5DNNC

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnC00
3UTBC 5B24A 5B31B 3R45A 2BYMB 2FJ7A 4XZQC 3C1CC 3W99D 4KUDA 1P3OA 3WTPC 1P3LA 3REHB 2BYKB 3AV1D 2F8NA 3AFAD 3AZLD 2HUEC 3MGSC 4J8WB 4Z5TB 1P3PB 1KX3D 5F99B 3MVDD 3KSYA 1TZYD 1HTAA 5AV5B 1P3IB 3AZND 3WTPA 4QLCB 5GXQA 1R4VA 3V9RB 3UT9C 5BO0B 3AZFC 4LD9B 1P34A 1P3FA 4ZUXD 5E5AD 1Q9CA 3AZHD 4YM6B 4R8PC 1M1AD 3AZKB 3MNNA 1H3OA 5B32C 3AZGC 1U35C 5AV8C 3WAAC 5B2IB 4Z66C 3AZMC 4R8PA 5CPJC 3VH6W 2CV5C 3X1TC 5AVCD 2HIOD 5B32A 4DRBA 5CPKD 1HQ3A 5B31C 3REID 3AYWC 4KGCA 5AVBA 3AZMA 5CHLB 5B40D 3REJD 3MGPB 1P3AD 3B6FA 4CAYA 1P3MA 5B1LD 4KHAB 5B31A 1EQZA 4Z5TC 1P3PC 5F99C 3AYWA 3B0DB 3X1VA 1AOIB 3W98D 1P3IC 1P3BA 4YS3A 4H9NB 3W96C 1BH8B 4QLCC 3LELA 5B33B 4J8UB 4AWLB 4LD9C 3B0CT 4M6BA 1N1JB 3LZ1D 5BT1D 3RELB 3O62B 4YM6C 3AZKC 3W96A 4QLCA 5B0ZD 5B24D 4X23A 2CWEA 2FJ7D 4J8VB 2AROA 1B6WA 3WA9B 5B2IC 3WTPE 1KX3A 4KUDD 5B2JB 1TZYA 1P3OD 1P3LD 4HGAC 3LZ0A 1M19B 4WU8B 2F8ND 5GT3B 1P3KA 5AY8C 3AZEA 1KX5B 4JJNB 4ZUXA 5AV6A 2YFVA 3WTPD 1M18C 5GXQD 5DNMB 3UTAA 1M1AA 3MGPC 1P34D 1P3FD 5AY8A 5GT0B 5B1MA 4EO5B 5CPIB 4H9SC 3TU4B 1M18A 3B0DC 1AOIC 4Z2MG 4J8XB 5AVCA 2HIOA 4J8UC 3X1SB 5B33C 3AZJA 4H9OB 4AWLC 3NQJB 4XUJB 1WWSA 5CP6B 4R8PD 1KX4C 5FUGB 5BNVB 3O62C 5B0YB 3AZIC 1S32B 5B32D 5C3IB 3VH6T 1HQ3D 3AZGD 5DNNB 4J8VC 4KGCD 5AVBD 1N1JA 3AZMD 1KX4A 1F66C 1ID3B 2PYOA 3AZIA 5BNXA 3LJAC 3W98A 1P3MD 3X1UB 3B0CW 1M19C 4WU8C 5B31D 1ULYA 5GT3C 1EQZD 3AYWD 3KWQB 3X1VD 1F66A 1P3BD 3WKJA 3LJAA 3LELD 5DNMC 3W97B 5B31G 3MGQB 2NQBC 5AV9A 4NE3A 4Z5TD 5GT0C 5F99D 4Z2MH 5CPIC 1ZLAC 3W96D 4QLCD 4X23D 4CSRB 5BS7A 5DNMA 4J8XC 3UTBA 2NQBA 2AROD 3X1SC 2IO5B 4XZQA 3C1CA 4H9QB 1BH9A 2RVQC 3A6NC 1ZLAA 3AZKD 1P3GC 3LZ0D 4WNNB 5B0YC 5GSUB 1S32C 1P3KD 3AZED 3X1SA 3MGSA 5DNNC 5AV6D 3A6NA 3UTAD 2YFWA 5JRGC 1P3GA 1ID3C 3AN2B 3UT9A 3X1UC 3AZFA 5AY8D 4WV4B 3KUYB 4UUZA 5B1MD 3C1BC 3KXBB 3KWQC 1M18D 5JA4A 5JRGA 1ID3A 3W99B 2NZDC 3AV2C 3AZJD 3W97C 3AZGA 1U35A 3C1BA 5AV8A 3AFAB 3AZLB 3WAAA 4Z66A 5CPJA 2NZDA 2CV5A 3X1TA 4DRAA 3AZNB 5B33D 3AV2A 3REHC 4J8WC 2BYMA 1KX4D 2PYOD 4WU9B 2IO5C 5E5AB 3AZID 3O62D 3AZHB 5AV5C 3REHA 2BYKA 4H9RB 4G92B 4J8WA 4Z5TA 1P3PA 1F66D 5F99A 3WKJD 3LJAD 1P3IA 5AV5A 5KDMB 1JFIB 3AN2C 5AV9D 3V9RA 5BO0A 4LD9A 5CPKB 3KUYC 3REIB 1TAFB 3KXBC 4YM6A 5DNMD 3W99C 5B40B 3REJB 3AZKA 3UTBD 2NQBD 1P3AB 3B6GB 5GT0D 4H9PB 5B1LB 4XZQD 3KUYA 3C1CD 3AZLC 5B2IA 1ZLAD 3KXBA 4J8XD 3AZNC 3X1SD 3MGSD 1A7WA 3MGRB 4ZBJB 2RVQD 4G91B 3LZ1B 3A6ND 4WU9C 4E44A 5E5AC 1P3GD 1S32D 3UT9D 3AZHC 3AZFD 3MGPA 3NQUB 5B0ZB 5B24B 4KHAA 5DNND 4G92C 3R45B 2FJ7B 3RELC 5JRGD 4H9SA 4WU9A 1ID3D 4KUDB 1P3OB 1AOIA 1P3LB 3X1UD 4H9NA 1BH8A 4J8UA 1U35D 5B33A 3C1BD 5AV8D 2F8NB 3WAAD 4Z66D 3WA9C 3RELA 5CPJD 1B67A 4NE5A 2NZDD 2CV5D 5B2JC 3X1TD 3O62A 3AV2D 3WTPB 3W97D 5GXQB 5B40C 3REJC 1P3AC 3B6GC 1P34B 1P3FB 4J8VA 5B1LC 1KX5C 4JJNC 3WA9A 5B2JA 3MNNB 1H3OB 3REHD 3REKB 1M19A 4WU8A 5GT3A 4J8WD 3MGRC 1P3PD 4ZBJC 1KX5A 4JJNA 2F8NK 4EO5C 4G91C 1P3ID 5AV5D 3TU4C 5B32B 4LD9D 1HQ3B 3VH5A 3MGRA 5GT0A 4XUJC 4YM6D 5CP6C 5AVBB 3AZMB 4KGCB 5CPIA 4E45A 3TU4A 1P3OC 3B6FB 4CAYB 5C3IC 4J8XA 1P3MB 3KUYD 4H9OA 1EQZB 5B2ID 3NQJA 4XUJA 3KXBD 3AYWB 5CP6A 5FUGA 3X1VB 5BNVA 1P3BB 5B0YA 4YS3B 1S32A 3LELB 5GXQC 1P34C 1P3FC 5DNNA 3MGPD 3W96B 3MNNC 3X1UA 3REKC 4X23B 5G49B 3MGQC 3AV1B 2AROB 3B0BA 4WU9D 3KWQA 3MVDB 1KX3B 1TZYB 1AOID 4J8UD 4WZSB 3LZ0B 3W97A 3REKA 3MGQA 1P3KB 1HQ3C 3AZEB 3RELD 4ZUXB 3VH6A 5AV6B 4KGCC 2YFVB 5AVBC 3UTAB 1M1AB 4HGAB 5GSUC 4CSRA 3B6FC 1P3MC 4J8VD 5AY8B 3WA9D 5B1MB 1EQZC 5B2JD 4H9QA 1M18B 3X1VC 4WNNA 1P3BC 4WU8D 1M19D 5GSUA 4YS3C 5AVCB 5GT3D 2HIOB 3B6GD 3LELC 3AZJB 1KX5D 4JJND 2L5AA 3AN2A 4X23C 3MGRD 3AV1C 2AROC 3AFAC 5CPID 1KX4B 3TU4D 3MVDC 1KX3C 2PYOB 3AZIB 1TZYC 5BNXB 3VH5T 3W98B 3W99A 1F1EA 3LZ0C 5G49A 4XUJD 1P3KC 3AV1A 3AFAA 3AZEC 5CP6D 3AZLA 1BFMA 4ZUXC 1F66B 3MVDA 5AV6C 5B0YD 3WKJB 3LJAB 3UTAC 1M1AC 3AZNA 5AV9B 5B1MC 5E5AA 3AZHA 2F8NG 5AVCC 3UTBB 2HIOC 2NQBB 3AZJC 5CPKC 4H9RA 3KWQD 2LY8A 4XZQB 3C1CB 3REIC 1BH9B 1ZLAB 2JSSA 3MNND 3REKD 5KDMA 1JFIA 4NFTA 3MGQD 5CPKA 2HUEB 3MGSB 3REIA 1KU5A 1TAFA 3A6NB 2PYOC 2YFWB 1P3GB 3W98C 5B40A 3REJA 3UT9B 3AZFB 1P3AA 3B6GA 4UUZB 4H9PA 5B1LA 4NE6A 3LZ1C 4R8PB 5BT1C 5JA4B 3WKJC 5JRGB 5B32G 5GSUD 3B6FD 1WWIA 3AZGB 5B0ZC 5B24C 1U35B 5AV9C 3C1BB 5AV8B 3WAAB 4Z66B 2FJ7C 3VH5W 3LZ1A 2F8NH 5CPJB 2NZDB 4KUDC 2CV5B 3X1TB 4YS3D 3AN2D 1P3LC 3AV2B 5BS7C 3NQUA 5B0ZA
chains in the Genus database with same CATH superfamily
3UTBC 5B24A 5B31B 3R45A 2BYMB 2FJ7A 4XZQC 3C1CC 3W99D 4KUDA 1P3OA 3WTPC 1P3LA 3REHB 2BYKB 3AV1D 2F8NA 3AFAD 3AZLD 2HUEC 3MGSC 4J8WB 4Z5TB 1P3PB 1KX3D 5F99B 3MVDD 3KSYA 1TZYD 1HTAA 5AV5B 1P3IB 3H0RC 3AZND 3WTPA 3AL0C 4QLCB 5GXQA 1R4VA 3V9RB 3UT9C 5BO0B 3AZFC 4LD9B 1P34A 1P3FA 3EG5B 4ZUXD 2DQNC 5E5AD 1Q9CA 3AZHD 4YM6B 4R8PC 1M1AD 3AZKB 3MNNA 1H3OA 5B32C 3AZGC 1U35C 5AV8C 3WAAC 5B2IB 4Z66C 3AZMC 4R8PA 5CPJC 3VH6W 2CV5C 3X1TC 5AVCD 2HIOD 5B32A 4DRBA 5CPKD 1HQ3A 5B31C 3REID 3AYWC 4KGCA 5AVBA 3AZMA 5CHLB 5B40D 3REJD 3MGPB 1P3AD 3B6FA 1Z2CB 4CAYA 1P3MA 5B1LD 2Y2MA 4KHAB 5B31A 1EQZA 4Z5TC 1P3PC 5F99C 3AYWA 3B0DB 3X1VA 1AOIB 3W98D 1P3IC 1P3BA 4YS3A 4H9NB 3W96C 1BH8B 4QLCC 3LELA 5B33B 4J8UB 4AWLB 4LD9C 2Y2GA 3B0CT 4M6BA 1N1JB 3LZ1D 5BT1D 3RELB 3O62B 4YM6C 3AZKC 3W96A 4QLCA 5B0ZD 5B24D 4X23A 4WJ3C 2CWEA 2FJ7D 4J8VB 2AROA 1B6WA 3WA9B 5B2IC 3WTPE 1KX3A 4KUDD 5B2JB 1TZYA 1P3OD 1P3LD 4HGAC 3LZ0A 1M19B 4WU8B 2F8ND 5GT3B 1P3KA 5AY8C 3AZEA 1KX5B 4JJNB 4ZUXA 5AV6A 2YFVA 3WTPD 1M18C 5GXQD 5DNMB 3UTAA 1M1AA 3MGPC 1P34D 1P3FD 5AY8A 2Y2KA 5GT0B 5B1MA 4EO5B 5CPIB 4H9SC 3TU4B 1M18A 3B0DC 1AOIC 4Z2MG 4J8XB 3EPKA 5AVCA 2HIOA 4J8UC 3X1SB 5B33C 3AZJA 4H9OB 3F6TA 4AWLC 3NQJB 4XUJB 1WWSA 5CP6B 4R8PD 1KX4C 5FUGB 5BNVB 3O62C 5B0YB 3AZIC 1S32B 5B32D 5C3IB 3VH6T 1HQ3D 2F2AC 3AZGD 3FDDA 5DNNB 4J8VC 4KGCD 5AVBD 1N1JA 3A1KA 3AZMD 1KX4A 1F66C 1ID3B 2PYOA 3AZIA 5BNXA 3LJAC 3W98A 1P3MD 3X1UB 3B0CW 1M19C 4WU8C 5B31D 1ULYA 5GT3C 1EQZD 2ZY2A 3AYWD 3KWQB 3X1VD 1F66A 1P3BD 3WKJA 3LJAA 3LELD 5DNMC 3W97B 5B31G 3MGQB 3IP4C 2NQBC 5AV9A 4NE3A 4Z5TD 2Y2JA 5F99D 5GT0C 4Z2MH 5CPIC 1ZLAC 3W96D 4QLCD 4X23D 4CSRB 5BS7A 5DNMA 4J8XC 3UTBA 2NQBA 2AROD 3X1SC 2IO5B 4XZQA 3C1CA 4H9QB 1BH9A 2RVQC 3A6NC 1ZLAA 3AZKD 1P3GC 3LZ0D 4WNNB 1PZRA 5B0YC 5GSUB 1S32C 2Y2PA 1P3KD 3AZED 3X1SA 3MGSA 5DNNC 5AV6D 3A6NA 3UTAD 2YFWA 5JRGC 1P3GA 1ID3C 3AN2B 3UT9A 3X1UC 3AZFA 5AY8D 4WV4B 3KUYB 4UUZA 5B1MD 3C1BC 1T3UA 3KXBB 3KWQC 1M18D 5JA4A 5JRGA 1ID3A 3W99B 2NZDC 2Y2NA 3AV2C 3AZJD 3W97C 3AZGA 1U35A 3C1BA 1W2EA 5AV8A 3AFAB 3AZLB 3WAAA 4Z66A 2VQRA 3P5JB 5CPJA 2NZDA 2CV5A 3X1TA 2Y2QA 4DRAA 3AZNB 5B33D 3AV2A 3REHC 4J8WC 2BYMA 1KX4D 2PYOD 4WU9B 2IO5C 5E5AB 3AZID 3O62D 3AZHB 5AV5C 3REHA 3EPJA 2BYKA 4H9RB 4G92B 4J8WA 4Z5TA 1P3PA 1F66D 5F99A 3WKJD 3LJAD 1P3IA 5AV5A 5KDMB 1JFIB 3AN2C 5AV9D 3V9RA 5BO0A 4LD9A 5CPKB 3KUYC 3REIB 1TAFB 3KXBC 4YM6A 3H0MC 5DNMD 3W99C 5B40B 3REJB 3AZKA 3UTBD 2NQBD 2UWXA 1P3AB 3B6GB 5GT0D 4H9PB 5B1LB 4XZQD 3KUYA 3C1CD 3AZLC 5B2IA 1ZLAD 3KXBA 4DQYB 4J8XD 3A1IA 3AZNC 3X1SD 3MGSD 1A7WA 3MGRB 4ZBJB 2RVQD 4G91B 3LZ1B 3A6ND 4WU9C 4E44A 5E5AC 1P3GD 2ZY5A 1S32D 3UT9D 3AZHC 3AZFD 3MGPA 3NQUB 5B0ZB 5B24B 2BG1A 4KHAA 5DNND 4G92C 3R45B 2FJ7B 3RELC 5JRGD 4H9SA 4WU9A 1ID3D 4KUDB 4UPKA 1P3OB 1AOIA 1P3LB 3X1UD 4H9NA 1BH8A 4J8UA 1U35D 5B33A 3C1BD 5AV8D 2F8NB 3WAAD 4Z66D 3WA9C 3RELA 5CPJD 1B67A 4NE5A 2NZDD 2CV5D 5B2JC 3X1TD 3O62A 3AV2D 3WTPB 3W97D 5GXQB 5B40C 3REJC 1P3AC 3B6GC 1P34B 1P3FB 4J8VA 5B1LC 1KX5C 4JJNC 3WA9A 5B2JA 3MNNB 1H3OB 3REHD 3REKB 1M19A 4WU8A 5GT3A 4J8WD 3MGRC 1P3PD 4ZBJC 1KX5A 4JJNA 2W8SA 2F8NK 4EO5C 4G91C 1P3ID 5AV5D 3TU4C 5B32B 4LD9D 1HQ3B 3VH5A 3MGRA 5GT0A 4XUJC 4YM6D 5CP6C 5AVBB 3AZMB 4KGCB 5CPIA 4E45A 3TU4A 2FFFB 1P3OC 3B6FB 4CAYB 5C3IC 4J8XA 1P3MB 3KUYD 4H9OA 1EQZB 5B2ID 3NQJA 4XUJA 3KXBD 3AYWB 5CP6A 5FUGA 3X1VB 5BNVA 1P3BB 5B0YA 4YS3B 1S32A 3LELB 5GXQC 1P34C 1P3FC 5DNNA 3MGPD 2XD1A 3W96B 3MNNC 3X1UA 3REKC 4X23B 5G49B 3MGQC 3AV1B 2AROB 3B0BA 2JE5A 4WU9D 3KWQA 3MVDB 1KX3B 1TZYB 1AOID 2JCHA 4WZSB 3LZ0B 3W97A 4J8UD 3REKA 3MGQA 1P3KB 1HQ3C 3AZEB 3RELD 4ZUXB 3VH6A 5AV6B 4KGCC 2YFVB 2ZY4A 5AVBC 3UTAB 1M1AB 4HGAB 5GSUC 4CSRA 2RIQA 3B6FC 1P3MC 4J8VD 5AY8B 3WA9D 5B1MB 1EQZC 5B2JD 4H9QA 1M18B 3X1VC 2Y2LA 4WNNA 1P3BC 4WU8D 1M19D 5GSUA 4YS3C 5AVCB 5GT3D 2HIOB 3B6GD 3LELC 3KFUG 3AZJB 1KX5D 4JJND 2L5AA 3AN2A 4X23C 3MGRD 3AV1C 2AROC 2Y2OA 3AFAC 5CPID 1KX4B 3TU4D 3MVDC 1KX3C 2PYOB 3AZIB 1TZYC 5BNXB 3VH5T 3W98B 3EPLA 3W99A 1F1EA 3LZ0C 5G49A 4XUJD 1P3KC 3AV1A 3AFAA 3AZEC 5CP6D 3AZLA 1BFMA 4ZUXC 1F66B 3MVDA 5AV6C 5B0YD 3WKJB 3LJAB 3UTAC 1M1AC 3AZNA 5AV9B 2Y2HA 5B1MC 5E5AA 3AZHA 2F8NG 5AVCC 3UTBB 2HIOC 2NQBB 3AZJC 5CPKC 4H9RA 3KWQD 2LY8A 4XZQB 3C1CB 3REIC 1BH9B 1ZLAB 2JSSA 3MNND 3REKD 5KDMA 1JFIA 4NFTA 3MGQD 2ZM5A 5CPKA 2HUEB 3MGSB 2ZY3A 3EPHA 3REIA 1KU5A 1TAFA 3A6NB 3H0LC 2YFWB 2PYOC 1P3GB 2Y2IA 3W98C 5B40A 3REJA 3UT9B 3AZFB 1P3AA 3B6GA 4UUZB 2G5IC 4H9PA 5B1LA 2DF4C 4NE6A 3LZ1C 4R8PB 5BT1C 2XD5A 5JA4B 5JRGB 3WKJC 5B32G 5GSUD 3B6FD 1WWIA 3AZGB 5B0ZC 5B24C 1U35B 5AV9C 3C1BB 5AV8B 3WAAB 4Z66B 2FJ7C 3VH5W 3LZ1A 2G5HC 2F8NH 5CPJB 2NZDB 4KUDC 2CV5B 3X1TB 4YS3D 3AN2D 1P3LC 3AV2B 5BS7C 3NQUA 2J8PA 5B0ZA
chains in the Genus database with same CATH topology
3UTBC 5B24A 5B31B 3R45A 2BYMB 2FJ7A 4XZQC 3C1CC 3W99D 4KUDA 1P3OA 3WTPC 1P3LA 3REHB 2BYKB 3AV1D 2F8NA 3AFAD 3AZLD 2HUEC 3MGSC 4J8WB 4Z5TB 1P3PB 1KX3D 5F99B 3MVDD 3KSYA 1TZYD 1HTAA 5AV5B 1P3IB 3H0RC 3AZND 3WTPA 3AL0C 4QLCB 5GXQA 1R4VA 3V9RB 3UT9C 5BO0B 3AZFC 4LD9B 1P34A 1P3FA 3EG5B 4ZUXD 2DQNC 5E5AD 1Q9CA 3AZHD 4YM6B 4R8PC 1M1AD 3AZKB 3MNNA 1H3OA 5B32C 3AZGC 1U35C 5AV8C 3WAAC 5B2IB 4Z66C 3AZMC 4R8PA 5CPJC 3VH6W 2CV5C 3X1TC 5AVCD 2HIOD 5B32A 4DRBA 5CPKD 1HQ3A 5B31C 3REID 3AYWC 4KGCA 5AVBA 3AZMA 5CHLB 5B40D 3REJD 3MGPB 1P3AD 3B6FA 1Z2CB 4CAYA 1P3MA 5B1LD 2Y2MA 4KHAB 5B31A 1EQZA 4Z5TC 1P3PC 5F99C 3AYWA 3B0DB 3X1VA 1AOIB 3W98D 1P3IC 1P3BA 4YS3A 4H9NB 3W96C 1BH8B 4QLCC 3LELA 5B33B 4J8UB 4AWLB 4LD9C 2Y2GA 3B0CT 4M6BA 1N1JB 3LZ1D 5BT1D 3RELB 3O62B 4YM6C 3AZKC 3W96A 4QLCA 5B0ZD 5B24D 4X23A 4WJ3C 2CWEA 2FJ7D 4J8VB 2AROA 1B6WA 3WA9B 5B2IC 3WTPE 1KX3A 4KUDD 5B2JB 1TZYA 1P3OD 1P3LD 4HGAC 3LZ0A 1M19B 4WU8B 2F8ND 5GT3B 1P3KA 5AY8C 3AZEA 1KX5B 4JJNB 4ZUXA 5AV6A 2YFVA 3WTPD 1M18C 5GXQD 5DNMB 3UTAA 1M1AA 3MGPC 1P34D 1P3FD 5AY8A 2Y2KA 5GT0B 5B1MA 4EO5B 5CPIB 4H9SC 3TU4B 1M18A 3B0DC 1AOIC 4Z2MG 4J8XB 3EPKA 5AVCA 2HIOA 4J8UC 3X1SB 5B33C 3AZJA 4H9OB 3F6TA 4AWLC 3NQJB 4XUJB 1WWSA 5CP6B 4R8PD 1KX4C 5FUGB 5BNVB 3O62C 5B0YB 3AZIC 1S32B 5B32D 5C3IB 3VH6T 1HQ3D 2F2AC 3AZGD 3FDDA 5DNNB 4J8VC 4KGCD 5AVBD 1N1JA 3A1KA 3AZMD 1KX4A 1F66C 1ID3B 2PYOA 3AZIA 5BNXA 3LJAC 3W98A 1P3MD 3X1UB 3B0CW 1M19C 4WU8C 5B31D 1ULYA 5GT3C 1EQZD 2ZY2A 3AYWD 3KWQB 3X1VD 1F66A 1P3BD 3WKJA 3LJAA 3LELD 5DNMC 3W97B 5B31G 3MGQB 3IP4C 2NQBC 5AV9A 4NE3A 4Z5TD 2Y2JA 5F99D 5GT0C 4Z2MH 5CPIC 1ZLAC 3W96D 4QLCD 4X23D 4CSRB 5BS7A 5DNMA 4J8XC 3UTBA 2NQBA 2AROD 3X1SC 2IO5B 4XZQA 3C1CA 4H9QB 1BH9A 2RVQC 3A6NC 1ZLAA 3AZKD 1P3GC 3LZ0D 4WNNB 1PZRA 5B0YC 5GSUB 1S32C 2Y2PA 1P3KD 3AZED 3X1SA 3MGSA 5DNNC 5AV6D 3A6NA 3UTAD 2YFWA 5JRGC 1P3GA 1ID3C 3AN2B 3UT9A 3X1UC 3AZFA 5AY8D 4WV4B 3KUYB 4UUZA 5B1MD 3C1BC 1T3UA 3KXBB 3KWQC 1M18D 5JA4A 5JRGA 1ID3A 3W99B 2NZDC 2Y2NA 3AV2C 3AZJD 3W97C 3AZGA 1U35A 3C1BA 1W2EA 5AV8A 3AFAB 3AZLB 3WAAA 4Z66A 2VQRA 3P5JB 5CPJA 2NZDA 2CV5A 3X1TA 2Y2QA 4DRAA 3AZNB 5B33D 3AV2A 3REHC 4J8WC 2BYMA 1KX4D 2PYOD 4WU9B 2IO5C 5E5AB 3AZID 3O62D 3AZHB 5AV5C 3REHA 3EPJA 2BYKA 4H9RB 4G92B 4J8WA 4Z5TA 1P3PA 1F66D 5F99A 3WKJD 3LJAD 1P3IA 5AV5A 5KDMB 1JFIB 3AN2C 5AV9D 3V9RA 5BO0A 4LD9A 5CPKB 3KUYC 3REIB 1TAFB 3KXBC 4YM6A 3H0MC 5DNMD 3W99C 5B40B 3REJB 3AZKA 3UTBD 2NQBD 2UWXA 1P3AB 3B6GB 5GT0D 4H9PB 5B1LB 4XZQD 3KUYA 3C1CD 3AZLC 5B2IA 1ZLAD 3KXBA 4DQYB 4J8XD 3A1IA 3AZNC 3X1SD 3MGSD 1A7WA 3MGRB 4ZBJB 2RVQD 4G91B 3LZ1B 3A6ND 4WU9C 4E44A 5E5AC 1P3GD 2ZY5A 1S32D 3UT9D 3AZHC 3AZFD 3MGPA 3NQUB 5B0ZB 5B24B 2BG1A 4KHAA 5DNND 4G92C 3R45B 2FJ7B 3RELC 5JRGD 4H9SA 4WU9A 1ID3D 4KUDB 4UPKA 1P3OB 1AOIA 1P3LB 3X1UD 4H9NA 1BH8A 4J8UA 1U35D 5B33A 3C1BD 5AV8D 2F8NB 3WAAD 4Z66D 3WA9C 3RELA 5CPJD 1B67A 4NE5A 2NZDD 2CV5D 5B2JC 3X1TD 3O62A 3AV2D 3WTPB 3W97D 5GXQB 5B40C 3REJC 1P3AC 3B6GC 1P34B 1P3FB 4J8VA 5B1LC 1KX5C 4JJNC 3WA9A 5B2JA 3MNNB 1H3OB 3REHD 3REKB 1M19A 4WU8A 5GT3A 4J8WD 3MGRC 1P3PD 4ZBJC 1KX5A 4JJNA 2W8SA 2F8NK 4EO5C 4G91C 1P3ID 5AV5D 3TU4C 5B32B 4LD9D 1HQ3B 3VH5A 3MGRA 5GT0A 4XUJC 4YM6D 5CP6C 5AVBB 3AZMB 4KGCB 5CPIA 4E45A 3TU4A 2FFFB 1P3OC 3B6FB 4CAYB 5C3IC 4J8XA 1P3MB 3KUYD 4H9OA 1EQZB 5B2ID 3NQJA 4XUJA 3KXBD 3AYWB 5CP6A 5FUGA 3X1VB 5BNVA 1P3BB 5B0YA 4YS3B 1S32A 3LELB 5GXQC 1P34C 1P3FC 5DNNA 3MGPD 2XD1A 3W96B 3MNNC 3X1UA 3REKC 4X23B 5G49B 3MGQC 3AV1B 2AROB 3B0BA 2JE5A 4WU9D 3KWQA 3MVDB 1KX3B 1TZYB 1AOID 2JCHA 4WZSB 3LZ0B 3W97A 4J8UD 3REKA 3MGQA 1P3KB 1HQ3C 3AZEB 3RELD 4ZUXB 3VH6A 5AV6B 4KGCC 2YFVB 2ZY4A 5AVBC 3UTAB 1M1AB 4HGAB 5GSUC 4CSRA 2RIQA 3B6FC 1P3MC 4J8VD 5AY8B 3WA9D 5B1MB 1EQZC 5B2JD 4H9QA 1M18B 3X1VC 2Y2LA 4WNNA 1P3BC 4WU8D 1M19D 5GSUA 4YS3C 5AVCB 5GT3D 2HIOB 3B6GD 3LELC 3KFUG 3AZJB 1KX5D 4JJND 2L5AA 3AN2A 4X23C 3MGRD 3AV1C 2AROC 2Y2OA 3AFAC 5CPID 1KX4B 3TU4D 3MVDC 1KX3C 2PYOB 3AZIB 1TZYC 5BNXB 3VH5T 3W98B 3EPLA 3W99A 1F1EA 3LZ0C 5G49A 4XUJD 1P3KC 3AV1A 3AFAA 3AZEC 5CP6D 3AZLA 1BFMA 4ZUXC 1F66B 3MVDA 5AV6C 5B0YD 3WKJB 3LJAB 3UTAC 1M1AC 3AZNA 5AV9B 2Y2HA 5B1MC 5E5AA 3AZHA 2F8NG 5AVCC 3UTBB 2HIOC 2NQBB 3AZJC 5CPKC 4H9RA 3KWQD 2LY8A 4XZQB 3C1CB 3REIC 1BH9B 1ZLAB 2JSSA 3MNND 3REKD 5KDMA 1JFIA 4NFTA 3MGQD 2ZM5A 5CPKA 2HUEB 3MGSB 2ZY3A 3EPHA 3REIA 1KU5A 1TAFA 3A6NB 3H0LC 2YFWB 2PYOC 1P3GB 2Y2IA 3W98C 5B40A 3REJA 3UT9B 3AZFB 1P3AA 3B6GA 4UUZB 2G5IC 4H9PA 5B1LA 2DF4C 4NE6A 3LZ1C 4R8PB 5BT1C 2XD5A 5JA4B 5JRGB 3WKJC 5B32G 5GSUD 3B6FD 1WWIA 3AZGB 5B0ZC 5B24C 1U35B 5AV9C 3C1BB 5AV8B 3WAAB 4Z66B 2FJ7C 3VH5W 3LZ1A 2G5HC 2F8NH 5CPJB 2NZDB 4KUDC 2CV5B 3X1TB 4YS3D 3AN2D 1P3LC 3AV2B 5BS7C 3NQUA 2J8PA 5B0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB C;  5B24 A;  5B31 B;  3R45 A;  2BYM B;  2FJ7 A;  4XZQ C;  3C1C C;  3W99 D;  4KUD A;  1P3O A;  3WTP C;  1P3L A;  3REH B;  2BYK B;  3AV1 D;  2F8N A;  3AFA D;  3AZL D;  2HUE C;  3MGS C;  4J8W B;  4Z5T B;  1P3P B;  1KX3 D;  5F99 B;  3MVD D;  3KSY A;  1TZY D;  1HTA A;  5AV5 B;  1P3I B;  3AZN D;  3WTP A;  4QLC B;  5GXQ A;  1R4V A;  3V9R B;  3UT9 C;  5BO0 B;  3AZF C;  4LD9 B;  1P34 A;  1P3F A;  4ZUX D;  5E5A D;  1Q9C A;  3AZH D;  4YM6 B;  4R8P C;  1M1A D;  3AZK B;  3MNN A;  1H3O A;  5B32 C;  3AZG C;  1U35 C;  5AV8 C;  3WAA C;  5B2I B;  4Z66 C;  3AZM C;  4R8P A;  5CPJ C;  3VH6 W;  2CV5 C;  3X1T C;  5AVC D;  2HIO D;  5B32 A;  4DRB A;  5CPK D;  1HQ3 A;  5B31 C;  3REI D;  3AYW C;  4KGC A;  5AVB A;  3AZM A;  5CHL B;  5B40 D;  3REJ D;  3MGP B;  1P3A D;  3B6F A;  4CAY A;  1P3M A;  5B1L D;  4KHA B;  5B31 A;  1EQZ A;  4Z5T C;  1P3P C;  5F99 C;  3AYW A;  3B0D B;  3X1V A;  1AOI B;  3W98 D;  1P3I C;  1P3B A;  4YS3 A;  4H9N B;  3W96 C;  1BH8 B;  4QLC C;  3LEL A;  5B33 B;  4J8U B;  4AWL B;  4LD9 C;  3B0C T;  4M6B A;  1N1J B;  3LZ1 D;  5BT1 D;  3REL B;  3O62 B;  4YM6 C;  3AZK C;  3W96 A;  4QLC A;  5B0Z D;  5B24 D;  4X23 A;  2CWE A;  2FJ7 D;  4J8V B;  2ARO A;  1B6W A;  3WA9 B;  5B2I C;  3WTP E;  1KX3 A;  4KUD D;  5B2J B;  1TZY A;  1P3O D;  1P3L D;  4HGA C;  3LZ0 A;  1M19 B;  4WU8 B;  2F8N D;  5GT3 B;  1P3K A;  5AY8 C;  3AZE A;  1KX5 B;  4JJN B;  4ZUX A;  5AV6 A;  2YFV A;  3WTP D;  1M18 C;  5GXQ D;  5DNM B;  3UTA A;  1M1A A;  3MGP C;  1P34 D;  1P3F D;  5AY8 A;  5GT0 B;  5B1M A;  4EO5 B;  5CPI B;  4H9S C;  3TU4 B;  1M18 A;  3B0D C;  1AOI C;  4Z2M G;  4J8X B;  5AVC A;  2HIO A;  4J8U C;  3X1S B;  5B33 C;  3AZJ A;  4H9O B;  4AWL C;  3NQJ B;  4XUJ B;  1WWS A;  5CP6 B;  4R8P D;  1KX4 C;  5FUG B;  5BNV B;  3O62 C;  5B0Y B;  3AZI C;  1S32 B;  5B32 D;  5C3I B;  3VH6 T;  1HQ3 D;  3AZG D;  5DNN B;  4J8V C;  4KGC D;  5AVB D;  1N1J A;  3AZM D;  1KX4 A;  1F66 C;  1ID3 B;  2PYO A;  3AZI A;  5BNX A;  3LJA C;  3W98 A;  1P3M D;  3X1U B;  3B0C W;  1M19 C;  4WU8 C;  5B31 D;  1ULY A;  5GT3 C;  1EQZ D;  3AYW D;  3KWQ B;  3X1V D;  1F66 A;  1P3B D;  3WKJ A;  3LJA A;  3LEL D;  5DNM C;  3W97 B;  5B31 G;  3MGQ B;  2NQB C;  5AV9 A;  4NE3 A;  4Z5T D;  5GT0 C;  5F99 D;  4Z2M H;  5CPI C;  1ZLA C;  3W96 D;  4QLC D;  4X23 D;  4CSR B;  5BS7 A;  5DNM A;  4J8X C;  3UTB A;  2NQB A;  2ARO D;  3X1S C;  2IO5 B;  4XZQ A;  3C1C A;  4H9Q B;  1BH9 A;  2RVQ C;  3A6N C;  1ZLA A;  3AZK D;  1P3G C;  3LZ0 D;  4WNN B;  5B0Y C;  5GSU B;  1S32 C;  1P3K D;  3AZE D;  3X1S A;  3MGS A;  5DNN C;  5AV6 D;  3A6N A;  3UTA D;  2YFW A;  5JRG C;  1P3G A;  1ID3 C;  3AN2 B;  3UT9 A;  3X1U C;  3AZF A;  5AY8 D;  4WV4 B;  3KUY B;  4UUZ A;  5B1M D;  3C1B C;  3KXB B;  3KWQ C;  1M18 D;  5JA4 A;  5JRG A;  1ID3 A;  3W99 B;  2NZD C;  3AV2 C;  3AZJ D;  3W97 C;  3AZG A;  1U35 A;  3C1B A;  5AV8 A;  3AFA B;  3AZL B;  3WAA A;  4Z66 A;  5CPJ A;  2NZD A;  2CV5 A;  3X1T A;  4DRA A;  3AZN B;  5B33 D;  3AV2 A;  3REH C;  4J8W C;  2BYM A;  1KX4 D;  2PYO D;  4WU9 B;  2IO5 C;  5E5A B;  3AZI D;  3O62 D;  3AZH B;  5AV5 C;  3REH A;  2BYK A;  4H9R B;  4G92 B;  4J8W A;  4Z5T A;  1P3P A;  1F66 D;  5F99 A;  3WKJ D;  3LJA D;  1P3I A;  5AV5 A;  5KDM B;  1JFI B;  3AN2 C;  5AV9 D;  3V9R A;  5BO0 A;  4LD9 A;  5CPK B;  3KUY C;  3REI B;  1TAF B;  3KXB C;  4YM6 A;  5DNM D;  3W99 C;  5B40 B;  3REJ B;  3AZK A;  3UTB D;  2NQB D;  1P3A B;  3B6G B;  5GT0 D;  4H9P B;  5B1L B;  4XZQ D;  3KUY A;  3C1C D;  3AZL C;  5B2I A;  1ZLA D;  3KXB A;  4J8X D;  3AZN C;  3X1S D;  3MGS D;  1A7W A;  3MGR B;  4ZBJ B;  2RVQ D;  4G91 B;  3LZ1 B;  3A6N D;  4WU9 C;  4E44 A;  5E5A C;  1P3G D;  1S32 D;  3UT9 D;  3AZH C;  3AZF D;  3MGP A;  3NQU B;  5B0Z B;  5B24 B;  4KHA A;  5DNN D;  4G92 C;  3R45 B;  2FJ7 B;  3REL C;  5JRG D;  4H9S A;  4WU9 A;  1ID3 D;  4KUD B;  1P3O B;  1AOI A;  1P3L B;  3X1U D;  4H9N A;  1BH8 A;  4J8U A;  1U35 D;  5B33 A;  3C1B D;  5AV8 D;  2F8N B;  3WAA D;  4Z66 D;  3WA9 C;  3REL A;  5CPJ D;  1B67 A;  4NE5 A;  2NZD D;  2CV5 D;  5B2J C;  3X1T D;  3O62 A;  3AV2 D;  3WTP B;  3W97 D;  5GXQ B;  5B40 C;  3REJ C;  1P3A C;  3B6G C;  1P34 B;  1P3F B;  4J8V A;  5B1L C;  1KX5 C;  4JJN C;  3WA9 A;  5B2J A;  3MNN B;  1H3O B;  3REH D;  3REK B;  1M19 A;  4WU8 A;  5GT3 A;  4J8W D;  3MGR C;  1P3P D;  4ZBJ C;  1KX5 A;  4JJN A;  2F8N K;  4EO5 C;  4G91 C;  1P3I D;  5AV5 D;  3TU4 C;  5B32 B;  4LD9 D;  1HQ3 B;  3VH5 A;  3MGR A;  5GT0 A;  4XUJ C;  4YM6 D;  5CP6 C;  5AVB B;  3AZM B;  4KGC B;  5CPI A;  4E45 A;  3TU4 A;  1P3O C;  3B6F B;  4CAY B;  5C3I C;  4J8X A;  1P3M B;  3KUY D;  4H9O A;  1EQZ B;  5B2I D;  3NQJ A;  4XUJ A;  3KXB D;  3AYW B;  5CP6 A;  5FUG A;  3X1V B;  5BNV A;  1P3B B;  5B0Y A;  4YS3 B;  1S32 A;  3LEL B;  5GXQ C;  1P34 C;  1P3F C;  5DNN A;  3MGP D;  3W96 B;  3MNN C;  3X1U A;  3REK C;  4X23 B;  5G49 B;  3MGQ C;  3AV1 B;  2ARO B;  3B0B A;  4WU9 D;  3KWQ A;  3MVD B;  1KX3 B;  1TZY B;  1AOI D;  4J8U D;  4WZS B;  3LZ0 B;  3W97 A;  3REK A;  3MGQ A;  1P3K B;  1HQ3 C;  3AZE B;  3REL D;  4ZUX B;  3VH6 A;  5AV6 B;  4KGC C;  2YFV B;  5AVB C;  3UTA B;  1M1A B;  4HGA B;  5GSU C;  4CSR A;  3B6F C;  1P3M C;  4J8V D;  5AY8 B;  3WA9 D;  5B1M B;  1EQZ C;  5B2J D;  4H9Q A;  1M18 B;  3X1V C;  4WNN A;  1P3B C;  4WU8 D;  1M19 D;  5GSU A;  4YS3 C;  5AVC B;  5GT3 D;  2HIO B;  3B6G D;  3LEL C;  3AZJ B;  1KX5 D;  4JJN D;  2L5A A;  3AN2 A;  4X23 C;  3MGR D;  3AV1 C;  2ARO C;  3AFA C;  5CPI D;  1KX4 B;  3TU4 D;  3MVD C;  1KX3 C;  2PYO B;  3AZI B;  1TZY C;  5BNX B;  3VH5 T;  3W98 B;  3W99 A;  1F1E A;  3LZ0 C;  5G49 A;  4XUJ D;  1P3K C;  3AV1 A;  3AFA A;  3AZE C;  5CP6 D;  3AZL A;  1BFM A;  4ZUX C;  1F66 B;  3MVD A;  5AV6 C;  5B0Y D;  3WKJ B;  3LJA B;  3UTA C;  1M1A C;  3AZN A;  5AV9 B;  5B1M C;  5E5A A;  3AZH A;  2F8N G;  5AVC C;  3UTB B;  2HIO C;  2NQB B;  3AZJ C;  5CPK C;  4H9R A;  3KWQ D;  2LY8 A;  4XZQ B;  3C1C B;  3REI C;  1BH9 B;  1ZLA B;  2JSS A;  3MNN D;  3REK D;  5KDM A;  1JFI A;  4NFT A;  3MGQ D;  5CPK A;  2HUE B;  3MGS B;  3REI A;  1KU5 A;  1TAF A;  3A6N B;  2PYO C;  2YFW B;  1P3G B;  3W98 C;  5B40 A;  3REJ A;  3UT9 B;  3AZF B;  1P3A A;  3B6G A;  4UUZ B;  4H9P A;  5B1L A;  4NE6 A;  3LZ1 C;  4R8P B;  5BT1 C;  5JA4 B;  3WKJ C;  5JRG B;  5B32 G;  5GSU D;  3B6F D;  1WWI A;  3AZG B;  5B0Z C;  5B24 C;  1U35 B;  5AV9 C;  3C1B B;  5AV8 B;  3WAA B;  4Z66 B;  2FJ7 C;  3VH5 W;  3LZ1 A;  2F8N H;  5CPJ B;  2NZD B;  4KUD C;  2CV5 B;  3X1T B;  4YS3 D;  3AN2 D;  1P3L C;  3AV2 B;  5BS7 C;  3NQU A;  5B0Z A; 
#chains in the Genus database with same CATH topology
 3UTB C;  5B24 A;  5B31 B;  3R45 A;  2BYM B;  2FJ7 A;  4XZQ C;  3C1C C;  3W99 D;  4KUD A;  1P3O A;  3WTP C;  1P3L A;  3REH B;  2BYK B;  3AV1 D;  2F8N A;  3AFA D;  3AZL D;  2HUE C;  3MGS C;  4J8W B;  4Z5T B;  1P3P B;  1KX3 D;  5F99 B;  3MVD D;  3KSY A;  1TZY D;  1HTA A;  5AV5 B;  1P3I B;  3H0R C;  3AZN D;  3WTP A;  3AL0 C;  4QLC B;  5GXQ A;  1R4V A;  3V9R B;  3UT9 C;  5BO0 B;  3AZF C;  4LD9 B;  1P34 A;  1P3F A;  3EG5 B;  4ZUX D;  2DQN C;  5E5A D;  1Q9C A;  3AZH D;  4YM6 B;  4R8P C;  1M1A D;  3AZK B;  3MNN A;  1H3O A;  5B32 C;  3AZG C;  1U35 C;  5AV8 C;  3WAA C;  5B2I B;  4Z66 C;  3AZM C;  4R8P A;  5CPJ C;  3VH6 W;  2CV5 C;  3X1T C;  5AVC D;  2HIO D;  5B32 A;  4DRB A;  5CPK D;  1HQ3 A;  5B31 C;  3REI D;  3AYW C;  4KGC A;  5AVB A;  3AZM A;  5CHL B;  5B40 D;  3REJ D;  3MGP B;  1P3A D;  3B6F A;  1Z2C B;  4CAY A;  1P3M A;  5B1L D;  2Y2M A;  4KHA B;  5B31 A;  1EQZ A;  4Z5T C;  1P3P C;  5F99 C;  3AYW A;  3B0D B;  3X1V A;  1AOI B;  3W98 D;  1P3I C;  1P3B A;  4YS3 A;  4H9N B;  3W96 C;  1BH8 B;  4QLC C;  3LEL A;  5B33 B;  4J8U B;  4AWL B;  4LD9 C;  2Y2G A;  3B0C T;  4M6B A;  1N1J B;  3LZ1 D;  5BT1 D;  3REL B;  3O62 B;  4YM6 C;  3AZK C;  3W96 A;  4QLC A;  5B0Z D;  5B24 D;  4X23 A;  4WJ3 C;  2CWE A;  2FJ7 D;  4J8V B;  2ARO A;  1B6W A;  3WA9 B;  5B2I C;  3WTP E;  1KX3 A;  4KUD D;  5B2J B;  1TZY A;  1P3O D;  1P3L D;  4HGA C;  3LZ0 A;  1M19 B;  4WU8 B;  2F8N D;  5GT3 B;  1P3K A;  5AY8 C;  3AZE A;  1KX5 B;  4JJN B;  4ZUX A;  5AV6 A;  2YFV A;  3WTP D;  1M18 C;  5GXQ D;  5DNM B;  3UTA A;  1M1A A;  3MGP C;  1P34 D;  1P3F D;  5AY8 A;  2Y2K A;  5GT0 B;  5B1M A;  4EO5 B;  5CPI B;  4H9S C;  3TU4 B;  1M18 A;  3B0D C;  1AOI C;  4Z2M G;  4J8X B;  3EPK A;  5AVC A;  2HIO A;  4J8U C;  3X1S B;  5B33 C;  3AZJ A;  4H9O B;  3F6T A;  4AWL C;  3NQJ B;  4XUJ B;  1WWS A;  5CP6 B;  4R8P D;  1KX4 C;  5FUG B;  5BNV B;  3O62 C;  5B0Y B;  3AZI C;  1S32 B;  5B32 D;  5C3I B;  3VH6 T;  1HQ3 D;  2F2A C;  3AZG D;  3FDD A;  5DNN B;  4J8V C;  4KGC D;  5AVB D;  1N1J A;  3A1K A;  3AZM D;  1KX4 A;  1F66 C;  1ID3 B;  2PYO A;  3AZI A;  5BNX A;  3LJA C;  3W98 A;  1P3M D;  3X1U B;  3B0C W;  1M19 C;  4WU8 C;  5B31 D;  1ULY A;  5GT3 C;  1EQZ D;  2ZY2 A;  3AYW D;  3KWQ B;  3X1V D;  1F66 A;  1P3B D;  3WKJ A;  3LJA A;  3LEL D;  5DNM C;  3W97 B;  5B31 G;  3MGQ B;  3IP4 C;  2NQB C;  5AV9 A;  4NE3 A;  4Z5T D;  2Y2J A;  5F99 D;  5GT0 C;  4Z2M H;  5CPI C;  1ZLA C;  3W96 D;  4QLC D;  4X23 D;  4CSR B;  5BS7 A;  5DNM A;  4J8X C;  3UTB A;  2NQB A;  2ARO D;  3X1S C;  2IO5 B;  4XZQ A;  3C1C A;  4H9Q B;  1BH9 A;  2RVQ C;  3A6N C;  1ZLA A;  3AZK D;  1P3G C;  3LZ0 D;  4WNN B;  1PZR A;  5B0Y C;  5GSU B;  1S32 C;  2Y2P A;  1P3K D;  3AZE D;  3X1S A;  3MGS A;  5DNN C;  5AV6 D;  3A6N A;  3UTA D;  2YFW A;  5JRG C;  1P3G A;  1ID3 C;  3AN2 B;  3UT9 A;  3X1U C;  3AZF A;  5AY8 D;  4WV4 B;  3KUY B;  4UUZ A;  5B1M D;  3C1B C;  1T3U A;  3KXB B;  3KWQ C;  1M18 D;  5JA4 A;  5JRG A;  1ID3 A;  3W99 B;  2NZD C;  2Y2N A;  3AV2 C;  3AZJ D;  3W97 C;  3AZG A;  1U35 A;  3C1B A;  1W2E A;  5AV8 A;  3AFA B;  3AZL B;  3WAA A;  4Z66 A;  2VQR A;  3P5J B;  5CPJ A;  2NZD A;  2CV5 A;  3X1T A;  2Y2Q A;  4DRA A;  3AZN B;  5B33 D;  3AV2 A;  3REH C;  4J8W C;  2BYM A;  1KX4 D;  2PYO D;  4WU9 B;  2IO5 C;  5E5A B;  3AZI D;  3O62 D;  3AZH B;  5AV5 C;  3REH A;  3EPJ A;  2BYK A;  4H9R B;  4G92 B;  4J8W A;  4Z5T A;  1P3P A;  1F66 D;  5F99 A;  3WKJ D;  3LJA D;  1P3I A;  5AV5 A;  5KDM B;  1JFI B;  3AN2 C;  5AV9 D;  3V9R A;  5BO0 A;  4LD9 A;  5CPK B;  3KUY C;  3REI B;  1TAF B;  3KXB C;  4YM6 A;  3H0M C;  5DNM D;  3W99 C;  5B40 B;  3REJ B;  3AZK A;  3UTB D;  2NQB D;  2UWX A;  1P3A B;  3B6G B;  5GT0 D;  4H9P B;  5B1L B;  4XZQ D;  3KUY A;  3C1C D;  3AZL C;  5B2I A;  1ZLA D;  3KXB A;  4DQY B;  4J8X D;  3A1I A;  3AZN C;  3X1S D;  3MGS D;  1A7W A;  3MGR B;  4ZBJ B;  2RVQ D;  4G91 B;  3LZ1 B;  3A6N D;  4WU9 C;  4E44 A;  5E5A C;  1P3G D;  2ZY5 A;  1S32 D;  3UT9 D;  3AZH C;  3AZF D;  3MGP A;  3NQU B;  5B0Z B;  5B24 B;  2BG1 A;  4KHA A;  5DNN D;  4G92 C;  3R45 B;  2FJ7 B;  3REL C;  5JRG D;  4H9S A;  4WU9 A;  1ID3 D;  4KUD B;  4UPK A;  1P3O B;  1AOI A;  1P3L B;  3X1U D;  4H9N A;  1BH8 A;  4J8U A;  1U35 D;  5B33 A;  3C1B D;  5AV8 D;  2F8N B;  3WAA D;  4Z66 D;  3WA9 C;  3REL A;  5CPJ D;  1B67 A;  4NE5 A;  2NZD D;  2CV5 D;  5B2J C;  3X1T D;  3O62 A;  3AV2 D;  3WTP B;  3W97 D;  5GXQ B;  5B40 C;  3REJ C;  1P3A C;  3B6G C;  1P34 B;  1P3F B;  4J8V A;  5B1L C;  1KX5 C;  4JJN C;  3WA9 A;  5B2J A;  3MNN B;  1H3O B;  3REH D;  3REK B;  1M19 A;  4WU8 A;  5GT3 A;  4J8W D;  3MGR C;  1P3P D;  4ZBJ C;  1KX5 A;  4JJN A;  2W8S A;  2F8N K;  4EO5 C;  4G91 C;  1P3I D;  5AV5 D;  3TU4 C;  5B32 B;  4LD9 D;  1HQ3 B;  3VH5 A;  3MGR A;  5GT0 A;  4XUJ C;  4YM6 D;  5CP6 C;  5AVB B;  3AZM B;  4KGC B;  5CPI A;  4E45 A;  3TU4 A;  2FFF B;  1P3O C;  3B6F B;  4CAY B;  5C3I C;  4J8X A;  1P3M B;  3KUY D;  4H9O A;  1EQZ B;  5B2I D;  3NQJ A;  4XUJ A;  3KXB D;  3AYW B;  5CP6 A;  5FUG A;  3X1V B;  5BNV A;  1P3B B;  5B0Y A;  4YS3 B;  1S32 A;  3LEL B;  5GXQ C;  1P34 C;  1P3F C;  5DNN A;  3MGP D;  2XD1 A;  3W96 B;  3MNN C;  3X1U A;  3REK C;  4X23 B;  5G49 B;  3MGQ C;  3AV1 B;  2ARO B;  3B0B A;  2JE5 A;  4WU9 D;  3KWQ A;  3MVD B;  1KX3 B;  1TZY B;  1AOI D;  2JCH A;  4WZS B;  3LZ0 B;  3W97 A;  4J8U D;  3REK A;  3MGQ A;  1P3K B;  1HQ3 C;  3AZE B;  3REL D;  4ZUX B;  3VH6 A;  5AV6 B;  4KGC C;  2YFV B;  2ZY4 A;  5AVB C;  3UTA B;  1M1A B;  4HGA B;  5GSU C;  4CSR A;  2RIQ A;  3B6F C;  1P3M C;  4J8V D;  5AY8 B;  3WA9 D;  5B1M B;  1EQZ C;  5B2J D;  4H9Q A;  1M18 B;  3X1V C;  2Y2L A;  4WNN A;  1P3B C;  4WU8 D;  1M19 D;  5GSU A;  4YS3 C;  5AVC B;  5GT3 D;  2HIO B;  3B6G D;  3LEL C;  3KFU G;  3AZJ B;  1KX5 D;  4JJN D;  2L5A A;  3AN2 A;  4X23 C;  3MGR D;  3AV1 C;  2ARO C;  2Y2O A;  3AFA C;  5CPI D;  1KX4 B;  3TU4 D;  3MVD C;  1KX3 C;  2PYO B;  3AZI B;  1TZY C;  5BNX B;  3VH5 T;  3W98 B;  3EPL A;  3W99 A;  1F1E A;  3LZ0 C;  5G49 A;  4XUJ D;  1P3K C;  3AV1 A;  3AFA A;  3AZE C;  5CP6 D;  3AZL A;  1BFM A;  4ZUX C;  1F66 B;  3MVD A;  5AV6 C;  5B0Y D;  3WKJ B;  3LJA B;  3UTA C;  1M1A C;  3AZN A;  5AV9 B;  2Y2H A;  5B1M C;  5E5A A;  3AZH A;  2F8N G;  5AVC C;  3UTB B;  2HIO C;  2NQB B;  3AZJ C;  5CPK C;  4H9R A;  3KWQ D;  2LY8 A;  4XZQ B;  3C1C B;  3REI C;  1BH9 B;  1ZLA B;  2JSS A;  3MNN D;  3REK D;  5KDM A;  1JFI A;  4NFT A;  3MGQ D;  2ZM5 A;  5CPK A;  2HUE B;  3MGS B;  2ZY3 A;  3EPH A;  3REI A;  1KU5 A;  1TAF A;  3A6N B;  3H0L C;  2YFW B;  2PYO C;  1P3G B;  2Y2I A;  3W98 C;  5B40 A;  3REJ A;  3UT9 B;  3AZF B;  1P3A A;  3B6G A;  4UUZ B;  2G5I C;  4H9P A;  5B1L A;  2DF4 C;  4NE6 A;  3LZ1 C;  4R8P B;  5BT1 C;  2XD5 A;  5JA4 B;  5JRG B;  3WKJ C;  5B32 G;  5GSU D;  3B6F D;  1WWI A;  3AZG B;  5B0Z C;  5B24 C;  1U35 B;  5AV9 C;  3C1B B;  5AV8 B;  3WAA B;  4Z66 B;  2FJ7 C;  3VH5 W;  3LZ1 A;  2G5H C;  2F8N H;  5CPJ B;  2NZD B;  4KUD C;  2CV5 B;  3X1T B;  4YS3 D;  3AN2 D;  1P3L C;  3AV2 B;  5BS7 C;  3NQU A;  2J8P A;  5B0Z A; 
#chains in the Genus database with same CATH homology
 3UTB C;  5B24 A;  5B31 B;  3R45 A;  2BYM B;  2FJ7 A;  4XZQ C;  3C1C C;  3W99 D;  4KUD A;  1P3O A;  3WTP C;  1P3L A;  3REH B;  2BYK B;  3AV1 D;  2F8N A;  3AFA D;  3AZL D;  2HUE C;  3MGS C;  4J8W B;  4Z5T B;  1P3P B;  1KX3 D;  5F99 B;  3MVD D;  3KSY A;  1TZY D;  1HTA A;  5AV5 B;  1P3I B;  3H0R C;  3AZN D;  3WTP A;  3AL0 C;  4QLC B;  5GXQ A;  1R4V A;  3V9R B;  3UT9 C;  5BO0 B;  3AZF C;  4LD9 B;  1P34 A;  1P3F A;  3EG5 B;  4ZUX D;  2DQN C;  5E5A D;  1Q9C A;  3AZH D;  4YM6 B;  4R8P C;  1M1A D;  3AZK B;  3MNN A;  1H3O A;  5B32 C;  3AZG C;  1U35 C;  5AV8 C;  3WAA C;  5B2I B;  4Z66 C;  3AZM C;  4R8P A;  5CPJ C;  3VH6 W;  2CV5 C;  3X1T C;  5AVC D;  2HIO D;  5B32 A;  4DRB A;  5CPK D;  1HQ3 A;  5B31 C;  3REI D;  3AYW C;  4KGC A;  5AVB A;  3AZM A;  5CHL B;  5B40 D;  3REJ D;  3MGP B;  1P3A D;  3B6F A;  1Z2C B;  4CAY A;  1P3M A;  5B1L D;  2Y2M A;  4KHA B;  5B31 A;  1EQZ A;  4Z5T C;  1P3P C;  5F99 C;  3AYW A;  3B0D B;  3X1V A;  1AOI B;  3W98 D;  1P3I C;  1P3B A;  4YS3 A;  4H9N B;  3W96 C;  1BH8 B;  4QLC C;  3LEL A;  5B33 B;  4J8U B;  4AWL B;  4LD9 C;  2Y2G A;  3B0C T;  4M6B A;  1N1J B;  3LZ1 D;  5BT1 D;  3REL B;  3O62 B;  4YM6 C;  3AZK C;  3W96 A;  4QLC A;  5B0Z D;  5B24 D;  4X23 A;  4WJ3 C;  2CWE A;  2FJ7 D;  4J8V B;  2ARO A;  1B6W A;  3WA9 B;  5B2I C;  3WTP E;  1KX3 A;  4KUD D;  5B2J B;  1TZY A;  1P3O D;  1P3L D;  4HGA C;  3LZ0 A;  1M19 B;  4WU8 B;  2F8N D;  5GT3 B;  1P3K A;  5AY8 C;  3AZE A;  1KX5 B;  4JJN B;  4ZUX A;  5AV6 A;  2YFV A;  3WTP D;  1M18 C;  5GXQ D;  5DNM B;  3UTA A;  1M1A A;  3MGP C;  1P34 D;  1P3F D;  5AY8 A;  2Y2K A;  5GT0 B;  5B1M A;  4EO5 B;  5CPI B;  4H9S C;  3TU4 B;  1M18 A;  3B0D C;  1AOI C;  4Z2M G;  4J8X B;  3EPK A;  5AVC A;  2HIO A;  4J8U C;  3X1S B;  5B33 C;  3AZJ A;  4H9O B;  3F6T A;  4AWL C;  3NQJ B;  4XUJ B;  1WWS A;  5CP6 B;  4R8P D;  1KX4 C;  5FUG B;  5BNV B;  3O62 C;  5B0Y B;  3AZI C;  1S32 B;  5B32 D;  5C3I B;  3VH6 T;  1HQ3 D;  2F2A C;  3AZG D;  3FDD A;  5DNN B;  4J8V C;  4KGC D;  5AVB D;  1N1J A;  3A1K A;  3AZM D;  1KX4 A;  1F66 C;  1ID3 B;  2PYO A;  3AZI A;  5BNX A;  3LJA C;  3W98 A;  1P3M D;  3X1U B;  3B0C W;  1M19 C;  4WU8 C;  5B31 D;  1ULY A;  5GT3 C;  1EQZ D;  2ZY2 A;  3AYW D;  3KWQ B;  3X1V D;  1F66 A;  1P3B D;  3WKJ A;  3LJA A;  3LEL D;  5DNM C;  3W97 B;  5B31 G;  3MGQ B;  3IP4 C;  2NQB C;  5AV9 A;  4NE3 A;  4Z5T D;  2Y2J A;  5F99 D;  5GT0 C;  4Z2M H;  5CPI C;  1ZLA C;  3W96 D;  4QLC D;  4X23 D;  4CSR B;  5BS7 A;  5DNM A;  4J8X C;  3UTB A;  2NQB A;  2ARO D;  3X1S C;  2IO5 B;  4XZQ A;  3C1C A;  4H9Q B;  1BH9 A;  2RVQ C;  3A6N C;  1ZLA A;  3AZK D;  1P3G C;  3LZ0 D;  4WNN B;  1PZR A;  5B0Y C;  5GSU B;  1S32 C;  2Y2P A;  1P3K D;  3AZE D;  3X1S A;  3MGS A;  5DNN C;  5AV6 D;  3A6N A;  3UTA D;  2YFW A;  5JRG C;  1P3G A;  1ID3 C;  3AN2 B;  3UT9 A;  3X1U C;  3AZF A;  5AY8 D;  4WV4 B;  3KUY B;  4UUZ A;  5B1M D;  3C1B C;  1T3U A;  3KXB B;  3KWQ C;  1M18 D;  5JA4 A;  5JRG A;  1ID3 A;  3W99 B;  2NZD C;  2Y2N A;  3AV2 C;  3AZJ D;  3W97 C;  3AZG A;  1U35 A;  3C1B A;  1W2E A;  5AV8 A;  3AFA B;  3AZL B;  3WAA A;  4Z66 A;  2VQR A;  3P5J B;  5CPJ A;  2NZD A;  2CV5 A;  3X1T A;  2Y2Q A;  4DRA A;  3AZN B;  5B33 D;  3AV2 A;  3REH C;  4J8W C;  2BYM A;  1KX4 D;  2PYO D;  4WU9 B;  2IO5 C;  5E5A B;  3AZI D;  3O62 D;  3AZH B;  5AV5 C;  3REH A;  3EPJ A;  2BYK A;  4H9R B;  4G92 B;  4J8W A;  4Z5T A;  1P3P A;  1F66 D;  5F99 A;  3WKJ D;  3LJA D;  1P3I A;  5AV5 A;  5KDM B;  1JFI B;  3AN2 C;  5AV9 D;  3V9R A;  5BO0 A;  4LD9 A;  5CPK B;  3KUY C;  3REI B;  1TAF B;  3KXB C;  4YM6 A;  3H0M C;  5DNM D;  3W99 C;  5B40 B;  3REJ B;  3AZK A;  3UTB D;  2NQB D;  2UWX A;  1P3A B;  3B6G B;  5GT0 D;  4H9P B;  5B1L B;  4XZQ D;  3KUY A;  3C1C D;  3AZL C;  5B2I A;  1ZLA D;  3KXB A;  4DQY B;  4J8X D;  3A1I A;  3AZN C;  3X1S D;  3MGS D;  1A7W A;  3MGR B;  4ZBJ B;  2RVQ D;  4G91 B;  3LZ1 B;  3A6N D;  4WU9 C;  4E44 A;  5E5A C;  1P3G D;  2ZY5 A;  1S32 D;  3UT9 D;  3AZH C;  3AZF D;  3MGP A;  3NQU B;  5B0Z B;  5B24 B;  2BG1 A;  4KHA A;  5DNN D;  4G92 C;  3R45 B;  2FJ7 B;  3REL C;  5JRG D;  4H9S A;  4WU9 A;  1ID3 D;  4KUD B;  4UPK A;  1P3O B;  1AOI A;  1P3L B;  3X1U D;  4H9N A;  1BH8 A;  4J8U A;  1U35 D;  5B33 A;  3C1B D;  5AV8 D;  2F8N B;  3WAA D;  4Z66 D;  3WA9 C;  3REL A;  5CPJ D;  1B67 A;  4NE5 A;  2NZD D;  2CV5 D;  5B2J C;  3X1T D;  3O62 A;  3AV2 D;  3WTP B;  3W97 D;  5GXQ B;  5B40 C;  3REJ C;  1P3A C;  3B6G C;  1P34 B;  1P3F B;  4J8V A;  5B1L C;  1KX5 C;  4JJN C;  3WA9 A;  5B2J A;  3MNN B;  1H3O B;  3REH D;  3REK B;  1M19 A;  4WU8 A;  5GT3 A;  4J8W D;  3MGR C;  1P3P D;  4ZBJ C;  1KX5 A;  4JJN A;  2W8S A;  2F8N K;  4EO5 C;  4G91 C;  1P3I D;  5AV5 D;  3TU4 C;  5B32 B;  4LD9 D;  1HQ3 B;  3VH5 A;  3MGR A;  5GT0 A;  4XUJ C;  4YM6 D;  5CP6 C;  5AVB B;  3AZM B;  4KGC B;  5CPI A;  4E45 A;  3TU4 A;  2FFF B;  1P3O C;  3B6F B;  4CAY B;  5C3I C;  4J8X A;  1P3M B;  3KUY D;  4H9O A;  1EQZ B;  5B2I D;  3NQJ A;  4XUJ A;  3KXB D;  3AYW B;  5CP6 A;  5FUG A;  3X1V B;  5BNV A;  1P3B B;  5B0Y A;  4YS3 B;  1S32 A;  3LEL B;  5GXQ C;  1P34 C;  1P3F C;  5DNN A;  3MGP D;  2XD1 A;  3W96 B;  3MNN C;  3X1U A;  3REK C;  4X23 B;  5G49 B;  3MGQ C;  3AV1 B;  2ARO B;  3B0B A;  2JE5 A;  4WU9 D;  3KWQ A;  3MVD B;  1KX3 B;  1TZY B;  1AOI D;  2JCH A;  4WZS B;  3LZ0 B;  3W97 A;  4J8U D;  3REK A;  3MGQ A;  1P3K B;  1HQ3 C;  3AZE B;  3REL D;  4ZUX B;  3VH6 A;  5AV6 B;  4KGC C;  2YFV B;  2ZY4 A;  5AVB C;  3UTA B;  1M1A B;  4HGA B;  5GSU C;  4CSR A;  2RIQ A;  3B6F C;  1P3M C;  4J8V D;  5AY8 B;  3WA9 D;  5B1M B;  1EQZ C;  5B2J D;  4H9Q A;  1M18 B;  3X1V C;  2Y2L A;  4WNN A;  1P3B C;  4WU8 D;  1M19 D;  5GSU A;  4YS3 C;  5AVC B;  5GT3 D;  2HIO B;  3B6G D;  3LEL C;  3KFU G;  3AZJ B;  1KX5 D;  4JJN D;  2L5A A;  3AN2 A;  4X23 C;  3MGR D;  3AV1 C;  2ARO C;  2Y2O A;  3AFA C;  5CPI D;  1KX4 B;  3TU4 D;  3MVD C;  1KX3 C;  2PYO B;  3AZI B;  1TZY C;  5BNX B;  3VH5 T;  3W98 B;  3EPL A;  3W99 A;  1F1E A;  3LZ0 C;  5G49 A;  4XUJ D;  1P3K C;  3AV1 A;  3AFA A;  3AZE C;  5CP6 D;  3AZL A;  1BFM A;  4ZUX C;  1F66 B;  3MVD A;  5AV6 C;  5B0Y D;  3WKJ B;  3LJA B;  3UTA C;  1M1A C;  3AZN A;  5AV9 B;  2Y2H A;  5B1M C;  5E5A A;  3AZH A;  2F8N G;  5AVC C;  3UTB B;  2HIO C;  2NQB B;  3AZJ C;  5CPK C;  4H9R A;  3KWQ D;  2LY8 A;  4XZQ B;  3C1C B;  3REI C;  1BH9 B;  1ZLA B;  2JSS A;  3MNN D;  3REK D;  5KDM A;  1JFI A;  4NFT A;  3MGQ D;  2ZM5 A;  5CPK A;  2HUE B;  3MGS B;  2ZY3 A;  3EPH A;  3REI A;  1KU5 A;  1TAF A;  3A6N B;  3H0L C;  2YFW B;  2PYO C;  1P3G B;  2Y2I A;  3W98 C;  5B40 A;  3REJ A;  3UT9 B;  3AZF B;  1P3A A;  3B6G A;  4UUZ B;  2G5I C;  4H9P A;  5B1L A;  2DF4 C;  4NE6 A;  3LZ1 C;  4R8P B;  5BT1 C;  2XD5 A;  5JA4 B;  5JRG B;  3WKJ C;  5B32 G;  5GSU D;  3B6F D;  1WWI A;  3AZG B;  5B0Z C;  5B24 C;  1U35 B;  5AV9 C;  3C1B B;  5AV8 B;  3WAA B;  4Z66 B;  2FJ7 C;  3VH5 W;  3LZ1 A;  2G5H C;  2F8N H;  5CPJ B;  2NZD B;  4KUD C;  2CV5 B;  3X1T B;  4YS3 D;  3AN2 D;  1P3L C;  3AV2 B;  5BS7 C;  3NQU A;  2J8P A;  5B0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...