5DNSA

T1428 loop variant in p3221
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTYPWGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords t1428 beta1 loop design
total genus 84
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 5dnsA00
3NB2A 2QYUA 3NAWA 2XTYA 2QZAA 4YC5A 2XTXA 3SY2A 3PSZA 4YFOA 3DU1X 4YCQA 2XT4A 2O6WA 3SQVA 5DNSA 2XT2A 2J8KA 2XTWA 4YEIA 4YDTA 3PSSA
chains in the Genus database with same CATH superfamily
4XN0A 2W7ZA 1VBLA 4XLAA 4XLCA 2VFMA 5AMVA 1KTWA 1QA1A 1O88A 2B0RA 4XLHA 3AK5A 1TYVA 2F3LA 2Z8GA 3BH6B 1AIRA 4XQFA 4XONA 2O17A 3DU1X 1EA0A 1OGMX 1QQ1A 2VBKA 3EQNA 4OJLA 1PLUA 1L1IA 1QRCA 1O8LA 1O8GA 4XLFA 1QA3A 3SQVA 4I84A 3LYCA 4XOTA 4OZZA 5DNSA 4XKVA 1K8FA 1JRGA 3PETA 4MR0A 2J8KA 3ZPPA 3B8YA 2XTWA 2INUA 4YZQA 2BX6A 2NT9A 4XN3A 3VSTA 3VSUA 1WMRA 4YZ0A 3BH7B 1KCDA 2EWEA 2VBEA 3GRHA 4YZAA 1TYWA 5C1EA 1IA5A 1EE6A 1OOCA 1HG8A 2XTYA 1BHEA 4XR6A 2BM7A 2NTBA 1XG2A 2G0YA 1IB4A 3P4GA 2XTXA 2ODLA 4XMYA 1TYUA 1EZGA 4OJ5A 4Z06A 3SYJA 4YELA 1PE9A 4Z05A 1QCXA 3KRGA 4YCQA 1GQ8A 4YZXA 4OM9A 2O6WA 2VFOA 4U49A 1X0CA 3SZEA 1O8MA 2NTPA 2PECA 1OFLA 1O8IA 1DBOA 3VMVA 2NZMA 5C1CA 4U4BA 2INVA 2QY1A 3ML3A 4EW9A 2PYGA 1K5CA 1OGOX 4W8RA 5JLVC 1OFMA 4V02C 3PSSA 1CZFA 2PYHA 3NAWA 3NB2A 1PXZA 1O8DA 4XOPA 2QXZA 4JRAC 3RIQA 3VMWA 1OFDA 1RWRA 2QZAA 2BM4A 5JMCB 1KCCA 1BN8A 2UVFA 2NT6A 3SY2A 3JX8A 3PSZA 4PMHA 3EQOA 1KQ5A 2V5IA 1QA2A 3GQ7A 2NSPA 4OJOA 1LLWA 1IDJA 4OZYA 4XKWA 4HWVA 4YFOA 2BM5A 4XLEA 1H80A 2XT4A 2VBMA 1QJVA 1NHCA 2QX3A 3B4NA 2X3HA 4YEJA 3GQ9A 2X6YA 3N6ZA 3VSVA 2XT2A 2NSTA 1JTAA 2BSPA 3GQ8A 3JURA 4OPWA 4YEIA 2BM6A 1TYXA 2IOUG 4XM3A 4Z03A 1QRBA 4C2LA 3N90A 2O0VA 1O8FA 2VFPA 1LM1A 2QYUA 4AVZA 4XL9A 2YUHA 3B90A 3ZSCA 1O8JA 2VJJA 1TSPA 1HF2A 1O8HA 2O1DA 4YC5A 2IQ7A 2VFNA 4W8QA 3TH0A 2X6WA 2X6XA 1O8KA 2O0WA 3WWGA 2XC1A 1WXRA 1RU4A 2NTQA 2O04A 3FY3A 3UW0A 4XNFA 1DABA 4URRA 3LJYA 1CLWA 2X85A 3LMWA 1O8EA 1IDKA 3H09A 4NK8A 1OFEA 4KH3A 2UVEA 2VJIA 3GQAA 1DBGA 1K4ZA 4OJ6A 4MXNA 4XORA 4W8SA 1LLZA 2J8IA 4OJPA 3SUCA 4NK6A 4W8TA 1RMGA 2VFQA 4YDTA 3T9GA
chains in the Genus database with same CATH topology
3NB2A 2QYUA 3NAWA 2XTYA 2QZAA 4YC5A 2XTXA 3SY2A 3PSZA 4YFOA 3DU1X 4YCQA 2XT4A 2O6WA 3SQVA 5DNSA 2XT2A 2J8KA 2XTWA 4YEIA 4YDTA 3PSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NB2 A;  2QYU A;  3NAW A;  2XTY A;  2QZA A;  4YC5 A;  2XTX A;  3SY2 A;  3PSZ A;  4YFO A;  3DU1 X;  4YCQ A;  2XT4 A;  2O6W A;  3SQV A;  5DNS A;  2XT2 A;  2J8K A;  2XTW A;  4YEI A;  4YDT A;  3PSS A; 
#chains in the Genus database with same CATH topology
 4XN0 A;  2W7Z A;  1VBL A;  4XLA A;  4XLC A;  2VFM A;  5AMV A;  1KTW A;  1QA1 A;  1O88 A;  2B0R A;  4XLH A;  3AK5 A;  1TYV A;  2F3L A;  2Z8G A;  3BH6 B;  1AIR A;  4XQF A;  4XON A;  2O17 A;  3DU1 X;  1EA0 A;  1OGM X;  1QQ1 A;  2VBK A;  3EQN A;  4OJL A;  1PLU A;  1L1I A;  1QRC A;  1O8L A;  1O8G A;  4XLF A;  1QA3 A;  3SQV A;  4I84 A;  3LYC A;  4XOT A;  4OZZ A;  5DNS A;  4XKV A;  1K8F A;  1JRG A;  3PET A;  4MR0 A;  2J8K A;  3ZPP A;  3B8Y A;  2XTW A;  2INU A;  4YZQ A;  2BX6 A;  2NT9 A;  4XN3 A;  3VST A;  3VSU A;  1WMR A;  4YZ0 A;  3BH7 B;  1KCD A;  2EWE A;  2VBE A;  3GRH A;  4YZA A;  1TYW A;  5C1E A;  1IA5 A;  1EE6 A;  1OOC A;  1HG8 A;  2XTY A;  1BHE A;  4XR6 A;  2BM7 A;  2NTB A;  1XG2 A;  2G0Y A;  1IB4 A;  3P4G A;  2XTX A;  2ODL A;  4XMY A;  1TYU A;  1EZG A;  4OJ5 A;  4Z06 A;  3SYJ A;  4YEL A;  1PE9 A;  4Z05 A;  1QCX A;  3KRG A;  4YCQ A;  1GQ8 A;  4YZX A;  4OM9 A;  2O6W A;  2VFO A;  4U49 A;  1X0C A;  3SZE A;  1O8M A;  2NTP A;  2PEC A;  1OFL A;  1O8I A;  1DBO A;  3VMV A;  2NZM A;  5C1C A;  4U4B A;  2INV A;  2QY1 A;  3ML3 A;  4EW9 A;  2PYG A;  1K5C A;  1OGO X;  4W8R A;  5JLV C;  1OFM A;  4V02 C;  3PSS A;  1CZF A;  2PYH A;  3NAW A;  3NB2 A;  1PXZ A;  1O8D A;  4XOP A;  2QXZ A;  4JRA C;  3RIQ A;  3VMW A;  1OFD A;  1RWR A;  2QZA A;  2BM4 A;  5JMC B;  1KCC A;  1BN8 A;  2UVF A;  2NT6 A;  3SY2 A;  3JX8 A;  3PSZ A;  4PMH A;  3EQO A;  1KQ5 A;  2V5I A;  1QA2 A;  3GQ7 A;  2NSP A;  4OJO A;  1LLW A;  1IDJ A;  4OZY A;  4XKW A;  4HWV A;  4YFO A;  2BM5 A;  4XLE A;  1H80 A;  2XT4 A;  2VBM A;  1QJV A;  1NHC A;  2QX3 A;  3B4N A;  2X3H A;  4YEJ A;  3GQ9 A;  2X6Y A;  3N6Z A;  3VSV A;  2XT2 A;  2NST A;  1JTA A;  2BSP A;  3GQ8 A;  3JUR A;  4OPW A;  4YEI A;  2BM6 A;  1TYX A;  2IOU G;  4XM3 A;  4Z03 A;  1QRB A;  4C2L A;  3N90 A;  2O0V A;  1O8F A;  2VFP A;  1LM1 A;  2QYU A;  4AVZ A;  4XL9 A;  2YUH A;  3B90 A;  3ZSC A;  1O8J A;  2VJJ A;  1TSP A;  1HF2 A;  1O8H A;  2O1D A;  4YC5 A;  2IQ7 A;  2VFN A;  4W8Q A;  3TH0 A;  2X6W A;  2X6X A;  1O8K A;  2O0W A;  3WWG A;  2XC1 A;  1WXR A;  1RU4 A;  2NTQ A;  2O04 A;  3FY3 A;  3UW0 A;  4XNF A;  1DAB A;  4URR A;  3LJY A;  1CLW A;  2X85 A;  3LMW A;  1O8E A;  1IDK A;  3H09 A;  4NK8 A;  1OFE A;  4KH3 A;  2UVE A;  2VJI A;  3GQA A;  1DBG A;  1K4Z A;  4OJ6 A;  4MXN A;  4XOR A;  4W8S A;  1LLZ A;  2J8I A;  4OJP A;  3SUC A;  4NK6 A;  4W8T A;  1RMG A;  2VFQ A;  4YDT A;  3T9G A; 
#chains in the Genus database with same CATH homology
 3NB2 A;  2QYU A;  3NAW A;  2XTY A;  2QZA A;  4YC5 A;  2XTX A;  3SY2 A;  3PSZ A;  4YFO A;  3DU1 X;  4YCQ A;  2XT4 A;  2O6W A;  3SQV A;  5DNS A;  2XT2 A;  2J8K A;  2XTW A;  4YEI A;  4YDT A;  3PSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...