA 5EMKA 2PR2A 3ORYA 4JLVA 2X5KO 4AECA 4BU0A 5IWAB 4C4RA 1FS5A 3AR5A 5FPPA 4V38A 3NFRA 5K2OA 5KNCD 3E84A 2DOKA 4MW0A 5KQSA 5IN4A 4UJ5A 3EEIA 1T9BA 2VJNA 1VA5A 3HO8A 5IF9A 5WRFA 2J7PD 3WQRA 1NG9A 2VUHB 1G6Q1 1WVIA 2WU1A 1BDJA 1Y5LA 3RS9A 2PMDA 2GZRA 4C89A 2ERYA 2ZUEA 2QTWB 3KLMX 4M9SA 4MV4A 3B52X 3ZW9A 1QNFA 1HYBA 4N5MA 4DCPA 4RQAA 2J0UA 4DCCA 5MN4A 1P1BA 3LGAA 3E9MA 4I3GA 1RI2A 1W94A 4Y2PA 4AIIA 5FADA 2B34A 3PF8A 1TTTA 3GPCA 1V7CA 2IFTA 3V8QA 3IXQA 2P5UA 4PGGA 4RLQA 4DYHA 3FDXA 1ABFA 4XVCA 2HA0A 5TPWB 3K70D 4JELA 1G3RA 1SVOA 3FHCB 4JYBA 1LKZA 2R7AA 3D3WA 1FDOA 4P32A 1SUIA 3STTA 4PWZA 3UEOA 2XWSA 4KXWA 1UKBA 3L01A 4G89A 4NONA 3G85A 4Y6PA 4LTNA 4KC0A 4HAUA 4CUZA 5HJ5A 1YA8A 1H4QA 1MHTA 3W78A 4E07A 1TJPB 2IEDA 4DY4A 2WBLC 2PKRA 1K2WA 2VHQA 4RY0A 5KS2A 8LDHA 3JZMA 1BWPA 2JKYA 2QRZA 4OPMA 3AF3A 3VXKA 3KAPA 2JGJA 4Q9NA 1QP8A 2OZPA 2PGAA 1ZNWA 1QHIA 3SDZA 4EY5A 3AP2A 1NV9A 1X1DA 1QF9A 4GOOD 4X3OA 5COAA 5B58C 1P0FA 5D3MA 1D0IA 2C8KA 2IP2A 4ZAYA 3U3DA 4RL6A 3PC2A 1Y0BA 4UFNA 5IAOA 1PSDA 1QLJA 2YW9A 5H1YA 2FHPA 1K5PA 1KI1A 1E92A 2B20A 2UUBB 4DDMA 3LPNA 5JFTA 1OFGA 1VBNA 1ZN9A 1E1MA 3E35A 2AK2A 4TRNA 1F06A 3B2NA 2AFHA 3NDPA 4LZZA 5KYGA 5D01A 4LWPA 2YUIA 1V43A 3T9FA 5HOEA 1TEHA 4PVDA 3N2GB 1P0MA 4PGAA 1RRKA 2P3LA 3EG9A 3N28A 2H31A 4PO1A 2Q4TA 4BN4A 4E09A 4FN5A 4FDTA 4JJ7A 1OWNA 3JSAA 2OBBA 1TEZA 1IH8A 4GEKA 5CRIA 3EHEA 5BWBA 1BA3A 2XOEA 3R7WA 4N40A 1BHJA 2ZYAA 5EEHA 3L77A 4UATA 4ZVMA 3DEZA 5AK5A 2PXHA 2PZKA 1A9ZA 1Z8FA 5J47A 3RRJA 3OZRA 3RDPA 4YI3A 1YJ5A 2ZIVB 3DTVD 4WNAA 2B3TA 5DN9A 1U8TA 2YYYA 2JASA 3QM1A 3ZCUA 1XLTC 2PS0A 5J4HA 5G4LA 5F2OA 1XX6A 2CY0A 2HK6A 4JOCA 1I32A 4M38A 3Q2IA 4NDNE 4R1QA 2PSEA 1M6HA 4DDHA 3SOPA 4I2NA 4XLZA 3A14A 1LBHA 5KVCA 3H5LA 3UWMA 1HQKA 2O48X 2QE7A 2PDAA 4LJKA 5CB4B 4KMRA 3BSFA 4CBVA 5CCXA 3W05A 1P5HA 1JI0A 1OI7A 1HT2E 3REOA 4EB3A 5EIBD 5LWHA 5DW0A 1EHYA 3IAFA 4A5OA 4NNJA 1V95A 3K05A 1XPOA 1GPDG 3HWWA 3GRFA 4WPGA 5EZYA 4Z3OA 1Y3FE 3ETEA 1EDDA 1OZFA 2EEPA 4LYJA 2VPXA 1TLTA 4WZZA 4TYMA 3LC0A 1YJ8A 1JU9A 2D5AA 1IUNA 3NHPA 2JFBA 1VB3A 2V8OA 4C6RA 2F1HA 4EG5A 2X42A 2CYAA 3R7FA 3RU9A 2B7BA 3L5KA 4L85A 2ZJFA 4S3MA 1URPA 4XUCA 5BSFA 3T99A 2PANA 1MOSA 4IOLA 4D57A 2AFIA 2F00A 3NBUA 2G8NA 1G8KA 1HYGA 3LOQA 4R1MA 3VU0A 5CFZA 3K1ZA 2DU8A 3R9KA 3NYIA 3DLPX 4K8RB 2FG7C 3ILHA 1XZIA 2KS6A 3ACBA 5DNCA 3A04A 2VSQA 5JYBA 4GRIA 1ONBA 3JQ7A 4OLHA 3IB3A 1YZVA 3TBKA 1Z25A 3G5UA 2X23A 2NTNA 4R4JA 3G1TA 2X5OA 1VJ0A 1PL8A 3NOOA 4NSNA 3G5TA 3UJHA 3DT6A 4F6LA 1AUQA 1HV8A 3I9OA 2GF9A 4XVQA 4UU7A 1NX6A 5GM2A 1GGJA 2P8SA 1SBQA 2UXCB 4LOJA 5F7ZA 5B37A 3HCBA 3M4YA 4N41A 1TIBA 2P27A 3FN4A 4G9EA 3GH3A 3D6JA 4WJZA 4CUKA 1OAOC 3V1YA 3DONA 1TF5A 3U9LA 2LVBA 2XUDA 1TMOA 1W88B 2B8JA 3O4VA 4YX9A 2WHYA 2CVHA 3HN2A 3K4QA 3N76A 1OYVA 5CA1B 4O4LF 2RFLA 5HIIA 4OAPA 3QH4A 1B8NA 4LHZA 4M9XA 3PXAA 5LWQA 1JFFA 1NWCA 1RABA 3JYHA 4YMUA 2QOEA 1C3OB 1JKJB 3SYNA 5CJ2A 1W88A 4MUGA 5AK4A 1WTAA 2FI1A 1DTEA 2ZWMA 1HMPA 1FFGA 3LXMA 1FK8A 4P08A 5EMLA 3JWHA 3IR7A 4QUHA 2AD1A 1W59A 5CAEA 3S1SA 2C9DA 1WDKA 1SQFA 1SRQA 3K9HA 4ZOQI 2QTNA 3F3YA 1ZGGA 1QIJA 1X14A 5E6RA 2VHWA 1TKBA 4KXMA 2XT9A 3SQMA 4BWFB 4DV7B 1CE8A 3RW9A 4DC1A 5CLHA 4HYQA 5BSWA 4MYRA 3P32A 3U3OA 4BQQA 2AXPA 1SHZA 1SC1A 1ULHA 1Z07A 3MUNA 3W6NA 1IONA 5HPYB 1BMTA 1JI3A 3PDIA 2J3JA 1R9MA 1Q11A 1U02A 1V5WA 1Z0UA 4LMAA 2C2MA 4PC6A 3UWDA 2F64A 3L82B 3SXJA 1BZYA 3DOCA 2ONJA 3F6SA 1LDBA 2FN7A 1PZEA 4QPCA 2FU5C 1G1AA 2FVXA 3Q3GE 4M0CA 3TO5A 2PQMA 5ICMA 5EUQB 3GLIB 2PWYA 2P2DA 1BA2A 1DJLA 5BW6B 4B82A 1K98A 3NKLA 3EDMA 2VSXA 1Y5NA 4FX2A 3T52A 4AZ3A 4BS9A 5LLTA 2CSXA 2NAPA 1SVIA 5DHPA 4BUCA 1WDWB 5DCUA 1Z5NA 2J3DA 5KJ1A 4XSHA 3W79A 1AV6A 2EBUA 5C8YB 3B9RA 3ZHBA 3NTOA 3D02A 1ZNZA 4ZHQA 5FTMA 1ISJA 4JBGA 1DZ3A 5G1NA 1NLUA 1T6BY 3QVMA 3P2JA 4KQFA 1TUBB 4D96A 3ONWA 1H9BA 2GDJA 1EFPB 3V8MA 3L04A 1SPBS 5KYXA 4LF4B 1L5MA 2QY6A 1ZOSA 4R1NA 1D09A 1ZO8A 3V4ZA 2QGNA 3GLHE 4NC9A 1L7QA 4BLWA 3BE4A 2HF8A 3ADKA 3IXLA 2OR3A 3NYQA 4J6FA 4JC4A 3QHQA 3VOBA 5AW7A 1JQ3A 1BS1A 4PYOA 1LA2A 1PT8A 2WD9A 2IZOA 2WJYA 3K0CC 4TYYA 3HCEA 3MT8A 3W04A 5E0KB 3DMTC 4JSTA 1M2VB 1VJDA 3DBHA 3EZ7A 3ZKAA 3T0GA 4HUQB 4JN6B 2ZLBA 4PR3A 4UE3S 1OH8A 1KPHA 1P73A 3M4JA 3ZHXA 2FX5A 4OLJA 1QH1B 1ESCA 4WX2B 4YUWA 5C5EA 4MEAA 3CVOA 1ULUA 5FOSA 2OGZA 2GCOB 3N6RA 4RVHA 3TINA 5FUYA 1XO1A 5FPYA 4CHGA 2BGNA 3O21A 3RROA 5HKBA 1B15A 1IY2A 1JLKA 2VXYA 3CZPA 4RVGA 1DELA 4S1PA 3D0QA 4TT3D 3VRHA 3SEQA 3F90A 1VIDA 1P2BA 3P9NA 4LXHA 4R1UA 2AYYA 4OL0A 1T3ZA 2MSLA 2AE2A 3D6TB 1C41A 5FI0B 3TRIA 2BGWA 4KQ6A 4PRYA 1BO6A 5KNCA 5CIQA 4GZMA 4PICA 2RI6A 5JS1A 1EFDN 1EP2B 1AS0A 4WXYB 5GGXA 1E63A 4C4SA 2JG3A 2DQZA 4FZ5A 3L6DA 1O57A 4HLUC 1BD4A 2RBEA 3U4DA 3TBFA 1KYXA 3ZV4A 1F20A 1OROA 2B2XA 4IVPA 1PN3A 2LCIA 2R00C 2XT6A 4NLLA 5B7PA 4XWOA 5AO9A 4EZEA 2R1ZA 2VWGA 3GRZA 5IJ0A 4Y0VA 4CL8A 3IEPA 5DNUA 2QXTA 3DKIA 4QYIA 5DM70 1QIEA 2ZXUA 5ALLA 2B30A 4B2PA 4BKUA 3T1QA 2JFOA 3H8VA 1PEKE 5JXIA 1QZ3A 1PJLA 3TLMA 3D7LA 2HM7A 3OWXA 5DEOA 4ZV4A 2C04A 4HX5A 3QKRA 2I6UA 3U4HA 1JSCA 1KFKB 1DARA 5AK6A 3CMCO 3G8BA 3GLHA 2WTEA 4CR7A 1SOMA 1VJTA 4NRDA 1TJYA 3OOYA 4OF4A 3UO8B 2ZB2A 4B7CA 5GV8A 4DIBA 4YRSA 3DE3X 1EK5A 3O8CA 4QECA 4QXQA 3VR2D 3ZWXA 3PNLA 2AJ8A 3LBNA 3AGQA 4KQ1A 4YCJA 2GXAA 1H93A 3D8TA 3ZWVA 2B4AA 2ZDGA 2N42A 4F06A 1O97C 1YASA 4YK7A 4X3PA 5AD1A 1R8QA 3UOGA 4BRUA 3OP1A 3RK4A 4IDQA 5FT9A 5LN1A 3WQSB 2KBEA 2VCEA 1ZMXA 3ADOA 3TX2A 2LWIA 2XKBA 2BKEA 1WXHA 2G8LA 1NQTA 2JK0A 4MUNA 5IKPA 1T1SA 4RJKA 2Z08A 1FP4B 1HFJA 3FMFA 3G8CA 4HJRA 1AB5A 2C9YA 2H63A 4RC9A 4HXFB 1NNEA 4V0SA 2UV8A 3NM6B 1QFMA 2C96A 1T4GA 1LWNA 1WMFA 4R68A 5L4NA 1E60A 2EZ9A 2QR3A 2VQFB 1ZVQA 1JPJA 4URHA 4X41A 4BNXA 2CSUA 4EFKA 2UZ1B 5JCOA 2O0HA 4DLWA 2J41A 2QLLA 2CYCA 5FH9A 4NCXA 4G0WA 1O8BA 3T4EA 1D6SA 1PKEA 4Q34A 1PU2A 1UANA 2PLFA 1WB9A 4O2BF 3IP3A 3LMKA 4BTVA 2B99A 2V7GA 5C7YA 3VSBA 4EHHA 5A9TA 5L95A 4A0HA 4ALJA 2VCYA 1ODLA 3AF2A 4U2DA 4UAVA 1ORDA 1WB6A 1KGDA 2YZMA 4E1VA 2I7TA 1T26A 2VAMA 3GW8A 3KL4A 3RWOA 1W36B 4CGYA 2XYQA 4W1SA 3GUYA 5K6RA 1YZUA 5MN6A 3M5WA 4B4OA 2C7GA 1KEWA 3CZMA 1H9AA 3H3XA 3R0VA 5C0OE 4NOKA 5BSVA 2ZUTA 3BJMA 5HBGA 3RF6A 1KKLA 3ABSB 4P38A 3REQB 1BE0A 4IMPA 5I9NA 4QPPA 1RSZA 3HJRA 3KUUA 1WZ2A 1AGNA 2CVFA 3L9WA 2ZYWX 2BDUA 1M2HA 2PJUA 4NG5A 3B9PA 3PENA 5FA6A 4YT8A 1SFRA 3HP7A 4B80A 1GAWA 1VMEA 2AV6A 3DL4A 4MKFA 5A3SA 3GEIA 3Q40A 2HO4A 4YRCA 1P31A 3MBOA 4LJLA 3QMMA 4C0AC 3IPYA 3MWLA 4RETA 5CGQB 2WWRA 3WMRA 2WYHA 3DE1X 3L4EA 4MWDA 1B3RA 3W8RA 2Y1KA 3RFTA 5D85A 4B2IA 4MW7A 1A4RA 2OCGA 3IAM6 4XB1A 4WL0A 2ZUVA 1VL5A 3ENNA 3HUEA 3R7NA 5AVRA 3JQEA 1VYHA 1IEVA 1XL0A 2AA3A 4RTJA 1S7CA 4JBNA 2XQGA 1ZU5A 2ZYHA 2AH5A 4QXOA 3F6PA 2DTDA 1G16A 1ST2A 1K7XB 3DXZA 4CDGA 4W5TA 1RM0A 3TSAA 4H2DA 3OJLA 2PGOA 5LP1A 1SH7A 1W85B 1UDAA 4YDQA 4TTVA 1B16A 1CS0A 4QYTA 1EINA 1U99A 2B69A 2PVPA 4HDKB 1QYVA 4QUAA 3DZIA 3H2ZA 3TTTA 1PWEA 5KOJB 1WXEA 3IEXA 5IUNC 2V59A 3CNHA 3DEIA 4HP8A 4DQXA 2C5FA 3UG7A 3ZDEA 3SBXA 5CLJA 2WWHA 2AFIE 1R66A 3I6YA 3B82A 3LY5A 5AVTA 2FSUA 2J31A 1QPZA 4AURA 5JDIC 2Z4SA 4DEXA 4NL4H 5EUCA 5BVHB 4YH1A 4CMBA 5FD8A 3QGMA 3ORRA 1D8AA 1S3FA 1XTJA 4L8WB 4ZAGA 3LHKA 3UV3A