5DNSA

T1428 loop variant in p3221
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTYPWGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords t1428 beta1 loop design
total genus 84
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 5dnsA00
2XTXA 2QZAA 3PSZA 4YFOA 3NAWA 5DNSA 2XT4A 4YC5A 2J8KA 3PSSA 4YDTA 2XT2A 2QYUA 4YEIA 2XTWA 4YCQA 3SQVA 3SY2A 2XTYA 3NB2A 2O6WA 3DU1X
chains in the Genus database with same CATH superfamily
1TYVA 1OFDA 2VJIA 1JRGA 2NSPA 2O0WA 1IB4A 4YFOA 4URRA 3RIQA 3VSVA 4AVZA 1KTWA 4NK6A 4XKWA 2V5IA 2J8IA 1O8HA 1TYUA 1IA5A 2VFNA 4YC5A 1QQ1A 2IOUG 2X6YA 1QCXA 1KCDA 2QXZA 3WWGA 2X6XA 1BN8A 3N90A 1LLWA 4YEJA 3ZPPA 4KH3A 1NHCA 1RU4A 3ZSCA 2XT2A 1DABA 2XTWA 1O8JA 1O8KA 2NT6A 4YZ0A 3B8YA 2O17A 2NTBA 4XLFA 2G0YA 2VFQA 3GQ7A 1QA1A 4OJLA 4W8TA 1RWRA 3LYCA 5AMVA 3SZEA 1O8GA 4OJOA 4XMYA 1WMRA 3GQ9A 1XG2A 1DBGA 4YELA 3SUCA 5C1EA 1PE9A 1QRBA 1O8MA 1O8IA 1TYWA 1X0CA 1QJVA 2VBKA 3EQNA 1IDJA 2IQ7A 5DNSA 2XT4A 1BHEA 2PYHA 3EQOA 1HF2A 4PMHA 2J8KA 3VMWA 4HWVA 3PSSA 3BH7B 1LLZA 2BM4A 3ML3A 3P4GA 4W8SA 4XOPA 1QRCA 4I84A 1EZGA 2EWEA 3B4NA 1PLUA 3H09A 4MXNA 3GRHA 4XM3A 4XKVA 4YEIA 2VFOA 1TSPA 4XLHA 3JURA 1VBLA 3SQVA 3SY2A 1CZFA 2O6WA 2UVEA 3T9GA 2UVFA 4Z05A 1KQ5A 1H80A 3DU1X 1QA2A 2XTXA 2QZAA 3BH6B 4OJPA 4YZQA 4W8RA 1O8FA 2VJJA 4OZYA 2O1DA 1PXZA 2BX6A 4XORA 5JLVC 2F3LA 2NSTA 1RMGA 2XC1A 2YUHA 3JX8A 4XQFA 2O04A 1TYXA 1O8LA 1OOCA 2INVA 4XONA 4YZXA 3VMVA 4OJ6A 3AK5A 1WXRA 4OPWA 3B90A 1GQ8A 4XR6A 4MR0A 4YDTA 2O0VA 3FY3A 1EE6A 5JMCB 2BM7A 1OFMA 1DBOA 4Z03A 3UW0A 1OFLA 2QYUA 2NTPA 4XOTA 4XL9A 3VSUA 1O88A 1JTAA 2VBEA 4C2LA 1O8EA 3GQAA 4OJ5A 3KRGA 1K4ZA 2X3HA 4V02C 4XLAA 1OFEA 1OGOX 4OZZA 2PYGA 4OM9A 2X85A 4Z06A 1CLWA 3PSZA 4XN0A 4U4BA 3NAWA 1LM1A 4XN3A 1O8DA 1K8FA 4XNFA 3PETA 3LMWA 4XLCA 2NTQA 4U49A 4EW9A 1IDKA 4YZAA 4JRAC 1AIRA 2QX3A 2W7ZA 2PECA 3SYJA 2BM6A 3GQ8A 1K5CA 2NZMA 2VFPA 1EA0A 1L1IA 4XLEA 2NT9A 2QY1A 3N6ZA 3VSTA 2VFMA 4YCQA 4W8QA 2BSPA 2ODLA 2VBMA 2Z8GA 3LJYA 2BM5A 2X6WA 2XTYA 3NB2A 4NK8A 5C1CA 3TH0A 1KCCA 1HG8A 1OGMX 1QA3A 2B0RA 2INUA
chains in the Genus database with same CATH topology
2XTXA 2QZAA 3PSZA 4YFOA 3NAWA 5DNSA 2XT4A 4YC5A 2J8KA 3PSSA 4YDTA 2XT2A 2QYUA 4YEIA 2XTWA 4YCQA 3SQVA 3SY2A 2XTYA 3NB2A 2O6WA 3DU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTX A;  2QZA A;  3PSZ A;  4YFO A;  3NAW A;  5DNS A;  2XT4 A;  4YC5 A;  2J8K A;  3PSS A;  4YDT A;  2XT2 A;  2QYU A;  4YEI A;  2XTW A;  4YCQ A;  3SQV A;  3SY2 A;  2XTY A;  3NB2 A;  2O6W A;  3DU1 X; 
#chains in the Genus database with same CATH topology
 1TYV A;  1OFD A;  2VJI A;  1JRG A;  2NSP A;  2O0W A;  1IB4 A;  4YFO A;  4URR A;  3RIQ A;  3VSV A;  4AVZ A;  1KTW A;  4NK6 A;  4XKW A;  2V5I A;  2J8I A;  1O8H A;  1TYU A;  1IA5 A;  2VFN A;  4YC5 A;  1QQ1 A;  2IOU G;  2X6Y A;  1QCX A;  1KCD A;  2QXZ A;  3WWG A;  2X6X A;  1BN8 A;  3N90 A;  1LLW A;  4YEJ A;  3ZPP A;  4KH3 A;  1NHC A;  1RU4 A;  3ZSC A;  2XT2 A;  1DAB A;  2XTW A;  1O8J A;  1O8K A;  2NT6 A;  4YZ0 A;  3B8Y A;  2O17 A;  2NTB A;  4XLF A;  2G0Y A;  2VFQ A;  3GQ7 A;  1QA1 A;  4OJL A;  4W8T A;  1RWR A;  3LYC A;  5AMV A;  3SZE A;  1O8G A;  4OJO A;  4XMY A;  1WMR A;  3GQ9 A;  1XG2 A;  1DBG A;  4YEL A;  3SUC A;  5C1E A;  1PE9 A;  1QRB A;  1O8M A;  1O8I A;  1TYW A;  1X0C A;  1QJV A;  2VBK A;  3EQN A;  1IDJ A;  2IQ7 A;  5DNS A;  2XT4 A;  1BHE A;  2PYH A;  3EQO A;  1HF2 A;  4PMH A;  2J8K A;  3VMW A;  4HWV A;  3PSS A;  3BH7 B;  1LLZ A;  2BM4 A;  3ML3 A;  3P4G A;  4W8S A;  4XOP A;  1QRC A;  4I84 A;  1EZG A;  2EWE A;  3B4N A;  1PLU A;  3H09 A;  4MXN A;  3GRH A;  4XM3 A;  4XKV A;  4YEI A;  2VFO A;  1TSP A;  4XLH A;  3JUR A;  1VBL A;  3SQV A;  3SY2 A;  1CZF A;  2O6W A;  2UVE A;  3T9G A;  2UVF A;  4Z05 A;  1KQ5 A;  1H80 A;  3DU1 X;  1QA2 A;  2XTX A;  2QZA A;  3BH6 B;  4OJP A;  4YZQ A;  4W8R A;  1O8F A;  2VJJ A;  4OZY A;  2O1D A;  1PXZ A;  2BX6 A;  4XOR A;  5JLV C;  2F3L A;  2NST A;  1RMG A;  2XC1 A;  2YUH A;  3JX8 A;  4XQF A;  2O04 A;  1TYX A;  1O8L A;  1OOC A;  2INV A;  4XON A;  4YZX A;  3VMV A;  4OJ6 A;  3AK5 A;  1WXR A;  4OPW A;  3B90 A;  1GQ8 A;  4XR6 A;  4MR0 A;  4YDT A;  2O0V A;  3FY3 A;  1EE6 A;  5JMC B;  2BM7 A;  1OFM A;  1DBO A;  4Z03 A;  3UW0 A;  1OFL A;  2QYU A;  2NTP A;  4XOT A;  4XL9 A;  3VSU A;  1O88 A;  1JTA A;  2VBE A;  4C2L A;  1O8E A;  3GQA A;  4OJ5 A;  3KRG A;  1K4Z A;  2X3H A;  4V02 C;  4XLA A;  1OFE A;  1OGO X;  4OZZ A;  2PYG A;  4OM9 A;  2X85 A;  4Z06 A;  1CLW A;  3PSZ A;  4XN0 A;  4U4B A;  3NAW A;  1LM1 A;  4XN3 A;  1O8D A;  1K8F A;  4XNF A;  3PET A;  3LMW A;  4XLC A;  2NTQ A;  4U49 A;  4EW9 A;  1IDK A;  4YZA A;  4JRA C;  1AIR A;  2QX3 A;  2W7Z A;  2PEC A;  3SYJ A;  2BM6 A;  3GQ8 A;  1K5C A;  2NZM A;  2VFP A;  1EA0 A;  1L1I A;  4XLE A;  2NT9 A;  2QY1 A;  3N6Z A;  3VST A;  2VFM A;  4YCQ A;  4W8Q A;  2BSP A;  2ODL A;  2VBM A;  2Z8G A;  3LJY A;  2BM5 A;  2X6W A;  2XTY A;  3NB2 A;  4NK8 A;  5C1C A;  3TH0 A;  1KCC A;  1HG8 A;  1OGM X;  1QA3 A;  2B0R A;  2INU A; 
#chains in the Genus database with same CATH homology
 2XTX A;  2QZA A;  3PSZ A;  4YFO A;  3NAW A;  5DNS A;  2XT4 A;  4YC5 A;  2J8K A;  3PSS A;  4YDT A;  2XT2 A;  2QYU A;  4YEI A;  2XTW A;  4YCQ A;  3SQV A;  3SY2 A;  2XTY A;  3NB2 A;  2O6W A;  3DU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...