5DO2D

Complex structure of mers-rbd bound with 4c2 antibody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S protein
publication title A humanized neutralizing antibody against MERS-CoV targeting the receptor-binding domain of the spike protein.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Viral protein/immune system
total genus 55
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2D01
1QHOA 3HI5L 1HH6B 4B50A 5JXEC 1QBAA 4PJGB 2D7OA 2Z93B 1YEHH 4XVTH 3FT3A 5CWSA 2R23B 4I0PB 1J0KA 4KJYA 3ROOA 3WIFB 3V7AE 3ZDYE 4JG1H 3DTXA 5T3ZL 2UUDK 4JFQB 3L3HB 1QSEB 1A7NH 3BIBX 4L8CB 2BVQB 2QQKL 4KUCF 1RZIB 2AQ2A 4Y4KD 3GZKA 4N5EC 4XNUH 1VACA 4O58H 2A83A 4Y19B 4HX1A 3A6BL 4JVUA 4YPGB 5E5MB 4RQQB 4NNYB 3HMXH 2FB4H 1LO0L 3LKRA 3WUWA 4GRMB 3T08A 4OGZA 1N2RB 2Z35B 2YKLL 1NUFA 3KJ4B 4Z7UF 4D0DA 1HILA 2RFXB 4OGYH 5AWNH 3OPZL 3QISA 4X83A 3CVHL 3C60C 4M61A 3U82B 4QHKJ 4PUBL 5CJOL 4BH7A 5LVEA 4MJ6B 1B3JA 1LK3H 4JZNA 5HHOE 2GUOB 5IVXE 3BEVA 1QFHA 2BSSB 2Q76B 1INDH 5K9QI 4LHUA 1PKQA 3PWJA 2XA8L 4LLWA 2YWYA 4KJQD 3PP3K 1AY1L 4ALAH 2W0FA 5E8PB 1WCBB 3GJFB 1FGVL 5EZIH 5IQ7L 5T1LD 4E5XB 2QEJA 4KKBD 1QVOA 4NQCE 2HJFB 5ITFA 2XWTA 2M2DA 4QRRE 3P9MA 4CADA 5CGMA 3MLTA 1U8HB 1OTSC 4XP9L 4IRSC 2ZCLL 2HVKA 5C0CE 3H7LA 4GW5A 4P3DA 5D7LE 4APQC 3CXDH 4JZOA 3BKCH 5BXFA 4MCYA 1I8LA 5E6IA 3DX9A 15C8H 3H0TB 1XGQA 3EDKA 1U3YA 2MHAB 3SCMC 2X1PA 4BK4A 2BXYA 4G80B 3WJJA 1LDSA 4KROD 1HYSC 1D6VL 4UIKH 3ULUD 1QYGH 5EIIA 3HB3C 4I3SH 5F7EL 4TQEL 1U36A 1NLBL 4GJTB 3H9SD 3MUHL 3VH8B 1ACYL 1E6OL 4I4WA 1I9EA 2DWEB 3BPLB 4X80H 4F7CB 3WO4C 4PRPE 5IMKA 3UTQB 4I2XB 1Q9LB 4MNQB 1AQKL 4HPOL 4YBHA 1QRND 5C6TH 3FB8A 1SY6L 2AABL 3QDHA 4NKOA 1J8HB 4NOFA 5L6YH 3MCG1 1CGSH 5C9JA 2XQBH 4JY5H 1GAFH 3RVWD 2WQRA 4LAJH 5DMGC 1MNUH 4YFLF 1RUKH 1AGFA 4HWNA 1YZZA 1WZ1L 1GGCH 2H2SC 3D39D 5FM5M 2Y7QA 1NBYB 1VGEL 4FTVB 5FA4A 3O41A 3ZL4L 4BZ2L 3TFKD 4EUPH 1ZGLP 3GNML 1IC4H 1I8MB 2HTLD 4QYOA 3KNBB 3VCLA 5JQHC 3NIDF 4NKIL 1A6AB 1S7QA 5CILL 5D7IF 1B0GB 4NQCA 3MNVA 3PDOA 4WV1A 4QRRA 4XT1C 1FO0H 1S7XA 3VRIA 3BD4A 1FFNB 2ZPKL 4OLUH 5F1IB 5DJZA 3EOAB 3U4BL 3CFKA 5HYJE 4ZO7A 5I8OL 5I1DA 2ZCKL 1RUMH 4MDIA 1K2DB 1AP2A 1RJCA 1UM4H 1LEKB 3MJ9L 3WJLC 5K9QG 1Z0MA 4HEME 3VFMB 2MSPA 3VXRA 3L3JA 4MD5B 4EIGB 2QQNL 2GT9A 5K9JH 4BQ6A 3M17A 1UJTA 4GW1B 4YUEL 4PGJA 1A3RL 1C5BH 3RUGB 2R1WB 1XF2A 2D2OA 3GSNH 3MV7D 4Y5VA 1BBJB 5DZOA 2X4UA 3V8OA 2C3WA 3RA7L 5CJQL 1LNUB 5IBTL 4XRCB 1AO7E 1MRFH 1JV5B 4JFYA 3MNZB 1IBGH 4YLQT 1OL0A 3U0TB 5L88L 1ZT7A 1OWRM 4ZOAA 3MOAH 1ZANH 4JM2B 4PRPA 4Z7NF 1LP9E 1T83C 4DAGH 3TN0C 3CPLB 5DYOB 1XGRA 1A7RL 4WWID 5JLZB 1PAMA 5EZJA 3T65B 3LKQA 1U91B 2DRUA 4N5ED 4K8RD 5EC1B 1AGEB 1GGIH 4YFEA 4KV5F 5SWZE 1NLDL 3FN0H 3VXSD 1WGOA 5EOCL 1EFXA 5EOQH 2NNAB 3B3IB 4PR5B 1TPXB 5E94A 1V7ML 4PTTA 5E1HB 3O81A 1DQTA 1Q0YH 4RDQG 1MCIA 1SMOA 5D5ME 3KPPB 3RZCC 4NJ9L 3RY6C 2NY0B 2NY2C 3T8XA 3C60D 3QXUA 1PYWB 3OKDB 1X5LA 4LLDA 4PLJC 5L8LB 4B0MM 1HXYA 1RUPL 1TZGL 4U7KA 4MAYB 3ORJA 3W0WD 2R56H 5JA9A 2E9JA 1CU4L 4XC3L 2ED7A 2AEQL 1F4XH 4X7SH 5AWNL 5ID1B 4ZFFB 1WZLA 3OR7B 3LIZL 3X13B 4CN4A 5GZNC 1ERNA 4KQ3L 3UYRL 4YFDB 3HMWH 3QWRA 4NN6C 5IV2B 5BRZB 4M7KL 1NUNB 4CJ1A 5GIRB 5CZXD 5IHZA 1F11A 1OAUL 1JGVH 1OTSD 1MFBH 1ZVYA 3QRFM 1BZ7B 5DI8B 3HZMB 1EXUB 3BRGC 2IAMD 4GXVL 4APQD 1LO2H 5KSAA 4U6VH 1AGCB 3J8F7 4M7LT 4HKZA 4NYLA 1Z3GL 4HT1L 5E2VH 5F9AC 5C09A 1JL8A 3R8QA 4KAQH 4OM1H 4LIQE 3BPNB 1GIGL 3DMMB 4P2RD 1UG9A 5I1IH 5C0BB 1P4BH 3I9GL 2Z9TA 1YEKH 1HYSD 1ZS8A 2WUCL 4NNXA 2P48B 5F93C 2XFXA 4P5TC 1OW0A 3HB3D 4IRZL 3MV9B 4NUGL 4V2BA 5FYKH 1CWVA 4OZHA 3MRCB 4ZOBA 1KEML 1EO8L 3KPTA 3STZA 3DO3A 1XGPA 2AJSL 1OTTC 4PTUB 5GHWH 5F96L 4V1DD 4HHAA 2EEDA 4ZOCA 5EA0H 4Q2ZA 1O7SA 4UDTB 5EORL 3IT8D 1G9EA 4U1JB 4GSDL 3CX2A 3MRMA 3DOSA 4JANA 3SEPA 5DGRA 3GEWB 4OM0L 4F33A 5ENWA 1DN0B 3M1BB 3QAZB 1AI1L 1EUUA 4K07A 5DLML 2OYPA 3RHWK 2ZP0T 3CFBB 4RGNC 5JXAL 3ULVL 1U58A 4ZS7L 3GJEB 4XNQA 4F7PA 3LEVH 5DRXB 2V7HA 4OQTH 4UINH 1BECA 4KY1H 4NN7C 1IGCH 1NFDB 1OQXA 2H2SD 3LKNA 4IJ3C 2JIXD 1D5BA 1OAKH 2OTUB 2R1YB 4ZTOL 1FIEA 1K85A 3C5JA 4KKNA 4FOMA 5FYLH 1G7LA 4JO1L 3S37X 4U0RB 4CMMA 1V7NH 2WBJC 2FX9L 2KZWA 1INEH 4K3EH 1WBXB 2R2EA 2OQJA 3MBEC 1FL3B 2E6JA 3MROA 3RTQC 5HVWA 4QXUH 1QFWL 4NT6B 4XPAH 3SE4C 2AEIT 5IHLB 2OR8A 5IFHH 4I18C 4DKEH 2OL3L 4P5MA 3L7EA 4JFDE 4FFYH 1U8MB 1U9KA 4MXVF 3S3JA 3VFTA 1R24A 2FO1A 2GIYA 1YMMB 3LEXA 4ZTPH 4QTHB 3PABB 4YXKL 3CFEB 3V6ZA 3IDGA 2WINB 2VLME 2J8UF 5E95B 2VZTA 1AQDB 4UDUB 1R5WA 4WTZA 2Z31A 3FN3A 1FPTL 4ORGA 4HZAA 4QO1A 3HPJB 4JFFE 3BZDA 3O0RL 1T0MB 1YECL 4ONGL 4AEHH 1Q0XL 4ODXA 3UEZA 3KYMB 4YQXH 3ES6B 3QEGH 1MRFL 5CIPA 2Z8SA 2W0KA 2V2TA 1YN6A 2UWEF 4PJCB 2GSIA 2QSTA 2YD8A 5A16B 3MUGA 3V8CA 2CDGB 3LHPL 3O2DA 2VDNL 3HRPA 4P2CG 1MCWM 2YK1H 1VFUA 2X1QA 1JWUB 5DMJB 1XEDA 1MPAL 2CMRL 3GBLA 2FIRT 2J4WL 3K2UH 4JKMA 4OZIE 5IGXL 4H26B 1T21A 5CP7A 1P7HL 3DGCR 3S5LB 2X40A 3LKPB 5I1HL 3SJVB 1YQ2A 5JOFB 4HKJB 5EO0B 3CH1B 3RZCD 2FATL 5FKAA 2F54A 2NY2D 3QUML 3SKNA 3SQOH 3P0VH 4YHIA 1HIMH 3K7UA 4PLJD 4EIZC 3S88L 5I1CH 5EOQL 2IH1A 4TVSa 2NW3A 4NQEB 2AJZB 3DVIA 3MRRA 5HVHB 2CKNA 3FJTA 4R7NB 2ZKHH 4PS4H 3ARGA 2FHFA 5DHVH 1EK3A 5HGDA 3HZVA 1NAML 4HV8A 4HS8H 2IFFL 3P9LB 4YHYC 1HSBA 2VLKD 5TH2B 3PQYA 2D7NA 2CKBL 4YGVA 3GSRA 1SEBA 4P4KB 1PG7X 4MJIA 3H9ZA 3O8XC 3HN3A 1ZT4A 4XBPB 4RMQA 4HIXH 5KOMC 4AMKL 1U8IA 2O5XH 4Q6IB 1O7VA 5IT2L 3OV6A 4X98A 5BJTA 5E9DB 1GC1H 3BZEB 1XGTA 3LEYL 3TA3A 3ZDZF 1BQLH 5F6HI 1M71B 2XXCB 5EU5B 3VE0B 2XTJB 1FE8L 2MKLC 4P5TD 2CXKA 5IROC 1FP5A 3JUYA 1NFIB 3RGHA 1DQQB 1F6AA 2R0ZL 1NJ9A 4Z18A 4OD2A 5D70L 3HS0A 4OM1L 4OCRL 4LSVL 1C08B 1P1ZB 1FAKT 3MREA 4G7VL 3G5YB 2ORBL 4OZIA 4D9RE 1DR9A 2ESVB 4Y4HA 5CEZL 4JEGB 5D7KE 2GITA 4UNTA 3U79A 5FDWA 4K94H 5GS0L 2IANE 3AXLA 1QLFB 4ZAKC 3D85B 5C8JB 1I1CA 2XPGB 5BQ7A 4PJDB 4M00A 3WFHB 1FYTD 2KKQA 3P2TA 4EBQH 2D0GA 4LRIA 1RU9H 4LFHD 5DJ8A 3KPOB 3IF1B 3TT1H 5E08H 1KCSH 3CUPB 3TESA 5J4MA 1G7IA 5J6GB 2P1YA 3TYGL 5EBWB 1SM3H 5BO1H 4LLMB 2FBOJ 5D6CB 2XACC 1J1XH 4M6NH 3T0EE 5B38B 4JLRB 3DX7A 4GG8A 3C9NB 4WUUB 1LO4L 4G42B 5C0AD 5DK3A 4G5ZH 2B39A 4UU9B 1IQDB 4L8DB 5HYQB 3QG7H 1NCWL 3W82A 4I48B 4L8SA 1H3GA 3MBED 1DTUA 3OMZA 3RTQD 3IDJB 1IAIH 5D7JA 1TQCB 2J88L 4P2QE 1UVQA 3MLWH 4YDVA 2BK8A 3GKZA 1P4LB 1V7NL 1WTGT 2F53D 3U9PH 3VXTB 5BZWA 3THMH 1WBZA 2P8MA 1JFQH 1MFDL 4KI5E 3ARXA 2EDJA 3F7YB 5EOTA 1JYVA 3IFPB 1FGNL 3TLRA 1SBBA 1JE6A 5GGUA 2LABA 2JELL 2BVOB 3VH8G 2AXFA 2WMPA 1YYLL 2AJVL 4YX2H 4GKZB 3D3VD 3RVUC 3U46B 1NCBH 2DD8H 4MB3A 3F6LA 5GGQL 3MYJA 1FLTX 2CUMA 2HYMA 5KSBE 4IRJA 3MV11 4JO2L 3UJTL 4OBRA 1JPTH 2H9GB 5I8CA 3TM6A 3RPIB 3I6GA 5E6IC 5L2KB 2D7QA 3EFDH 4YHNB 1OB1A 5F72S 4F2MB 5CBAA 3TH4T 4EN3B 2IANA 1LE9A 4NDMA 4G8FB 1DBML 1U3HB 3ZKQD 3RWIA 2EXYC 1CR9H 1S7RA 1CE1H 1HHKA 4PLKC 4WU7B 1A7PH 2EECA 1DSFH 5HGHA 3SDXE 3IRZA 5IK3A 2X9YA 4M6AA 3RJDA 1J5OL 5C92A 1B4JH 2BVYA 1NCAL 4CJ0A 3FQTB 3T0EA 3UTSB 4QHNB 1MWAA 2YK1L 5F1OB 3MX0A 4TSAH 5D4QA 3A6CH 1KJMB 5B3NA 2CDEA 3IFOA 3VXUE 1FIGL 3VWKB 3VD4A 3LPWA 3DUUA 4XXCA 3F7VA 4L4VA 4M5YL 4EDWH 1I7UA 2UVEA 4FQ1H 3L5WA 4OGXH 5FGCB 3UXFA 1IL1A 4GS7B 1RSFA 2D7TL 2DDQH 2VUYA 3N85L 1MVUB 3P0VL 5DD6A 2VLLB 3TBWB 2P5EA 2P8LB 1MREH 1NC4D 1PQZB 2ZSWA 1RZFL 1UB5A 4PJ8D 1S5HB 4MA3B 3EHBC 4CDHA 4RGOH 5F7LB 3VXNA 4X8JA 2DQFA 1T1ZA 4XP1L 1T0NA 3RL1B 3D18B 3UBXB 2CGRL 2QKIB 2XZQH 2VZUA 3LN9A 1ZMYA 1WC7A 5HHQB 1I4FB 2H2PC 2PO6A 2EEBA 1HHHB 5GS1C 3HNTL 4HLZH 1A22B 2Y5TB 4LLUB 1CF8H 3EO0B 1NBZA 4ZXBC 1QFPA 5CJ5A 3NAAH 3B6SA 4XB7A 4D0BB 4NQVB 1MCPH 4NQXA 2CIIA 3GKWL 3H42H 1X5IA 4POYA 2WLYA 3JWNC 4GAGH 2HT3D 1NC2B 3QCTH 5TJWK 2YRPA 3TBYA 1HXMB 2O5ZH 5HYIA 2BX5A 4OF5A 2JJSC 4JHBA 3Q1SH 4Z7VE 1R0AH 1A1NB 2XIDA 2Q20A 1DQJB 3DIFB 5IEHA 1FJ1B 1M7DA 4OF8A 2FL5A 4G9FA 4X5WA 3FOMB 1A8JH 1HHIB 3DX6B 3O6LL 4P3WA 1OSPH 1BZQK 1IGML 4NO3A 4LPTA 3WFEH 4ZAKD 4PJHF 4XPHL 1HCFX 5LGJB 3R06B 35C8L 4ZD3L 5MEPA 2ED8A 3VXUA 1NBVH 2UZIL 3C5ZA 4OV5B 4K94L 1CZ8H 2VDOL 3CLFH 3ULUF 5TDPA 4HS3B 4ZSOE 3VXMA 3STLA 4N1HB 3P40A 5ICXB 3RGVA 3O4LE 5ICZA 3REVA 5IKCA 3TT1L 1UWGH 5C70A 3K3QA 3TV3H 5T1MA 3TGXA 4PLNC 4YHPA 2QTEA 4XWOC 4RGNE 5BV7C 4U49A 4G6KL 4G5ZL 1FZMA 3RU8L 4X6CF 3FO2B 4X7CC 5IVZA 3T3MF 3DGGB 5J13C 3BRFA 4LHUD 3MLSH 1BZ9A 1JYNA 5H35B 3UAJC 5BZDA 5AYUL 3PE9A 4ZFGL 1NUGA 5B8CC 3NCBB 1AKJA 3BZFB 3U9PL 1OGAE 4LMQE 1XF5B 2IBGA 3RVUD 3HRZA 3GSVA 4QWWC 1JGUH 4R96A 5I17A 5JTWA 2AGJL 1T22A 5SWSE 5I8KL 1KCUH 3ESUF 2A6DA 4Z7VA 3DX8B 4PRHA 4G8EB 4Z77A 2OI9B 3TZVB 3UTTE 2MQ0A 4M8VA 1SJVA 3QCUL 4LGRB 5E6ID 1W8NA 2FJHB 1XFPA 5DEGA 5KSVB 2CRZA 3QJFB 5DRZA 4NQSA 4JJ5A 2EXYD 5KVDL 4DCQA 5HDQL 1RZKL 3QEHA 3TT3H 1OW0C 3GMQB 2DI9A 1MFCH 4D8PB 1I7RA 2AERT 4C56B 4QRUB 3Q3GA 1YEIL 1IC7L 4X4YB 5GSVB 1Y18A 3B9EA 3FQXA 5I73C 1QFOA 3TVMA 4TUOA 5EU3A 2DJUA 2HKHH 5JHDE 4PP1D 4LARL 2ADFH 1UH4A 2BNRB 4LIQH 1IILE 3QIWA 4R4FL 2VLRA 4D9QE 4OIBA 5DR5H 2PUQT 3BPOB 4X7DC 5JO5B 3ARUA 1B9ZA 2OJZL 1PD6A 1IARB 3DUSA 2FEEL 5I75B 3JWDH 4WJ5A 4MCZA 9CGTA 4WY7H 5DXWA 1CD9B 2CXGA 5IIEA 4KUZL 1JGEB 5DRWB 2FGWH 3HUJB 4LPXA 4LLYB 1FG9C 4Y1AB 4RGMB 3EHBD 4MX7A 1A6TB 3GMLA 3VGHA 2E5EA 4FQ1L 4LCWB 1ZEAL 4L5FL 4X6EA 3VFPB 5M94B 2YPLA 1IKNA 3PHOA 1OGAA 3P4OA 1GGBH 2NXZB 4L8BB 3RKPA 2NY5L 4HBCL 2H2PD 2ADJB 4MJ5A 4D9LL 4S11A 3O2DH 3HNVH 1T2QH 5ACZB 4XNMB 2IBZX 2EDEA 5E2TH 3ARDC 1FRGL 3BH9A 5F21B 3HC3L 4M62L 2DJ4A 1HOCA 2J6EH 3MV8D 4K23L 4QKXB 4FQIL 3VXRD 5GGSB 1ORQA 3DRQA 3IXTB 3ZKMC 2W65A 4F9PA 1I1YB 1T5WB 4ETQA 43C9A 3U7WL 2A9ML 3S5LG 4BSWA 2UYLB 1TTFA 2OLDA 2FNBA 2X4PB 2Z31C 4GAGL 4JPWL 2R39A 1N6VA 4JDZB 3BE1H 1MHCB 1OAZL 2CLRB 4LF3A 5D1QC 5LJYH 3PUCA 4M6ML 3SE9L 3MRQB 3NA9H 3RWEA 2XN9A 5JHDA 1IFHH 4ZPTA 3FONA 3MLUL 3N50A 5FECB 3QUKB 3C6LB 4L3AA 1D9KB 1XR9A 3LS5L 3KYOA 2JCCF 3RI5K 3EOTL 4TVPD 5EO9B 4JHWL 3BN3B 4POZD 1DBBL 3Q6GH 1EFXD 2XKUA 4NRXA 1UEMA 1RIVH 3L7FA 1XIWB 4JN1L 1NGZB 5FGBA 2YPVH 2EYSB 4AYFA 5CZVL 2FECL 5I74B 1JN6A 2B1HH 3GSWA 3OZ9H 1LQSR 2FCBA 2X70B 1JNJA 1HH6A 4J6RH 4PJGA 4XWOD 1BX2B 2APBA 4R4BB 3TP4A 3QUYC 2Z93A 5EWIH 2R23A 4I0PA 3WIFA 2A77H 2VSDA 3FRUB 3MJGX 2EYTB 3QWOB 4IIQC 4PJ7E 4XCYB 3IS1X 5DD1H 2E7HA 4ELKB 3G6DL 1OPGH 4JFQA 1CXKA 3L3HA 5E7BA 1QSEA 4FQLH 3GI8L 3UAJD 4L8CA 4G6ML 2BVQA 1RZIA 2P45B 3QWRD 2CR3A 3HC4L 1L6ZA 4WFFE 4Y19A 3WDHA 4PG2A 4OI8A 4YPGA 5E5MA 2XQYG 5INDB 2EH8L 4RQQA 4NNYA 4XP5H 5IFJB 4HIHB 2JE8A 4GRMA 1N2RA 4MXWH 3RWCB 2Z35A 3O6FC 5KSAD 4OB5H 3MLVL 4NQUA 3N1PC 4OFYA 5C09D 2P43B 2RFXA 3BVNB 4PLOB 3VD3A 3OJVC 1ZLVH 3KHOA 2I24N 3NTCL 1PX4A 5IVOA 4MJ6A 4QXGL 5TFSH 1I3RB 4EVNB 1UJ3B 3LH2H 5F1KC 1U95B 2GUOA 2Q76A 2BSSA 5D96C 3VFSB 1EO5A 4EZMA 3QCVH 4ESKA 1PVHA 5E8PA 1WCBA 3GJFA 5FYKU 5IJKA 3B43A 5TQ2H 4E5XA 5EU6E 2HJFA 4P5KB 5A2IH 5B38G 4ONOA 3UBXI 4JO4H 4EDXB 3QQ4B 3NABH 1U8HA 2IBZY 4M7ZC 1BFVH 3WKML 4W6XB 1K6QL 5AZ2L 3CVHB 5T33H 2R4SH 3BUTA 1CFTB 2HWZL 3DWTA 3QH3B 5F6IC 4DVBB 2XZZA 2W9LA 1BD2B 3VGAB 3H0TA 3PJSB 4I1NB 2EDBA 2MHAA 3SKJH 5C0RL 2JKXA 4G80A 4KVNL 4LIQL 3ILQD 3KJ6L 3QUZB 1Z2KA 1G7JB 1KV3A 4ZOEA 2Y6SD 4M7LL 4PGEB 3BAEH 1MQ8A 1NEUA 4MZ2A 5MI0B 3LZFL 3VH8A 4G7YL 3DPBA 3Q5YA 4NM4H 1I1FB 1K4DB 1C7TA 5HHME 1HDMB 4OJFL 2P44B 2DWEA 4JM4L 4F7CA 3UTQA 4I2XA 1HI6B 1Q38A 4FQJL 3KDMB 1Q9LA 3GHEH 4WW2C 4K3DH 2UUDH 4MNQA 2DJSA 2ARJB 2YMXH 4XZUB 3ARDD 3DHMA 3KXFB 3HE6B 1J8HA 1PDKA 4K3HA 5ABDE 3QDAA 4NZJA 3DXAB 5GRZA 2ICCA 3GSOB 5CJBA 1CICB 5ID0B 1V3MA 4JO3L 3HZKB 1MWAH 3ZKMD 4XCFL 2RHEA 3FMGL 1DANT 1NBYA 3HTLX 4FTVA 1PG7W 4CVXB 4RISL 5D2LB 3GMMB 1EHAA 5D8JH 4FNLH 2Z31D 1I8MA 3KNBA 4KJWD 1A6AA 1OVZA 1B0GA 4WEBL 5KTEL 3QEQE 5D1QD 4FQQB 3IDMB 3NOIA 3LMJL 3ZE0E 4F58H 5KVMC 1FFNA 3MC0A 3NN8B 5F1IA 5KS9F 1SBSL 1GXEA 4E42B 3EOAA 1D5MB 1L6XA 2BC4B 3S7GA 4PJEB 1RFDH 4KZDH 1K2DA 4L3CB 1LEKA 5IW1B 3WFDL 4PB9L 4N0CD 5DURD 1C5CL 1CXLA 3VFMA 3ZDXF 4MD5A 4L3EE 3R8BB 1FZJB 3C09C 3X11B 4GW1A 4TTGA 4D0CB 1TZHB 4PRAB 2FDBP 2C3GA 5F6HJ 3RUGA 1TNNA 1UKQA 2R1WA 2EEAA 1IGYB 1KLUB 4GAFB 4NCC1 3W2DH 1BBJA 5JORB 2F54D 2VZVA 1RZJL 3V0WH 1LNUA 5LWYH 4F8QA 1P84K 4XRCA 1JV5A 2HRPH 3U0TA 3MNZA 1N4XH 4C83B 1EBPA 3QUYD 2DS4A 5AYQA 1PBYA 4E41B 4DEPC 1J0HA 5KAQG 3EJYC 3GDBA 3MNWB 3NZHL 5BOZG 5C0BE 4JM2A 1CD8A 5FK9B 1Z9MA 2YUVA 3CPLA 4IOSD 4JAMB 3NH7L 1FNEB 5JLZA 4KRMB 2HA1A 3E6FB 3T65A 4LDLB 5ESVB 4CVWA 2PXYB 3LRGA 2J12B 1U91A 4N1CA 5HDBF 1KYOJ 5EC1A 1AGEA 1DUZA 3PQYD 5I6XB 4M43H 5GJTL 3E8UH 5LBSL 3SBWC 2NNAA 3HR5B 1BOGB 2W38A 4MJID 3GMPB 3B3IA 4PR5A 1OPGL 3PV7A 4ZUUB 5L0QB 3O6FD 1ZXQA 1J0JA 2M8XA 3S37H 1VB9A 3KPPA 2CK2A 3TA3D 4TOYL 2Q3ZA 3MOBL 1PYWA 3OKDA 4P23C 2IGFH 4OCLC 1A6UL 1IKFH 2GEEA 3FOLB 3HPLB 4MAYA 1I8KB 4FQCH 3GMNB 4PFEA 4XVJH 2WAHA 4ORZC 5DJXB 1OCWL 4K9EC 1G7PB 5ID1A 4ZFFA 3OR7A 1JPST 3QHTC 4XHQA 3R0NA 3X13A 4XP4L 4YE4H 1BVKB 3MRPB 4CU6A 4HWZB 1ETZB 4JJHA 4PBXA 4FG6C 5IV2A 2VR5A 3BGFB 5BRZA 3T2NH 5TFSL 4YHOL 5GIRA 1BF2A 2FHCA 2ZUQB 1A9BB 1UYWL 2CRYA 1BZ7A 5T5FH 5DI8A 3HZMA 1EXUA 5T5NF 2Z4QB 4ODWB 1P69B 3MRIB 5I0DA 1AGCA 4AIOA 2CSPA 1CL7L 1MHEB 3OXSB 3UO1L 1FAIH 1BJ1H 2BSTB 4MB4A 3W11D 2FSEB 5DJ6B 4NHCH 3BJLA 3DMMA 2BDNH 3VXQB 1HHJB 2EKJA 5C0BA 3SN6N 4QRPE 3BKJL 1ZHNB 2ERJC 5I71B 3ARYA 4XGZB 5J0BA 1UZ6E 1UM5H 1TJHH 3MV9A 4PREB 4M48L 3IFLL 4H20H 3MRCA 1A7OH 1CTNA 5DT1L 4PTUA 2X1XR 5FV2A 1X5FA 3KWWB 4UDTA 1MUJB 4U1JA 4OLZH 5FYJE 4YK4B 3GI9L 4PJ9B 1BLNB 2ENSA 2VQUA 4JR9L 5CBEB 3JWOH 3O3AB 3BAEL 3ARBB 1KN2L 1DN0A 3M1BA 2G5BB 3QXWA 4YPJA 4PJ5E 3CFBA 5ITBH 1CN4A 3UZVB 3GJEA 3UJJH 3GHEL 5DRXA 3VRJA 5KG9B 1NFDA 3OGCB 1DBAH 4EXPX 2JJVA 2HKFH 2DQGL 4I3GA 1J7VR 3SJVE 3V5HB 3L3KB 2OTUA 2R1YA 3AREC 2IPUG 1CK0H 2OP4L 5C86A 5IFAL 4GFTB 5IB5B 4NO0B 5A3IC 4IRJD 1YQVH 2DQCL 4NQEE 1WBXA 1I3VA 3LS4H 5ISZE 3S36X 1FL3A 1L7TL 1X5GA 3BO8B 3EYOB 4FNLL 2WWMC 4NT6A 4RMTA 1N64H 3VFRB 4P3CL 2WUBL 5TF0A 1CLZH 1UCTA 3GHBL 1U8MA 7FABL 1YMMA 2IH3B 3X3GL 3UZQA 2PYEB 4QTHA 4N0YH 1GSMA 1EMTH 3OG4B 4X6FB 5HHVH 3PABA 3AM8C 1ZV5A 4LASH 3TBTB 3O3BB 2CUHA 3CFEA 5EB9A 5TF1H 3ZZ1A 1CFVH 1KB5L 2RCSL 2WINA 3O3UN 4OKVB 4U1IB 4DVRH 1AQDA 4UDUA 4C57C 2Q6WB 4YHLL 2PNDA 4OLEA 4JFEE 4WI7A 1MI5D 1G7HB 1RK0B 3OKEB 1KNOB 3HPJA 4BQ9A 4FMFA 3RPKA 3QIWC 2J2ZA 1T0MA 2YD2A 4L4VD 2XTJE 1GGUA 4H1LB 3QULB 2OR9L 3CK0L 1RQ5A 4IMKC 4XCEB 1QFWM 2OL3B 1EVTC 3ES6A 4KTYA 3P30L 2P5ED 4PJCA 3FQNB 5DVNA 2I25N 5A16A 2JJTA 2CDGA 2BP3A 4N8CH 5JUEH 1JWUA 1JNLH 4GRLB 3OKKB 4J8RA 5MP6H 1VA9A 3F58H 4RMRA 4CDGC 2CQVA 3VXOB 4PJAE 5CEYB 4H26A 3L9RB 4KGLA 1CVRA 3S5LA 4BKLB 4DKDC 1F4YL 3QDGD 3RVXC 4E9LA 3SJVA 4YGAB 4LL9A 4KTEH 5JOFA 2OZ4A 5I30H 4HKJA 5EO0A 1SEQL 3CH1A 5L7XL 2PO6D 3DLQR 5HY9B 3EJZD 5EULV 4NQEA 4Y5YC 2AJZA 5C6PB 1ZLSL 2YD4A 1MHPH 1DQLH 4R7NA 3AC0A 2NR6D 5L9DL 3CX5J 3IJSB 5E8EB 2OCFD 5ALBH 3PHSA 4XPFL 5GRUH 3SO3C 4ZO6A 2EDKA 4XBEL 1AHWC 1WICA 1JHKH 1P4IH 4FG6D 1BQUA 3P9LA 5TH2A 4NC0B 4CW1B 1DQML 4LVEA 4P4KA 3KPSE 3UDWA 4G9FD 4LSSL 3SGJA 4PRIB 4XBPA 3MLXL 3QUMB 4AY0A 3ARVA 5F3BB 4JN2B 4Q6IA 3QUXB 3F6IA 5E9DA 3CLEH 3HI6L 3BZEA 4OTXH 4AM0B 2FD6H 1A14L 4Y88A 1M71A 2BHZA 5EU5A 1XGYL 4J1UB 2K3TA 3SY0B 3V4UH 3VE0A 3C5ZD 5JQ6L 3C8DA 1QBBA 2ICEB 3WXVL 1D5IH 2LE9A 5TE4H 1FLRL 3P4LA 1NFIA 1NAMB 1DQQA 3VXMD 4JVWA 1G84A 3H8NA 4TYUA 1WIOA 4PD4J 2W07A 5K9OB 2VSCA 2CKBB 1F90L 1C08A 2FIKB 1P1ZA 3FCTB 3N1GC 1UWXK 2VXVH 1FZKB 4OD3L 3G5YA 3B9AA 4Z8FH 5LQBL 4XX1G 3DSNA 2ESVA 3C5SB 1OAXL 2CUIA 2DI8A 1G0DA 1MQKH 1H5BB 5F7HA 3I50H 4NO2B 2ZCHL 1M7XA 1YA5A 1QLFA 4UIMB 5DK2B 3GJFH 3SDAB 3D85A 5C8JA 2XPGA 4PJDA 3WFHA 1QLEH 1KSRA 5DVOA 4YDIL 3KPOA 3IF1A 3ZKSD 3WIHA 3CUPA 1AKJD 1HHGB 1TQBC 2I60L 5ILTH 5J6GA 3TNNB 5EBWA 1MF2H 4M6OL 3SGDI 4LLMA 2P49B 4TSBL 5IUSA 5D6CA 3KLAB 2DQUL 4OCXH 5B38A 1XMWA 4JLRA 4J7RA 3C9NA 1K3IA 4G42A 4WUUA 3O6KH 5A3ID 2FX8L 4UU9A 4L8DA 4PRHD 5FF6B 2BERA 3V95A 3KJ4C 5HYQA 1YN7B 1BGXH 4KK6C 4I48A 1G9MH 1RK1B 2COQA 5JOPE 1N5YL 4WFEE 4KRPC 1HWGB 1EJ6A 3IDJA 3BSZL 2WWMD 4UMGA 4P59L 4ZFOL 1P4LA 4UAOB 4WENB 1JBJA 1H3XA 1NSNH 2XKNB 1PG7L 2YN3A 1NGQH 4R8WL 3VXTA 2B4CH 1ZVSB 2A9NH 5CEXB 5CMAB 4GUPB 3H7BB 3F7YA 4HC1L 4PJIB 3TBSB 5F3HB 3FQWB 3IFPA 4ONHB 1KEGH 1A9EB 3QA3A 1E4XI 2BVOA 2FH8A 2HTKC 1RZ8B 4RMSA 2AV7B 2A74B 4ZO8A 4GKZA 4Q9RH 3U46A 1EJOL 3CXHK 4ZNEA 3F12B 1ZAGA 3QI9B 3QIWD 2AK4B 2VLRD 2NX5D 4Y5XB 4F3FB 2H9GA 3RPIA 4U1SB 1IEBB 4UT7H 5L2KA 4YHNA 3TPUB 4DUWA 5C07B 4F2MA 3G5XB 1IQWH 4HSQA 4EN3A 5L8KB 1TMCB 3EZJB 4G8FA 5HJ3B 1U3HA 5HHXH 2VLJE 5JDJA 2AP2A 1KENL 4WU7A 3BW9B 4DKFL 1N3NB 2IBBA 4H0IA 3UROR 2R29H 1MCOH 4JZJC 4BH8B 2YPLD 5GISL 3WL9B 4AEIH 2Y1VA 12E8H 3RWJB 4I77L 4U6TA 3QNYB 4LSTL 1CLOH 3FQTA 3BPLC 2DLFL 4OZGB 3UTSA 4QHNA 3S8WA 4JG0H 4PGZA 1BAFH 4WUKL 1KJMA 4Y4FB 3VWKA 4KDTA 1MJ7L 1F2XK 1HZHH 5T3XE 1TFHA 5KJRH 4ZQKA 1ZVHA 1TCMA 1E6JL 5IJVB 1MVUA 3S4SB 2VLLA 2HP4A 5CUSL 3TBWA 4WU5B 3V52H 2P8LA 2VDPH 1WFOA 1PQZA 5J12B 3DSFH 1KACB 3TIDB 4YHML 1S5HA 4MA3A 3RNQB 5GGSY 4MNGB 2IPTH 4XWGL 2OX5A 1I9RL 4U1NB 5I1KL 3UBXA 3RL1A 3BN9C 3D18A 4LPWA 2QKIA 3WN5B 3GMOB 2X7LB 1HQRB 3WCYA 2XN9D 2G5RA 1I4FA 5HHQA 5IHUH 1U8JB 3HG1B 1RZGB 1FBIL 4JRWA 3NIFF 5MHSD 1OOAA 2MPAH 1BBDH 2Y5TA 4LLUA 3EO0A 1ZHBB 4GT7A 3MRBB 1LP9F 3UTPD 4D0BA 4NQVA 5EC2B 1YJDH 4YWGL 1EGJL 2BRRL 4TNWF 3P0GB 1BVLB 1NC2A 3QIBB 4OF0A 5BVJB 1HXMA 1FYHB 3VMNA 4XNXH 4WCYL 4HXBH 4R0LB 3OGOE 4XI5C 1YYMH 4N1EA 5JMRA 2V5YA 3VXPB 1A1NA 1DQJA 3DIFA 1FJ1A 3HNSH 4LSQL 3AS2A 4DJMA 3I3DA 2I9TB 3FOMA 1HHIA 3DX6A 3WFBL 3U1SH 3BKMH 3WFCL 4I0PD 4I9WE 1P9MC 4TRPL 3X3FL 5HPOA 2HFTA 4U1GB 3SPVB 5LGJA 3R06A 4FZEH 4KK9C 1KFAH 1MIEL 1JNNH 1QSED 2YHGA 3OAYK 1NAKL 4C56E 2NY7L 4HJJL 4AL8H 2B7DT 1CIDA 1S9WB 4FFWC 4OV5A 4G9DB 1N8ZB 4HK3N 1MCEA 2IFGA 4U0QB 1NCUA 4Y19D 2UVFA 4HS3A 1MFEL 3QDJE 3OKYA 4Q7DA 3BP7B 1T7VA 3MODH 1MCLA 5ICXA 1TPXC 4Y16B 1OTUC 1F4AA 4UNVA 2BNRE 4KK6D 3WNMA 5JW4R 2NXYC 4HWEL 4OFYD 1VCAA 2DQDH 3OTTA 4LCIL 4KRPD 4DN3L 4RIRB 1P2CB 5EO1B 3WIIL 4LCUB 3OAUH 4JQXC 3LSOB 1EV2E 4PJXB 1QFWI 3MRNA 2D4DA 1FDLH 1KTKE 3FO2A 3DGGA 4R90H 4C54A 4FZ8H 3LV3B 5H35A 3VGEA 4GQ9H 4LCWE 5GGTH 3U7AA 3P11L 1X5XA 5TPWL 4F9LC 4GOSA 3LQAC 3BZFA 1KB9K 2HTKD 3I02B 4QTIL 1XF5A 1NL0H 3AUVA 1NSNL 2R0LH 2X4SB 3P3YA 4JDTH 5BS0D 3KPRE 2F15A 3JV6B 3DX8A 3AVEA 4MA1B 4G8EA 3TF7C 1FV1A 3TZVA 4KVCL 4JQVC 4LVHB 2FJHA 3PDGA 5KSVA 5FUOL 3QJFA 1S7WB 3NMEA 3BWAB 1JF6A 3FFCD 4XMKL 1U8NB 4NJAL 1MH5B 4JPVL 4P2OC 4O02H 2IQAB 2ZUXA 2CK0L 2A6JB 3GMQA 3JTSB 5TDNB 3QQ9D 4FQXB 4D8PA 4JFZH 4C56A 4QRUA 4FXLA 5GJSL 2EDQA 3CX5K 4KMQA 4X4YA 3FRPG 1CCZA 1IQWL 3DARA 5JPMB 4WHDA 2J8OA 4QXTB 1E4KA 1IC1A 1A1MB 2C4FU 2F19L 4MNQD 2VAJA 2BNRA 4M1GL 4Y8AA 1MCOL 3RAJH 4ONFL 2B2XH 1KN4L 1EHLL 1J8HD 2VXQH 4KHXL 1KPVB 2VQ1B 3MLRH 4GRWB 5JO5A 3K8MA 3OJ2C 1D5XB 1U8LB 4HUVB 2NY4B 4MQTB 4HCRA 5HHOB 4FTVD 1JGEA 5DRWA 1OAQH 3HUJA 5IVXB 5I1GH 3DYMA 4LLYA 4Y1AA 4QGYA 3CMOH 1A6TA 4YDKL 3PWVB 4LCWA 3BN9D 4WFGD 1MY5A 3INUL 4UT9H 2BJMH 3I6KB 3TWCH 3VFPA 1BM3H 3S96B 2ED9A 4FRWA 3GO1L 4LSUL 3BDXA 3TJHC 4L8BA 1JP5A 2QBWA 3IAGC 2P42B 2ADJA 4KFZC 2GYSA 3RDTB 5C0CB 5D7LB 4EUPG 1KPRB 5ACZA 1R5VB 4XNMA 2D0FA 1HKFA 2IQ9H 5D2NC 3AAZB 3RWGB 5DWUH 1V5JA 3AFLA 4OD1H 2OZ4H 3FHAA 2FLRT 5GGSA 3VA2C 1FORL 3IXTA 1DBJH 2WW8A 1I1YA 2F5AH 1T5WA 4X8XA 4BUGA 2OXHA 3QO1B 2UYLA 2Y36L 1P53A 4OZIF 2X4PA 4ZUSB 1A6VH 1BJ8A 1YEDB 4JDZA 1MHCA 3DVNB 1CGUA 2CLRA 1CFSB 3U7YL 4Q9QL 4OI9A 3L1OH 1JRHH 3MRQA 4JM2D 2HT4C 3UJIH 2OS7A 3WE6B 3U30B 4KK9D 2B5IB 1BFTA 3ZKNC 5FECA 1CLYL 3QUKA 3C6LA 1D9KA 1XF3B 2P24B 1K8DB 1L0QA 1K4CB 2RAMA 3HE7C 1KT2B 2XQYK 5EO9A 4LOUD 4TUKH 3SDDB 3T0DA 4FXGB 2DMKA 4J4PA 1JNNL 1XIWA 4O2EB 1OY3B 4Z0BL 1OTUD 5E70A 5ELIA 4YEEA 1CBVL 1NGZA 1VEOA 2NXYD 2EYSA 3EIFA 5FUCE 5J1TC 3N1MC 5FFLA 4U31A 2X70A 4KK8D 2PKDA 4HUXB 1BD2E 1CTOA 1BX2A 3H3PL 4R4BA 5I15H 3VDCA 1JIBA 2V17L 3QWOA 3FRUA 4XCYA 2EYTA 1BQSA 3VFOB 4OAWB 1VFOA 4YIQB 4AH2B 4ELKA 5HYJB 2JF1A 5JIPA 4L9DA 3VGGA 1PGRB 2APWA 5IR1B 4LCCB 4N90D 4TVPL 4BJLA 3O2VL 1Q72L 2HFFB 5BRZD 1FNGB 4DGVH 5INDA 8CGTA 5IFJA 4HIHA 1I9IL 2A6KB 4D94A 3UP1A 4IS6B 3RWCA 3SGJC 1HKLH 4D3CH 3L5XH 4X9BA 1ES0B 1NGYB 2DWDB 3KXFE 1PEWA 2W9DH 1YEGH 3BVNA 3LD8B 1AO7B 5BV7L 1EBAA 4HWBH 4U6YA 4MVBC 3DXAE 4Q0XL 3DMMD 1JTTA 1QNZH 4LVOB 3OKOB 3MLZH 2R0KH 1A64A 1LP9B 2J8HA 1I3RA 4EVNA 1UJ3A 4CVZB 1WFNA 1U95A 2GY5A 3CSBA 1MRCH 3ZTNH 3CVIL 3MV9D 2CR6A 1KLGB 4YNYB 2Q87A 3P9WB 3VFSA 5D2LE 2YBRB 1UH2A 2WZPD 5JDSB 3WBDA 3I6LE 5DD0H 2DBJA 5FCUL 1AFVH 3PXHA 1CD0A 4J12A 4P5KA 5SWZB 4OZFB 1L7IL 2AJXH 4GXUM 1YEEL 4LRNL 4EDXA 2V6HA 3QQ4A 1NMBL 3PGFH 4X0KB 3ZMRA 4KKAC 5I18H 1C5DB 3IDYB 1P6FA 2OK0H 2H3NB 4WHTB 4PJEE 1JPSL 5D5MB 3CVHA 1T20B 4PB0H 1CFTA 3EKCA 3QH3A 4DVBA 2L7UA 1NMAH 3QFJE 1BD2A 1DE4B 5E2WL 3T2QA 1W72L 3PJSA 2F58L 2EKSB 5FO8B 2BMKB 2B2XL 3QUZA 2AKRB 3HFMH 4UTAH 2EDLA 1OM3H 1G7JA 4EOWL 4YEFA 5ADOL 3SE8H 4PGEA 4O4YH 2OSLB 1QPXA 4R2GC 4L4TE 4XXDA 4GMSH 5D7SH 1I1FA 1K4DA 4OUOA 3TJHD 4E41E 1HDMA 2AK1L 5T5NG 5F1NB 4I0CC 1HI6A 3KDMA 2ARJA 5FYJL 4XZUA 2HT2C 5LXGH 3CIQA 3KXFA 3TO2B 3HE6A 4KRNA 2V5MA 4JREB 1RUQL 3N06B 1A6WL 3KYKH 5DUMH 1YMMD 3DXAA 2C26A 5AZEH 3GSOA 3V9FA 1CICA 3I3BA 3ZHLA 5ID0A 4NZRH 3G5VB 3HZKA 4N8VB 3FB6B 4TSCH 3M8OH 4DTGL 1ND0B 3DBXB 4PV8B 3OJDB 4CVXA 5D2LA 1O0VA 3GMMA 5A40E 1IM3B 3HAEB 3IXAB 4EXKA 5DWUL 2DN7A 3PWPE 3P4NB 5EUOB 4FQQA 2DQTH 4NKQB 3IDMA 4XNYL 4UOW1 3QEUB 1SY6A 3NN8A 3ZE2E 3ZKND 1MCBA 4E42A 1D5MA 2BC4A 4PJEA 4YDLB 1C7SA 2WBWB 1W0WB 4L3CA 5IW1A 4KROB 4LLVB 4OBSA 3S4SG 1JRHL 2BOBB 2AS5M 3SDYL 4L29B 4OIIH 1LEGB 2B0SL 3KLDA 1FZJA 5FM5O 3X11A 1EH9A 4D0CA 1A7BA 4JHAH 4PRAA 1KCVH 1VFBB 2E27H 4Y2DB 1FNFA 1IGYA 1KLUA 5JIIA 1KELL 3ARZA 1IEAB 2X6MA 3MJ7B 5JORA 3ZE1F 2ITCB 3IFNH 2X4NB 1KCRL 2DM7A 3GBNH 3BWUC 3WNLA 4C83A 4UV7H 4ZS6D 1X4XA 4E41A 4KDTC 3MNWA 1FNHA 4W6WB 5FK9A 4JAMA 4N8PA 1FNEA 3E6FA 5ESVA 1UFUA 5F88B 2PXYA 3MJ9A 4XP6L 4YZFE 1IAII 3ZLQC 1JGLL 4JFDB 2QSVA 2EC8A 1A7QL 1V3LA 4H5SB 4NZUL 3U4AA 4BZ1L 4O51B 1BOGA 3HR5A 3LAFA 3QZWG 3GMPA 4M5ZH 4ZUUA 1JI2A 4Z7VF 2V2WB 4AENB 4N0UB 1ZGLB 1DN2A 5E9DD 5T3XH 3N9GH 1XH3B 1MCCA 5TQ0H 2ADGB 4MVBD 1QSZA 3MA9L 5C7XH 1ZGLM 3S36H 4JFFB 5KZCB 3HPLA 3FOLA 4RFNC 4IHOB 1I8KA 5F9WB 3GMNA 4KGJA 2XYCA 5DJXA 1G7PA 1A0QH 5DA0B 4KI1A 1R6VA 1BVKA 3MRPA 4HWZA 1ETZA 3T2OA 1WAAA 3WUWG 4ZUVB 1NH6A 2A73B 3O9WC 3PGCB 4S1DC 3WLWC 1FC1A 3GSQB 1A9BA 2ESVD 2QR0B 4KKAD 3M07A 5IW6B 2Z4QA 4ODWA 3MRIA 5HDOA 1JF1B 4JPKH 1MHEA 3OXSA 5DD0L 3D85D 2BSTA 3JSSA 3KGRA 4NFDA 5DQDH 1MFAH 1S3KH 1OAYH 5ESAB 2FSEA 4KQ4L 5DJ6A 5KVFH 2AJXL 2FEEI 2PYEE 2GJ6D 3VXQA 5IQ9B 2XNAB 4BA8A 1HHJA 3Q5OA 3D9AH 2W91A 5JOEA 1X3DA 4LHUG 3KPLB 2CJUL 1WT5A 1ZHNA 4XGZA 2HFEB 2IPUK 1WEJL 4PREA 5D93B 4C58B 4R2GD 4HQQL 4WUUD 5DD5L 1IM9D 4HFUL 3CFCH 4P9HC 2AEWA 3BP4B 4HDIB 3KWWA 5IBLC 3L6FB 1MUJA 3ECBB 2Q8BL 2F5BH 4PJ9A 4UTAL 4Z95L 1BLNA 5FOBB 5DS8B 4DZ8B 1H3PL 3SE8L 5CBEA 1AXSB 2HT2D 1INQB 3MCLL 3O3AA 1ZTXH 4YXLL 3ARBA 5IWLA 3W9DB 2G5BA 2O5YL 1IGTB 1YNKL 2V5TA 3W0WB 1I3UA 3C8KB 4DQOL 4S2SB 5CCKL 4ODHL 3V7AG 4OT1H 3SDCB 5KG9A 3DVFA 4CL7A 3OGCA 4R97B 4HF5H 4NWTL 1HYRC 1CE6B 3V5HA 3L3KA 3FRPA 2EH7H 4JKKA 3BQUC 3QQ3B 4OLYL 1CDBA 3EO9H 4IRSB 5IB5A 1BQHG 4S1SH 4OLWL 4NO0A 5E2UH 1XR8B 1X5ZA 4KPHL 1RIUL 1LWRA 2BY3A 3GM8A 5L2KD 2GI7A 3BO8A 4UB0H 3EYOA 5E2JA 2HN7B 3SCMB 1WK0A 1FFPB 4P2RB 3STBA 3VFRA 4N9GB 3DYOA 3B9KB 2R9HC 3AY4A 2R8SH 1UQSB 2IH3A 4ELMB 2PYEA 4HUMB 3RVTD 2OMNA 4X6FA 4XMPH 3TBTA 1TXKA 3G6JB 3O3BA 4O2FB 3LQZB 1KJVB 3GK8H 4U1KB 4OKVA 4V1DB 2FECI 5DFTA 3V4VL 3MACH 3UTSD 4U1IA 1MOEA 5JR1H 2Q6WA 1AE6L 3IGAB 4HPYL 2XWBB 4PJGF 4DOHB 4HIIB 1G7HA 1RK0A 3OKEA 1KNOA 3VWKD 4DUXA 2XZAL 3MRJB 4PJBE 3SKMB 3OKNB 3BPOC 1S78C 4H1LA 3RX5A 5LGHH 3F5WB 4P2QB 4XCEA 2LU4A 4I3RH 2OL3A 3V6OA 1FVCB 4OCYH 4GG6B 3GBMH 4X6BB 3FQNA 1YDPB 3NCYS 2CDFB 3C2AH 4GRLA 2JIXB 3OKKA 3PV6B 5KW9H 4LPYA 4BELD 5ESQB 3VXOA 1KB5B 5CEYA 3L9RA 4BKLA 3IDUA 1CFBA 4J3VA 3OAZK 2EIDA 2EE9A 2NW2B 5GGVL 1G9NC 1N0XH 5HY9A 3OJMB 4X5XB 1MVFA 1RZ7H 2XOTA 3I75B 5KSBB 2VC2L 1T04B 2NTFB 1JHLL 4WGVB 3QDME 3LOWA 4G3YH 5E7FA 3IJSA 5E8EA 5CLWA 2B20A 4PBVC 4XCCH 3UPRB 4KK5D 4HLZG 1FFRA 1ZLUK 5D7IE 2DYPD 4LNRB 3O9WD 4S1DD 3WLWD 5CEZE 1NCCL 4HZLB 4CW1A 1W0YT 3SDXB 2AEPH 1MELA 4PRIA 2BNQE 3KLHC 5FHBH 3QUMA 4NQDE 4JN2A 5AG8A 5F3BA 1KC5L 2DQHH 3QUXA 4K3JH 2HMID 4H8WH 2PW2B 5E4IA 2ILLA 3TN0B 1FG2B 2KPNA 4AM0A 3IB4A 5IMLB 3KYNB 4J1UA 3SY0A 1H8SA 4PJIE 5FKPB 2RQ8A 4K9EL 5F89B 5KVEL 2ICEA 1F4WH 1LDPL 2D03L 4KZEL 1HSAB 3HI5H 1NAMA 1QRKA 2A6IB 2G75B 2Q7NA 2J5LC 5HPMB 3OKMB 4WFHD 3L3IB 4ZYKB 1F3DH 2X9WA 3CAFA 5DO2C 5DUBB 1CDYA 1H8OA 3BYYA 5K9OA 3VW3L 2CKBA 2FIKA 3C87A 2DF3A 3PNWB 5T3ZH 1FZKA 4JQIL 2OR7A 1KJ2L 3IKCB 1K8IB 1VFAB 4U05A 2NY2B 3C5SA 2QQKH 5TE7L 3SHSA 5E1AB 5DEZA 5C07E 2YRLA 5INCA 1H5BA 4NO2A 1TCRB 3A6BH 1AJ7L 5DK2A 4UIMA 1E27B 3SDAA 4P57B 2P8PB 3E3QC 3IJHB 1LO0H 1KULA 4KV5E 2YKLH 3IDXL 3JTTB 4Y4KC 5ERWB 1HHGA 1TVHB 5F97E 3FT2B 3H9YA 2YN5A 3TNNA 3OPZH 4Y2OA 1WWBX 3CVHH 1MJUL 3KLAA 3BQUD 3GB7B 4PUBH 5CJOH 5E56A 1NUDA 1UZ8B 5FF6A 1YN7A 3QRGL 4NC1C 2ZUYA 1ZE3C 3TZVD 1RK1A 3ARTA 2XA8H 1AY1H 5HGGS 5CINL 1FGVH 5IQ7H 1YNLL 4P99A 2FWOB 5EZOL 1YPZE 4S1SL 2XKNA 1CG9B 3QJHB 3BGMB 5HYFA 1ZVSA 4XP9H 5JHLL 1AXTL 5CEXA 5CMAA 4GUPA 4CU7A 3H7BA 4MZ3A 1N0LA 4KJQC 4PJIA 5F3HA 4QOKA 3TBSA 5AD0B 3X17A 3CU7A 3FQWA 5C0FB 4ONHA 1A9EA 1S5IL 3RUGF 1RZ8A 1RJLB 2AV7A 4ZSOB 3S3PA 2A74A 1IT9L 3DI3B 1F8TL 4OQTA 5KANI 1N7ML 3O4LB 3QI9A 1NEZB 1D6VH 1M7IB 3D1MC 2NQCA 1CXHA 2AK4A 3VG9C 3WNNA 5H37G 4NGHL 4Y5XA 1S78D 2HH0L 4F3FA 4JM2F 4QEGA 5F7EH 4TQEH 3LKOB 1JVKA 4U1SA 1IEBA 1NLBH 4YBLC 4ZFOB 4F80A 3TPUA 4RZCB 4V2CB 4RGNB 1ACYH 5C07A 4F8TA 1BHGA 3G5XA 1E6OH 1FYTB 3FO9B 1S9XB 5HJ3A 4MHHI 3MZTA 5HI5D 2FZ3B 4NN7B 5D6DC 4UV4L 2H8PB 3ULUC 1UWXH 3BW9A 4Y1AD 3CZFB 5IESL 1N3NA 1AQKH 4HPOH 4M1DL 2G2RB 5MI0C 1SY6H 4NC2B 4BH8A 1JZ7A 2AABH 2Z92B 3GGWB 3RQ3A 3WL9A 5C0AB 4S0TD 3RWJA 1QG3A 2Q7YB 1A5FL 2WBJB 1DBKL 3F8UB 3FN9A 3ROLB 4OZGA 3BD3A 2P5WE 1L9NA 5SWSB 1WZ1H 1T1WB 4Y4FA 1VGEH 2PN5A 3UTTB 3SGDH 3ZL4H 4BZ2H 1TJIL 5HDLA 3UTZB 4W6YB 4I18B 2IF7A 1F97A 3GNMH 4FQHB 5D71L 1CQKA 3RIFF 2G9HB 4NKIH 5CILH 1TETL 3U2SB 2GFBB 5IJVA 3S4SA 1RZ7L 3SGKC 2YXMA 1R3HB 4HGWB 1A1OB 2ZPKH 3TIDA 1L0YA 2A38A 3RNQA 4PP2B 2W59A 4HGKC 3U4BH 3FKUS 4MNGA 5I9QC 4U1NA 5I8OH 3FAWA 4NRYB 3AS1A 2ZCKH 2ZUWA 3WN5A 3GMOA 3MJ9H 2X7LA 4KDWA 1HQRA 3MJ6A 1U3ZA 1U8JA 3HG1A 1DLFL 1RZGA 3WXWL 4HK3J 2QQNH 4MXVE 3BHBB 5KVGL 3C6LD 1D9KD 4YUEH 3ESVF 1A3RH 1YEFL 1ZHBA 3V0AC 5IF0B 3MRBA 5EC2A 5CJQH 3S3SA 2DQHL 5IBTH 3CSYB 1EA9C 4K3JL 1G0YR 5JIKA 1BVLA 3QNZB 3QIBA 5DO2D 5BVJA 5L88H 4R0LA 4TTDD 3PWUB 4MQ7B 1A7RH 3FQRB 3VXPA 2AJUH 3QHZL 2EICA 4WNQB 5EDXA 5DJ2A 3NCJL 3LKSB 4NM8L 4BFIB 1QTYT 4W68A 2I9TA 3DURB 4Q58C 2YPKB 5KOVC 5C08D 1NLDH 3VD9A 2BRQA 3EDFA 4LBEB 2WV3A 4MMZC 3SPVA 5EOCH 2VDQL 3OL2A 4WO4C 1V7MH 4G8GE 2DKUA 2PXYC 4KHTL 2D3VA 4CN1A 4P46B 1S9WA 4LKCB 1FH5L 1NFDF 3MUJA 4G9DA 1N8ZA 2A1WL 4K8RC 3QNXB 4NJ9H 4M4PA 4QF1B 4JRXD 3VG0L 3BP7A 3TH2T 5C3LD 1RUPH 1TZGH 2ZWLT 4Y16A 2ZNXA 4MLIA 3ALXA 1CDGA 3O8XB 1GGYA 1ZLWK 1CU4H 3H3BC 1PW3A 4XC3H 1FFQA 2AEQH 4PPTA 3ARSA 3KG5A 3KPQB 3LIZH 4GRWE 4RIRA 1FSKB 1P2CA 3OG6B 5EO1A 1KTLB 4LCUA 4K7PL 4KQ3H 3UYRH 2R2HB 3LSOA 3U9UB 4PJXA 3TJEL 4O5LL 5T3ZD 2MJWA 2YUXA 2VTFA 2Z8RA 4M7KH 1P5VA 3PXJA 1WZKA 4HXAL 1OAUH 2K7QA 1UGNA 5DC0A 3DV4B 4GXVH 3LV3A 4BM7A 3ULSB 1N26A 1Z3GH 5F7FA 4HT1H 3REWB 1NKOA 3I02A 2UZYB 5TDOB 5CZXC 1GIGH 5E8DL 2X4SA 2CLVB 3ZDZE 5C71A 3I9GH 1HH9B 1KG0B 4UILL 2WUCH 2IAMC 3JV6A 4W4OC 3U36B 5LCVL 1OP3H 4AIZB 4IRZH 4NUGH 4ZAKB 2LU7A 3MRKB 3Q6FB 3DYPA 1KEMH 1EO8H 1S7WA 2HVJB 4EJ1C 4LDOB 2AJSH 3BWAA 2AVGA 5F96H 4PJ7B 3QHFL 1SQ2N 1U8NA 2X42A 5ANME 5EORH 3C08L 4PJCF 1MH5A 4GSDH 1E28B 3B8SA 2IQAA 2A83B 3CU1A 1YC7A 2A6JA 3JTSA 5TDNA 4FQXA 4OM0H 2CO7B 1AI1H 5DLMH 5JPMA 2VERN 4Y8DC 1A6ZB 5JXAH 3ULVH 4QXTA 1BQHA 4YK4C 4ZS7H 4L1HA 4PJ9C 1A1MA 3NCCB 4JY4B 4MQXC 3QG6B 4JRYD 3VFWB 4XVSL 3HE6D 4KDVA 1KPVA 4S1RH 4ZTOH 2VQ1A 4PYGA 1D5XA 1WV7T 2B1AL 4JO1H 1U8LA 2NLJB 4HUVA 4O9HL 1EEUA 2VXTL 4JFHE 1RUAL 1ZHKB 2FX9H 4Q9BA 2NY6B 5HHOA 3MR9B 5K33A 4M93B 5IVXA 1QEWB 5D1ZB 5BOPA 3CDYA 7CGTA 3DV6B 3TH3T 3PWVA 4H1LH 2EO9A 1QFWH 4MYWB 3I6KA 5EU6B 2HG5B 3S96A 1T03L 2OL3H 5F9JB 25C8L 3LB6C 1VKXB 4W4NA 1UWEL 2HFGL 3RDTA 5C0CA 2QLVB 5HGBB 5D7LA 5HI3D 1KPRA 1DZBA 4YXKH 1R5VA 2KQNA 4OIAA 2FR4B 3GUTB 2NY1B 3T3PF 5LAXB 5EH1A 3AAZA 4KTDL 5TGBB 3RWGA 1FPTH 5CD5D 1GYAA 3T2PA 4J2XA 3ME0A 2D4FA 3A0OA 3P0YL 3F7QA 3O0RH 1YECH 4ONGH 1VFMA 1Q0XH 1WVZA 3QO1A 5J11C 4GAYB 3NFSL 3V2AR 3SE3A 4ZUSA 5IBUB 4XPGL 1RY7B 1YEDA 5F70A 3DVNA 5HHMB 1UACL 1CFSA 3LHPH 2VDNH 1EZVX 5ALCL 4MMXC 2CMRH 1MPAH 3WE6A 2J4WH 3MGTB 2EDDA 4PJDF 2AJUL 4WO4D 4UT6L 5IGXH 4XAKD 4X9FA 3FO0H 2PXYD 1XF3A 5I1HH 2P24A 3DVGB 1K8DA 1K4CA 4DKAA 6FABL 1QSFD 2VDRL 2FATH 1KT2A 2WK2A 3QUMH 1JNHB 3AMLA 4YJZL 5IMOB 2DLIA 4FFZL 3RRQA 4PGBB 3SDDA 3S35L 3S88H 4FXGA 1UM6L 3N1QC 1NDGB 4O2EA 1RURL 4MD0B 5FIEA 4MA7L 3AU1B 3VFGL 3VWJB 4ODTH 1WQVT 3E3QE 4HUXA 5SX5K 2GSGB 1NAMH 2X10A 2IFFH 2O61B 5GS1B 3IJYB 3QEQB 2AXJA 2VDML 4ZXBB 3NACL 3NCMA 2VZ3A 2CKBH 3VFOA 4OAWA 4YIQA 4AH2A 5HYJA 4CUCA 4PIRF 3MV8B 3PP4L 4AMKH 5IR1A 4LCCA 1GZPB 1XCTB 5IT2H 32C2B 4FN0A 2HFFA 3BJ91 1FNGA 3LEYH 1F00I 4XX1E 3FO1B 5T1DL 5IB1B 2APVA 2A6KA 4L3EB 5CGTA 4LMQI 2NY3C 4IS6A 3FQUB 1OQOA 1FE8H 2D7PA 1CDJA 4CBPA 1ES0A 5I8EB 1NGYA 2DWDA 5J1AB 4ENED 2R0ZH 5IOPB 1FNSL 1AO7A 3WNOA 5D70H 4ZDHA 1OD7A 4QT5B 4OCRH 1MAML 4LSVH 4HKXB 1MCRA 5DHXB 3OKOA 3CCHB 1RHHB 1LP9A 3O6ML 4G7VH 4IDJL 4CVZA 2ORBH 4DGIL 1R3IL 2ID5A 3ISWA 5CEZH 2P7TB 1KLGA 4YNYA 3AGVA 4R6UA 1PZ5B 5GS0H 2PETA 2YBRA 2DKMA 5JDSA 5DD3L 3LQAL 3ABZA 4RSVA 1FZOB 5EUOE 3RWHB 1QKZL 2Q86B 5SWZA 4QHMB 4PJ9D 1T7XA 2M1KA 4ODVL 2PTTB 5MEND 3DHJA 4X0KA 4MQXD 3FT4B 5KSUB 1C5DA 3GRWL 5E8OB 3ARBD 4JKPL 2H3NA 4LLDB 1SJXA 4WHTA 1I9JL 1ADQL 1IC5L 5D5MA 2H45A 2KUTA 3TYGH 1T20A 5BV7B 2H1PL 1LO5B 1P5UA 1DE4A 4CN6A 1U92B 4TPRL 3ULUE 1KXQE 1LO4H 5J13B 2EKSA 4X7EC 3TEUA 4ZUTB 5FO8A 4MWFB 1MIML 1NCWH 5E6YA 2VDKL 3H9SE 1T1XB 4NZDA 4NN5C 2AKRA 5B8CB 5JW4M 1G6RL 1UCBH 4S1RL 4P0DA 2J88H 2OSLA 1VHPA 2IPKB 5AUMB 4NO0D 1EZVY 2AI0H 5CS7A 3EYFB 3LB6D 1QRNE 1J1PL 1XAUA 1KJ3L 4Z5RB 2Y07L 3GIZL 5F1NA 4WI2A 1CFNB 1MFDH 1PLGL 4X6CE 2DBLL 5KAQF 4OLVL 3T3ME 3BDYL 1FGNH 3TO4B 4LU5L 1BEYL 2JELH 3ULVD 1W72B 3TO2A 1YYLH 2AJVH 2NMSA 2ZUUA 2K9UA 5DC9B 3QXDB 3D39E 4XMLL 1HEZB 1IAMA 5GGQH 2E7LA 3JVGA 1DEEB 3G5VA 3EYQC 3FB5B 3FB6A 4N8VA 4QRPB 5C2BL 3NFPB 1JPGA 3T77B 4JO2H 1ND0A 3UJTH 4JB9L 5I73B 3MV01 1J1OL 3DBXA 4PV8A 3OJDA 4NNPL 4N0UE 1IM3A 3HAEA 3IXAA 3VRLE 1TDQA 1DBMH 3K74B 1B0RB 3P4NA 5FO9B 5EUOA 1FN4B 3T1FB 4KXZH 4EQ2A 3QEUA 4HUWB 4Y5XC 3S34L 3VGDA 2YRZA 5EFIB 1J5OH 4RMVA 1TLKA 1GCFA 2DKSA 3MRDB 1NCAH 1W0WA 3KR3L 4DZBB 4PJ5B 5F9DC 2VRAA 4LLVA 1HNGA 3UX9B 2BOBA 3R4DA 4GRLD 4L29A 1LEGA 3MV7E 2QSQA 1FIGH 2AJYL 2E3VA 4WW1B 3FO0L 4N9OB 1WUNT 4M5YH 4Y2DA 2J6EA 1X5YA 1IEAA 3MJ7A 3V5DB 1VGKB 3UC0H 2ITCA 1HK6A 2D7TH 2X4NA 4QCIB 3N85H 2EIEA 3ZKXC 1UB6B 1JMXA 1RZFH 1W0VB 2IJ0C 1SYSB 3ARDB 5ISZB 5E99L 1U6AL 1WF5A 2VWEC 4XP1H 3IETB 1MCKA 4ODTL 2CGRH 5F88A 2VAAB 4H88L 5J56B 3VXSE 1H3WM 4MSWB 4JFDA 1IE5A 8FABB 4PJ8C 1DL7L 1JTOA 4XC1L 3HNTH 4H5SA 2QQLL 4S10A 4O51A 2NY3D 5SWQB 1IMHC 4BUHA 4PRID 4BFGA 1JI1A 2V2XB 3QO0B 1T4KB 2EIZA 2V2WA 4AENA 4N0UA 3QBTB 5D1QB 3GKWH 1ZGLA 1PSKL 1XH3A 2AV1B 3W0WE 4JFEB 2D31B 3T0AA 2ADGA 4HIEB 2CPCA 4JFFA 3CD4A 5CLTA 1U8QB 1SVZA 2EDTA 4IHOA 4XCNB 2YA1A 4RX4D 2QL1A 3O4OC 2V9RA 4O2CB 2HT3C 3QIBC 1BFSA 4PRBB 1N5AB 5DJ0B 5EUKB 3O6LH 1RMFL 2YWZA 3O3EB 1IGMH 2NTSP 4U1HB 4R0LC 4XPHH 2DQJL 4ZUVA 2VJXA 35C8H 2IC2A 2A73A 3PGCA 4EI5C 4OZ4B 4ZD3H 5JZ7C 3GSQA 2NYYD 5DMYA 4OUUB 3GMRB 4PJAB 5ADPL 3EGSB 3CSGA 5JXEA 2UZIH 3VGBA 5IW6A 3QUYB 5B4MD 1JF1A 2EDNA 2VDOH 1F42A 4P2RE 1MCJA 4IIQB 2JCCE 4R3SB 5ESAA 3MXWL 3LPGA 1ULVA 4PY8I 4ELME 1KOAA 4GKNB 5IQ9A 2XNAA 3OXRB 3E1F1 2LFGA 4HJ0C 3ALPA 1GC1C 3KPLA 3LN4B 1QR4A 3G6JE 1XCQB 3O2WL 4YXHL 3HUJF 2HFEA 4YR6B 4V1DE 4IM8A 2BVTA 2WIIB 4S1QL 3GSRB 4FS0A 3T0WA 5FXCH 2EZ0C 4G6KH 2WNGA 4AG4L 3O6FB 4DOHE 3BP4A 3RU8H 1RHFA 1T66C 4HDIA 5HHNB 3L6FA 1T2XA 3ECBA 5FYKD 5GS0D 3LN5B 4LPVA 1UCBL 3KPSB 4X9IA 5DS8A 4DZ8A 4Z76B 1AXSA 1INQA 5AYUH 4ZFGH 4O00A 3MXVL 4GG6E 1IGTA 2AI0L 3C8KA 4S2SA 4KMLB 3HC0B 1J18A 1A02N 4K94C 2AGJH 5I8KH 5D96B 1QLRB 4JPIB 3I85A 3EYQD 5ACLA 3SDCA 4LAQL 4QOKD 3QCUH 1CE6A 4JGMA 4PRNB 5EBLB 1AD9B 4PRDB 4QY8B 1A2YB 4GRWH 1SHMA 3VI3E 3QQ3A 3BKYL 4M7ZB 4IRSA 5HDQH 5KVDH 3P73B 1XR8A 1RZKH 2J3SA 1OARL 4N0FB 2AK4D 3WLBB 5FM8A 3JV0A 5FYLD 4A2MA 4J23A 4ZNCD 5F6IB 1I8LC 1OF2B 1YEIH 1IC7H 3PWNB 1QQDB 4K71C 2HN7A 5DF0A 3SCMA 1FFPA 4P2RA 3RY4A 3WJJC 1KLFA 3DI2B 4N9GA 1LK2B 2R4RL 3B9KA 1DVFB 4LARH 1UQSA 4ELMA 3MFGB 4R4FH 4XVUC 3G6JA 4O2FA 3LQZA 4P48A 5GS2H 1KJVA 4U1KA 4V1DA 2OJZH 5EU7C 4PP1C 1QBLL 4WW2B 3IGAA 2XWBA 5F9OL 5DJDB 4WI3A 4HIIA 4Y4FD 5GSRB 4KUZH 1Z9SA 2EE6A 5HTSA 3MRJA 3SKMA 3OKNA 1ZEAH 4L5FH 3F5WA 4P2QA 1QO3B 3UC0L 4OQ1A 4X99B 1FVCA 5EOTB 4GG6A 5I19L 4X6BA 2CDFA 2NY5H 4GMTH 4HBCH 4RWYL 3BIKB 5GGUB 4D9LH 4E0RB 2JIXA 3SKUD 3WHE1 3PV6A 3U0PB 4JCMA 4Z7WE 1JUFA 3X12B 4CGTA 5ESQA 1F45A 1KB5A 4XAWL 2BSED 1FRGH 3RL2B 3IU4L 1VEPA 2W9EH 5E4EC 2SEBB 3HC3H 4M62H 4WV1C 2BSRB 1PY9A 5IBUG 1NMCC 2NW2A 2NZ9C 3HG1D 4K23H 2D9QB 4FQIH 1NANH 4X5XA 2Y06L 3I75A 2MCPL 5KSBA 1QACA 1S8DB 1T04A 2NTFA 3U7WH 5HHPB 2A9MH 5AAWA 2AW2A 2P46B 2VXSL 4ODUB 4FHBD 4JPWH 3QIBD 2VLKE 3UPRA 3LVEA 1EEYB 1OAZH 2VLJB 4M6MH 3SE9H 1AIFA 2XZCL 4LNRA 1F58L 1KPUB 4Y5VC 2FEDD 4EI5D 1GPOL 3MLUH 3MTRA 5JZ7D 5FUZL 4HZLA 5DUPL 3WMSA 3SDXA 3SE3C 2I5YL 3LS5H 5KS9E 4R26L 1MI5B 2BVUA 2GK2A 3EOTH 2CDEB 4DEPB 4JHWH 4F37K 5DDHB 1DBBH 2PW2A 1IZKA 1EEZB 3MMEB 4RFOL 1T83A 1HQ4B 3TN0A 4U4BA 1FG2A 1MJ8L 5IMLA 4KKCC 5GRJL 3KYNA 4FP8L 4QHUB 4TNWK 3BFOA 4JN1H 5FKPA 4HJ0D 3CMGA 5CZVH 5F89A 1EIBA 1PX3A 3LRSB 5EZLB 1HSAA 2A6IA 2G75A 5HPMA 3OKMA 4POZC 3L3IA 4M8QB 4ZYKA 5DUBA 2LTQC 3V5KB 2EZ0D 4HUNB 1T66D 1YY8B 1EHXA 3QDGB 3PNWA 4ODSL 4DW2L 3G6DH 1H0DB 3IKCA 2GTWB 1K8IA 1VFAA 4NBZB 2QADC 3GI8H 3RY6A 4G6MH 3U0WL 5E1AA 5KBNC 4P23B 4U2ZA 3HC4H 1FYTE 2R2BB 5IG7B 3HR6A 1TCRA 2C1PB 1E27A 4A6YL 2EH8H 3OWEA 4P57A 3WSQH 2P8PA 3IJHA 5BVPL 4OZFH 1N59B 1IGIH 3MLVH 3JTTA 5ERWA 1TVHA 3OAZH 5C0AE 3FT2A 5FGRA 3RIAK 5I1EL 5D2LF 3NTCH 3FB7B 4G43B 3GB7A 4P9HL 2BNUB 3AB0C 1KJ2B 1WCQA 2DTML 1UZ8A 3CDGB 4QXGH 5KSAC 3OBAA 4DN4L 1D7FA 1GHFL 2F53E 3RNKB 3ARWA 1BMGA 2YD3A 2FWOA 4PJEF 1KXVC 3R0MA 1B88A 2YSSB 4LVOC 2OBGA 4PJFE 3IDNB 3C2SA 5EIVA 3DNKA 1CG9A 4FXKB 2Y4SA 3QJHA 3BGMA 2ERJB 3S97C 1JRHI 2R1XB 2DOCA 4UNUA 3WKMH 4FQXD 4X6DB 1JWMB 2DLEA 4LCYB 1J0ZA 1K6QH 5AD0A 3D3VE 5AZ2H 5C0FA 4XVUD 5H37H 3PIQB 2HWZH 1X5JA 1R3JB 2VKWA 4LLQB 1RJLA 4ZSOA 3QDJB 4MDJB 4LSRL 5C0RH 3O45B 3O4LA 4CAGA 4LSPL 4KVNH 3IDYC 1NEZA 1M7IA 1KCKA 5CGYC 3KJ6H 1BJ1J 5AAMA 2RR3A 4M7LH 4P2YA 4HIJB 3LKOA 1YEJL 5FHAL 4ZFOA 3LZFH 4RZCA 4G7YH 4XPTL 2FX7L 1RVFL 2NY4D 1FYTA 3FO9A 1S9XA 3HAEH 1ZT1B 2FZ3A 4LQFL 4OJFH 5HHOD 4JM4H 4HC1A 2H8PA 2ZUSA 3ILQC 3G6AB 1N6QL 4FQJH 2F74B 3CZFA 4UTBL 2BHUA 2Y6SC 1LO3L 1R3KB 3AREB 3VFUB 2VISB 2MKWA 4NQCD 2Z92A 4U2YA 3GGWA 5C0AA 4M9OA 2Q7YA 4FABL 2WBJA 4QRRD 2NZ9D 5C9KA 3ROLA 2QHRL 4GMTL 5IM7B 5I1JL 3RFZC 3O11B 4XPBL 5C0CD 4JO3H 2BHYA 3V4PL 4BK5A 5SWSA 5D7LD 2P47B 4XCFH 4MA8L 3KPRB 5E03A 4KJPD 1T1WA 5GS2D 3FMGH 3V0VB 4PV9B 5I1AB 3UTTA 2W9EL 3RX8A 3UTZA 3FFDB 4RISH 5TE6L 3MJ8B 3OKLB 4FQHA 3KHQA 3BESR 3T4YB 2G9HA 2HLFD 2I9LB 3D25B 4RFEB 3U2SA 4HCRL 3JVGC 4WEBH 5KTEH 2C4XA 2GFBA 2DAVA 2VDLL 2MQCA 4IMLB 4UQ2B 3LMJH 5BW7A 2ZJSL 1WAAF 4HGWA 1A1OA 5I16B 3ZSTA 4M7JL 1SBSH 2VITB 4PP2A 3JWDC 1Y6MR 1BWWA 4I8DA 4KJWC 5J57B 1OP5H 4QHLB 1G9NL 3WFDH 4PB9H 4JDVB 4PRPD 1Z5LA 1C5CH 1C16B 2NX5B 4FQ2L 4UI2A 3HHRB 4WI4A 1T89A 3JXAA 3BHBA 1B90A 4KKCD 3WD5L 1MRDL 1WFTA 4YDLC 4DUVA 4WJ5B 4Z7OF 5IF0A 1RZJH 5JW3L 4L4JA 4N0CC 3CSYA 1UKSA 1NCDL 1W8OA 3QXVA 4CMHC 3QNZA 2XG5A 2CLZB 3MBXL 5A2FA 3NZHH 3L3GB 2DICA 4HK0B 4X6EB 3CNKA 4WHYH 2W0LA 1PY4A 3PWUA 2PR4L 2CH8A 4MQ7A 4DGYH 3FQRA 3NH7H 4MJ2A 1RULL 1ZWIA 3EZ8A 4WNQA 2QADD 5GRVL 3LKSA 2GW5A 3DURA 2C3HA 3A67L 2YPKA 2XI9A 4OCSH 5B3JE 4Y5YB 1T1YB 2R69L 2QHLA 5GJTH 4LBEA 5LBSH 4TNVF 2BZDA 5HYJD 3SQBA 4OCWL 3ARGC 1ZLVK 3IAPA 3T04D 4P46A 1EGJA 4LKCA 2R0WL 4KMTL 1AHWB 4WEUD 1B2WL 3QNXA 2VL5B 4TOYH 4QF1A 3MOBH 3WSQL 5LKNA 1A6UH 4IBLT 1BREA 3PL6B 1U3JA 2JB5L 3EW3B 3O8XA 1IGIL 4LVNC 1VERA 5DMKB 1OCWH 1I1RA 1DQDL 1AO7D 3KPQA 3TA3C 4XP4H 1KTLA 1NGPL 4KC3B 2R2HA 3U9UA 1J87A 4GAJL 3MRLB 1PKQE 3I2CL 3ULVF 5JPNB 4YHOH 1YNTB 2EIBA 1UYWH 3DV4A 1HWHB 1IJ9A 1PZUB 3ULSA 1CL7H 2G60L 3UO1H 4LLAA 1OLLA 1JZ2A 4LEXL 3LCYA 5SWZD 3REWA 1CT8B 4NZTL 4HFWB 4Z7QF 1A3LL 4F57L 4U1LB 3BI9X 3ILPB 5TDOA 5F8RC 2BVEA 4Y4HC 5J06A 2CLVA 2MWCA 5CD3B 1HH9A 1KG0A 2W92A 1JMZA 1UA6L 5CGYD 4X7FC 3BKJH 3U36A 1VPOL 4NKMB 4AIZA 2X41A 4ZAKA 3MRKA 3Q6FA 4M48H 3IFLH 3W11C 2HVJA 4LRIC 5DT1H 5C1MB 3VD5A 4PJ7A 1F5WA 1E28A 4YC2C 5C0NC 3GI9H 1TQBB 2C1OB 3CFDB 4JR9H 5EU7E 5D93C 1XZ0B 1KN2H 3QXAB 1M4KA 4DK6A 2FBJL 4XTRD 3EYSL 1DUYB 4L8SC 1A6ZA 2QSCL 4LP5A 1S7VB 4K7FB 5F1SA 4KRPB 4JY4A 5D7JC 5E0QA 3QPXL 2XY1A 3QG6A 3VFWA 1RD6A 2I26N 4XHJC 2DQGH 1QHPA 4OSUL 4XNZB 1AGBB 2ARWA 3RWFB 1G1CA 2OP4H 3L5IA 4J3OC 3LDBC 3VFNB 5IFAH 2NLJA 1URLA 3SDCC 3NGBB 3NIGE 1ZHKA 1KBGL 2DQCH 2ICES 3ULUL 4R97C 4J3XA 1ZLWH 2BFVL 1L7TH 3MR9A 1QEWA 2PW1B 4UQ3B 5D1ZA 3DV6A 3BH8B 5EU6A 4P49A 4CKVX 4P3CH 2HG5A 2WUBH 4GKOA 4IRJC 1R3LB 3BT2L 5F9JA 5BS0B 3GHBH 1KTDB 4F7MB 1NCTA 4D2NA 7FABH 1VKXA 3X3GH 3HI1B 3ZT5A 3T0VA 1S7UB 4ERSL 5HGBA 1F02I 2EE3A 3PP3H 1A21A 1I8IB 3MV8E 1I1AB 4JY6B 4PJBF 3VXRE 3FFCB 5EN2B 3GUTA 1KB5H 2RCSH 3QT2A 2FR4A 3FHQA 5LAXA 4G6FD 1UEYA 3QFJB 1OD9A 3B9KC 5TGBA 2IG2L 4YHLH 3H3KA 4YHKL 4MQSB 5I2IB 4ZFZB 3MCKB 4PGDB 4OF6A 3VJ6B 4JZJB 3U4EB 1MLBB 4Y2DD 1I7ZB 2OR9H 3UBXG 3GSUB 3CK0H 1C1EL 4GAYA 3EYUL 3T0EC 4L4TB 5C0EB 3P30H 1I7TB 2XT1B 5M7QA 1U8PB 1O5DT 4XXCC 2JJWA 4UUJB 1SJHB 1QFUL 1D3CA 1IGFL 5DK0B 4DGYL 5DYOA 3MGTA 5FCSH 2VH5L 3ARGD 3ZTJH 4TVPE 1T3FB 1WITA 1F4YH 4HWUA 3DVGA 1QBMH 4PY7B 1CI5A 4JFDD 1SEQH 1E4WH 4OCSL 5L7XH 3SOBL 3D87B 1JNHA 1ED3B 5IMOA 4MAUL 2J1KA 4Q97A 4PGBA 1KIPB 4KI5C 4JKLA 1Q9WB 3MLYL 5I1LB 1NDGA 1JTPA 3EYVB 1ZLSH 2VLMD 4MD0A 4NQTA 4PY8J 4AIXA 2FJGB 3AU1A 3VWJA 5L9DH 4XPFH 1MEXL 2PO6C 2YEZB 3PWPB 4XBEH 1ZKAA 2GSGA 2LVEA 4MS8D 5KZCD 4JFFD 2O61A 3EJZC 5GS1A 3IJYA 3QEQA 3DO7B 4GW4B 4ZXBA 4U7SA 4HBQA 4OLXL 1DQMH 3VI4E 1TVBB 2CD0A 4TULL 2NR6C 1I3GL 3B2VL 4LSSH 1H3UA 5HD8D 1ACZA 3MV8A 3MLXH 4K8RL 3QB7C 4MLSA 1FVDB 4PJIF 4BQ8A 4OFIA 1GZPA 1XCTA 4YHZL 2JJSA 32C2A 1TJGL 3HI6H 1E4XL 4M3JA 1PFCA 3TCLB 3MQIA 3FO1A 5DMIL 2IWGA 1A14H 5IB1A 3HZYB 4L3EA 4Y4HD 5C09E 2KH2B 4NWUL 1XGYH 5JXED 3VFVB 5JQ6H 3NIFE 3FQUA 3WXVH 5AG9A 2GJZB 1WBYB 1X5KA 1FLRH 2VXUL 5I8EA 2WBKA 5J1AA 1ORSB 5IOPA 2AQ1A 3K8KA 4QNPE 2XRAL 4QT5A 1GL4B 2VABB 4HKXA 1F90H 1MY7A 3F7PC 3CCHA 2VMFA 2LU3A 4OZHE 1RHHA 3C5ZC 4OD3H 5C0ND 1YEHL 2DI7A 4XVTL 5LQBH 1DUZB 1T6WA 3NCFB 1OAXH 2P7TA 2FO4B 1PZ5A 1CGWA 1RV6X 4JG1L 3RGVC 2ZCHH 1FZOA 1H3TA 3RWHA 1A7NL 2Q86A 5K9KB 1FCGA 4QHMA 2NXYB 4XNUL 4BFBD 4OZGF 4O58L 2PTTA 5GGTA 3RZWA 4YDIH 5D7JD 3FT4A 5KSUA 5HGAB 5E8OA 3HMXL 3BP6B 2FB4L 2I60H 4XHJD 2IMNA 5CZKA 1GZQB 4M6OH 5CSZB 1LO5A 3BXNB 4TSBH 2DQUH 2V7NB 3ETBF 1U92A 4Z9KB 4JE4B 4OGYL 2FX8H 3SDCD 4ZUTA 4MWFA 3EDJA 2FYYB 1YPZF 1T1XA 5B8CA 1N5YH 4U6XB 3BSZH 1LK3L 5SX5H 2Z0BA 4IRSD 4P59H 2IPKA 4LGPB 5AUMA 1INDL 3EYFA 1PG7H 4R8WH 1W2KT 5F7UA 4ALAL 4HJGB 4Z5RA 3IDIB 2V5SA 5EZIL 4D9RD 1CFNA 4LSDA 4HC1H 5D7KD 1M05B 3K2MC 2E9IA 2IAND 3SCMD 3TO4A 3OF6A 1W72A 3MOQA 3B9KD 1EJOH 3CXDL 3QXDA 4P2OB 2DMCA 3JWOC 3BKCL 1HEZA 1DEEA 1I85A 1JJUA 3FB5A 4QRPA 1G6RB 4TN9A 15C8L 3CDFA 3NFPA 4KH2A 3T77A 2L7JA 3AROA 4MB5A 3MGOB 4Z6AT 3TVMC 3GFUA 3T0ED 4JHZA 4UIKL 1PKOA 1T7WA 4OFPA 4NHUB 1QYGL 1TIUA 5D72H 4I3SL 1B0RA 2Y25A 5DTFB 5FO9A 1FN4A 1Q9KB 3T1FA 1YY9C 1KENH 2BY0A 3U6RB 4HUWA 4DKFH 1RJYB 4MJ4A 4P2QD 2YC1B 5EFIA 4X80L 5DMGD 5GISH 3KYMA 3DROB 1GJIA 4I77H 1NPUA 3VRJB 3EAKA 2GQHA 2LAAA 2ITDB 3MRDA 4LSTH 4DZBA 5C6TL 4PJ5A 2DLFH 1AC0A 2DTSA 5CJ8A 4KI5D 5L6YL 1CGSL 4WUKH 2XQBL 4JY5L 2F54E 1GAFL 1J12A 4WW1A 3MA7B 3LKPA 1MJ7H 1ZOXA 3WUZA 1IKNC 1QBML 1MNUL 2JJUA 4Z7UB 1RUKL 4L9LB 2UV3A 1E4WL 3V5DA 1GGCL 1VGKA 4WEMB 1E6JH 2DQEH 4QCIA 1CLCA 5CUSH 4PGCB 4WWKB 1UB6A 4PJXF 1IC4L 2DQIH 2ZOLB 1W0VA 1SYSA 4YHMH 3ARDA 1X9QA 5ISZA 5D2NB 2GAZB 4YO0B 4XWGH 1I9RH 1FO0L 4HG4J 5I1KH 1EERB 3IETA 2VAAA 3PQYE 4OLUL 5DFWH 4MSWA 4MJIE 4F9PC 5BW7C 1DDHB 1X4YA 8FABA 3OB8A 1FBIH 5J9PB 4CRPA 1RUML 4R9HA 1UM4L 3NPSC 5SWQA 2BY1A 1BP3B 3PG2A 2XV6B 4UOJA 3RVVC 2V2XA 1Q8MA 4RA3A 4M9PA 5CJXA 3QO0A 1T4KA 3K1KC 2H26B 5DQJB 5K9JL 4YWGH 5D1QA 1EGJH 1BFOB 2BRRH 2AV1A 1C5BL 1VEMA 3TN0D 1T89C