5DNND

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnD00
4WU9D 3A6ND 2F8NG 3WKJA 3MGPB 5GT3C 4J8XB 4Z5TB 4E44A 1KX4C 2FJ7C 3C1CC 3WTPA 3X1VD 4R8PB 4ZUXC 1P3IC 4Z2MH 1EQZA 4H9NA 5JA4A 4H9PB 5CPID 1JFIB 3WKJC 3MGPA 2IO5B 3UTBA 3LZ0C 3B6GC 1P3KB 1M1AD 5E5AC 4EO5C 3AZFA 3MNND 3TU4D 3AV1C 1F66D 3KUYD 4XZQD 2RVQD 4H9SC 1M18B 4YS3A 5BNXA 3RELD 5B0ZB 3AFAA 4JJND 5GXQD 4R8PA 1P3OB 1KX3A 3REJD 4Z66B 3VH6A 3REID 4WV4B 3O62B 5FUGB 4H9NB 5KDMA 2F8ND 4DRBA 5B32A 1JFIA 4G91C 5B1MB 3X1VA 5B33D 3AZKD 3WAAD 1P3KA 5AY8B 3LZ1B 4J8XD 3KXBB 3X1SA 3AZFB 1P3AB 1WWSA 4KHAB 3W97B 4R8PC 1ID3A 2HIOD 4J8UB 4DRAA 1P3OA 3REIA 5JRGA 1M19B 5B1LA 3AZEB 1P3PB 3REHD 2BYMA 4X23B 1KX5C 1P3LB 1EQZD 2AROD 5B33A 5DNND 4KGCD 4HGAB 3X1SD 3W96D 3MNNC 3TU4C 1M18D 3MGRD 4WZSB 3C1CD 3REJC 5B0YC 4J8UA 1ZLAD 4NE6A 5B32G 4YS3D 3MVDC 3MGQD 5CPKA 3O62D 4UUZA 5GT0C 5B1LB 5F99B 3AN2D 2AROA 3MGSB 5BNXB 3AV2D 4ZBJC 3KXBD 4ZUXB 2YFVB 4JJNC 5B2ID 3KSYA 4QLCC 5B2IC 1KX3B 4Z2MG 4J8UD 1F66C 1ZLAA 3A6NC 4WU9C 5KDMB 5CPJB 4ZBJB 5AY8A 3LZ1A 3WAAC 3MVDB 1BH9A 3AZKC 2AROB 4XUJD 3C1CA 4ZUXA 1F66B 2YFWB 3B0CT 1HTAA 4M6BA 2CV5B 5B2IA 5AV5D 3REIB 3AZIA 3W99B 1P3PA 5AY8C 3LZ1C 3LELB 3AZLD 4X23A 1U35A 1AOIA 1N1JB 5G49B 3KWQA 3X1TB 1M1AC 5B33B 3AYWC 4LD9D 3WKJD 3UTAD 4H9RA 5CPIC 4NE3A 1H3OA 4J8WA 1HQ3A 1P3BB 3UTBC 4XZQC 3REKD 1KX4B 5B32C 3W97C 1KX3D 4G92B 3AZJA 5B31A 1P3AA 4J8XC 1P3FB 1P3PD 5CP6A 3LJAD 5B1MA 3AN2C 3AYWA 5CPJD 3AZMA 3AFAC 1N1JA 4H9RB 3AZEC 4H9OB 4J8WC 1HQ3C 3MGPD 1P3GA 2PYOD 3W98D 1ID3B 3REIC 2YFVA 4XZQA 1TAFA 5AVCC 3AZLA 2HUEB 3VH5A 2NZDB 4Z5TD 4EO5B 1ZLAB 1P3FA 4J8VC 5B24A 2BYKB 3UTBB 3AV1B 5BNVB 1ULYA 1S32D 5F99D 5E5AD 1ID3C 5CPIB 4WNNB 3MGSD 3REHC 1P3MC 4LD9B 1P3GC 4CSRA 5JRGC 3REJA 3AFAB 3AZGB 2NQBB 5B2IB 3KUYB 4XZQB 5AV9A 3W99A 1P3FC 5GT0A 5AV6A 3UT9D 1KX4D 2FJ7B 3AZIB 3VH5W 5B24B 1P3OD 3REKA 4Z66D 1P3LC 4YM6C 3MNNA 5G49A 3REHA 3TU4A 1P3MA 5B31D 2JSSA 1P3AD 1H3OB 1M19C 3C1BB 5CHLB 3B6FD 5B40D 5AV8C 3AZKB 3WAAB 4CSRB 5GSUD 5AVBC 1S32A 4CAYB 5DNNA 3UT9C 4H9PA 4YM6B 4KGCA 5AV9B 3B0DB 5CP6B 3W97D 3REKC 3AZJB 3WA9C 2FJ7A 1P3LA 2LY8A 1P3MB 1P3IA 1P34C 2PYOA 3AYWB 3W98A 1TZYA 5B2JC 3X1TD 3REHB 3NQJA 3LELC 3MGQA 5CPKD 1F66A 3A6NA 4WU9A 1S32C 5DNNB 4KGCB 5B0ZC 1TAFB 3AZIC 1Q9CA 2NQBD 1P34B 2NZDA 5JA4B 4Z66C 4H9QB 3AZFC 4G92C 4JJNB 3AV1A 5AV5C 3WA9A 5GXQB 5BO0B 3KWQC 4QLCB 2F8NH 3LJAB 4KUDD 3MGSA 2F8NB 5CPIA 3KXBA 4AWLC 4WU8D 3AZGA 3AZHD 4LD9A 5AV8B 3AN2B 5B0ZA 3A6NB 5B40B 4WU9B 1P3PC 4X23C 3AZFD 3AZJC 4WU8C 3WA9B 3X1UB 5AV6D 1KX4A 3WTPC 3O62A 5CP6C 2NZDD 5CP6D 3LJAA 3AZMC 3X1VB 3AZJD 3R45A 3LZ0B 1BH9B 3B6GB 3KXBC 5E5AB 5AVCD 3X1TC 2F8NA 3AZGC 3AZND 4LD9C 3MGPC 2YFWA 4H9OA 5B1LC 2CV5A 1P3GB 4XUJB 1R4VA 5B24C 3AZGD 3AZNC 3AZHA 1P3KD 1M1AB 5BS7A 3W96B 4Z5TC 3X1UA 5B32B 3LJAC 4UUZB 3AZEA 1P34D 2F8NK 1P3BC 2L5AA 2NQBC 1TZYB 5B24D 2HIOA 5B0ZD 3RELB 3X1TA 3R45B 4KUDB 4WNNA 5B1LD 5JRGD 4KHAA 1BH8A 3LELD 5CPKC 1F1EA 3C1BC 1HQ3B 1B67A 3AZHB 1P3KC 5B1MD 5GT0B 4H9QA 5AV9D 3W96A 3VH5T 4E45A 1P3OC 3MGRA 1P3MD 5AVBD 3AV2C 5AV8A 1P3FD 5GT3B 1KX5A 3C1BA 4J8WD 1M19D 3AZNB 5AV6C 4KUDC 5B40A 5BT1C 2CV5D 2PYOC 3W98C 5CPJA 1TZYC 5GXQC 5B2JA 5B0YA 4J8UC 4HGAC 1TZYD 3MVDA 5B31G 3MGRB 5AVBA 3V9RA 3C1CB 5C3IB 1BFMA 1M18A 4WU8B 5GT3A 1KX5B 4NE5A 5AV8D 5B40C 4Z66A 1HQ3D 4XUJA 5DNMB 1M1AA 3WA9D 5GSUA 5AY8D 3LZ1D 5AV6B 3AFAD 4JJNA 3B6FA 1P3BD 3AV2B 5F99A 3REKB 3LELA 3MGQC 3AZMB 4ZUXD 3B0DC 2HIOB 3RELA 3UTAC 3UT9B 2FJ7D 1M18C 3AZID 4J8VB 5AVCB 3W97A 3WTPD 2NZDC 5GT3D 5B31C 1P3AC 4J8WB 4WU8A 4X23D 4XUJC 5B1MC 1P3LD 1P3GD 1EQZB 3O62C 3C1BD 4YS3C 3MVDD 3WTPE 1ID3D 2BYMB 3VH6T 1KX3C 5BNVA 2CWEA 5C3IC 3KWQB 3RELC 3UTAA 4YM6D 1P3IB 3LZ0A 5AVCA 3B6GA 1B6WA 5E5AA 1KU5A 2CV5C 3AV1D 4R8PD 4YS3B 3NQJB 3MGQB 4J8VA 1U35C 1AOIC 5BT1D 3AZHC 3AZNA 4H9SA 3AYWD 2IO5C 3AZLB 1WWIA 4AWLB 5GT0D 5B0YB 3WKJB 2HIOC 3UTAB 5BO0A 5B2JD 1U35B 1AOIB 3MNNB 3TU4B 3X1VC 5AV9C 5AVBB 4J8XA 4QLCD 5BS7C 4J8VD 5B33C 3X1SC 3AN2A 4Z5TA 3X1UC 3B0CW 3WTPB 3NQUA 1P3BA 2NQBA 1A7WA 4YM6A 3B6FB 5DNMA 5GSUB 3MGRC 4G91B 3AZLC 3AV2A 3X1UD 2RVQC 2PYOB 3W98B 3KWQD 4NFTA 3B0BA 1P3ID 5DNNC 3UT9A 4KGCC 5AV5B 2AROC 3W99D 2HUEC 3LZ0D 3B6GD 1KX5D 3W96C 3KUYA 3UTBD 1S32B 3NQUB 5FUGA 5DNMC 5CPKB 3AZED 4CAYA 1P34A 5DNMD 5CPJC 5GXQA 2BYKA 4QLCA 3VH6W 5B0YD 1ZLAC 3W99C 5B2JB 1U35D 1AOID 3AZMD 3X1SB 5B32D 4KUDA 3V9RB 1BH8B 3AZKA 5AV5A 3WAAA 3REJB 3KUYC 5GSUC 5JRGB 3MGSC 1M19A 1EQZC 3B6FC 5F99C 5B31B
chains in the Genus database with same CATH superfamily
4WU9D 3A6ND 2F8NG 3WKJA 3F6TA 3MGPB 5GT3C 3EPHA 4J8XB 3H0MC 4Z5TB 4E44A 1KX4C 2FJ7C 1T3UA 3C1CC 3WTPA 3X1VD 4R8PB 4ZUXC 3KFUG 1P3IC 4Z2MH 1EQZA 2Y2GA 4H9NA 5JA4A 2Y2OA 4H9PB 5CPID 1JFIB 3A1IA 3WKJC 3MGPA 2IO5B 3UTBA 3LZ0C 3B6GC 1P3KB 1M1AD 5E5AC 4EO5C 3AZFA 3MNND 3TU4D 3AV1C 1F66D 3KUYD 4XZQD 2RVQD 4H9SC 1M18B 4YS3A 5BNXA 3RELD 5B0ZB 3AFAA 4JJND 5GXQD 4R8PA 1P3OB 1KX3A 3REJD 4Z66B 3VH6A 3REID 2JE5A 4WV4B 3O62B 5FUGB 4H9NB 5KDMA 2F8ND 4DRBA 5B32A 1JFIA 4G91C 5B1MB 3X1VA 5B33D 3AZKD 3WAAD 2ZY2A 1P3KA 5AY8B 3LZ1B 4J8XD 3KXBB 3X1SA 1PZRA 3P5JB 3AZFB 1P3AB 1WWSA 4KHAB 3W97B 4R8PC 1ID3A 2HIOD 4J8UB 4DRAA 1P3OA 3REIA 5JRGA 2ZY3A 1M19B 5B1LA 3AZEB 1P3PB 2DF4C 2BYMA 3REHD 4X23B 1KX5C 1P3LB 1EQZD 2AROD 5B33A 5DNND 4KGCD 4HGAB 3EPLA 3X1SD 2G5HC 3W96D 3MNNC 3TU4C 1M18D 3MGRD 4WZSB 3C1CD 3REJC 5B0YC 4J8UA 1ZLAD 4NE6A 5B32G 4YS3D 3MVDC 3MGQD 5CPKA 3O62D 4UUZA 5GT0C 5B1LB 5F99B 3AN2D 2AROA 3MGSB 5BNXB 3AV2D 4ZBJC 3KXBD 4ZUXB 2YFVB 4JJNC 5B2ID 3KSYA 4QLCC 5B2IC 1KX3B 4Z2MG 4J8UD 1F66C 1ZLAA 3A6NC 4WU9C 5KDMB 5CPJB 4ZBJB 5AY8A 3LZ1A 3WAAC 3MVDB 1BH9A 3AZKC 2AROB 4XUJD 3C1CA 4ZUXA 1F66B 1Z2CB 2YFWB 3B0CT 1HTAA 4M6BA 2CV5B 5B2IA 5AV5D 3REIB 3AZIA 3W99B 1P3PA 5AY8C 3LZ1C 2VQRA 3LELB 3AZLD 4X23A 1U35A 1AOIA 1N1JB 2W8SA 5G49B 3KWQA 2ZM5A 3X1TB 1M1AC 5B33B 3AYWC 4LD9D 3WKJD 3UTAD 4H9RA 5CPIC 4NE3A 1H3OA 4J8WA 1HQ3A 1P3BB 3UTBC 4XZQC 3REKD 1KX4B 5B32C 3W97C 1KX3D 4G92B 3AZJA 5B31A 1P3AA 4J8XC 1P3FB 1P3PD 5CP6A 3LJAD 5B1MA 3AN2C 3AYWA 5CPJD 3AZMA 3AFAC 1N1JA 4H9RB 3AZEC 4H9OB 4J8WC 1HQ3C 3MGPD 1P3GA 2PYOD 3W98D 1ID3B 3REIC 3AL0C 2YFVA 4XZQA 1TAFA 5AVCC 3AZLA 2HUEB 3VH5A 2NZDB 4Z5TD 4EO5B 1ZLAB 1P3FA 4J8VC 5B24A 2BYKB 4UPKA 3UTBB 3AV1B 5BNVB 1ULYA 1S32D 5F99D 5E5AD 2Y2KA 1ID3C 5CPIB 4WNNB 3MGSD 3REHC 1P3MC 4LD9B 1P3GC 4CSRA 5JRGC 3REJA 4WJ3C 3AFAB 2Y2JA 3AZGB 2NQBB 5B2IB 3KUYB 4XZQB 5AV9A 3W99A 1P3FC 5GT0A 5AV6A 3UT9D 1KX4D 2FJ7B 3AZIB 3VH5W 5B24B 1P3OD 3REKA 4Z66D 1P3LC 4YM6C 3MNNA 5G49A 3REHA 3TU4A 1P3MA 5B31D 2JSSA 1P3AD 2UWXA 1H3OB 1M19C 3C1BB 2Y2IA 5CHLB 3B6FD 5B40D 5AV8C 3AZKB 3WAAB 4CSRB 5GSUD 5AVBC 1S32A 4CAYB 5DNNA 2DQNC 4H9PA 4YM6B 3UT9C 4KGCA 5AV9B 3B0DB 5CP6B 3W97D 3REKC 3AZJB 3H0RC 3WA9C 2FJ7A 1P3LA 2LY8A 1P3MB 1P3IA 1P34C 2PYOA 3AYWB 3W98A 1TZYA 5B2JC 3X1TD 3REHB 3NQJA 3LELC 3MGQA 5CPKD 1F66A 3A6NA 4WU9A 1S32C 5DNNB 4KGCB 5B0ZC 1TAFB 3AZIC 1Q9CA 2NQBD 1P34B 2NZDA 5JA4B 4Z66C 4H9QB 3AZFC 2BG1A 4JJNB 4G92C 5AV5C 3AV1A 3WA9A 5GXQB 5BO0B 3KWQC 4QLCB 2F8NH 3LJAB 4KUDD 3MGSA 2F8NB 5CPIA 3KXBA 4AWLC 4WU8D 2XD5A 3AZGA 3AZHD 4LD9A 5AV8B 3AN2B 5B0ZA 3A6NB 5B40B 4WU9B 1P3PC 4X23C 3AZFD 3AZJC 4WU8C 3WA9B 3X1UB 5AV6D 1KX4A 3WTPC 3O62A 5CP6C 2ZY4A 2NZDD 2FFFB 5CP6D 3LJAA 3AZMC 2ZY5A 3X1VB 3AZJD 3R45A 3EG5B 3LZ0B 1BH9B 3B6GB 2JCHA 3KXBC 5E5AB 5AVCD 3X1TC 2F8NA 3AZGC 2Y2MA 3AZND 3MGPC 4LD9C 2YFWA 4H9OA 5B1LC 2CV5A 1P3GB 4XUJB 1R4VA 5B24C 3AZGD 3AZNC 3AZHA 1P3KD 1M1AB 5BS7A 3W96B 4Z5TC 3X1UA 5B32B 3LJAC 4UUZB 3AZEA 1P34D 2F8NK 1P3BC 2L5AA 2NQBC 1TZYB 5B24D 2HIOA 5B0ZD 3RELB 3X1TA 3R45B 4KUDB 4WNNA 5B1LD 3IP4C 5JRGD 4KHAA 1BH8A 3LELD 2Y2QA 5CPKC 1F1EA 3C1BC 1HQ3B 1B67A 3AZHB 1P3KC 5B1MD 2Y2LA 3EPJA 5GT0B 4H9QA 5AV9D 3W96A 3VH5T 4E45A 1P3OC 3MGRA 1P3MD 5AVBD 3AV2C 5AV8A 1P3FD 5GT3B 1KX5A 3C1BA 4J8WD 1M19D 3AZNB 5AV6C 2XD1A 4KUDC 5B40A 5BT1C 2CV5D 2G5IC 2PYOC 3W98C 5CPJA 1TZYC 5GXQC 5B2JA 2J8PA 5B0YA 4J8UC 4HGAC 1TZYD 3MVDA 5B31G 3MGRB 5AVBA 3FDDA 3V9RA 3C1CB 2F2AC 5C3IB 1BFMA 1M18A 4WU8B 5GT3A 1KX5B 4NE5A 5AV8D 5B40C 4Z66A 1HQ3D 4XUJA 5DNMB 1M1AA 3WA9D 5GSUA 5AY8D 3LZ1D 5AV6B 3EPKA 3AFAD 4JJNA 3B6FA 1P3BD 3AV2B 5F99A 3REKB 3LELA 3MGQC 3AZMB 4ZUXD 3B0DC 2HIOB 3RELA 3UTAC 3UT9B 2FJ7D 1M18C 3AZID 4J8VB 5AVCB 3W97A 3WTPD 2NZDC 5GT3D 5B31C 1P3AC 4J8WB 4WU8A 4X23D 4XUJC 5B1MC 1P3LD 1P3GD 1EQZB 3O62C 3C1BD 2Y2HA 4YS3C 3MVDD 3WTPE 1ID3D 2BYMB 3VH6T 1KX3C 3A1KA 5BNVA 2CWEA 5C3IC 3KWQB 3RELC 3UTAA 4YM6D 1P3IB 3LZ0A 5AVCA 3B6GA 1B6WA 5E5AA 1KU5A 2CV5C 3AV1D 4R8PD 4YS3B 3NQJB 3MGQB 4J8VA 2RIQA 1U35C 1AOIC 5BT1D 3AZHC 3AZNA 4H9SA 3AYWD 2IO5C 3AZLB 1WWIA 4AWLB 5GT0D 5B0YB 3WKJB 2HIOC 3UTAB 5BO0A 5B2JD 1U35B 1AOIB 3MNNB 3TU4B 3X1VC 5AV9C 5AVBB 4J8XA 4QLCD 5BS7C 4J8VD 5B33C 3X1SC 3AN2A 4Z5TA 3X1UC 3H0LC 3B0CW 3WTPB 3NQUA 1P3BA 2Y2NA 2NQBA 1A7WA 4YM6A 3B6FB 5DNMA 5GSUB 3MGRC 4G91B 3AZLC 3AV2A 3X1UD 2RVQC 2PYOB 3W98B 3KWQD 4NFTA 3B0BA 1P3ID 5DNNC 3UT9A 4KGCC 5AV5B 2AROC 3W99D 2HUEC 3LZ0D 3B6GD 1KX5D 3W96C 3KUYA 3UTBD 1S32B 3NQUB 5FUGA 5DNMC 5CPKB 3AZED 4CAYA 1P34A 5DNMD 5CPJC 5GXQA 2BYKA 4QLCA 3VH6W 5B0YD 1ZLAC 3W99C 5B2JB 1U35D 1AOID 3AZMD 3X1SB 5B32D 2Y2PA 4KUDA 3V9RB 1BH8B 3AZKA 5AV5A 3WAAA 3REJB 3KUYC 4DQYB 1W2EA 5GSUC 5JRGB 3MGSC 1M19A 1EQZC 3B6FC 5F99C 5B31B
chains in the Genus database with same CATH topology
4WU9D 3A6ND 2F8NG 3WKJA 3F6TA 3MGPB 5GT3C 3EPHA 4J8XB 3H0MC 4Z5TB 4E44A 1KX4C 2FJ7C 1T3UA 3C1CC 3WTPA 3X1VD 4R8PB 4ZUXC 3KFUG 1P3IC 4Z2MH 1EQZA 2Y2GA 4H9NA 5JA4A 2Y2OA 4H9PB 5CPID 1JFIB 3A1IA 3WKJC 3MGPA 2IO5B 3UTBA 3LZ0C 3B6GC 1P3KB 1M1AD 5E5AC 4EO5C 3AZFA 3MNND 3TU4D 3AV1C 1F66D 3KUYD 4XZQD 2RVQD 4H9SC 1M18B 4YS3A 5BNXA 3RELD 5B0ZB 3AFAA 4JJND 5GXQD 4R8PA 1P3OB 1KX3A 3REJD 4Z66B 3VH6A 3REID 2JE5A 4WV4B 3O62B 5FUGB 4H9NB 5KDMA 2F8ND 4DRBA 5B32A 1JFIA 4G91C 5B1MB 3X1VA 5B33D 3AZKD 3WAAD 2ZY2A 1P3KA 5AY8B 3LZ1B 4J8XD 3KXBB 3X1SA 1PZRA 3P5JB 3AZFB 1P3AB 1WWSA 4KHAB 3W97B 4R8PC 1ID3A 2HIOD 4J8UB 4DRAA 1P3OA 3REIA 5JRGA 2ZY3A 1M19B 5B1LA 3AZEB 1P3PB 2DF4C 2BYMA 3REHD 4X23B 1KX5C 1P3LB 1EQZD 2AROD 5B33A 5DNND 4KGCD 4HGAB 3EPLA 3X1SD 2G5HC 3W96D 3MNNC 3TU4C 1M18D 3MGRD 4WZSB 3C1CD 3REJC 5B0YC 4J8UA 1ZLAD 4NE6A 5B32G 4YS3D 3MVDC 3MGQD 5CPKA 3O62D 4UUZA 5GT0C 5B1LB 5F99B 3AN2D 2AROA 3MGSB 5BNXB 3AV2D 4ZBJC 3KXBD 4ZUXB 2YFVB 4JJNC 5B2ID 3KSYA 4QLCC 5B2IC 1KX3B 4Z2MG 4J8UD 1F66C 1ZLAA 3A6NC 4WU9C 5KDMB 5CPJB 4ZBJB 5AY8A 3LZ1A 3WAAC 3MVDB 1BH9A 3AZKC 2AROB 4XUJD 3C1CA 4ZUXA 1F66B 1Z2CB 2YFWB 3B0CT 1HTAA 4M6BA 2CV5B 5B2IA 5AV5D 3REIB 3AZIA 3W99B 1P3PA 5AY8C 3LZ1C 2VQRA 3LELB 3AZLD 4X23A 1U35A 1AOIA 1N1JB 2W8SA 5G49B 3KWQA 2ZM5A 3X1TB 1M1AC 5B33B 3AYWC 4LD9D 3WKJD 3UTAD 4H9RA 5CPIC 4NE3A 1H3OA 4J8WA 1HQ3A 1P3BB 3UTBC 4XZQC 3REKD 1KX4B 5B32C 3W97C 1KX3D 4G92B 3AZJA 5B31A 1P3AA 4J8XC 1P3FB 1P3PD 5CP6A 3LJAD 5B1MA 3AN2C 3AYWA 5CPJD 3AZMA 3AFAC 1N1JA 4H9RB 3AZEC 4H9OB 4J8WC 1HQ3C 3MGPD 1P3GA 2PYOD 3W98D 1ID3B 3REIC 3AL0C 2YFVA 4XZQA 1TAFA 5AVCC 3AZLA 2HUEB 3VH5A 2NZDB 4Z5TD 4EO5B 1ZLAB 1P3FA 4J8VC 5B24A 2BYKB 4UPKA 3UTBB 3AV1B 5BNVB 1ULYA 1S32D 5F99D 5E5AD 2Y2KA 1ID3C 5CPIB 4WNNB 3MGSD 3REHC 1P3MC 4LD9B 1P3GC 4CSRA 5JRGC 3REJA 4WJ3C 3AFAB 2Y2JA 3AZGB 2NQBB 5B2IB 3KUYB 4XZQB 5AV9A 3W99A 1P3FC 5GT0A 5AV6A 3UT9D 1KX4D 2FJ7B 3AZIB 3VH5W 5B24B 1P3OD 3REKA 4Z66D 1P3LC 4YM6C 3MNNA 5G49A 3REHA 3TU4A 1P3MA 5B31D 2JSSA 1P3AD 2UWXA 1H3OB 1M19C 3C1BB 2Y2IA 5CHLB 3B6FD 5B40D 5AV8C 3AZKB 3WAAB 4CSRB 5GSUD 5AVBC 1S32A 4CAYB 5DNNA 2DQNC 4H9PA 4YM6B 3UT9C 4KGCA 5AV9B 3B0DB 5CP6B 3W97D 3REKC 3AZJB 3H0RC 3WA9C 2FJ7A 1P3LA 2LY8A 1P3MB 1P3IA 1P34C 2PYOA 3AYWB 3W98A 1TZYA 5B2JC 3X1TD 3REHB 3NQJA 3LELC 3MGQA 5CPKD 1F66A 3A6NA 4WU9A 1S32C 5DNNB 4KGCB 5B0ZC 1TAFB 3AZIC 1Q9CA 2NQBD 1P34B 2NZDA 5JA4B 4Z66C 4H9QB 3AZFC 2BG1A 4JJNB 4G92C 5AV5C 3AV1A 3WA9A 5GXQB 5BO0B 3KWQC 4QLCB 2F8NH 3LJAB 4KUDD 3MGSA 2F8NB 5CPIA 3KXBA 4AWLC 4WU8D 2XD5A 3AZGA 3AZHD 4LD9A 5AV8B 3AN2B 5B0ZA 3A6NB 5B40B 4WU9B 1P3PC 4X23C 3AZFD 3AZJC 4WU8C 3WA9B 3X1UB 5AV6D 1KX4A 3WTPC 3O62A 5CP6C 2ZY4A 2NZDD 2FFFB 5CP6D 3LJAA 3AZMC 2ZY5A 3X1VB 3AZJD 3R45A 3EG5B 3LZ0B 1BH9B 3B6GB 2JCHA 3KXBC 5E5AB 5AVCD 3X1TC 2F8NA 3AZGC 2Y2MA 3AZND 3MGPC 4LD9C 2YFWA 4H9OA 5B1LC 2CV5A 1P3GB 4XUJB 1R4VA 5B24C 3AZGD 3AZNC 3AZHA 1P3KD 1M1AB 5BS7A 3W96B 4Z5TC 3X1UA 5B32B 3LJAC 4UUZB 3AZEA 1P34D 2F8NK 1P3BC 2L5AA 2NQBC 1TZYB 5B24D 2HIOA 5B0ZD 3RELB 3X1TA 3R45B 4KUDB 4WNNA 5B1LD 3IP4C 5JRGD 4KHAA 1BH8A 3LELD 2Y2QA 5CPKC 1F1EA 3C1BC 1HQ3B 1B67A 3AZHB 1P3KC 5B1MD 2Y2LA 3EPJA 5GT0B 4H9QA 5AV9D 3W96A 3VH5T 4E45A 1P3OC 3MGRA 1P3MD 5AVBD 3AV2C 5AV8A 1P3FD 5GT3B 1KX5A 3C1BA 4J8WD 1M19D 3AZNB 5AV6C 2XD1A 4KUDC 5B40A 5BT1C 2CV5D 2G5IC 2PYOC 3W98C 5CPJA 1TZYC 5GXQC 5B2JA 2J8PA 5B0YA 4J8UC 4HGAC 1TZYD 3MVDA 5B31G 3MGRB 5AVBA 3FDDA 3V9RA 3C1CB 2F2AC 5C3IB 1BFMA 1M18A 4WU8B 5GT3A 1KX5B 4NE5A 5AV8D 5B40C 4Z66A 1HQ3D 4XUJA 5DNMB 1M1AA 3WA9D 5GSUA 5AY8D 3LZ1D 5AV6B 3EPKA 3AFAD 4JJNA 3B6FA 1P3BD 3AV2B 5F99A 3REKB 3LELA 3MGQC 3AZMB 4ZUXD 3B0DC 2HIOB 3RELA 3UTAC 3UT9B 2FJ7D 1M18C 3AZID 4J8VB 5AVCB 3W97A 3WTPD 2NZDC 5GT3D 5B31C 1P3AC 4J8WB 4WU8A 4X23D 4XUJC 5B1MC 1P3LD 1P3GD 1EQZB 3O62C 3C1BD 2Y2HA 4YS3C 3MVDD 3WTPE 1ID3D 2BYMB 3VH6T 1KX3C 3A1KA 5BNVA 2CWEA 5C3IC 3KWQB 3RELC 3UTAA 4YM6D 1P3IB 3LZ0A 5AVCA 3B6GA 1B6WA 5E5AA 1KU5A 2CV5C 3AV1D 4R8PD 4YS3B 3NQJB 3MGQB 4J8VA 2RIQA 1U35C 1AOIC 5BT1D 3AZHC 3AZNA 4H9SA 3AYWD 2IO5C 3AZLB 1WWIA 4AWLB 5GT0D 5B0YB 3WKJB 2HIOC 3UTAB 5BO0A 5B2JD 1U35B 1AOIB 3MNNB 3TU4B 3X1VC 5AV9C 5AVBB 4J8XA 4QLCD 5BS7C 4J8VD 5B33C 3X1SC 3AN2A 4Z5TA 3X1UC 3H0LC 3B0CW 3WTPB 3NQUA 1P3BA 2Y2NA 2NQBA 1A7WA 4YM6A 3B6FB 5DNMA 5GSUB 3MGRC 4G91B 3AZLC 3AV2A 3X1UD 2RVQC 2PYOB 3W98B 3KWQD 4NFTA 3B0BA 1P3ID 5DNNC 3UT9A 4KGCC 5AV5B 2AROC 3W99D 2HUEC 3LZ0D 3B6GD 1KX5D 3W96C 3KUYA 3UTBD 1S32B 3NQUB 5FUGA 5DNMC 5CPKB 3AZED 4CAYA 1P34A 5DNMD 5CPJC 5GXQA 2BYKA 4QLCA 3VH6W 5B0YD 1ZLAC 3W99C 5B2JB 1U35D 1AOID 3AZMD 3X1SB 5B32D 2Y2PA 4KUDA 3V9RB 1BH8B 3AZKA 5AV5A 3WAAA 3REJB 3KUYC 4DQYB 1W2EA 5GSUC 5JRGB 3MGSC 1M19A 1EQZC 3B6FC 5F99C 5B31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 D;  3A6N D;  2F8N G;  3WKJ A;  3MGP B;  5GT3 C;  4J8X B;  4Z5T B;  4E44 A;  1KX4 C;  2FJ7 C;  3C1C C;  3WTP A;  3X1V D;  4R8P B;  4ZUX C;  1P3I C;  4Z2M H;  1EQZ A;  4H9N A;  5JA4 A;  4H9P B;  5CPI D;  1JFI B;  3WKJ C;  3MGP A;  2IO5 B;  3UTB A;  3LZ0 C;  3B6G C;  1P3K B;  1M1A D;  5E5A C;  4EO5 C;  3AZF A;  3MNN D;  3TU4 D;  3AV1 C;  1F66 D;  3KUY D;  4XZQ D;  2RVQ D;  4H9S C;  1M18 B;  4YS3 A;  5BNX A;  3REL D;  5B0Z B;  3AFA A;  4JJN D;  5GXQ D;  4R8P A;  1P3O B;  1KX3 A;  3REJ D;  4Z66 B;  3VH6 A;  3REI D;  4WV4 B;  3O62 B;  5FUG B;  4H9N B;  5KDM A;  2F8N D;  4DRB A;  5B32 A;  1JFI A;  4G91 C;  5B1M B;  3X1V A;  5B33 D;  3AZK D;  3WAA D;  1P3K A;  5AY8 B;  3LZ1 B;  4J8X D;  3KXB B;  3X1S A;  3AZF B;  1P3A B;  1WWS A;  4KHA B;  3W97 B;  4R8P C;  1ID3 A;  2HIO D;  4J8U B;  4DRA A;  1P3O A;  3REI A;  5JRG A;  1M19 B;  5B1L A;  3AZE B;  1P3P B;  3REH D;  2BYM A;  4X23 B;  1KX5 C;  1P3L B;  1EQZ D;  2ARO D;  5B33 A;  5DNN D;  4KGC D;  4HGA B;  3X1S D;  3W96 D;  3MNN C;  3TU4 C;  1M18 D;  3MGR D;  4WZS B;  3C1C D;  3REJ C;  5B0Y C;  4J8U A;  1ZLA D;  4NE6 A;  5B32 G;  4YS3 D;  3MVD C;  3MGQ D;  5CPK A;  3O62 D;  4UUZ A;  5GT0 C;  5B1L B;  5F99 B;  3AN2 D;  2ARO A;  3MGS B;  5BNX B;  3AV2 D;  4ZBJ C;  3KXB D;  4ZUX B;  2YFV B;  4JJN C;  5B2I D;  3KSY A;  4QLC C;  5B2I C;  1KX3 B;  4Z2M G;  4J8U D;  1F66 C;  1ZLA A;  3A6N C;  4WU9 C;  5KDM B;  5CPJ B;  4ZBJ B;  5AY8 A;  3LZ1 A;  3WAA C;  3MVD B;  1BH9 A;  3AZK C;  2ARO B;  4XUJ D;  3C1C A;  4ZUX A;  1F66 B;  2YFW B;  3B0C T;  1HTA A;  4M6B A;  2CV5 B;  5B2I A;  5AV5 D;  3REI B;  3AZI A;  3W99 B;  1P3P A;  5AY8 C;  3LZ1 C;  3LEL B;  3AZL D;  4X23 A;  1U35 A;  1AOI A;  1N1J B;  5G49 B;  3KWQ A;  3X1T B;  1M1A C;  5B33 B;  3AYW C;  4LD9 D;  3WKJ D;  3UTA D;  4H9R A;  5CPI C;  4NE3 A;  1H3O A;  4J8W A;  1HQ3 A;  1P3B B;  3UTB C;  4XZQ C;  3REK D;  1KX4 B;  5B32 C;  3W97 C;  1KX3 D;  4G92 B;  3AZJ A;  5B31 A;  1P3A A;  4J8X C;  1P3F B;  1P3P D;  5CP6 A;  3LJA D;  5B1M A;  3AN2 C;  3AYW A;  5CPJ D;  3AZM A;  3AFA C;  1N1J A;  4H9R B;  3AZE C;  4H9O B;  4J8W C;  1HQ3 C;  3MGP D;  1P3G A;  2PYO D;  3W98 D;  1ID3 B;  3REI C;  2YFV A;  4XZQ A;  1TAF A;  5AVC C;  3AZL A;  2HUE B;  3VH5 A;  2NZD B;  4Z5T D;  4EO5 B;  1ZLA B;  1P3F A;  4J8V C;  5B24 A;  2BYK B;  3UTB B;  3AV1 B;  5BNV B;  1ULY A;  1S32 D;  5F99 D;  5E5A D;  1ID3 C;  5CPI B;  4WNN B;  3MGS D;  3REH C;  1P3M C;  4LD9 B;  1P3G C;  4CSR A;  5JRG C;  3REJ A;  3AFA B;  3AZG B;  2NQB B;  5B2I B;  3KUY B;  4XZQ B;  5AV9 A;  3W99 A;  1P3F C;  5GT0 A;  5AV6 A;  3UT9 D;  1KX4 D;  2FJ7 B;  3AZI B;  3VH5 W;  5B24 B;  1P3O D;  3REK A;  4Z66 D;  1P3L C;  4YM6 C;  3MNN A;  5G49 A;  3REH A;  3TU4 A;  1P3M A;  5B31 D;  2JSS A;  1P3A D;  1H3O B;  1M19 C;  3C1B B;  5CHL B;  3B6F D;  5B40 D;  5AV8 C;  3AZK B;  3WAA B;  4CSR B;  5GSU D;  5AVB C;  1S32 A;  4CAY B;  5DNN A;  3UT9 C;  4H9P A;  4YM6 B;  4KGC A;  5AV9 B;  3B0D B;  5CP6 B;  3W97 D;  3REK C;  3AZJ B;  3WA9 C;  2FJ7 A;  1P3L A;  2LY8 A;  1P3M B;  1P3I A;  1P34 C;  2PYO A;  3AYW B;  3W98 A;  1TZY A;  5B2J C;  3X1T D;  3REH B;  3NQJ A;  3LEL C;  3MGQ A;  5CPK D;  1F66 A;  3A6N A;  4WU9 A;  1S32 C;  5DNN B;  4KGC B;  5B0Z C;  1TAF B;  3AZI C;  1Q9C A;  2NQB D;  1P34 B;  2NZD A;  5JA4 B;  4Z66 C;  4H9Q B;  3AZF C;  4G92 C;  4JJN B;  3AV1 A;  5AV5 C;  3WA9 A;  5GXQ B;  5BO0 B;  3KWQ C;  4QLC B;  2F8N H;  3LJA B;  4KUD D;  3MGS A;  2F8N B;  5CPI A;  3KXB A;  4AWL C;  4WU8 D;  3AZG A;  3AZH D;  4LD9 A;  5AV8 B;  3AN2 B;  5B0Z A;  3A6N B;  5B40 B;  4WU9 B;  1P3P C;  4X23 C;  3AZF D;  3AZJ C;  4WU8 C;  3WA9 B;  3X1U B;  5AV6 D;  1KX4 A;  3WTP C;  3O62 A;  5CP6 C;  2NZD D;  5CP6 D;  3LJA A;  3AZM C;  3X1V B;  3AZJ D;  3R45 A;  3LZ0 B;  1BH9 B;  3B6G B;  3KXB C;  5E5A B;  5AVC D;  3X1T C;  2F8N A;  3AZG C;  3AZN D;  4LD9 C;  3MGP C;  2YFW A;  4H9O A;  5B1L C;  2CV5 A;  1P3G B;  4XUJ B;  1R4V A;  5B24 C;  3AZG D;  3AZN C;  3AZH A;  1P3K D;  1M1A B;  5BS7 A;  3W96 B;  4Z5T C;  3X1U A;  5B32 B;  3LJA C;  4UUZ B;  3AZE A;  1P34 D;  2F8N K;  1P3B C;  2L5A A;  2NQB C;  1TZY B;  5B24 D;  2HIO A;  5B0Z D;  3REL B;  3X1T A;  3R45 B;  4KUD B;  4WNN A;  5B1L D;  5JRG D;  4KHA A;  1BH8 A;  3LEL D;  5CPK C;  1F1E A;  3C1B C;  1HQ3 B;  1B67 A;  3AZH B;  1P3K C;  5B1M D;  5GT0 B;  4H9Q A;  5AV9 D;  3W96 A;  3VH5 T;  4E45 A;  1P3O C;  3MGR A;  1P3M D;  5AVB D;  3AV2 C;  5AV8 A;  1P3F D;  5GT3 B;  1KX5 A;  3C1B A;  4J8W D;  1M19 D;  3AZN B;  5AV6 C;  4KUD C;  5B40 A;  5BT1 C;  2CV5 D;  2PYO C;  3W98 C;  5CPJ A;  1TZY C;  5GXQ C;  5B2J A;  5B0Y A;  4J8U C;  4HGA C;  1TZY D;  3MVD A;  5B31 G;  3MGR B;  5AVB A;  3V9R A;  3C1C B;  5C3I B;  1BFM A;  1M18 A;  4WU8 B;  5GT3 A;  1KX5 B;  4NE5 A;  5AV8 D;  5B40 C;  4Z66 A;  1HQ3 D;  4XUJ A;  5DNM B;  1M1A A;  3WA9 D;  5GSU A;  5AY8 D;  3LZ1 D;  5AV6 B;  3AFA D;  4JJN A;  3B6F A;  1P3B D;  3AV2 B;  5F99 A;  3REK B;  3LEL A;  3MGQ C;  3AZM B;  4ZUX D;  3B0D C;  2HIO B;  3REL A;  3UTA C;  3UT9 B;  2FJ7 D;  1M18 C;  3AZI D;  4J8V B;  5AVC B;  3W97 A;  3WTP D;  2NZD C;  5GT3 D;  5B31 C;  1P3A C;  4J8W B;  4WU8 A;  4X23 D;  4XUJ C;  5B1M C;  1P3L D;  1P3G D;  1EQZ B;  3O62 C;  3C1B D;  4YS3 C;  3MVD D;  3WTP E;  1ID3 D;  2BYM B;  3VH6 T;  1KX3 C;  5BNV A;  2CWE A;  5C3I C;  3KWQ B;  3REL C;  3UTA A;  4YM6 D;  1P3I B;  3LZ0 A;  5AVC A;  3B6G A;  1B6W A;  5E5A A;  1KU5 A;  2CV5 C;  3AV1 D;  4R8P D;  4YS3 B;  3NQJ B;  3MGQ B;  4J8V A;  1U35 C;  1AOI C;  5BT1 D;  3AZH C;  3AZN A;  4H9S A;  3AYW D;  2IO5 C;  3AZL B;  1WWI A;  4AWL B;  5GT0 D;  5B0Y B;  3WKJ B;  2HIO C;  3UTA B;  5BO0 A;  5B2J D;  1U35 B;  1AOI B;  3MNN B;  3TU4 B;  3X1V C;  5AV9 C;  5AVB B;  4J8X A;  4QLC D;  5BS7 C;  4J8V D;  5B33 C;  3X1S C;  3AN2 A;  4Z5T A;  3X1U C;  3B0C W;  3WTP B;  3NQU A;  1P3B A;  2NQB A;  1A7W A;  4YM6 A;  3B6F B;  5DNM A;  5GSU B;  3MGR C;  4G91 B;  3AZL C;  3AV2 A;  3X1U D;  2RVQ C;  2PYO B;  3W98 B;  3KWQ D;  4NFT A;  3B0B A;  1P3I D;  5DNN C;  3UT9 A;  4KGC C;  5AV5 B;  2ARO C;  3W99 D;  2HUE C;  3LZ0 D;  3B6G D;  1KX5 D;  3W96 C;  3KUY A;  3UTB D;  1S32 B;  3NQU B;  5FUG A;  5DNM C;  5CPK B;  3AZE D;  4CAY A;  1P34 A;  5DNM D;  5CPJ C;  5GXQ A;  2BYK A;  4QLC A;  3VH6 W;  5B0Y D;  1ZLA C;  3W99 C;  5B2J B;  1U35 D;  1AOI D;  3AZM D;  3X1S B;  5B32 D;  4KUD A;  3V9R B;  1BH8 B;  3AZK A;  5AV5 A;  3WAA A;  3REJ B;  3KUY C;  5GSU C;  5JRG B;  3MGS C;  1M19 A;  1EQZ C;  3B6F C;  5F99 C;  5B31 B; 
#chains in the Genus database with same CATH topology
 4WU9 D;  3A6N D;  2F8N G;  3WKJ A;  3F6T A;  3MGP B;  5GT3 C;  3EPH A;  4J8X B;  3H0M C;  4Z5T B;  4E44 A;  1KX4 C;  2FJ7 C;  1T3U A;  3C1C C;  3WTP A;  3X1V D;  4R8P B;  4ZUX C;  3KFU G;  1P3I C;  4Z2M H;  1EQZ A;  2Y2G A;  4H9N A;  5JA4 A;  2Y2O A;  4H9P B;  5CPI D;  1JFI B;  3A1I A;  3WKJ C;  3MGP A;  2IO5 B;  3UTB A;  3LZ0 C;  3B6G C;  1P3K B;  1M1A D;  5E5A C;  4EO5 C;  3AZF A;  3MNN D;  3TU4 D;  3AV1 C;  1F66 D;  3KUY D;  4XZQ D;  2RVQ D;  4H9S C;  1M18 B;  4YS3 A;  5BNX A;  3REL D;  5B0Z B;  3AFA A;  4JJN D;  5GXQ D;  4R8P A;  1P3O B;  1KX3 A;  3REJ D;  4Z66 B;  3VH6 A;  3REI D;  2JE5 A;  4WV4 B;  3O62 B;  5FUG B;  4H9N B;  5KDM A;  2F8N D;  4DRB A;  5B32 A;  1JFI A;  4G91 C;  5B1M B;  3X1V A;  5B33 D;  3AZK D;  3WAA D;  2ZY2 A;  1P3K A;  5AY8 B;  3LZ1 B;  4J8X D;  3KXB B;  3X1S A;  1PZR A;  3P5J B;  3AZF B;  1P3A B;  1WWS A;  4KHA B;  3W97 B;  4R8P C;  1ID3 A;  2HIO D;  4J8U B;  4DRA A;  1P3O A;  3REI A;  5JRG A;  2ZY3 A;  1M19 B;  5B1L A;  3AZE B;  1P3P B;  2DF4 C;  2BYM A;  3REH D;  4X23 B;  1KX5 C;  1P3L B;  1EQZ D;  2ARO D;  5B33 A;  5DNN D;  4KGC D;  4HGA B;  3EPL A;  3X1S D;  2G5H C;  3W96 D;  3MNN C;  3TU4 C;  1M18 D;  3MGR D;  4WZS B;  3C1C D;  3REJ C;  5B0Y C;  4J8U A;  1ZLA D;  4NE6 A;  5B32 G;  4YS3 D;  3MVD C;  3MGQ D;  5CPK A;  3O62 D;  4UUZ A;  5GT0 C;  5B1L B;  5F99 B;  3AN2 D;  2ARO A;  3MGS B;  5BNX B;  3AV2 D;  4ZBJ C;  3KXB D;  4ZUX B;  2YFV B;  4JJN C;  5B2I D;  3KSY A;  4QLC C;  5B2I C;  1KX3 B;  4Z2M G;  4J8U D;  1F66 C;  1ZLA A;  3A6N C;  4WU9 C;  5KDM B;  5CPJ B;  4ZBJ B;  5AY8 A;  3LZ1 A;  3WAA C;  3MVD B;  1BH9 A;  3AZK C;  2ARO B;  4XUJ D;  3C1C A;  4ZUX A;  1F66 B;  1Z2C B;  2YFW B;  3B0C T;  1HTA A;  4M6B A;  2CV5 B;  5B2I A;  5AV5 D;  3REI B;  3AZI A;  3W99 B;  1P3P A;  5AY8 C;  3LZ1 C;  2VQR A;  3LEL B;  3AZL D;  4X23 A;  1U35 A;  1AOI A;  1N1J B;  2W8S A;  5G49 B;  3KWQ A;  2ZM5 A;  3X1T B;  1M1A C;  5B33 B;  3AYW C;  4LD9 D;  3WKJ D;  3UTA D;  4H9R A;  5CPI C;  4NE3 A;  1H3O A;  4J8W A;  1HQ3 A;  1P3B B;  3UTB C;  4XZQ C;  3REK D;  1KX4 B;  5B32 C;  3W97 C;  1KX3 D;  4G92 B;  3AZJ A;  5B31 A;  1P3A A;  4J8X C;  1P3F B;  1P3P D;  5CP6 A;  3LJA D;  5B1M A;  3AN2 C;  3AYW A;  5CPJ D;  3AZM A;  3AFA C;  1N1J A;  4H9R B;  3AZE C;  4H9O B;  4J8W C;  1HQ3 C;  3MGP D;  1P3G A;  2PYO D;  3W98 D;  1ID3 B;  3REI C;  3AL0 C;  2YFV A;  4XZQ A;  1TAF A;  5AVC C;  3AZL A;  2HUE B;  3VH5 A;  2NZD B;  4Z5T D;  4EO5 B;  1ZLA B;  1P3F A;  4J8V C;  5B24 A;  2BYK B;  4UPK A;  3UTB B;  3AV1 B;  5BNV B;  1ULY A;  1S32 D;  5F99 D;  5E5A D;  2Y2K A;  1ID3 C;  5CPI B;  4WNN B;  3MGS D;  3REH C;  1P3M C;  4LD9 B;  1P3G C;  4CSR A;  5JRG C;  3REJ A;  4WJ3 C;  3AFA B;  2Y2J A;  3AZG B;  2NQB B;  5B2I B;  3KUY B;  4XZQ B;  5AV9 A;  3W99 A;  1P3F C;  5GT0 A;  5AV6 A;  3UT9 D;  1KX4 D;  2FJ7 B;  3AZI B;  3VH5 W;  5B24 B;  1P3O D;  3REK A;  4Z66 D;  1P3L C;  4YM6 C;  3MNN A;  5G49 A;  3REH A;  3TU4 A;  1P3M A;  5B31 D;  2JSS A;  1P3A D;  2UWX A;  1H3O B;  1M19 C;  3C1B B;  2Y2I A;  5CHL B;  3B6F D;  5B40 D;  5AV8 C;  3AZK B;  3WAA B;  4CSR B;  5GSU D;  5AVB C;  1S32 A;  4CAY B;  5DNN A;  2DQN C;  4H9P A;  4YM6 B;  3UT9 C;  4KGC A;  5AV9 B;  3B0D B;  5CP6 B;  3W97 D;  3REK C;  3AZJ B;  3H0R C;  3WA9 C;  2FJ7 A;  1P3L A;  2LY8 A;  1P3M B;  1P3I A;  1P34 C;  2PYO A;  3AYW B;  3W98 A;  1TZY A;  5B2J C;  3X1T D;  3REH B;  3NQJ A;  3LEL C;  3MGQ A;  5CPK D;  1F66 A;  3A6N A;  4WU9 A;  1S32 C;  5DNN B;  4KGC B;  5B0Z C;  1TAF B;  3AZI C;  1Q9C A;  2NQB D;  1P34 B;  2NZD A;  5JA4 B;  4Z66 C;  4H9Q B;  3AZF C;  2BG1 A;  4JJN B;  4G92 C;  5AV5 C;  3AV1 A;  3WA9 A;  5GXQ B;  5BO0 B;  3KWQ C;  4QLC B;  2F8N H;  3LJA B;  4KUD D;  3MGS A;  2F8N B;  5CPI A;  3KXB A;  4AWL C;  4WU8 D;  2XD5 A;  3AZG A;  3AZH D;  4LD9 A;  5AV8 B;  3AN2 B;  5B0Z A;  3A6N B;  5B40 B;  4WU9 B;  1P3P C;  4X23 C;  3AZF D;  3AZJ C;  4WU8 C;  3WA9 B;  3X1U B;  5AV6 D;  1KX4 A;  3WTP C;  3O62 A;  5CP6 C;  2ZY4 A;  2NZD D;  2FFF B;  5CP6 D;  3LJA A;  3AZM C;  2ZY5 A;  3X1V B;  3AZJ D;  3R45 A;  3EG5 B;  3LZ0 B;  1BH9 B;  3B6G B;  2JCH A;  3KXB C;  5E5A B;  5AVC D;  3X1T C;  2F8N A;  3AZG C;  2Y2M A;  3AZN D;  3MGP C;  4LD9 C;  2YFW A;  4H9O A;  5B1L C;  2CV5 A;  1P3G B;  4XUJ B;  1R4V A;  5B24 C;  3AZG D;  3AZN C;  3AZH A;  1P3K D;  1M1A B;  5BS7 A;  3W96 B;  4Z5T C;  3X1U A;  5B32 B;  3LJA C;  4UUZ B;  3AZE A;  1P34 D;  2F8N K;  1P3B C;  2L5A A;  2NQB C;  1TZY B;  5B24 D;  2HIO A;  5B0Z D;  3REL B;  3X1T A;  3R45 B;  4KUD B;  4WNN A;  5B1L D;  3IP4 C;  5JRG D;  4KHA A;  1BH8 A;  3LEL D;  2Y2Q A;  5CPK C;  1F1E A;  3C1B C;  1HQ3 B;  1B67 A;  3AZH B;  1P3K C;  5B1M D;  2Y2L A;  3EPJ A;  5GT0 B;  4H9Q A;  5AV9 D;  3W96 A;  3VH5 T;  4E45 A;  1P3O C;  3MGR A;  1P3M D;  5AVB D;  3AV2 C;  5AV8 A;  1P3F D;  5GT3 B;  1KX5 A;  3C1B A;  4J8W D;  1M19 D;  3AZN B;  5AV6 C;  2XD1 A;  4KUD C;  5B40 A;  5BT1 C;  2CV5 D;  2G5I C;  2PYO C;  3W98 C;  5CPJ A;  1TZY C;  5GXQ C;  5B2J A;  2J8P A;  5B0Y A;  4J8U C;  4HGA C;  1TZY D;  3MVD A;  5B31 G;  3MGR B;  5AVB A;  3FDD A;  3V9R A;  3C1C B;  2F2A C;  5C3I B;  1BFM A;  1M18 A;  4WU8 B;  5GT3 A;  1KX5 B;  4NE5 A;  5AV8 D;  5B40 C;  4Z66 A;  1HQ3 D;  4XUJ A;  5DNM B;  1M1A A;  3WA9 D;  5GSU A;  5AY8 D;  3LZ1 D;  5AV6 B;  3EPK A;  3AFA D;  4JJN A;  3B6F A;  1P3B D;  3AV2 B;  5F99 A;  3REK B;  3LEL A;  3MGQ C;  3AZM B;  4ZUX D;  3B0D C;  2HIO B;  3REL A;  3UTA C;  3UT9 B;  2FJ7 D;  1M18 C;  3AZI D;  4J8V B;  5AVC B;  3W97 A;  3WTP D;  2NZD C;  5GT3 D;  5B31 C;  1P3A C;  4J8W B;  4WU8 A;  4X23 D;  4XUJ C;  5B1M C;  1P3L D;  1P3G D;  1EQZ B;  3O62 C;  3C1B D;  2Y2H A;  4YS3 C;  3MVD D;  3WTP E;  1ID3 D;  2BYM B;  3VH6 T;  1KX3 C;  3A1K A;  5BNV A;  2CWE A;  5C3I C;  3KWQ B;  3REL C;  3UTA A;  4YM6 D;  1P3I B;  3LZ0 A;  5AVC A;  3B6G A;  1B6W A;  5E5A A;  1KU5 A;  2CV5 C;  3AV1 D;  4R8P D;  4YS3 B;  3NQJ B;  3MGQ B;  4J8V A;  2RIQ A;  1U35 C;  1AOI C;  5BT1 D;  3AZH C;  3AZN A;  4H9S A;  3AYW D;  2IO5 C;  3AZL B;  1WWI A;  4AWL B;  5GT0 D;  5B0Y B;  3WKJ B;  2HIO C;  3UTA B;  5BO0 A;  5B2J D;  1U35 B;  1AOI B;  3MNN B;  3TU4 B;  3X1V C;  5AV9 C;  5AVB B;  4J8X A;  4QLC D;  5BS7 C;  4J8V D;  5B33 C;  3X1S C;  3AN2 A;  4Z5T A;  3X1U C;  3H0L C;  3B0C W;  3WTP B;  3NQU A;  1P3B A;  2Y2N A;  2NQB A;  1A7W A;  4YM6 A;  3B6F B;  5DNM A;  5GSU B;  3MGR C;  4G91 B;  3AZL C;  3AV2 A;  3X1U D;  2RVQ C;  2PYO B;  3W98 B;  3KWQ D;  4NFT A;  3B0B A;  1P3I D;  5DNN C;  3UT9 A;  4KGC C;  5AV5 B;  2ARO C;  3W99 D;  2HUE C;  3LZ0 D;  3B6G D;  1KX5 D;  3W96 C;  3KUY A;  3UTB D;  1S32 B;  3NQU B;  5FUG A;  5DNM C;  5CPK B;  3AZE D;  4CAY A;  1P34 A;  5DNM D;  5CPJ C;  5GXQ A;  2BYK A;  4QLC A;  3VH6 W;  5B0Y D;  1ZLA C;  3W99 C;  5B2J B;  1U35 D;  1AOI D;  3AZM D;  3X1S B;  5B32 D;  2Y2P A;  4KUD A;  3V9R B;  1BH8 B;  3AZK A;  5AV5 A;  3WAA A;  3REJ B;  3KUY C;  4DQY B;  1W2E A;  5GSU C;  5JRG B;  3MGS C;  1M19 A;  1EQZ C;  3B6F C;  5F99 C;  5B31 B; 
#chains in the Genus database with same CATH homology
 4WU9 D;  3A6N D;  2F8N G;  3WKJ A;  3F6T A;  3MGP B;  5GT3 C;  3EPH A;  4J8X B;  3H0M C;  4Z5T B;  4E44 A;  1KX4 C;  2FJ7 C;  1T3U A;  3C1C C;  3WTP A;  3X1V D;  4R8P B;  4ZUX C;  3KFU G;  1P3I C;  4Z2M H;  1EQZ A;  2Y2G A;  4H9N A;  5JA4 A;  2Y2O A;  4H9P B;  5CPI D;  1JFI B;  3A1I A;  3WKJ C;  3MGP A;  2IO5 B;  3UTB A;  3LZ0 C;  3B6G C;  1P3K B;  1M1A D;  5E5A C;  4EO5 C;  3AZF A;  3MNN D;  3TU4 D;  3AV1 C;  1F66 D;  3KUY D;  4XZQ D;  2RVQ D;  4H9S C;  1M18 B;  4YS3 A;  5BNX A;  3REL D;  5B0Z B;  3AFA A;  4JJN D;  5GXQ D;  4R8P A;  1P3O B;  1KX3 A;  3REJ D;  4Z66 B;  3VH6 A;  3REI D;  2JE5 A;  4WV4 B;  3O62 B;  5FUG B;  4H9N B;  5KDM A;  2F8N D;  4DRB A;  5B32 A;  1JFI A;  4G91 C;  5B1M B;  3X1V A;  5B33 D;  3AZK D;  3WAA D;  2ZY2 A;  1P3K A;  5AY8 B;  3LZ1 B;  4J8X D;  3KXB B;  3X1S A;  1PZR A;  3P5J B;  3AZF B;  1P3A B;  1WWS A;  4KHA B;  3W97 B;  4R8P C;  1ID3 A;  2HIO D;  4J8U B;  4DRA A;  1P3O A;  3REI A;  5JRG A;  2ZY3 A;  1M19 B;  5B1L A;  3AZE B;  1P3P B;  2DF4 C;  2BYM A;  3REH D;  4X23 B;  1KX5 C;  1P3L B;  1EQZ D;  2ARO D;  5B33 A;  5DNN D;  4KGC D;  4HGA B;  3EPL A;  3X1S D;  2G5H C;  3W96 D;  3MNN C;  3TU4 C;  1M18 D;  3MGR D;  4WZS B;  3C1C D;  3REJ C;  5B0Y C;  4J8U A;  1ZLA D;  4NE6 A;  5B32 G;  4YS3 D;  3MVD C;  3MGQ D;  5CPK A;  3O62 D;  4UUZ A;  5GT0 C;  5B1L B;  5F99 B;  3AN2 D;  2ARO A;  3MGS B;  5BNX B;  3AV2 D;  4ZBJ C;  3KXB D;  4ZUX B;  2YFV B;  4JJN C;  5B2I D;  3KSY A;  4QLC C;  5B2I C;  1KX3 B;  4Z2M G;  4J8U D;  1F66 C;  1ZLA A;  3A6N C;  4WU9 C;  5KDM B;  5CPJ B;  4ZBJ B;  5AY8 A;  3LZ1 A;  3WAA C;  3MVD B;  1BH9 A;  3AZK C;  2ARO B;  4XUJ D;  3C1C A;  4ZUX A;  1F66 B;  1Z2C B;  2YFW B;  3B0C T;  1HTA A;  4M6B A;  2CV5 B;  5B2I A;  5AV5 D;  3REI B;  3AZI A;  3W99 B;  1P3P A;  5AY8 C;  3LZ1 C;  2VQR A;  3LEL B;  3AZL D;  4X23 A;  1U35 A;  1AOI A;  1N1J B;  2W8S A;  5G49 B;  3KWQ A;  2ZM5 A;  3X1T B;  1M1A C;  5B33 B;  3AYW C;  4LD9 D;  3WKJ D;  3UTA D;  4H9R A;  5CPI C;  4NE3 A;  1H3O A;  4J8W A;  1HQ3 A;  1P3B B;  3UTB C;  4XZQ C;  3REK D;  1KX4 B;  5B32 C;  3W97 C;  1KX3 D;  4G92 B;  3AZJ A;  5B31 A;  1P3A A;  4J8X C;  1P3F B;  1P3P D;  5CP6 A;  3LJA D;  5B1M A;  3AN2 C;  3AYW A;  5CPJ D;  3AZM A;  3AFA C;  1N1J A;  4H9R B;  3AZE C;  4H9O B;  4J8W C;  1HQ3 C;  3MGP D;  1P3G A;  2PYO D;  3W98 D;  1ID3 B;  3REI C;  3AL0 C;  2YFV A;  4XZQ A;  1TAF A;  5AVC C;  3AZL A;  2HUE B;  3VH5 A;  2NZD B;  4Z5T D;  4EO5 B;  1ZLA B;  1P3F A;  4J8V C;  5B24 A;  2BYK B;  4UPK A;  3UTB B;  3AV1 B;  5BNV B;  1ULY A;  1S32 D;  5F99 D;  5E5A D;  2Y2K A;  1ID3 C;  5CPI B;  4WNN B;  3MGS D;  3REH C;  1P3M C;  4LD9 B;  1P3G C;  4CSR A;  5JRG C;  3REJ A;  4WJ3 C;  3AFA B;  2Y2J A;  3AZG B;  2NQB B;  5B2I B;  3KUY B;  4XZQ B;  5AV9 A;  3W99 A;  1P3F C;  5GT0 A;  5AV6 A;  3UT9 D;  1KX4 D;  2FJ7 B;  3AZI B;  3VH5 W;  5B24 B;  1P3O D;  3REK A;  4Z66 D;  1P3L C;  4YM6 C;  3MNN A;  5G49 A;  3REH A;  3TU4 A;  1P3M A;  5B31 D;  2JSS A;  1P3A D;  2UWX A;  1H3O B;  1M19 C;  3C1B B;  2Y2I A;  5CHL B;  3B6F D;  5B40 D;  5AV8 C;  3AZK B;  3WAA B;  4CSR B;  5GSU D;  5AVB C;  1S32 A;  4CAY B;  5DNN A;  2DQN C;  4H9P A;  4YM6 B;  3UT9 C;  4KGC A;  5AV9 B;  3B0D B;  5CP6 B;  3W97 D;  3REK C;  3AZJ B;  3H0R C;  3WA9 C;  2FJ7 A;  1P3L A;  2LY8 A;  1P3M B;  1P3I A;  1P34 C;  2PYO A;  3AYW B;  3W98 A;  1TZY A;  5B2J C;  3X1T D;  3REH B;  3NQJ A;  3LEL C;  3MGQ A;  5CPK D;  1F66 A;  3A6N A;  4WU9 A;  1S32 C;  5DNN B;  4KGC B;  5B0Z C;  1TAF B;  3AZI C;  1Q9C A;  2NQB D;  1P34 B;  2NZD A;  5JA4 B;  4Z66 C;  4H9Q B;  3AZF C;  2BG1 A;  4JJN B;  4G92 C;  5AV5 C;  3AV1 A;  3WA9 A;  5GXQ B;  5BO0 B;  3KWQ C;  4QLC B;  2F8N H;  3LJA B;  4KUD D;  3MGS A;  2F8N B;  5CPI A;  3KXB A;  4AWL C;  4WU8 D;  2XD5 A;  3AZG A;  3AZH D;  4LD9 A;  5AV8 B;  3AN2 B;  5B0Z A;  3A6N B;  5B40 B;  4WU9 B;  1P3P C;  4X23 C;  3AZF D;  3AZJ C;  4WU8 C;  3WA9 B;  3X1U B;  5AV6 D;  1KX4 A;  3WTP C;  3O62 A;  5CP6 C;  2ZY4 A;  2NZD D;  2FFF B;  5CP6 D;  3LJA A;  3AZM C;  2ZY5 A;  3X1V B;  3AZJ D;  3R45 A;  3EG5 B;  3LZ0 B;  1BH9 B;  3B6G B;  2JCH A;  3KXB C;  5E5A B;  5AVC D;  3X1T C;  2F8N A;  3AZG C;  2Y2M A;  3AZN D;  3MGP C;  4LD9 C;  2YFW A;  4H9O A;  5B1L C;  2CV5 A;  1P3G B;  4XUJ B;  1R4V A;  5B24 C;  3AZG D;  3AZN C;  3AZH A;  1P3K D;  1M1A B;  5BS7 A;  3W96 B;  4Z5T C;  3X1U A;  5B32 B;  3LJA C;  4UUZ B;  3AZE A;  1P34 D;  2F8N K;  1P3B C;  2L5A A;  2NQB C;  1TZY B;  5B24 D;  2HIO A;  5B0Z D;  3REL B;  3X1T A;  3R45 B;  4KUD B;  4WNN A;  5B1L D;  3IP4 C;  5JRG D;  4KHA A;  1BH8 A;  3LEL D;  2Y2Q A;  5CPK C;  1F1E A;  3C1B C;  1HQ3 B;  1B67 A;  3AZH B;  1P3K C;  5B1M D;  2Y2L A;  3EPJ A;  5GT0 B;  4H9Q A;  5AV9 D;  3W96 A;  3VH5 T;  4E45 A;  1P3O C;  3MGR A;  1P3M D;  5AVB D;  3AV2 C;  5AV8 A;  1P3F D;  5GT3 B;  1KX5 A;  3C1B A;  4J8W D;  1M19 D;  3AZN B;  5AV6 C;  2XD1 A;  4KUD C;  5B40 A;  5BT1 C;  2CV5 D;  2G5I C;  2PYO C;  3W98 C;  5CPJ A;  1TZY C;  5GXQ C;  5B2J A;  2J8P A;  5B0Y A;  4J8U C;  4HGA C;  1TZY D;  3MVD A;  5B31 G;  3MGR B;  5AVB A;  3FDD A;  3V9R A;  3C1C B;  2F2A C;  5C3I B;  1BFM A;  1M18 A;  4WU8 B;  5GT3 A;  1KX5 B;  4NE5 A;  5AV8 D;  5B40 C;  4Z66 A;  1HQ3 D;  4XUJ A;  5DNM B;  1M1A A;  3WA9 D;  5GSU A;  5AY8 D;  3LZ1 D;  5AV6 B;  3EPK A;  3AFA D;  4JJN A;  3B6F A;  1P3B D;  3AV2 B;  5F99 A;  3REK B;  3LEL A;  3MGQ C;  3AZM B;  4ZUX D;  3B0D C;  2HIO B;  3REL A;  3UTA C;  3UT9 B;  2FJ7 D;  1M18 C;  3AZI D;  4J8V B;  5AVC B;  3W97 A;  3WTP D;  2NZD C;  5GT3 D;  5B31 C;  1P3A C;  4J8W B;  4WU8 A;  4X23 D;  4XUJ C;  5B1M C;  1P3L D;  1P3G D;  1EQZ B;  3O62 C;  3C1B D;  2Y2H A;  4YS3 C;  3MVD D;  3WTP E;  1ID3 D;  2BYM B;  3VH6 T;  1KX3 C;  3A1K A;  5BNV A;  2CWE A;  5C3I C;  3KWQ B;  3REL C;  3UTA A;  4YM6 D;  1P3I B;  3LZ0 A;  5AVC A;  3B6G A;  1B6W A;  5E5A A;  1KU5 A;  2CV5 C;  3AV1 D;  4R8P D;  4YS3 B;  3NQJ B;  3MGQ B;  4J8V A;  2RIQ A;  1U35 C;  1AOI C;  5BT1 D;  3AZH C;  3AZN A;  4H9S A;  3AYW D;  2IO5 C;  3AZL B;  1WWI A;  4AWL B;  5GT0 D;  5B0Y B;  3WKJ B;  2HIO C;  3UTA B;  5BO0 A;  5B2J D;  1U35 B;  1AOI B;  3MNN B;  3TU4 B;  3X1V C;  5AV9 C;  5AVB B;  4J8X A;  4QLC D;  5BS7 C;  4J8V D;  5B33 C;  3X1S C;  3AN2 A;  4Z5T A;  3X1U C;  3H0L C;  3B0C W;  3WTP B;  3NQU A;  1P3B A;  2Y2N A;  2NQB A;  1A7W A;  4YM6 A;  3B6F B;  5DNM A;  5GSU B;  3MGR C;  4G91 B;  3AZL C;  3AV2 A;  3X1U D;  2RVQ C;  2PYO B;  3W98 B;  3KWQ D;  4NFT A;  3B0B A;  1P3I D;  5DNN C;  3UT9 A;  4KGC C;  5AV5 B;  2ARO C;  3W99 D;  2HUE C;  3LZ0 D;  3B6G D;  1KX5 D;  3W96 C;  3KUY A;  3UTB D;  1S32 B;  3NQU B;  5FUG A;  5DNM C;  5CPK B;  3AZE D;  4CAY A;  1P34 A;  5DNM D;  5CPJ C;  5GXQ A;  2BYK A;  4QLC A;  3VH6 W;  5B0Y D;  1ZLA C;  3W99 C;  5B2J B;  1U35 D;  1AOI D;  3AZM D;  3X1S B;  5B32 D;  2Y2P A;  4KUD A;  3V9R B;  1BH8 B;  3AZK A;  5AV5 A;  3WAA A;  3REJ B;  3KUY C;  4DQY B;  1W2E A;  5GSU C;  5JRG B;  3MGS C;  1M19 A;  1EQZ C;  3B6F C;  5F99 C;  5B31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...