5DNSA

T1428 loop variant in p3221
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTYPWGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords t1428 beta1 loop design
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 84
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 5dnsA00
2QYUA 3SY2A 5DNSA 3DU1X 3NB2A 2XTWA 3NAWA 2XT4A 2XT2A 2XTXA 2XTYA 3SQVA 3PSZA 4YDTA 2J8KA 2QZAA 3PSSA 4YEIA 4YCQA 4YFOA 2O6WA 4YC5A
chains in the Genus database with same CATH superfamily
4XLHA 1LLWA 1TSPA 2BM5A 2UVFA 2NZMA 2VFPA 3B4NA 4YELA 1VBLA 1OGMX 5DNSA 4YEJA 1LM1A 1QCXA 4XNFA 2BM7A 1BHEA 3LYCA 2BSPA 4U49A 3B90A 2PYGA 3NAWA 1K5CA 3AK5A 2BM4A 4OZYA 2XT4A 1O8MA 2XT2A 2IQ7A 1IDKA 4OJOA 3N6ZA 4YZAA 1EA0A 1PE9A 1PXZA 2X85A 4Z03A 1X0CA 3EQOA 3LMWA 1EZGA 3GQAA 1WXRA 2J8KA 1KCDA 4V02C 1DBGA 4Z05A 2O1DA 4OPWA 1DABA 4OJ6A 1HF2A 3SYJA 4YEIA 4YZ0A 2V5IA 2VJJA 4XM3A 2X3HA 2F3LA 1O8FA 2O6WA 2QX3A 4XLAA 1O8JA 4XN3A 3ZPPA 2O17A 2INVA 4XLFA 3SY2A 3JX8A 1JTAA 2VBKA 1HG8A 1LLZA 3FY3A 4XL9A 1CZFA 2VBMA 3DU1X 5AMVA 1KCCA 2O0WA 3VMWA 3LJYA 2VBEA 2NTQA 3EQNA 1RMGA 2G0YA 2VFMA 3H09A 1NHCA 2NTBA 1QRBA 3TH0A 3PSZA 5C1CA 1QA3A 1QRCA 1K8FA 1KQ5A 4HWVA 2QZAA 3PSSA 1O8GA 1TYXA 2ODLA 4OJLA 2X6YA 4XLEA 4OJ5A 1OGOX 3GQ9A 1K4ZA 1O8LA 1QJVA 1XG2A 2UVEA 4XKVA 2VJIA 4NK6A 1RU4A 2Z8GA 3KRGA 2VFNA 3T9GA 1WMRA 4W8QA 4XN0A 3SUCA 2BM6A 4URRA 4U4BA 4I84A 1BN8A 1O8IA 3BH6B 1OOCA 1O88A 2W7ZA 2XC1A 3VMVA 4C2LA 4YZQA 4PMHA 1RWRA 4EW9A 1TYUA 2J8IA 1DBOA 2O0VA 4YZXA 4XKWA 1EE6A 1H80A 2XTXA 2XTYA 4KH3A 2NT6A 1IB4A 4YDTA 1OFEA 1O8EA 1AIRA 1OFMA 3GRHA 2BX6A 4JRAC 3N90A 1GQ8A 4NK8A 3RIQA 2NSPA 2IOUG 5C1EA 4W8RA 3B8YA 2NT9A 3VSVA 4XQFA 5JMCB 1CLWA 2X6WA 2INUA 4XMYA 2PECA 4XONA 4XLCA 2QYUA 2B0RA 2EWEA 4XR6A 3JURA 3GQ7A 3PETA 4MR0A 1IDJA 4OJPA 3P4GA 2XTWA 3NB2A 1QA2A 2X6XA 3GQ8A 1KTWA 1QQ1A 1TYVA 3VSTA 4AVZA 2O04A 2VFOA 1OFDA 1JRGA 4XOTA 1L1IA 2NSTA 1OFLA 4MXNA 1O8HA 4XOPA 3SQVA 2QY1A 1TYWA 2YUHA 4W8SA 5JLVC 2QXZA 2VFQA 4Z06A 2NTPA 4OZZA 3SZEA 4XORA 3VSUA 3ZSCA 4OM9A 1QA1A 3UW0A 2PYHA 1PLUA 4YCQA 1O8DA 1IA5A 3BH7B 4YFOA 3WWGA 3ML3A 4YC5A 1O8KA 4W8TA
chains in the Genus database with same CATH topology
2QYUA 3SY2A 5DNSA 3DU1X 3NB2A 2XTWA 3NAWA 2XT4A 2XT2A 2XTXA 2XTYA 3SQVA 3PSZA 4YDTA 2J8KA 2QZAA 3PSSA 4YEIA 4YCQA 4YFOA 2O6WA 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYU A;  3SY2 A;  5DNS A;  3DU1 X;  3NB2 A;  2XTW A;  3NAW A;  2XT4 A;  2XT2 A;  2XTX A;  2XTY A;  3SQV A;  3PSZ A;  4YDT A;  2J8K A;  2QZA A;  3PSS A;  4YEI A;  4YCQ A;  4YFO A;  2O6W A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 4XLH A;  1LLW A;  1TSP A;  2BM5 A;  2UVF A;  2NZM A;  2VFP A;  3B4N A;  4YEL A;  1VBL A;  1OGM X;  5DNS A;  4YEJ A;  1LM1 A;  1QCX A;  4XNF A;  2BM7 A;  1BHE A;  3LYC A;  2BSP A;  4U49 A;  3B90 A;  2PYG A;  3NAW A;  1K5C A;  3AK5 A;  2BM4 A;  4OZY A;  2XT4 A;  1O8M A;  2XT2 A;  2IQ7 A;  1IDK A;  4OJO A;  3N6Z A;  4YZA A;  1EA0 A;  1PE9 A;  1PXZ A;  2X85 A;  4Z03 A;  1X0C A;  3EQO A;  3LMW A;  1EZG A;  3GQA A;  1WXR A;  2J8K A;  1KCD A;  4V02 C;  1DBG A;  4Z05 A;  2O1D A;  4OPW A;  1DAB A;  4OJ6 A;  1HF2 A;  3SYJ A;  4YEI A;  4YZ0 A;  2V5I A;  2VJJ A;  4XM3 A;  2X3H A;  2F3L A;  1O8F A;  2O6W A;  2QX3 A;  4XLA A;  1O8J A;  4XN3 A;  3ZPP A;  2O17 A;  2INV A;  4XLF A;  3SY2 A;  3JX8 A;  1JTA A;  2VBK A;  1HG8 A;  1LLZ A;  3FY3 A;  4XL9 A;  1CZF A;  2VBM A;  3DU1 X;  5AMV A;  1KCC A;  2O0W A;  3VMW A;  3LJY A;  2VBE A;  2NTQ A;  3EQN A;  1RMG A;  2G0Y A;  2VFM A;  3H09 A;  1NHC A;  2NTB A;  1QRB A;  3TH0 A;  3PSZ A;  5C1C A;  1QA3 A;  1QRC A;  1K8F A;  1KQ5 A;  4HWV A;  2QZA A;  3PSS A;  1O8G A;  1TYX A;  2ODL A;  4OJL A;  2X6Y A;  4XLE A;  4OJ5 A;  1OGO X;  3GQ9 A;  1K4Z A;  1O8L A;  1QJV A;  1XG2 A;  2UVE A;  4XKV A;  2VJI A;  4NK6 A;  1RU4 A;  2Z8G A;  3KRG A;  2VFN A;  3T9G A;  1WMR A;  4W8Q A;  4XN0 A;  3SUC A;  2BM6 A;  4URR A;  4U4B A;  4I84 A;  1BN8 A;  1O8I A;  3BH6 B;  1OOC A;  1O88 A;  2W7Z A;  2XC1 A;  3VMV A;  4C2L A;  4YZQ A;  4PMH A;  1RWR A;  4EW9 A;  1TYU A;  2J8I A;  1DBO A;  2O0V A;  4YZX A;  4XKW A;  1EE6 A;  1H80 A;  2XTX A;  2XTY A;  4KH3 A;  2NT6 A;  1IB4 A;  4YDT A;  1OFE A;  1O8E A;  1AIR A;  1OFM A;  3GRH A;  2BX6 A;  4JRA C;  3N90 A;  1GQ8 A;  4NK8 A;  3RIQ A;  2NSP A;  2IOU G;  5C1E A;  4W8R A;  3B8Y A;  2NT9 A;  3VSV A;  4XQF A;  5JMC B;  1CLW A;  2X6W A;  2INU A;  4XMY A;  2PEC A;  4XON A;  4XLC A;  2QYU A;  2B0R A;  2EWE A;  4XR6 A;  3JUR A;  3GQ7 A;  3PET A;  4MR0 A;  1IDJ A;  4OJP A;  3P4G A;  2XTW A;  3NB2 A;  1QA2 A;  2X6X A;  3GQ8 A;  1KTW A;  1QQ1 A;  1TYV A;  3VST A;  4AVZ A;  2O04 A;  2VFO A;  1OFD A;  1JRG A;  4XOT A;  1L1I A;  2NST A;  1OFL A;  4MXN A;  1O8H A;  4XOP A;  3SQV A;  2QY1 A;  1TYW A;  2YUH A;  4W8S A;  5JLV C;  2QXZ A;  2VFQ A;  4Z06 A;  2NTP A;  4OZZ A;  3SZE A;  4XOR A;  3VSU A;  3ZSC A;  4OM9 A;  1QA1 A;  3UW0 A;  2PYH A;  1PLU A;  4YCQ A;  1O8D A;  1IA5 A;  3BH7 B;  4YFO A;  3WWG A;  3ML3 A;  4YC5 A;  1O8K A;  4W8T A; 
#chains in the Genus database with same CATH homology
 2QYU A;  3SY2 A;  5DNS A;  3DU1 X;  3NB2 A;  2XTW A;  3NAW A;  2XT4 A;  2XT2 A;  2XTX A;  2XTY A;  3SQV A;  3PSZ A;  4YDT A;  2J8K A;  2QZA A;  3PSS A;  4YEI A;  4YCQ A;  4YFO A;  2O6W A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...