5DNSA

T1428 loop variant in p3221
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
b'MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTYPWGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords t1428 beta1 loop design
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 84
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 5dnsA00
2XTWA 3DU1X 3NAWA 2XTYA 4YCQA 5DNSA 3SQVA 2XTXA 3PSSA 2XT4A 2QZAA 3SY2A 4YFOA 2XT2A 4YEIA 4YDTA 3PSZA 2QYUA 2O6WA 4YC5A 2J8KA 3NB2A
chains in the Genus database with same CATH superfamily
4MR0A 2X3HA 2BM5A 1PE9A 1TSPA 2B0RA 2XTWA 4AVZA 1KCCA 4U4BA 1EA0A 2X6WA 4W8QA 1K5CA 1O8LA 5DNSA 1QA3A 2BM7A 2VBKA 4NK6A 2BX6A 3FY3A 4KH3A 2X6YA 3EQNA 4OJPA 3PSSA 2BM4A 3GRHA 3SZEA 1X0CA 5C1CA 2EWEA 2J8IA 1IB4A 4HWVA 2YUHA 3LMWA 1AIRA 4Z05A 4YZ0A 1BHEA 2VFQA 1QCXA 2PYHA 3H09A 4YZAA 3VMWA 3EQOA 1O8MA 1OFDA 1DBOA 2QX3A 2W7ZA 4OZZA 3PSZA 4PMHA 1L1IA 1DBGA 1O8EA 1O8HA 1TYWA 3TH0A 1KCDA 1O8KA 2NTPA 2NT9A 3BH7B 2XC1A 4Z06A 4OJ5A 2Z8GA 1HF2A 1RMGA 1IDJA 1WXRA 2NZMA 1QQ1A 1O88A 2UVEA 2ODLA 1JTAA 1KQ5A 1BN8A 4U49A 1O8FA 4XLAA 4XN0A 1DABA 1OFMA 4EW9A 2O0VA 3LJYA 2QY1A 1RWRA 2IOUG 4W8TA 3SY2A 3PETA 2O0WA 3SUCA 4OJLA 3VSTA 3ZPPA 2VJIA 4OJ6A 2G0YA 1HG8A 2F3LA 2O04A 2QXZA 3GQ8A 1JRGA 2VBEA 1KTWA 1O8DA 4I84A 4XLFA 5C1EA 1OGMX 4XM3A 3VMVA 1IDKA 4XN3A 4YEJA 4C2LA 2VFOA 1NHCA 1QJVA 2XTYA 4JRAC 2BM6A 2INUA 3GQ9A 4YCQA 1O8JA 2INVA 1RU4A 1EE6A 3JX8A 3SQVA 1QRBA 3GQAA 1CLWA 2IQ7A 3ZSCA 4W8SA 4W8RA 2NTQA 4NK8A 3VSUA 2VBMA 2VFPA 2XT4A 1OFLA 4OZYA 4YZQA 1QRCA 4XONA 4XNFA 4MXNA 3JURA 1TYVA 2V5IA 4YFOA 3GQ7A 3UW0A 4XKVA 2UVFA 2NSPA 4XMYA 4YC5A 2NT6A 1O8IA 3B8YA 1GQ8A 4V02C 1VBLA 4OM9A 2J8KA 3N6ZA 5AMVA 2BSPA 2X6XA 3DU1X 3NAWA 4Z03A 1K4ZA 2PYGA 4YELA 1EZGA 3VSVA 3SYJA 5JLVC 4XKWA 3B4NA 3B90A 3ML3A 4XORA 1PLUA 1QA1A 2VFMA 4URRA 1H80A 4XLCA 1LLZA 3RIQA 2XTXA 3WWGA 1LLWA 1IA5A 1OOCA 4XQFA 1K8FA 4XOTA 2NTBA 4OJOA 2QZAA 3LYCA 2O1DA 3P4GA 4YZXA 3KRGA 1O8GA 4XL9A 1TYXA 1XG2A 3AK5A 2PECA 4XLHA 2XT2A 4YEIA 3T9GA 1WMRA 1CZFA 3BH6B 3N90A 1LM1A 4XLEA 4YDTA 5JMCB 2QYUA 2O6WA 1QA2A 1PXZA 1OGOX 4XOPA 2NSTA 2X85A 3NB2A 1OFEA 4XR6A 2VFNA 1TYUA 4OPWA 2O17A 2VJJA
chains in the Genus database with same CATH topology
2XTWA 3DU1X 3NAWA 2XTYA 4YCQA 5DNSA 3SQVA 2XTXA 3PSSA 2XT4A 2QZAA 3SY2A 4YFOA 2XT2A 4YEIA 4YDTA 3PSZA 2QYUA 2O6WA 4YC5A 2J8KA 3NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTW A;  3DU1 X;  3NAW A;  2XTY A;  4YCQ A;  5DNS A;  3SQV A;  2XTX A;  3PSS A;  2XT4 A;  2QZA A;  3SY2 A;  4YFO A;  2XT2 A;  4YEI A;  4YDT A;  3PSZ A;  2QYU A;  2O6W A;  4YC5 A;  2J8K A;  3NB2 A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  2X3H A;  2BM5 A;  1PE9 A;  1TSP A;  2B0R A;  2XTW A;  4AVZ A;  1KCC A;  4U4B A;  1EA0 A;  2X6W A;  4W8Q A;  1K5C A;  1O8L A;  5DNS A;  1QA3 A;  2BM7 A;  2VBK A;  4NK6 A;  2BX6 A;  3FY3 A;  4KH3 A;  2X6Y A;  3EQN A;  4OJP A;  3PSS A;  2BM4 A;  3GRH A;  3SZE A;  1X0C A;  5C1C A;  2EWE A;  2J8I A;  1IB4 A;  4HWV A;  2YUH A;  3LMW A;  1AIR A;  4Z05 A;  4YZ0 A;  1BHE A;  2VFQ A;  1QCX A;  2PYH A;  3H09 A;  4YZA A;  3VMW A;  3EQO A;  1O8M A;  1OFD A;  1DBO A;  2QX3 A;  2W7Z A;  4OZZ A;  3PSZ A;  4PMH A;  1L1I A;  1DBG A;  1O8E A;  1O8H A;  1TYW A;  3TH0 A;  1KCD A;  1O8K A;  2NTP A;  2NT9 A;  3BH7 B;  2XC1 A;  4Z06 A;  4OJ5 A;  2Z8G A;  1HF2 A;  1RMG A;  1IDJ A;  1WXR A;  2NZM A;  1QQ1 A;  1O88 A;  2UVE A;  2ODL A;  1JTA A;  1KQ5 A;  1BN8 A;  4U49 A;  1O8F A;  4XLA A;  4XN0 A;  1DAB A;  1OFM A;  4EW9 A;  2O0V A;  3LJY A;  2QY1 A;  1RWR A;  2IOU G;  4W8T A;  3SY2 A;  3PET A;  2O0W A;  3SUC A;  4OJL A;  3VST A;  3ZPP A;  2VJI A;  4OJ6 A;  2G0Y A;  1HG8 A;  2F3L A;  2O04 A;  2QXZ A;  3GQ8 A;  1JRG A;  2VBE A;  1KTW A;  1O8D A;  4I84 A;  4XLF A;  5C1E A;  1OGM X;  4XM3 A;  3VMV A;  1IDK A;  4XN3 A;  4YEJ A;  4C2L A;  2VFO A;  1NHC A;  1QJV A;  2XTY A;  4JRA C;  2BM6 A;  2INU A;  3GQ9 A;  4YCQ A;  1O8J A;  2INV A;  1RU4 A;  1EE6 A;  3JX8 A;  3SQV A;  1QRB A;  3GQA A;  1CLW A;  2IQ7 A;  3ZSC A;  4W8S A;  4W8R A;  2NTQ A;  4NK8 A;  3VSU A;  2VBM A;  2VFP A;  2XT4 A;  1OFL A;  4OZY A;  4YZQ A;  1QRC A;  4XON A;  4XNF A;  4MXN A;  3JUR A;  1TYV A;  2V5I A;  4YFO A;  3GQ7 A;  3UW0 A;  4XKV A;  2UVF A;  2NSP A;  4XMY A;  4YC5 A;  2NT6 A;  1O8I A;  3B8Y A;  1GQ8 A;  4V02 C;  1VBL A;  4OM9 A;  2J8K A;  3N6Z A;  5AMV A;  2BSP A;  2X6X A;  3DU1 X;  3NAW A;  4Z03 A;  1K4Z A;  2PYG A;  4YEL A;  1EZG A;  3VSV A;  3SYJ A;  5JLV C;  4XKW A;  3B4N A;  3B90 A;  3ML3 A;  4XOR A;  1PLU A;  1QA1 A;  2VFM A;  4URR A;  1H80 A;  4XLC A;  1LLZ A;  3RIQ A;  2XTX A;  3WWG A;  1LLW A;  1IA5 A;  1OOC A;  4XQF A;  1K8F A;  4XOT A;  2NTB A;  4OJO A;  2QZA A;  3LYC A;  2O1D A;  3P4G A;  4YZX A;  3KRG A;  1O8G A;  4XL9 A;  1TYX A;  1XG2 A;  3AK5 A;  2PEC A;  4XLH A;  2XT2 A;  4YEI A;  3T9G A;  1WMR A;  1CZF A;  3BH6 B;  3N90 A;  1LM1 A;  4XLE A;  4YDT A;  5JMC B;  2QYU A;  2O6W A;  1QA2 A;  1PXZ A;  1OGO X;  4XOP A;  2NST A;  2X85 A;  3NB2 A;  1OFE A;  4XR6 A;  2VFN A;  1TYU A;  4OPW A;  2O17 A;  2VJJ A; 
#chains in the Genus database with same CATH homology
 2XTW A;  3DU1 X;  3NAW A;  2XTY A;  4YCQ A;  5DNS A;  3SQV A;  2XTX A;  3PSS A;  2XT4 A;  2QZA A;  3SY2 A;  4YFO A;  2XT2 A;  4YEI A;  4YDT A;  3PSZ A;  2QYU A;  2O6W A;  4YC5 A;  2J8K A;  3NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...