5DO2D

Complex structure of mers-rbd bound with 4c2 antibody
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A humanized neutralizing antibody against MERS-CoV targeting the receptor-binding domain of the spike protein.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Viral protein/immune system
molecule keywords S protein
total genus 55
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5do2D01
5CZKA 2VZUA 3BZFA 3F7QA 1HSAA 25C8L 2WQ8A 4K8RL 2XRAH 3TEUA 4X5WA 3T4YB 2R69L 1SEBB 3U46A 1T1WB 2A6KB 3HI1B 5C0DA 3P0VL 5L0QC 4WO4B 4P46C 2GJJA 2Q8BL 4OQ1A 1KLUA 4EKXA 1D6EA 4HGWB 4H1LA 4Y4HC 3ZL4L 3E8UL 5FHBL 3V52H 4G6AC 2BNRE 3BD5A 3U0WH 3CXHK 1TIUA 2F54B 2CGRH 2EE6A 3QFJD 3GKWL 4XNQB 3KLHC 3FO9B 4Z0BH 2Z93B 3VMNA 5L88H 4RAUB 1J7VR 4F9PA 3DYPA 1Q1JL 2DWDB 3BDXA 2YD3A 1HILA 3MRLB 5C0AE 1UWXK 4PY7B 4QF1B 1KTLB 2Y7QA 1GPOH 4OM1L 1T03H 3EYVB 2FSEA 1WBYA 5CJBA 3U36B 4TSBL 3SGDI 4KDVA 5HHMD 3SE4C 1WBXB 4Y8DC 4HX1A 4K71C 1G7LB 4FXKB 5FHBH 1A6PA 4E41D 1JMZA 5D4QA 2DJ4A 3FQNA 2GSIB 3HMWH 5DUMH 1GXEA 1IFHH 5ALCH 5I1KL 4I9WE 4P5TD 1U42A 3W9EB 1M71A 1J1XL 2ESVD 1B88A 4Y5XC 5DHVB 3EYOB 3HI1A 2VXUH 2XZZA 2VABA 2Y5TB 3C8KA 5FCUL 3LSOB 4WU5B 1SYVA 4EOWH 4R97B 5JR1L 3LS5L 1RULH 4MDJA 5ACZB 3IJSB 3G5VB 4P2RA 3VXUB 1LEGB 4J12A 3FFDB 1JWMB 3P9LA 4ENED 2R1YB 1ZS8B 1HH9B 3ZZ1A 2FHBA 1HI6A 2OL3H 5D1ZA 3LQZB 3ULVC 1JNNH 1FFPA 5KAQG 2C4XA 3ROOB 1C08B 2A73A 32C2A 4RGNB 2P5ED 1X7QA 2IALB 4ODVH 4ELME 2ZOKA 1SMOA 5DR5H 4LHQB 1WBXA 1WWBX 3VG9C 3UEZA 4X7SL 4JE4B 5LAXB 2WBJC 4RGOH 5HDBE 5H37G 5IMOB 1S9XA 2R4RH 2VR5A 1MY7A 3E1F1 3HCVB 4HUXA 1I7ZB 1KLGB 5E5MA 4NHCH 1RJZA 5IW6B 1KB5B 3MBEC 5FDWB 4PJEF 3H9SB 3D2UD 3MBXL 3QUMA 3RGVA 1NFDE 5DK0A 5IFJB 5I1CL 4OGZA 4U1GB 1MRFL 4ZFGH 1NC4A 4NC1C 5MP6L 1S7UA 2YPVL 5CJOL 3ZHKA 3NMEA 3W2DH 3QWRD 4PRHE 4JZJC 5KJRH 1EUUA 5ADOL 4FXGA 4LAQH 5DRWA 2NY2C 4CN1A 5IVNA 3GBML 2GYSA 2UZXB 4YWGH 5K9JH 3SDAC 3IRPX 4M7KH 4LHUD 3MJ7B 4MJ5A 4V2CB 2IMNA 5GS0L 1H0DB 3WN5A 2H1PH 3FO1B 4A2LA 2OL3B 1DUYB 1U93B 1A7QL 5C0GB 2R15A 5GZOC 1X7QB 2B0SL 3HNSL 5EC2A 3T4AB 4K2UH 1I9RL 2VQTA 3QH3B 4E0RB 1BOYA 2C3VB 1BAFH 2OJZL 4U1IA 4MD0B 1G9MC 1W0VA 2DKMA 5IVXB 1UKTA 5C70A 3T2QA 2VE6A 1DL7L 1FFOA 5I15L 5KN5B 3HNTH 4JFQB 3ZYZA 2X40A 4G42B 1PY9A 4HK3J 3ABZA 3LB6D 3JV4A 3NH7L 3SQBA 1YEEH 1HHIA 1KSRA 4TSCL 2X1OA 2F5BL 1FNSH 2X05A 3TH3T 2UWEA 3GMQB 4ODBD 3RP1A 6FABH 3G6JE 5ECJE 3SGKC 2HWZL 4DN4H 1OGTB 3OJDA 1Y6MR 1CE6B 2HRPL 1MAML 5IF0B 3RPIA 1G84A 3ALPA 1AH1A 4N0UB 3W82A 4XNMB 3CDGA 3EOAB 5E99H 4LLMA 4AEEA 4OLUH 5MEQA 4LCYA 2BXZA 1GGIL 3HMXH 1QFWI 3EDFA 5D1ZD 3K81A 3FN0L 4CW1B 2WBKA 5FYLH 2H9GA 5JXEC 4PS4H 3IETA 3KS0H 4PBVC 3CK0H 4Q6IC 2P5EA 4K3DH 4C56B 2HTLC 4G8GA 3V6OC 3FJTA 3ZT7A 2DQTH 4R90H 3SQOL 5FYJH 3AS3A 4HX1B 2GFBB 2VDOL 4IMKC 4H0IA 4U1IB 1SYSB 5DTFA 5GGVL 1H3VA 2IWGA 3D0LA 4C54A 4DVBA 1O7SA 3NFSL 3GGWB 4QOKE 5L2KB 4PJ9C 4PR5A 4XP4L 1M71B 4LAJH 5C7XH 2FJGB 2P8LB 5FYLE 4J3OC 1GVIA 4ETQB 4M1DH 2CXKA 3F58L 5EZIL 2VLME 4XVUC 4JFDA 4M5ZL 4LASL 4IDJH 1G9EA 2UVEA 4FFVC 3EO0B 1KB5H 4KTEH 4L1HA 1LEGA 4YO0A 4DAGL 2ATPA 5HYSB 5LGJA 1IL1A 1EPFA 4QTIL 4RAVB 5E4IA 1HH9A 5B39A 5HD8D 3BWAB 3UTQB 3WHE1 5J13B 1A6UL 5EFIB 1H3PH 1PD6A 5ETUA 1R3KB 1AI1H 1NCCL 2H2PC 3SDAD 2FL5A 2PTUA 3FT3B 4UB0H 2BRRL 2GIYA 2L7UA 2CRMA 2YPVH 2IANA 3Q2CA 5CJOH 4EQ3A 3C08L 1HYSD 1RFDL 1AXTH 1E6OL 4HH9A 3BMVA 1WK0A 1EHXA 1NBQA 1ZHBB 4YIQB 4YBQD 3BP5B 5D2LB 1REIA 4JM4L 2E6JA 3PHSA 5AUMA 1PX4A 3ZKMD 1IGTA 1EGJA 3LZFH 1U8KA 4JRYE 1YZZA 4NO0B 4ZUWB 1CFNA 3RNKA 2XN9B 4Z7WB 3IFOB 3PWLA 5FUOH 4ETQA 4O02L 2BVOB 4UTBL 1KIPB 3G6AB 3L7EA 3RY6A 4D9LL 4WUUB 4ACPA 4GG6E 2I5YH 3TZVC 1A6VH 5C6PB 4Z95H 4HSQA 4CVZB 5J11C 1B0GA 4H25A 1MRDL 2M8XA 1C5BH 1KENL 1EZVY 5DA4A 4XX1G 4EI5A 3EJYC 3C8HA 3MZTA 1BD2E 3BWAA 2WLYA 4PB9L 2YPLB 3CVHH 3DVFA 5I1GH 2L4OA 3MQIA 1YNTB 4AIXA 2VLRE 3O8XB 4X9GA 2E7BA 1NAKH 3LS5H 4D0CA 4EXKA 3RNQB 4P3WA 4CDHA 3VJ6A 4HULB 4QCIA 5AZ2H 5K93A 3MRQA 4QWWC 5CEZH 4PJXB 4NKDB 1VGKB 4GMSH 4G80A 4XVJH 1F6LL 4Y1AD 1J8HA 3PL6C 2X44D 3O2DL 1A5FL 4YAQB 4KK8D 3WL9A 4OLUL 2FIRT 3MLTA 2E5EA 3BOVA 1P6AB 3DURB 1D5BA 4S1DD 4O9HH 3ETBF 3P4NB 3DPBA 5GS2D 4GSDH 4YHZH 3VD5A 4NQSB 4YK4C 3T65A 3VXMA 3MXWH 5C07B 1Q9WA 4J3WA 2NXZD 1P84J 2X1QA 5JXAH 1RUKL 1WZKA 4ZNEA 4KK6D 2YD8A 4G8EA 4DOHE 5ITFA 4RZCA 2K1MA 3RIAF 4Y4KB 3IAGC 4HWZB 2F58L 4H1LH 3TPUB 4TVPE 3HN3A 2VDKL 3WJJA 1HQRB 2FBOJ 4EI6B 1VACA 2HFFA 3W5NA 2R1WA 2W60B 1NUGA 2CDGA 4Y19B 1KGCE 4YEEA 3VE0A 4C56A 4K94L 3VG0H 2ITCA 2VDLH 3SDAB 5F1IA 3STLB 3FTGA 4Y4FD 5GISL 1FBIL 4JY6B 3BQUC 5HSFA 4ZYKA 5F7LB 4KHXH 1UZ8B 4NKDA 2D0HA 4GKZA 4Z9KB 5EU6E 4HWEH 3E6FA 1G9ML 5FKPA 2BOBB 3QZWA 3VDAA 1YQVL 1QQDB 5C08A 2F58H 5IOPB 4HWBH 4PJBA 5F3BA 5D1XD 4U3CA 2X9WA 3ARWA 1QUNA 1QRNE 3HR5A 4AT6A 1NEZA 5GJTH 4U1MA 1NCWH 3MNVA 3EOBB 3WIIH 5DSCA 1P84K 4XH2A 4ZAKC 1FZJA 3BZFB 1A14H 5I1LA 3AM8C 5EBMB 1N7MH 1EVUA 4PRAB 1HQRA 4EI6A 1X5HA 2E7LC 4L4TD 2AK1H 2EXWC 4LNRB 5KTEH 3O6LH 3OKEA 3Q5TA 1QFWM 1ZT7B 5I17A 4E41A 2X6MA 3A6CH 5HHOB 5KVEH 2Z93A 5E94A 5D7JB 5F89A 3ZKXC 4PP2A 4NJAL 1IM9A 1S9WB 5B3JE 4O4YH 3IU4H 4KZEH 3VH8G 3VG9B 4Y5YA 1RHHA 3KYKL 1WCBA 5ESVB 1BZ9A 3VDBA 3ZDXE 2JTDA 4IMLB 3DROB 3QISA 1T21A 4ZAKA 1G0DA 5AYUH 3BRDA 1QKZH 4KK9C 4AG4H 4XPTH 3CFBB 1S78D 3VCLB 1BBJB 3B9KD 1V7NL 2B1HL 5D5MF 4G7VL 3EOBA 4R9HA 4FZEL 3UJTL 1G7PA 3I3DA 5CUSL 5C07D 4WVRA 4TNWK 4BSWB 5CKGA 3RL1A 3O41A 4YPJA 2P43B 4JDVB 4TTDC 3S37L 2X4SA 2UYLB 3I2CL 1J87A 3B2VH 5FKAB 3WLBA 2X4RA 1EAPA 1I7TA 3UTSD 2J12B 4P2OC 2YXMA 5J1AB 4M1GH 1F11A 5CGYC 3F6IA 4I18C 4ODUB 3EYQC 1I8KB 2WUCL 4MXQD 5A2LH 1BQUA 1NMAL 2BSTB 1Q9LA 2FB4H 3C8DA 1FYTD 4V2BA 3MRQB 4XP1L 4F7PA 5HTSA 4JANB 4PJCE 1ZT4B 3FRPA 1XGRA 1U2HA 3RX7A 4I0PA 2RR3A 4WWKC 3TZVB 4LSRH 3I3EA 3VXOA 3SDXE 1K4DA 2HKHH 2YRPA 5GIRA 1F4WH 4KJQD 1S8DB 2ZUTA 1R3JA 4AYFA 3JWOH 3QEUB 1E4XL 1MFBH 5E1AA 3QWOB 2BNUA 4GRLB 4WTXA 4UDUA 2XWTB 2BY0A 5H35A 4QHNB 2NLJB 4R4BB 4W4OC 5B4MC 5F7HA 2Q7YB 3OR7A 3RU8H 5JHDE 4K8RH 1XH3A 1XIWC 3W0WE 2F54E 5GS1B 3OZ9L 3ULVE 3S37X 4G8GD 3RVXC 2YK1H 4MJIE 2CDGB 3O3BB 4BZ1L 4HKBA 4DCQA 1G6VK 4I48B 4GW1A 4PY8I 2AKRA 3DUUA 4GXVH 1A7BA 4GS7B 4EN3C 3KPLA 3AAZA 2AS5M 1RZIA 4P2RD 3LKNB 4LCCB 5C0EB 3WHXA 2I27N 1KJVB 3PWJB 4PRNB 2B5IC 1GIGL 4XB8A 1JNHA 4YE4H 4JZNB 3FOMB 3MJ7A 5F3BB 4E41E 1Z6JT 4PJ5A 2HRPH 1L6XA 1NAKL 3RY6C 1NCAH 5B8CB 3BGMB 5HI5D 1TJIL 2F5BH 2HTLD 2H2PD 3S6CA 4TQEH 3PNWB 3QEUA 4GRWH 4XH2B 4GKOA 1KXTB 4IOSD 4H26B 2IPUK 1JFQH 2DMBA 2VE6B 5FM8A 4J3SA 1AXIB 4JFEE 3R06B 4JFQA 1FO0B 3LRSB 1AHWB 4UUJA 3IFLH 4JO3L 1BFVL 1EHAA 2IPUG 4O58L 4UOW1 1HHIB 4JG0H 4JQIL 3SPVA 3VRJA 1F3JB 1MFCH 5FYJE 1AQKH 4HKBB 4XNXH 3L3KB 5A3IC 2H2SD 2DM2A 4YH6A 1FG2A 1OWRM 4JRWA 2XA3A 2KQNA 5C08E 5DS8B 5EOTB 4Q9CA 3QDGB 4XVTH 4L4VD 3RU8L 1TVHB 3HC4L 1V3MA 3PGCB 5CWSB 4PJFE 4RA3A 3CDGB 2KZWA 3KPRD 2OTWA 2KDGA 3V0WL 1JRHI 3T8XA 1RZ7L 3CMOL 4XNYL 1NANI 4JHBA 1WCBB 1JPFB 5E2UL 1NGWB 2P8MB 2Z92A 1QBMH 1HKFA 3TBSB 3DV6A 4C56E 5IKCA 4S1QH 4NDMA 1DBBL 3JVGC 3ES6B 3NIDE 3EJYD 1BFTA 4OSUH 4Z7VB 3RA7H 1D7FA 1Z0MA 1E6JL 4PUBL 2CLRA 1G7HB 1QOKA 2NY1B 4UT6L 3OGCB 2FIKA 3ULVL 2X1PA 3NA9L 3AS1A 4NZRH 3KXFA 5H8DA 4JM2D 5EOCL 1IEBB 1WWWX 2NY5L 5MEPB 3WLBB 1L6ZA 1HDMB 5IG7A 3O6FB 3C09C 1I85C 3AMKA 2D9CA 2IAND 3ISWA 1TTFA 1M1SA 2AJZB 1JGVH 1KOAA 4P5KB 4LSPH 1C7SA 1NMCB 3BO8B 4BK5A 4G5ZH 3FB8A 1MFAL 5MENB 4BJLA 1INDL 1TTGA 3CFEB 4Q2ZA 1H3GA 2ERJC 3JTSA 2EC9T 4A6YL 5C0DB 1XFPA 1P4LA 4LPWA 1MAKA 2X4TA 1FL3B 3UPRB 2W38A 4JM2A 3C60B 5LKNA 5TQ2L 3VXTA 5E56A 2ZSVB 2Z8RA 2GK2A 3CFCL 3BP6B 3EDKA 1QKZL 3B43A 2VERN 1A21A 2FYYB 3G6JF 3P77B 3QO0B 4NSKA 3VXMD 3CMGA 4YUEL 5FYLL 5IFHL 2NTSP 2Q87A 1IQDA 4YHYB 1ROWA 3QWOA 4GRLA 4XCEB 3U30C 3WUWA 5D2LE 2N56A 3GSUB 5TF0A 2GTZB 4UINL 4PLJC 2ICCA 1IEBA 5GQBA 3OR7B 1T2QL 1VERA 5MEPA 4Z95L 5GS1A 4X6DF 1ITCA 5BS0A 2XN9A 2Y1VA 2IQ9H 4MD5A 1MIEL 1MHCA 1R5WB 2PN5A 3V95A 1U91A 4JRYA 1CLYL 4N0UE 5A2FA 3QHFL 3AU1A 2MQ3A 1KV3A 4YJZL 3M07A 1FO0H 3GMMB 1B0RB 3QEHA 3GSWB 2D3VA 3KAAA 1YMMA 3W9EA 5C0BD 2OS7A 3K2MC 3EJZD 1IILE 3GSVB 1WITA 4RX4D 2VLLB 3MGOB 3EW3B 4LVOB 3UTSE 1BVLA 1Q1JH 3VXTB 4MJ2A 4DZ8B 1AXTL 1E6OH 1NAMA 3QIWC 4JRXA 4N8PA 5GJTL 5I8EA 4M4RA 4ZG1A 1CF8L 3F7PC 5GXBB 3PWNB 3I6GB 3S35H 3T0EA 1G0XA 2EXWD 3MV8D 3TYFB 4C4KO 1JTOA 4JQXA 2D4FA 2A0LD 4YDVB 5AYQA 2Q8BH 2D4DA 3TA3C 1YQVH 4QXGH 4YWGL 1SBSL 4GKSB 4KI5D 3LN5B 2LFGA 3TV3H 4D0DB 3P9MA 3H0TB 2WP3T 2R8SH 5GSVA 4NQED 1OLZA 3LRSA 4JO1H 5T1KD 4OZIF 2I9LA 2V5YA 2PKDA 4OZFB 1JHLH 1FBIH 3P9WB 3LEVL 4MNGB 4S0TD 3ALWA 2EDEA 1I4FB 1IAIH 4G9FD 5KANG 2IC2A 4HJGB 4ZFGL 1AQKL 4XNXL 5LAXA 1IM9D 5C07A 3CU7A 1OD9A 1N4XL 2EDNA 3G04B 3HNVL 4J4PC 1J18A 1TZHA 4KHTL 2CK0L 4HWZA 4FFWC 4RMSA 1LO3L 4ZAKD 3NZHH 4L4TB 5J4MA 5KVGH 1F2QA 4TQEL 4R4NC 3TBSA 5JHLL 3CDCA 4J1UA 1W0WB 4OJFH 5I1EH 4L9DA 4LMQI 3INUL 5B3NA 3M17A 4PRID 1J88A 1MJUL 2X89D 5HI4C 3LEXA 5TE6L 5JW4N 4OUOA 4R0LB 5I30H 4MYWB 1P7HL 1RUPH 3OR6B 5A40E 5I1IH 3VD9A 1WCQA 5F44A 3WO4B 3ARFB 5DQ9B 1JWUB 1FV1A 4ODTL 5FGBC 2CKBL 3WJJC 1A6AA 5CEYB 4MNGA 3NACL 3CFCH 4EVNA 1Z9SA 4NUGH 1FVDB 1F3RB 5DVLA 3ARBC 3PP4L 3IDGB 3SGJA 1WAAA 4Q2ZB 2QSCH 5I1LB 43CAA 1KENH 1EFXD 1KXVC 1KPRA 3DHMA 2JELL 1N64L 4Z0XB 2J8UB 5D7IE 4U7SA 1IC4H 4IDLA 1AQDA 5T33H 1LE5B 1X5YA 3OKOA 3TGXA 4D0BA 2Z31A 1IGYA 3QAZB 5CILH 3UX9B 4NQDE 5D7KD 3O8XD 5BO1L 1KACB 1CFVL 4CU7A 5CSZB 1FZKA 2VQUA 3LZFL 3EYQD 3MRGB 1MPAL 3BESR 4M6NL 3TIEB 4C59B 2LU4A 5HY9A 1OL0A 5LCVL 1X5IA 4PRHA 2PO6C 3TZVD 3F8UB 4ESKA 1SVZA 3GIZL 5T1KA 1PBYA 2MJWA 1M6OB 4Y16D 5EB9A 5JQHC 3P4OB 1TQCB 1CLZL 5E9DD 3KNBB 4NC1E 3KDMA 2ESVE 2J2ZA 1Y18B 1KULA 3FQWB 4MQTB 5I9QC 4NCC2 3AVEA 3AC0A 4N0CD 5FCSH 4AMKH 3QI9A 4ODXB 4XXCC 3P0VH 1UEYA 5HVHB 1RZ7H 4XNYH 4DKDC 4XWGH 2R56H 2EYSA 1MAJA 3QR2A 1EFXA 1KN4L 4YDLB 1FFRA 5EU4A 4PJ5D 5J1AA 4PGZA 1NEZG 2PCPB 3HPLA 3VFOA 2QQKL 5JIHA 3FQTA 3GBNH 5I1JH 5SX5K 3HE7A 3VFWB 3VDCA 3HAEB 4OCSL 1YN7B 4M7JL 3E6HA 1L7IH 2QHRL 4GG8A 5TH2A 6CGTA 5JLZB 1G1YA 2BVUA 2YN3A 4LOUC 2FGZA 2VOTA 1YEKH 2NY0C 1ZT1A 4JPKH 2IPKB 5HDBF 1X4ZA 5C09A 3EYVA 4M48L 3ZMRA 4G6KL 4WI7A 3T0AA 4HIXL 1ED3A 3TA3A 4BFIA 5C0ND 2APTA 2DICA 1CI5A 4HCRA 3IDMA 4XGZB 4WI9A 1RZGB 4TOYL 3MLRL 4YFEA 3CNKA 3KPPB 3MRRA 1RJYA 4QF1A 4KKLD 5C3TA 1AE6L 4NIKB 5DC0A 2HJLB 4LLAA 1BECA 1FRGL 1MFEL 3VWJD 4NO0A 4ZUWA 3RNKB 4ZQKB 1IFHL 4WO4D 5JTWA 4YDKL 4WTWA 1P4BL 4NKQB 2LQRA 5IJVA 1OW0A 1PEWA 3SDDA 5CFHA 3KPOA 4MSWA 5I19H 5HGHA 5T1LB 1WGOA 3MR9B 2OLDA 3EO9H 3DX6B 4FQ1H 3FQTB 3FQNB 1QPPA 3MRNA 1AGCA 1XR9A 1OWWA 1RIUL 3C5JA 2WWKT 1JBJA 1GRWA 4M61B 4R0LA 4RQQA 5LCVH 1MFDH 2VLJE 5BCAA 1JN6A 4AL8L 2WINA 3MUY1 3WE6B 1FFPB 3QNYA 5KW9H 4M6NH 3DX9A 1IGCH 1K8DB 3GSOB 3ZTNL 1E28B 2GK0B 2YOCA 2WM0A 3GSQB 3L7FA 4Y5YC 3IJSA 2P5WE 1CK0H 1J5OL 2I26N 4OLZH 5SWZA 4U1KB 3WS6A 1EAJA 4M7KL 1VGEH 4BSVB 4ODHL 3C9NA 3C2AL 4NGHL 4NZTL 4D8PB 3OKYA 1U8IB 4XVSH 5DFVD 1EO8L 5CEXA 2K7PA 2V5SA 2YA1A 4EXPX 4KY1H 2ADIA 4JM2C 3W2DL 2XZAH 4WHYG 4Z7UB 3GBLA 4P2QB 3L95B 5CJQH 3VXRB 5DD3L 4I3SL 5J8OA 3PWVA 2LVEA 1IEHA 3KPMA 5T1LD 1CG9A 1IRAY 5ABDE 3K8MA 4M1GL 5BZDB 3CZJA 3GM8A 1D9KD 1MI5B 1FC2D 3ROLB 5E5MB 1MHPH 3V6FA 3UTOA 5DT1L 3PXJA 4Z7WE 1BD2A 3O2WL 5K9KB 1JRHH 1G9NL 3I9GL 1YN6A 3RRQA 4OLXL 2EKSB 2OL3A 1CGWA 2YRZA 1S7UB 3SDAA 2XI9A 3RWHB 3JWDH 4FQJH 5GGQL 4RMTA 1FORH 2DLFL 1QSEB 3FQWA 2QADD 1A7NL 3OKNA 4KJPC 5BRZA 2VSCA 4HZLA 3O0RL 3HFML 4MNQB 1Q94B 3LQMA 1NANH 3AROA 4HCRH 2VLRB 1NH6A 5FYJU 3MLYH 3G9VA 5LGKA 4CVXB 4QNPE 5C0GA 1OAZL 1ORQA 4QRTB 3WO3B 1TQBC 2GCYB 2QKIA 1DBAL 1MI5E 3MBEA 1FVCB 4WJ5A 2XZCH 2PYEB 2AJZA 3TM6A 3U1SH 4GXUN 1J8HD 3LRGA 4XMLH 3C2SA 3VFNB 2J1KA 2OZ4L 3ROLA 1KN4H 5HHVL 5D1QA 3WJLA 5IR1B 1V05A 5B3JF 1ZSDB 3OPZH 3RTQD 5SX4H 1LP9E 1LP9F 4JN1L 5HVWA 4XBEL 2OMBA 2P8PA 4LNRA 4W4NA 1YN6B 1A7RH 4ZTPL 3SKNA 2ZCHH 4X9FA 2YD1A 1LO2H 5E2WH 4OLWH 2LAGB 3BRGC 1XGPB 4B53A 3EJZC 3MJ6A 4HIHB 4HBCH 4DZBB 1I3RB 3V6BR 3JWOC 2GJ6E 1RUML 1G7JB 2I9TA 1S7SB 4ZUTB 1CD1B 3AGVA 4JFDE 4PJIE 3IDIA 1EJOL 4AEIH 3ZT6A 1A7RL 3IFPB 4ONGH 1DQMH 1EH9A 3RX8A 4PLOB 2RGSA 4K8RC 4FHBD 3TN0B 4KQ4L 5HHPA 3CUPB 1OAXL 3BUYA 5IESH 3BZEB 3QDMA 5C71A 2I60H 1UB6B 5E6ZA 5C3LD 3TFKC 2MCPH 3GJFA 2UY6A 4NQCE 3SDDB 1KFAH 3CLEL 2EEDA 4L8BA 1OP3K 4IDJL 4YNYB 3VRIA 4MJ4A 4PJ7F 3MR9A 3SO3B 4A6YB 4F3FA 2P5EE 1JNLH 1YEHH 2HG5A 1AKJA 3C5JB 4OLVH 3WDIA 4WI4A 4G43A 1T0NA 4HUUB 5T5FL 2FX7H 3BEWB 3T0EE 3U46B 2F5AH 4P0DA 1T5XA 1BJMA 3OL2A 1NLBL 1AY1H 2AXJA 1O0VA 3WE6A 4WUUE 2HP4A 3MRCB 5F9JA 2CRYA 1S9YB 5CJXA 3DRQB 4ZDHA 4JFDB 1GYAA 3CC5A 2BJMH 1AC6A 4L3AA 4K7FB 1M7XA 4M8QB 3BD4A 1T0MA 3WFBH 1IT9L 1YMME 3OQ3B 4X4ME 1CD1A 5E8DL 1FGVH 1ZT4A 5I1IL 3CX2A 3TYFA 5T3XD 4YHNB 1HINH 2QADC 2VN7A 4Z8FH 3L5HA 1HHKA 2V7NB 12E8L 3DX7A 4X6CA 1U8KB 1AFVH 2ZUUA 3EUUA 3EJJX 2OBGA 4NWTL 4Z7UA 5I16A 4PJEA 1MCWW 1U8PB 4UOW0 2JIXA 4HH9B 2DYPD 2BVQB 4U1HB 2Z35B 3QXDA 4JHWL 3VRIB 4PJ8D 3RY4A 4PREB 4PJ9D 5BZDA 1DBML 1H8OA 4P49A 4P3DA 1F8TH 1TJGL 2BNQB 2ZCKH 4JPIA 1IAKB 2VJXA 5AG9A 4WO4C 5DFWH 4XTRD 4OLVL 1S7TB 5K9KA 2J5LB 4BUHA 1I9JH 3V6ZA 1BIIB 3MO1A 4JFFB 4LLVA 4HKXA 4DOHB 5HYJD 4NUJA 1OQOA 4YXLH 3THMH 3QFJB 1AC0A 2AKRB 1K5NA 4ONHB 5FUOL 1T1XA 3BKJH 3MV7A 2YR3A 4MS8C 1E4JA 3FQXA 3S4SG 1OAUL 4R2GC 4ZPVB 5E9DA 1ONQB 4AH2A 3O6KL 1OAXH 1KJVA 4MCZA 4HUMB 5IBUG 5CJ5A 1CGSL 4WGVB 3H42L 1DR9A 3IXTA 5ESQA 1LE9B 3FT2A 1E0OB 5HGAA 3U4EA 5EULV 5B21A 1WF5A 2V7NA 4V1DB 2A73B 3OAYH 4NM4H 2DQGL 3BRFA 2XQBL 4FQCH 1CZ8H 3DARA 2ADGA 3RNQA 4Q9RL 3FAWA 5EIIA 1ZLVH 4IJ3B 4HC1H 1B4RA 1FVEB 5F6IC 1RIHH 2NTFB 2HLFD 4I2XB 1MCQA 2EE3A 4LLUA 4P3DB 3IFLL 4QHMB 4OFVA 2P42B 1IAKA 1KB5A 4K3JH 3SGKA 5HPMA 4FQIH 3U79A 3DYMA 2BXYA 1VADA 5C86A 1SJEA 1UWGH 2XPGA 1TMCB 5TDNA 2EDXA 5IHLB 2YD2A 1CIDA 1WFUA 1NC4B 4Y2DB 4HIXH 2N7AA 4OI9A 2YZ8A 1U3ZA 2YMXH 3O81A 3WFCL 1I3RA 1BOGB 3N9GH 5EN2B 1MCBA 3O6FC 2ZUQC 1T1ZA 1DBKL 5JW3H 3SDCD 4ZO8A 3UJJH 2Q8AH 3LKRA 5DHVH 4GKZB 1H3TA 1TZGL 5JO5B 5EU5B 1EEYA 5FUZL 4PRPE 4AQOA 3DO7B 2VR9A 1RSFA 1NGWA 3FN9A 4CVWA 1B2WH 5ILTH 2GTWA 4RGND 2FCBA 4Y19A 5LGHH 2DAVA 7FABL 1OPGH 3EFDH 4LK4A 4OF8A 5C2BH 3VE0B 3MRPB 1P53A 1JGLL 4ZFZB 4M7ZB 4Z7VA 3GHEH 1JJUA 3P4OA 5CD5D 4F80A 3LHPH 5D5MB 4MD0A 4URTB 1FE8L 2J8UE 1MCIA 5DYOA 4C57C 4I3RH 1QNZL 4L1DA 5FGCB 1WT5C 5M95B 4UV7H 2EYSB 1FPTH 5JDSB 5KSAC 1A3LH 1KB9J 2R56L 3PWPE 4OTXH 3QT2A 1JPST 2ESVB 4R7NB 5C0AA 1J0HA 5JORA 2IH1B 4MVBC 4ODSL 5D6DC 1YY8B 4XT1C 3TA3D 1BREA 4LLQA 4DN4L 4H20L 1IM3A 2H45A 3LKPB 1OGAA 4P5KA 5CCKH 3HPLB 5HI3C 4KY1L 2W0LA 4TULH 4YBLB 1T0MB 1KJMB 2AQ3A 4YHOL 1I3UA 4JEGB 2BNRA 3W81A 2DJSA 2H3NB 4FQIL 3VD4A 3JTSB 2R1YA 1I3VA 4NOFA 3VA2C 1G1CA 3DGGA 2DQJH 3V9FA 4XPGH 4PRAA 3MLSH 1LO0H 3BVNB 1IGMH 1C1EL 2O5ZH 4XNUL 2VXQL 1KBGH 1DQML 5I76A 3ARED 3H7BA 4BKLB 3LQAL 3S98A 2X2YA 2JLLA 4N1CA 1WFNA 3OKEB 1DTUA 4JFXB 2EZ0D 4OSUL 5HHQB 3L9RA 1X4YA 5I17B 3MFFB 3SE9L 4UTAH 5F1OB 5KG9B 2DL9A 1GGYA 3T0ED 1QRND 1GZQA 2JIXB 2AJUL 3OX8A 3BP4B 2GFBA 1WC7A 5HGBA 1UC6A 3IDMB 4AL8H 1RZGA 3QEGH 4G8FA 1H5BC 5JIIA 3UTTD 1WEJH 1A9BB 5DI8A 4F33A 1KXQE 3T2OA 1CGSH 2JJUA 1WWCA 3DI3B 4YC2B 2EIDA 5IEKA 2NYYD 5FF6A 2X4RB 2ZOLB 4BFBD 3BQUA 4R7NA 4ZO7A 2F19L 5C0AB 4LPUA 1U41A 3SDXA 1K6QH 2J5LC 1BBJA 3JUYA 1U8JB 1I8KA 3V4UL 1JK8B 2F54D 4AG4L 4ONHA 1J8KA 4J23A 1IQWH 1Q9LB 4M62L 2QBWA 3WS3B 1YDPB 4H88L 1OAZH 1JHTB 1DQQB 1Z9LA 5EUOF 4FXGB 3HR6A 5INCA 1HN1A 3BN3B 4HIIA 3B2UC 1SHMA 2ZJSL 4QRQA 4APQC 4WW2C 5J12C 2ATPB 5HYSA 1VHPA 3DX8B 3Q6GL 4BA8A 4XPHH 1JWSB 2Z9TA 5IB2A 4LBEA 4LSQL 1NFIA 1I7TB 2VLLA 3ARVA 1CGYA 3MGOA 1QFWH 1RIVL 1YYLH 1B3JA 4PBWD 3V5DB 2YSSA 3T04D 5FK9B 4PJHB 2H8PA 2AERT 1MJUH 3ULUC 4HWBA 4HDIB 2CLVB 4NWTH 4TVPD 2VZSA 3MRDA 4F7MA 3X3FH 1UFUA 2NY1D 5D6CA 3DSNA 5F70A 4N0RA 1EEQA 1S7VB 3H0TA 3P9MB 2R39A 4EUPG 5BXFA 5DMIH 4MJ6A 2AXFB 3TO4B 4P5TB 2JJSC 3TPKA 5DJYB 2V7HB 1IGTB 4M00A 2C4FT 3ARDA 5CMAB 4GXVL 2HJKA 5F7FA 4PJIB 3NAAL 3SKUD 5CGMA 2FATL 4MVBD 3H3PL 5F7UA 3TESA 2OP4H 5JIPA 1OGTA 5TQ0L 1JHLL 3AAZB 4OGYH 1RZKC 3IGAA 3VXUD 2VC2H 5IW1B 2MNUA 35C8L 4PP1D 4JLRB 3H3BC 4L4TA 3VXQB 4G7YH 4ZTOH 2R29L 3HI5H 1M7DA 2ZPKL 5JW5A 1W0WA 3GMRB 3FB6B 4HAFA 1U8QB 2A74A 3KYAA 5GGUB 3T1FA 3LS4H 3G5YB 3ARQA 1AGFB 2W07A 1UB5A 1CVRA 5A2KH 1P7QB 5BRZB 1F42A 4DVBB 4MB5A 4LEOA 1C1EH 1A4JA 1P7KA 4O5LH 3MCLL 4I77L 3FOMA 1UA6H 3TIDA 3H9SD 5ICZB 3QRGL 5DQ9A 2V7HA 1PFCA 3RZCA 3OXSA 2IH1A 5DJ2A 4OF0A 5CILL 1HOCB 1HQ4A 3P4NA 3K8KA 5IVZB 4YHZL 4MA3A 1FVDA 1T2XA 5CCKL 3O4OB 4QRRA 3QUZB 2CMRH 4LSVH 1MIEH 2XY1A 2FO4A 2VXVH 3GSRA 3RWCB 1DLFH 3JWNC 5I2IA 5HDQH 4OFIA 3I6KB 1KCSH 4Z7NF 1UJ3B 3I6LD 43CAB 4RMWA 4MWFA 5HJ3A 1YPZE 3MODH 1DVFD 3DGGB 3QDMD 4JLRA 5B39B 2GW5A 3AB0C 3ILQD 1EJ6A 4JFEB 5TQ0H 5B38G 2EDDA 4GMSL 5F96H 5DRXB 4ONFH 2FL5B 3PV7A 4JRXD 4LPVA 5LQBL 3MCKB 3D6GA 5AYUL 1DZBA 1GGUA 5EOTA 2O5XH 5LJYH 3S34L 5FO7B 1NUDA 2O61B 3G08A 2P4AB 1A02N 4PJ9A 5ILTL 3IVKB 3ZSSA 4KKBD 2BOBA 3QZWB 1P7KB 3VXME 1C5BL 3IDJB 1MWAA 2ARWA 4JKPH 1FHGA 3R8BB 4X6FA 3BQUB 5F93C 3U4BL 3HG1E 3KJ6L 3O9WB 4MQ7B 1MEXL 5IFAL 3FKUS 3FMGH 3P0YH 2AEPL 5ANMA 1YC8A 4LFHD 4U1MB 2FJHB 1JPSH 4O2FA 4PRIA 3QI9B 4ODXA 5CJ8A 2BNQD 1RUQH 3PWUB 4QRQB 1CD8A 3KPSD 3SDYH 2CO7B 5C0RH 1CDCA 3C09B 1I8MB 2PTTA 1BWMA 3ARRA 4MAUL 3WEXA 1FLRH 4PJFF 4KKAC 4OZGA 3I50L 2BRRH 1GZPB 4AEFA 1MUJB 5F9WC 1YN7A 5JPMA 4NSKB 4N9OB 4E42A 1Z3GH 2EYRA 5FIEA 5BVJA 1P7QD 5FGRA 4YPGA 4OGAC 4WFHD 1FNGB 4AIOA 4KK5D 5FYKH 3ULUE 5J1TC 3T0WA 2G2RA 1EEUA 1U3HC 4UILL 4ZOAA 4FFZL 2J6EL 3S35L 1IVLA 3DX7B 3GI8L 4PV8A 2LAAA 4U33A 3W9DA 4L29A 2ED8A 3ZTNH 4KTDL 1S7XB 3RDTA 4S2SB 3GUTA 1JHKH 4PTUB 3O4LD 3GHBL 4JY4B 1MJJB 3BGAA 2Z91A 2FEDC 4HUVA 4FNLL 2IH3B 3MLSL 1DUZB 4L9LB 5INDA 4TVPL 5FECB 4WGWB 3TPUA 5FKAA 1QFPA 3DTXA 2XG4A 5F1SA 1NGXA 2OTUB 4XP9L 1C5DA 3VFGH 4JHWH 5DQDH 3SN6N 1D6VH 4JRYB 3HZVA 3GSNB 4JFOB 4O9HL 4QGTA 4EDXA 4ODTH 2GAZB 4UT9L 5D96C 1JV5B 5C9JA 3LIZL 3T4YA 4U6VL 3NABL 5E6YA 3LEYL 4MXWH 4XCNA 5EBLA 1FCCA 5ID1A 4K55A 1T7ZA 3JVGA 1A5FH 1HHGA 4H0GA 3GSVA 3I6LE 2XXCB 5IFHH 3A6BH 5E8DH 4UT9H 1MCRA 1R24A 2E3VA 3T3PF 1CBVH 4X4XA 5KOMC 3P73A 2J88H 1DSFH 3O9WD 3RWDA 4UDTB 3UPAA 2DQUL 3TJHC 4X7TB 2P24A 4XP6H 2QL1A 3CPLB 2BSRB 1F4HA 1B4JL 3VFVA 1TZIB 1JZ3A 2ZWLT 2EIEA 4X4ZA 4GFTB 5EWIL 2KQMA 3GRWA 4UU9B 4X98A 5ERWA 3VXNB 1TZHB 1LD9B 5C6TH 1NJ9A 1T4KA 3KPSB 4P23C 3QUXD 5JW3L 5IEHB 1DBKH 3HZYB 3LN4A 2EYTA 5ALBH 1JHKL 4Q9QL 4OAWA 2ZCLL 4UTBH 3OMZA 3VFMA 3MMEB 2NW3A 5TJWK 4Y5VC 2G75B 3L5XH 5HHOA 2QJDA 4JFOA 4IRJB 3MV7E 2KBGA 3FO2B 3BIKA 4KKAD 2AEIT 2I60L 2OQJB 3LV3A 5F9AC 5MENE 2FZ3A 1G6RB 2G9HB 2O61A 3FRPG 4NZRL 3S9DB 3MROA 4RFEB 2ICWB 1HHGB 5EU5A 3FQRA 1R5VB 1F90L 3NCCB 1I7UB 3KHQA 4PJ7E 2B1AH 2GTWB 2IADA 2MSPA 2V5RA 4QXUL 3C8KB 2PO6B 4OGXL 1SYVB 2DMKA 3R0MA 4WHTB 1SY6L 5DD5H 1T3FB 1LDPL 2LTQB 5EPMB 4M9OA 2VLJB 1Q0YL 2O26U 4NC2B 1PKQB 3N85L 1HKLL 1U58B 1B90A 3NN8B 3CSBA 1MCHA 2ADJB 2GKIA 1RHFA 1FO0A 5IB1A 4DK3A 3GI9H 5LXGL 4MA1B 5JORB 4X6EB 4FQPA 1A6AB 3QUKB 3U1SL 3BDBA 3SPVB 3AXLB 2DTMH 4LLQB 1EK3A 1X4XA 4X7DC 4E5XA 2BHYA 1T6WA 1J11A 3TYGH 1D5IH 1Z2KA 5J6HB 3KLAA 1FYTB 3U4BH 4KRMB 3H2WA 3RDTC 3RVTD 3ZTJH 1DEEB 1L9NA 3HG1D 3P0GB 5CP3A 5FDWA 2WWMD 1EX0A 1KJ2A 4NRXA 4UIMA 4UINH 3PF2A 3PUCA 3L3JA 3VFUA 4DKEH 4LP5A 3K2UL 1OTSC 4NJ9H 1HWGB 1P69B 4LQFH 4I0PC 4V1DD 3N1MC 3HRZA 4LFHG 1NFDA 3BPNC 1K4CB 1EO7A 4EOWL 2PYFA 1QFUH 2PW1B 1AFVL 4MNHA 4S2SA 3GUTB 1N2RB 3JWDC 1F4AA 4Z8FL 2AK1L 5DLML 3MRFB 4Y2DC 5HY9B 3QNZB 1BGXH 2VZ3A 4RIRA 3GSXA 4L5FH 4OV5A 5ALCL 5I1KH 1QLEH 4XCYA 5I73C 1DN0B 4ELMA 3HMWL 5DUML 5HDQL 4G9DA 1AD0B 3OKLB 4P2QD 4WCYH 3EKCA 2BJML 3P4LA 5FYLD 4U0QB 3HZVB 5BJTB 3UTPE 5E2VH 1U8LA 2ED7A 5EA0H 1D9KB 1MI5D 1PZ5A 1NDMB 2FBJH 3VFWA 4HBQA 4EUPA 1CFSA 3HUJB 4TUOA 3MCLH 4I77H 4LCWA 4HG4K 4P59L 3WYRA 1FZOB 3ARXA 3QQNA 5L8LB 3CCHA 3DOSA 4PP1C 3AREA 5DK3A 3CAFA 2UWEB 3GMQA 1EMTH 3EYSL 1IAIL 3P73B 5GJSL 5L88L 1K3ZA 3S4SB 3QNXA 4YHML 5GJSH 5DWUL 2Z0BA 1JTTA 4LGPB 5FYKL 4P4KA 4M43H 5TGBA 3HLAA 1E4XI 2XFXA 5DJXA 3RGVC 1S7VA 4U0RC 4M03A 1NFDF 1OOAA 1OM3L 4BH7A 1JGDA 1QO3B 2HVKA 4LLDB 4K23H 4PJGB 1ZTXH 5DJYA 3N1QC 4P2YA 3MJGX 4RAHA 4DGVH 1OCWH 2DBLL 5FEBA 2XTJD 3S8WA 1ZA3A 2C1PB 2PYED 5D1XC 5FYKD 1GCFA 4I13B 3NAAH 2NY5C 1KYOJ 3BIKB 1JYNA 3GDBA 3GO1L 4YFDB 4YK4B 5L2KA 5CWSA 2BHUA 2HLAB 4LSTH 4BQCA 1GAFH 3OAUL 3HG1B 2FX9L 2FJGA 5HHVH 2P7TB 5C92A 2UUDK 2DQEL 3FQRB 5IBLC 4RMVA 3CCHB 4U6HB 3DX9B 3QHFH 3MUHL 1UVQB 4U4BA 4YBQC 1KN2H 1OD7A 2BDNH 3KGRA 5BMFH 2BVPB 3BWUC 4GAYA 4CBPA 3RVVD 4DTGH 1ZVYA 2AJXL 1F58H 3T0EB 3AY4C 2YEZB 3VFRA 2CIIB 5LWYL 3KYKH 1P7QA 3BHBB 1XR8A 2NY3D 4ZSOA 1XF2B 4PRHD 4JG1L 4GKSA 1XGUA 2FWOA 4LEOB 4RA0C 2AABL 2HFEA 3MV8E 5AZEH 5KSUB 5SWSD 5AAWA 5GS0D 3SOBH 4KTYA 4YGVB 4OCNC 2EKJA 3TIDB 2AJXH 1A6VL 1FORL 2HVKB 3MLVL 1IE5A 3PQYD 1OAKH 5ANME 5T3ZD 1HHHB 4P46A 4F7TA 4LLWA 3ZYOA 3GK8H 3W39B 1F97A 3WIHA 4XP5L 4B41A 4KAQL 2DKUA 4I0KA 4U1GC 5SX5H 1ZK9A 1G7MB 1QBAA 1KIQA 4FQLL 4N90E 2LV4A 3RBGA 5KN5A 3SDDC 3KR3H 1EEZA 4NFDA 5F7EH 4RBPK 3CFIC 3SBWA 4NCC1 1C12A 1DLFL 4WFGE 2XYCA 2EIZB 2I25N 1QACA 5CIPA 5FV1L 5KSVA 1GHFH 3MXVH 4PGBB 2EDJA 4XAKD 4KK8C 4DGIH 4H1LG 3M17B 4JFYB 1KELH 2FYYA 3P77A 3QO0A 4NZUH 4KZDL 1QSEA 1GPOL 4OM1H 4TVSa 1YPZA 1F90H 5FUCE 3V4VL 1EEYB 3DO7A 4YX2H 2EDOA 4GAJL 4MXVF 1EBAA 3NVQA 1NSNH 4OT1L 4J8RA 4UAOC 2YPLA 3ULVH 5MI0C 2XNAA 5D1QC 3R8QA 3WJLC 4R96A 3RGVD 2FEEL 2DLHA 1U95A 2DIBA 3N0PB 4G9FB 3C5ZB 2J8UF 2VITB 1B6DA 3EYSH 3B6SB 3F58H 5EZIH 1P4IH 1GHFL 3BPOB 3D69A 1VGKA 4PJ8A 3JV6B 1Y6KR 4IRZL 4P23A 4DWHA 5K59F 2EO9A 3QHZH 4PR5B 1N64H 4OZFH 1LO5B 2A6KA 3KPQB 2WMPA 1DQTA 1XEDA 3DBXA 1KCVL 2GEEA 5SWQB 3WFZA 4CVXA 1KLUB 3Q6FB 4QLRA 4PGDA 2YPLD 3F12B 2Y07L 4NM8L 2NY2D 5CIPB 1PG7X 1V7NH 3RDTD 3RVTC 3HS0A 3U82B 5DQJB 1Q9WB 15C8L 4OF5A 1FP5A 2YXFA 4K3DL 4DFIA 2GT9A 1QLEL 3O2VH 1EUTA 1MJ8L 2UV3A 5GGTH 2Y6SD 2ZUVA 4RGNE 5KSBE 4RMRA 3D87B 5DJXB 1GGIH 1VACB 3X14B 2C9AA 4P2CG 4PRHB 3ARFD 2G2RB 4PTTA 5AZ2L 3CX5J 5F72S 3BZEA 1QFUL 5T1DL 3A67H 1MJ7L 4IS6A 1HZHL 2XZQL 3WFCH 1UACH 4JKKA 4WWKA 2GJZB 1HZHH 1S7SA 4ZUSB 3QXAB 4OJFL 4ZYKB 3DWTA 3QXVA 5MI0B 1UWGL 4WV1A 3S35X 3KPRE 5J3HC 4G6JH 1MH5A 4GS7C 4EN3B 4B0MM 4DFHA 1UZ6F 1GAFL 3OAUH 4TVPH 2BX5A 4KDWA 1NGYB 3DBXB 3L3OA 5I1JL 2BCKA 1RVFL 3WS6C 3S88L 1EGJL 3G6AA 4HF5L 4G8IA 4NN6C 2R2EB 1FNEB 5T5NF 2F19H 3BJ91 2VAAA 3UTPD 5GGRB 3WO4C 2F8XC 3OXRB 1HNFA 3T1WA 4WHCA 2VXTL 1LVEA 3MLWL 2BK8A 2R9HD 4HW6A 4M93C 3ECBA 2Q86B 2M26A 2VABB 3MLXL 3MGAA 1KCUH 2DM3A 1QLRB 3TVMD 3O6KH 1RZ8A 2LABA 3CC5B 1CICB 3UZVB 3QSKB 4UB0L 4WW1B 3SO5A 4IRSA 3VG0L 4NYLA 3R0NA 5AWNL 4PREA 2W1NA 3DXAA 4XNUH 5CGYD 3EGSA 2AK4B 1RJZB 4ZO6A 1OTUD 2IEPA 4JQVC 4EZMA 4M3KB 2ERJB 5DMKA 4JQXC 3U7WL 3SDYL 2R0LH 5MERA 1A6ZB 4MLIA 4M4PA 2A1WL 1F8TL 1TJGH 4X6DB 4YHIB 3L3HA 4LLVB 4ZFOL 2AP2A 1UENA 1YEIL 4X80H 5BQ7B 4J6RL 1RZKH 4QRRD 4KKNA 2FECL 5HHOE 3VFMB 2PYEE 3MV7B 4TSAH 3MMEA 4YHPA 1S5HA 1FNEA 1KJ2H 3RL1B 1IMHC 1NMBH 1LEIB 3I2CH 4OKVA 4NKOA 2BOCB 3TBTB 4Q7DA 3VGHA 4KJQC 5ESQB 2EO1A 1YY9D 2X7LB 2IQAA 2FHCA 2VDOH 3TVMB 4W68A 1K8IB 2NY0B 4L3EB 3P40A 4F7CA 4QWWD 4PBXA 2J8OA 3MRHB 5LQBH 1RJCA 3L7FB 3P30L 3KDMB 1DQLL 1AGFA 4JDTL 1FVEA 1RK1A 3B8YA 3PWPA 2Z4QA 2B4CC 2Y4SA 4PJ8B 1TFHA 3K2UH 1A1NB 3GB7B 1CN4A 1H15A 3HMXL 3QJFA 4KU1A 2A38A 1LE9A 5D5ME 1H9VA 3O3EA 3IU4L 3V5HB 1DCLA 4UIKL 4J3TA 5EZOH 3QI9C 1U93A 4BQBA 3P2TA 2YMXL 4XI5D 4YDLC 2OTPA 3IU3A 2VXVL 1RZFH 2FD6L 1Q72H 3BT2L 4MA3B 1LGVA 3AXLA 3UZEA 3R1GL 3MFGB 2DTML 1SM3H 4EUPH 1QFHA 4TPRH 1QZ1A 3S36H 4X99B 2GT9B 5JXED 4GW4B 3HAEA 1WJ3A 3O6MH 5KVMC 1DEEA 4OIIH 4KQ3L 4PJGE 4U31A 2NY5H 5AAMA 1HHJA 4HJJH 1A2YB 2W0FA 1MIMH 1ZT1B 4YHYC 4XXCA 3ZKSD 3QIUC 3QA3A 1CLOL 4ETYA 3G5XB 5MHSD 2IPTH 1LDPH 2NXYC 3BPCA 1ZMYA 3VI4E 5D5MA 4N9GB 3QUXC 1JYVA 2DLIA 2GSGA 4N0UA 4MNHB 2QSTA 2B1AL 1N2RA 3D48R 1JGEB 2Z4QB 4G7YL 43C9B 3SKOA 1JL8A 3MLWH 1EO5A 2B4CH 2XN9E 4WI3A 4CRPA 2NZ9C 5CLWA 1RUAL 2NMSA 1OAUH 3PHOB 2UY7A 3ARUA 3DNKA 4HZAA 4MHHG 4G8GB 3UC0L 1U9KA 1QSVA 2R1XB 5D71H 2E8ZA 5I18H 2C5DC 4ZS6D 3MUZ1 2AEQL 3HE6D 1PAMA 4FQ2L 3MRNB 2BFVH 1OSPH 3B9AA 3FCTA 1IL1B 3TBVB 4R8WL 4XP4H 3SEPA 1GGBL 1QBLL 1S9VA 3CLFL 4JY5H 1N0LA 2CDFB 4FS0A 2WAHA 2HT2D 2V6HA 5C08D 4HIEB 2DTSA 4Z7WF 2A6IA 4XBPB 1SM3L 4X7SH 4S11A 3DHJA 1CLYH 3SKNB 3G5XA 1TJIH 2BVEA 1NL0H 3L3KA 4WCYL 2XWJA 1KPUA 4HIHA 3VGAC 2YS4A 2X70A 5JMOC 2MTPA 4Y4FA 3G9AB 1CDJA 4HQQL 4ISVB 3PWPD 5I8CA 2NY3B 4C58B 3QUYB 4W6WB 4PGCB 1JRHL 4CMMB 1BPVA 1A9BA 3LPGA 3MRBB 5J06A 3O8XC 4FMKA 4POZD 5DMJB 3B9KC 3CUPA 4JKMA 4WW2F 5CEXB 5DMGD 5IKCB 1CFTA 1WBYB 4Z7NE 1YJDH 1IQWL 4Z7UE 3SJVD 5KG9A 15C8H 3BPLC 4TTGA 3V4UH 4QKXB 2VDML 2C1PA 4X9BA 5DQDL 5I1HH 5FDYA 3WS3A 2F74A 1S5HB 2BNUB 1AY1L 2V9TA 4I2XE 1UCBL 2F5AL 3S96A 2YD9A 2V2XA 3I84A 4R4BA 3BAEH 4MMZC 1KEML 4TRPL 4X4MA 5L8KB 4QT5A 4P4KC 3PWLB 4U05A 4F8TA 5GRXG 1JGVL 4I48A 4L3EA 4XAKE 2H8PB 1I1FB 3LSOA 4GAFB 3MSPA 4WU5A 3QCTH 4JM2F 4WUUA 2BVPA 5IUSA 4W6YB 2A1WH 4WI6A 2H32B 3FHQA 4JDZA 4LARH 1R3LA 3EYFA 1WICA 5ELIA 3H9ZA 1PG7L 3WL9B 5EO1B 1V5JA 2FWOB 3LVEA 5E6IC 3NFNA 1P2CA 4TNVF 1R24B 3MTRA 4GXUM 4YHOH 1RFDH 1QHOA 3HC0B 4AIZA 3BGFC 4HDIA 1A1MB 1T83A 1NBYA 3RKPA 2HJKB 1YEFH 2V5MA 3UPCA 3OB0K 4OLWL 1RJLB 1T7VA 3QDME 2APFA 4YHKL 1OTSD 5C6WH 5FO8A 3PNWA 5IB3B 1CE1L 5D6DA 5KSBA 4P2OD 5GGSA 1PX3A 1J8HB 3HCVA 2NNAB 3MCG1 4OTXL 3MOBH 5DJ6A 3MBXH 4WI2A 5E70A 1UYWL 3KPSA 4UV7L 3BH8B 4KGJA 5EIQA 1T2JA 1UQSB 4PB0H 25C8H 4R2GD 3KPNA 4NCDA 1JYXA 2Y5EA 4GBXA 4J3VA 2P45B 4Q0XH 5E8NA 4ZOCA 2IMMA 5MEOA 4D9QE 3ZDYE 1I1YA 1N5AB 3QWQB 3HRPA 3BPCB 5I1DA 5GGTA 3DMMC 1RVFH 1YEJH 1BF2A 4XAWH 1MEXH 2IFFL 3HI6H 1CL7L 2W9DH 3MREB 4MJIB 5C7XL 1XCTA 3SOBL 2D7QA 5CBEB 4HIJB 4KJYA 1BWWA 2EICA 4OD3L 2H32H 2X4OA 4I3GA 5SWSE 5GGVH 4F7EB 4M7LT 1ZWIB 3S5LG 5JW5B 4K7PY 1MRCL 5TFSH 4R96B 4NO0D 2MKLC 4GQ9L 2DQUH 5GGUA 1A7PL 1RULL 2EDBA 3WNMA 3MJ9L 4RMQA 2ADGB 3I6GA 3U0PA 2C3VA 4ORGA 4LF3B 3UAJD 2FO4B 1PY4A 1RIVH 5IB3A 4YDVA 1GC1H 3ULUH 1QSEE 4MDIA 3LD8B 4XI5C 3TWCH 5E2TL 5IQ7H 5BRZE 1EFQA 2ZJSH 4LSTL 1MJ8H 3O2VL 5EBGA 1ZV5A 3OAYK 4JO2H 2HTKD 4IRJC 5CBAB 4YHKH 4X6BA 4PJCA 1ZT7A 4QHUA 5EOQH 1YEGH 2DWEB 4KI5F 4XP9H 4FABL 5DVKA 5HD8C 1NUNB 1ZTXL 2IGFL 2YPKB 3B83A 1YMMD 2QADB 2Y06L 3GNML 2DQCL 2Z8SA 1IBGL 2YD4A 1IZKA 4GUPA 4RBPH 3L3JB 3UBXI 4HIJA 3WD5L 1P1ZA 2ZKHH 4KUCF 4KH2A 4LARL 1ZGLP 1R0AL 5ISZA 5IHUL 2UVFA 4LMQE 1ADQA 5IMLA 2K9UA 5F9DC 4ALAH 1I9RH 1U2CA 1NUFA 4M02A 3MV9E 5D7JA 5F89B 3MV8A 3LQAH 1S5IL 1T7YA 1W8NA 5DJZB 1PDKA 3ZL4H 5K59E 3KLSA 1R3IH 5GRVL 1TNNA 3QQ9D 3SGEI 3TNMB 3S96B 3UTSB 1MH5B 4EN3A 1MQKH 1F2XK 2YUVA 2IGFH 1TVBA 3IT8D 4XPAL 4YQXL 2PTTB 1T21B 3NCJL 2CH8A 1I8LA 2EDQA 4KUCD 1DBMH 1NC2B 1F11B 2WK2A 2X4QB 4GKNB 1FAKT 4APQD 2VIRA 5DURD 3RHWF 4O2FB 4UZGA 5DHYB 4N5EC 2DB8A 3LDBB 3O41B 1A3LL 3AB0B 2WBJB 1FPTL 3LKQB 4Y16C 2YKLH 2UUDH 3L3DB 4YHLH 4I0PB 4ZD3L 5FO9A 4JVUA 1A4KB 1F5WA 1R3HA 4KAQH 3U48A 4RDQG 1GL4B 2B1HH 1QLRA 5EU6B 1A7PH 1UADC 1FGNH 3IF1B 1SJXA 3IAPA 4XCFL 2AEPH 1VFAA 5JHLH 5JPMB 3ZKMC 2VO5A 4OCXL 4XMKL 3OF6D 4OB5L 3TIEA 2E9BA 5GGSB 3DXAB 5DJ8B 2IH3A 4Y19E 5INDB 1F4XL 2WP3O 3U2SB 1X5JA 2QHRH 3RTQA 4P2QE 4PJBE 2F8VA 3IDXL 4OZFA 3WSQL 5I1AA 2MPAL 2O5XL 5I71B 3W9DB 2OR9H 4XPFH 4RWYH 3QDHA 3V8OA 1RURH 1MCPH 2AK4E 4HUWA 1KN2L 4KPHH 2F8OA 5BQ7A 3B5TA 4NQDB 5IGXH 5C09E 5DURB 3ZYIA 4LCWE 1N5YL 2EC8A 1UG9A 1MSPA 4L9LA 5H35B 1WZMA 4HK0B 2R0KL 3L5IA 2NW2A 1CGVA 3JZ7A 1CE1H 1X6NA 2RAMA 3QFDA 1LWRA 1UVQA 3WIIL 2W9EH 4EDWH 4PJHA 4EJ1C 2LU7A 1EERB 3IJYB 5E5RB 5HHMB 2A0LC 5I8KL 2DS4A 3MA9L 4XXDB 7CGTA 1JWMA 3WDJA 1X5GA 4LRIC 4PFEA 3ZE1F 1HCVA 4NO5A 3LCYA 3QYCA 1U3HD 3BW9B 1I1AC 4N8CL 1ADQL 1H15B 2VXQH 4M5YL 1EDQA 4X6DE 5DGRA 1JNHB 4JO4L 2AJSL 4EN3D 1J0JA 1UXSA 4PJBF 2MMXA 4MJ6B 1S7WA 1AHWA 4UT7L 2ESVA 1CGUA 1MELA 3X11B 2VWEE 1C16A 4XZUA 5D2LF 4YHMH 4D2NA 1UM4L 4P46B 4F7TB 3L5XL 5L0QB 3RWDB 4WW2A 3SE3C 3VXSA 1Q72L 4YXKL 5JDJA 2NW3B 1S9XB 3LKSA 3MLUL 4M1DL 4XWOC 5FYJD 1MCLA 1OB1B 2MFNA 3DUSB 1DN2A 3RIAK 5D7LE 4ZS6C 3W11D 4KJWC 4M6OH 3K7UA 5C6TL 3GIVB 4NWUH 2JCCF 3BZ4B 4Z77A 3NFPA 3MOAH 5JW4M 1R5VA 5DJDA 3SE8H 2EIZA 4P9HH 3SJVA 1BQLL 4PJAF 3H3PH 4DW2L 2VLKA 4NDMB 2CR3A 5EORL 3RWIA 5F1IB 1CICD 2J88L 3STLA 4RRPA 3U0TB 4WFEE 1MHHA 3SKJH 3PGCA 2HH0L 4IOFC 1HINL 5FOBA 3QUYD 1KJ3H 2OMNA 2OTWB 3QG6B 4MS8D 1JPFA 4AJ0A 2XNAB 2D2OA 4I18A 2KKQA 4RFNB 1SQ2N 1U6AH 3QUXB 3K3QA 4ZFFA 1NGZA 4X6EA 1J05B 1HXYB 4M8VA 3GSQA 5I1EL 4J4PD 3GMOB 4D9RD 4X80L 4P48A 3MV01 5T1MA 3LDBC 3RVUC 5F3HB 2IANE 4NQDD 5D7KE 1LO3H 1JPTH 1PKQA 3ZE0F 1YNKH 8FABA 5MENA 4XVSL 2BNQE 3S5LA 2Q20A 2H6PB 3F5WA 2EXYD 4WFGD 4NRXB 1FL3A 3BZ4A 3MLUH 3QDAA 3QO1B 3K1DA 4GBXD 4H88H 4WEBL 5HI3D 5KSAA 1U3YA 2V2WB 4ZUUB 4PUBH 2AXGA 2XICA 5T3ZH 1QA9B 1JE6A 2RIKA 3LEVH 4E5XB 3BO8A 1IGIH 1KC5H 1CZ8L 2ZSWA 1EHLL 5IESL 4UBDC 4X4YB 2DN7A 4LHJB 1IQDB 2ZKHL 5HYEA 5KVFL 1BBDL 3CGTA 3QG6A 2AW2A 2VXTH 1MCNA 3GSUA 4GW5A 1BBDH 4CW1A 5ESVA 4PJGF 3DI2B 3TO4D 5HYJA 3UBXB 3ZHLA 1DN0A 3CD4A 3L6FB 3C08H 1BJ1H 4QOKA 5KJRL 4MQ7A 3F7RA 5I8KH 4QRSA 3SE9H 4HFUH 2NY4D 4PJIA 4BFIB 5TF1H 4PGEA 1BVKA 2FNBA 3QEQE 2VNCA 5TDPB 3QEQB 4YXLL 1MCKA 1RY7B 4HZLB 4YDKH 3TNNA 4BQ9A 4EEEA 3MRRB 2ICES 2WW8A 3DIFB 4UNUA 5IW1A 3QNZA 4PG9B 5CHNA 4KWUA 5KS9F 4JGUA 4PG2A 3HUJA 1A9EB 2J7LA 2CQVA 1RPQA 4QTIH 3FOLA 1FO0L 1LP9A 1DLHA 1KIRB 2PXYA 5IROA 3KLDA 1V7ML 4F9LA 4QT5B 3CXDH 3AREB 4L8SB 5IGXL 3M8OH 5TE4H 5J6GA 2Q1EA 2VKXA 1FC1A 1ZGLA 4JRXE 1I7RA 2V2WA 1ORSA 1FAIH 3B5GA 4JRXB 4H20H 1BMGA 1OF2B 3O45A 4U1JA 3WSQH 5D7SH 1FIEA 4HS6A 3V7MA 1B0RA 3QEHB 1MHEA 3G6JA 2H32A 4RQQB 4X4YA 3ZDZE 1NLDL 1M05A 4PJAA 3TCLB 2WINB 3PDGA 2Q86A 4U1NB 1AGBB 4PRPB 3O9WC 1P2CB 4NFCA 1QO3A 4P5MA 1NQBA 3P30H 3GSOA 3V7AG 3LHPL 1AGEB 3MZGB 4MA7H 4QOKB 1K4DB 5GIRB 2IANB 3QRFM 1T6VN 4Q58C 2MKWA 1CT8B 5LGHL 1Q9OB 3JXAA 3G5ZB 3V2AR 3HE6B 4MCYB 5D2LA 3TT1L 3REWA 4BZ2L 5E24E 5FECA 4Y19D 2Q8AL 3QDMB 1LP9B 5E7FA 1JUFA 2CRIA 3IKKA 4Z7WA 4G5ZL 5EU3A 2ADIB 3C60D 4AMKL 3GRWL 1E4XH 4U1SB 3D3VB 1KPVA 3D3VE 3VXPA 4GBXB 5ISZD 4W6XB 5MEOB 1ZA3B 1ORSB 2AAVA 4LKXA 3TBWA 3B8SA 2IBBA 1YECH 2Y72A 5DZLA 5KAQF 1J1OL 4CVZA 1IKFH 4LVEA 1XF3B 1ZXQA 3ZDZF 3QUZC 5FHAH 5C0EA 3S3SA 4PRIE 2V9QA 4FFVD 1MCCA 3ZTJG 5D1XB 3FRUA 1INEH 1XF2A 4H8WH 1ADQH 3IB4A 5KSUA 3H8NA 2N1KA 5DMYA 4PJ8C 3GHBH 5AD0A 1S5IH 1G9NC 4AEIL 4KZDH 1L0YA 2FLBT 1BAFL 2OJZH 3BQUD 2HMID 4HFUL 4FZ8L 2NY6B 3ILPA 4PV9B 3GKWH 2GUOB 5GPRA 3GMOA 4NM4L 1X5KA 2BMKA 1YMHA 4PJXA 2Q7NA 1N6QL 4OZ4A 5KS9E 5JPNB 4KVNH 4WDIB 5F3HA 3CPLA 3WD5H 3HI5L 3M1BA 1RK0B 4NKMA 5HGDB 2V2TB 3R06A 3ROOA 1Y6NR 1UCBH 3F7VB 1D5XB 5I9QB 5EO0A 1RV6X 4FQHB 1K2DB 4Y0GA 5T3ZL 4EVNB 2APVA 5IQ9B 3Q3GB 4PYGA 5T3XE 1CDHA 4HWUA 1QYGH 1PG7W 2X42A 3GJFH 1OAKL 2QQLL 1MCPL 1J1PH 1DVFC 4NBYB 5DGQA 5KZCB 4JO3H 4PJXF 5CSZA 4NQXB 5IQ7L 1C5CL 2RCSH 4HKJA 1T1WA 1TVHA 2CO6B 1HHJB 3ULUL 5DMIL 1S7TA 4N1EA 1RUQL 4OZGF 1ZLWH 4YZFE 3WHE0 4NN5B 1W72B 5LWYH 2VL5A 2Z92B 5F7WC 5D8JL 3EZJB 3H6JA 4W4OA 4PGBA 1M6OA 4XNQA 4FQJL 4WU7B 5JW4R 4QRSB 2PNDA 2WIMA 3C5ZA 4UNTA 2NY3C 1BFSA 3FAXA 5IFAH 1IKNA 1PSKL 1A8JH 2C26A 4AH2B 5E8PA 5TDPA 4X8XA 1DJSA 3UP1A 5EPMA 2FIKB 3QQ4A 1BFOA 3UCRA 2ADFL 4HT1H 5K9OB 2OL3L 1T89A 1H3WM 3H3KA 5HXMA 4HFWA 4QRPE 4J8RB 1BQHB 2PXYB 3QCUH 1C5CH 2RCSL 1KB9K 3U36A 3NPSC 4PJDE 1I1AD 1NGPH 1IJ9A 4YC2C 4L8BB 1K2DA 1G7LA 4PJ5E 2JCCB 4NKIL 2DI7A 4L4TE 4Z7OF 3VI4F 5E7BA 2GY7B 3GZKA 3FCTB 2VAJA 2ZNWA 5GHWH 4QHMA 5JOEA 1UYWH 2WBJA 4NQEA 3N1FC 4F57L 1LO5A 3KPQA 4OM0H 1OP5H 3VFPB 4UIMB 3L3DA 2X4PA 1UM6L 1VADB 3OKDA 3DRQA 4H5SA 4L3ED 1XIWB 1OARL 3IDNA 3TBYA 2A6DA 4PJFB 4OFDA 2Q6WB 1RMFL 4TNWF 5GGVY 5DQJA 3RL2B 4MDJB 5ACZA 2X70B 1Z0NA 1AO7D 4YDIH 5EBWA 2MCPL 3W0WA 3C5ZD 4BUGA 3ARGB 4G6AD 5CSGA 1A0QL 4NN5C 1BF8A 1JPGB 3KPPA 3WKNA 1QSFA 4R6UA 3W5MA 2NXYB 1RJYB 2F15A 5T3XL 2VXSH 3GNMH 2CUIA 1NDGB 1U8MB 2C3GA 1MCSA 2NY4C 1EXUA 3DGCR 1MF2L 4XCYB 3AFLA 5I16B 4Z0BL 4TULL 4KRNA 1YEGL 2H26A 3QULA 3VRLE 4LVNC 3DETD 1SYSA 1RZFL 3V0AC 4NQDA 3TLRA 3PDDA 1KG0B 4P2OA 1I7ZA 3AU1B 1HIMH 2VAAB 4KGLA 4ZTOL 1XR9B 5D7LD 5F7EL 1YC7A 3GMMA 5SV3A 4M61A 1S78C 2D7NA 1JZ7A 1CL7I 1EA9C 5DHXB 3BUTA 1RI8A 3HTLX 5F88A 4JFFA 4XVJL 3SCMB 3MLRH 3LPWA 3OKDB 2DLEA 4Z18A 4NUGL 3D85B 5DDHA 1IKNC 5EU7E 2R4SH 1HH6A 1QRKA 5CINL 3KPTA 3LQAC 5GZNC 4WHTA 3FQXB 1WWAX 4MA7L 4I4WA 4MNGE 4HMDA 2YZ1A 1DBJL 2UZIL 2HTKC 5CJXC 3CVHL 4UAOB 3D2UA 1XGRB 4NO5B 4OFYD 3CH8A 4JHAH 5DD6A 4OIBA 1QSFB 4MJ5B 5I30L 1S3KH 5HGAB 1F00I 1SEQL 5HGDA 4I9WD 2HFTA 1MRDH 1X6LA 3U7YL 4BH7B 3A0OA 3FO1A 2W59A 3BSZH 3L5WA 1PLGH 5HI5C 1TPXC 4S0SD 1BX2A 4HGMA 4WY7L 2MHAA 3JWDL 3MUGB 3Q5YA 4HPYL 4JKLA 4IRSB 3QDGD 4J6RH 3VXSB 3TP4A 4J3UA 4KKLC 4NYLB 2YRLA 2VN4A 1G7IA 3BISA 5FB8A 5J6HA 5EUOB 5E8OB 4OIAA 1E4KC 1VDGA 1LEIA 4Y5VA 1KCRH 3NA4A 5DC4B 2WBJD 3F7YA 2G5BB 1OSPL 1XH3B 4HJ0D 4OQTH 1MHPL 1ZA6B 4WNQB 3NFPB 5CGTA 3WV0A 3NA9H 3L3HB 1L7TH 3O2DA 3B9KA 4OUUA 2ZG1A 4F7CB 4YDJB 1JK8A 5C07E 4NNPL 4K23L 3W0WD 3STBA 3BEVB 2DYPA 2R2BA 4LCUB 2P49B 3PWPB 3BX7C 1MHHB 4MHHI 2EDYA 4H25B 1XCTB 2RB8A 3OHXB 5E2UH 3NIFE 4NGHH 4UQ3A 5JO5A 3BHBA 1SBSH 5EC1B 4EI5B 1NFIB 5D9SB 2X7LA 4JAMA 5FM4A 4WEUD 4OV5B 4R26L 3FQUA 1VB9A 3LY6A 2D0FA 4XVTL 5DJCB 1JWUA 1EBPA 1QRNA 4ALAL 4RISH 5CEYA 1EMTL 3NIGE 4QCIB 3CSPA 3RUGA 1HYRC 4L8SC 3D0LB 3L3IA 2FR4A 4HJJL 4AENB 3BFOA 1INEL 2CKBB 1UH4A 1IBGH 4KQ3H 3TJHD 4DUWA 4TUOB 3RFZC 3NCYP 5E4EC 1M7IB 3VMOA 4QHKI 4F58L 5EA0L 3WDHA 5L7XH 1SBBA 2NPLX 3QO1A 3PP4H 3CX5K 3K0WA 5EZJA 3KJ4B 4GSDL 5KSVB 2C3HA 2O5YL 3F62A 5D7IB 2G60L 4YDJA 3EO0A 4RAUA 1NCUA 5D70L 3WIHL 1FNFA 3RIFF 4RZCB 4IBLT 1GOGA 12E8H 3DECA 3OHXA 5TGBB 4FN0A 4OD1L 1JVKA 4U6TA 2E9JA 1NGQH 2JK5A 3KYMA 1I9IL 4LHUA 1U8MA 4WFFD 3IAQA 4HV8B 4NBXB 2ARJQ 1NCDH 5IMLB 2D31B 3MJ9H 3GMLB 1IARB 5HHNB 4M6MH 5EG6C 1JGLH 5GRUH 4MQXC 4G6KH 2VITA 4P46D 5HHXL 4W81A 4M6AA 1U8HA 5TQ2H 4LVHC 1KG0A 4P2OB 1UZ8A 2FJFA 4XHQA 3H9HB 4HPOL 3DIFA 5DI8B 1U0QA 4Q97A 2VRAA 5AUMB 5E9DE 3NTCL 2OJEB 3T0XA 1A64A 1HXMA 1L7IL 3QJHB 3WIFA 4QY8B 3JBG7 5C0BE 3MC0A 4C4KT 2DL2A 1U8JA 1LHZA 5IVZA 4DEPC 3B5HA 1FSKB 4LPYA 4DGYH 4AEHH 2FLRT 4HIIB 4RFNC 4HS6B 1B0GB 3RPIB 5IF0A 4MA8L 3LKQA 4MWFB 5HJ3B 3VFRB 3RGHA 2R0WL 1HI6B 4KQ4H 4U6YA 1S9VB 5EO9A 4GG6A 1OQXA 4LCCC 4UT6H 3DO3A 3FO0L 4M7LH 4PJEE 2YD7A 3ZO0A 4XC3L 1CFQA 5TF1L 3EFFB 1HWHB 1MLBA 4HH8A 2Y9RT 5E1HB 3T09A 4Q9RH 2CK2A 4X6CE 1ZLSH 4YEFA 5KVDH 3MCKA 2XWBB 5HHNA 1MNUL 4LSUH 4PP2B 2OX5A 2HJFA 4Y4KD 4O00A 3AM8A 5E2WL 3QIUA 1U3HA 5SX4I 3QG7H 1CLOH 1Q9OA 4PGCA 3VD3A 5CSBA 4LHUG 2GTZA 2AXFA 4FRWA 3OPZL 1TQBB 2HJLA 4MAYD 4PY8J 4R0LC 3S36X 3MACL 4KI1A 4OV6F 2DQHH 3QUMB 4QTHB 5ICXA 4EIGB 3Q48A 4X6FB 5IB4A 1KB5L 2AQ2A 4U1LA 4O51A 3QIBB 1A22B 1UT9A 1KTRL 4X5LA 4NN7C 1FFNA 5CP7A 5IT2L 1F6FB 4G8EB 4RWYL 4OCYH 1PLGL 5I74B 4YBHA 4FP8L 4DEPB 5BVPL 2FH8A 4MX7B 2EZ0C 1L4IA 1QHPA 3T77A 2A83A 2FDBP 5JA8B 4PRBB 4KK6C 4Q6IB 3NZ8A 3FQUB 3S34H 5DVOA 3JV5A 4NUJB 1WFOA 1I1FA 5IHBA 3EFFA 2W65A 4QHLA 4HS3A 3T1FB 2JB6B 1CICA 1T1XB 3QH3A 3V7AE 3A67L 1N26A 1CCZA 3B6SA 4X7CC 1W0VB 4KFZC 4ERSL 5IVXA 3MLZL 3L3GB 3RWJA 3TH4T 3ULVF 1QQDA 3OJ2C 3QIWA 1MVUB 1UXSB 3PJSA 3U4EB 3QDJD 2GJ6A 3BH8A 4NO3B 2I24N 4ELKA 1NC2D 4Y2DD 4Z7UF 1KJ2L 4U1LB 4G8GE 1ES0B 2ICEA 3QDJE 4DW2H 1F6AA 5IQ9A 1CU4H 4MZ2A 1TJHH 1AKJD 1UJ3A 1KCVH 4X8JA 3QRGH 4MJIA 1K9TA 3TT3H 5I15H 2G5RA 4LLYA 3LMJH 1N4XH 1ZLUH 3OBAA 2M1KA 4POYA 2D7TL 3VW3L 3LKOA 1A0QH 1ZWIA 1C5DB 3HZMB 3FT4B 5E4EB 4LCIL 1CK0L 1K8IA 2UWEE 4K7PH 4Y2DA 5KS9B 1QVOB 4EI5C 3O8XA 2W65B 1I85A 3LOWA 1OT1A 4LSRL 4OZHA 4FQXD 3UTZB 4UT7H 1U8HB 3E8UH 4LCCA 2D7TH 3L3GA 1U92A 1GGCH 3H9HA 3UTTE 4MDIB 2GI7A 5HDLA 1XZ0B 4ONGL 2MQCA 1MWAB 2OSLB 4HFWB 35C8H 4ZAKB 5D96B 2YA2A 4IEFB 2EDTA 3CFBA 1VENA 2DLTA 2X1XR 3D18A 4LEXL 1FLRL 3MBEB 1T1YB 2VH5H 3BMWA 1AD9B 3CZFA 3IKCB 4QHNA 4PRIB 4JO2L 3WFDL 2VISA 1LK2A 4JJHA 3L1OL 2BVYA 1VEOA 5E95B 5LGJB 5ITFB 3D0VB 3D39E 2ZUWA 4WTZG 4Z76B 4PJIF 3ZDXF 3P3YA 1BGXL 4U6YB 3VWKC 2P1YA 3OKOB 4G6JL 3UTQA 2HKFH 1JGUH 1UEMA 3WUWG 4TOYH 4ERSH 1F3JA 3R1GH 4Q74A 2JIXD 1TETH 3BN9D 3U9UA 5TE7H 1GZPA 2ZSWB 3FTGB 2XZQH 1GZQB 5DS8A 2NZ9D 4LQFL 2VDRL 5EZOL 3UTTB 5D2NA 2OQJA 3LV3B 1MREH 1U3HB 4N1HB 4PB9H 5GZND 3UXFA 3HZKB 5SWZE 2AK4D 3BVNA 3HPJA 3IDYC 1U8NB 2P5WA 3TN0A 3UDWC 1RD6A 1F58L 2VDRH 5ICXB 5JMRA 4M7JH 3VXOB 3BP7A 1UB6A 2IFFH 3A6CL 3K4DA 1S8DA 3W11C 1FL5B 4KJWD 4AM0A 5E2JA 3MBED 2HVJA 1KT2B 3EDEA 2VLJA 4WWID 2ARJA 3RWEB 3EIFA 2VXUL 4HS8L 5INCB 4YHLL 1J1XH 3MACH 5DJAB 4NQCB 3PXHA 1CXFA 3MV9D 4JM4H 1DLHB 4Z76A 3QHZL 5FA4A 1A14L 4GJTB 3PL6B 2A83B 1ND0B 2MQ0A 5FA3B 4TSAL 1R3HB 3MRCA 3MA7B 1N6QH 3IRZA 2ATKB 4XCCL 2Y5TA 3EDJA 3GSNA 1TCMA 4XBGA 1Q0XH 4N5UA 5HVHC 3CFDA 2H41A 4M8QA 1EO8H 1H3PL 4I8DA 3FFDA 4XCNB 4FQXA 3SHSA 5T3XH 3TO4C 1IZJA 4IMKA 4O5LL 1TDQA 3D2UB 4IJ3C 4LBEB 2W9LA 1S7QA 5FGBA 2GJ6B 1JNJA 5AWNH 1JI1A 4TYUA 4P5MB 4PJ5B 4QYOA 32C2B 1N59A 5EU6A 5CMAA 1CFVH 2FB4L 2FEDD 4K7PL 3PP3K 3U0WL 4J4PA 1OTUC 4XCCH 2BSRA 3BIBX 3SDCA 4K94C 4ODSH 4X99A 4UQ2A 1G7IB 5FB8B 5F6HI 1MWAH 3K80A 4PJ7B 1QLFA 4V1DE 3TT3L 2GHWB 5C0NC 1UM5H 4L8CA 4KVCL 4HPOH 4U1SA 1ND0A 1OSZA 1QR1B 1T5WB 3LKOB 5C8JA 1R5WA 1OGAD 1YEDB 4HKXB 4OUUB 1U8QA 5T1LA 5HGHB 5GRUL 5KS9A 4XBGB 4UV4H 3RVXD 1URLA 3V6OA 2BNRD 3FZUC 1E27B 3QCUL 3EFDL 3HMXA 4ZPVA 5E9DB 2WANA 1AJ7L 4MB3A 2D03L 3QPQC 4LCWB 3E6FB 4JG1H 2E6QA 5EC1A 5CKAA 4PRDB 1I1CA 1S7QB 5E99L 3TO2B 4JAMB 3FT2B 1CFBA 2CIKB 3G6DH 4GRLC 5CEZL 1S7WB 1H0DA 1DDHA 1BVLB 3FB5A 2XOTA 1PQZB 5C0AD 2NY1C 4NJAH 1C16B 4XZUB 3HR5B 4GG6F 4Z5RA 5TE7L 4FA8A 3D18B 5JOPD 1AR2A 4FFWD 1LO4L 5TPWL 3C6LD 1MRCH 5TFSL 4QRRB 3VFGL 5DSCB 3LKSB 2NTFA 1V7MH 4P4KB 4XNZC 1DVFB 3BW9A 1LK2B 3I6KA 4M1CC 2DQEH 3C9NB 3NZHL 4UDUB 4AENA 4JY5L 4D0DA 4NKMB 1BQHG 4GRWF 1U8IA 5ICZA 2AJVL 3OKMA 1GJIA 3I85A 4OCSH 1D5IL 1UQSA 3X12A 2YUWA 1YEJL 4HIEA 4ZFOA 1L0QA 1QYGL 3BKYH 3DMMA 3EO1A 3P4MB 3VXRA 4ZOBA 4DQOL 2CJUH 3U9UB 2YD5A 2YK1L 2R23A 5D7IA 3MV11 5DRNB 2XQBH 3FN3A 4FFYH 5E94B 1BZ7B 5KSBF 1UWEH 2E7LA 3UTTA 5JNYB 1OB1A 3DUSA 4DUXA 1WAAE 1P5UA 2IAMA 5FOBB 4PPTA 1FH5H 4OCRL 1X5XA 4XWGL 2HMIC 3B3IB 1KEGL 4A2MA 4KJYB 4OZHE 5CD5C 1Q0YH 2P5WB 1ACYH 3GBMH 4CAGA 3VGEA 4GOSA 4FQQB 3TCXA 4MAYA 1Y0LB 1KC5L 1F4WL 1K4CA 1LDSA 3VXRD 1FL5A 3KG5A 3C6LB 3IFNL 4NC0B 3O11B 4ZOEA 2ARJB 3MRFA 4MAUH 1ZEAL 4MNQA 3RWEA 3WUWB 4Y5XB 1I9JL 3GMNB 3HB3D 4NP4H 2OI9B 3GSXB 3LMJL 3MYJA 2X4SB 1ACZA 4OF7A 4WENB 2ITDA 4RSVA 2VZOA 3T0VA 4NZUL 2ZCKL 4NHUA 4QY8A 1VPOL 4RMUA 2A77H 3OSKA 1NMAH 4FOMA 5J1SC 4X5XB 1A47A 5JXAL 3LPFA 2AXGB 4KDTA 3VGGA 3N50A 1OGAB 4OI8A 5BV7L 4GMTH 2BY1A 1KYOK 3CFDB 4OZFG 5CEZE 1FG2B 3BE1H 3VWKD 4YFLI 2BNRB 5JNYA 4O2CB 2H6PA 3F5WB 2EIBA 2JJSA 4MNQD 1FNAA 2DF3A 3L5JA 5HYJE 3RVWD 5IIEB 1DE4B 3QBTB 3ELAT 5DD1H 5IMKA 5F1KC 3ARBD 3OJVC 1TLKA 5I8OH 5FYKU 2EH8H 4XP6L 5HHXH 4UMGA 3ULSA 3I75A 4UNVA 1DQLH 3GHEL 4JN2B 5HHQA 3FO9A 2IG2H 3PQYB 2CPCA 5JR1H 3U30B 4ZUTA 4NPYA 2JF1A 5D7IF 1BM3H 5F96L 2HJFB 5I1GL 5C0IA 1EV2E 3WNLA 2AJYL 1TZGH 2XWTA 2LU3A 1KTLA 4RX4A 2C4FU 3UAJC 1JF5A 4IHOB 3MYJB 5A16B 5T5FH 2DOCA 2ITDB 4CN6A 5IMMA 3DTXB 3T0DA 2ILLA 1MFAH 4N5ED 1N0XH 3SDXB 4L8SA 5C8JB 1TETL 1PKQE 3QIBA 3INUH 2H26B 2OI9C 2X4QA 1N8ZB 3L7EB 5L7XL 5A2JH 1ERNA 1MJJA 3KPLB 5KZCD 3JV6A 2HG5B 1RZJC 1FJ1B 1DQQA 1VPOH 1JV5A 4PJHF 3VWKA 1JZ4A 4WIQA 1O5DT 2R0LL 4KV5F 5EZLA 4JO4H 1WBZA 1JWSA 3GJEB 3BGFB 3F6LA 3IS1X 3T77B 4KRPC 3KHOA 3L1OH 5JIKA 5D72H 3KS0J 4JM2B 3MRIB 2Z31D 2QR0B 3E3QE 1Q9KB 4HLZG 4Y1AE 5DK2B 2YSSB 1UKQA 2VLKD 1CGTA 1NCNA 4LEXH 4LIQE 5CD3B 2JJVA 3HNSH 3O45B 3UC0H 1IAII 3UZQA 3MRDB 5E08H 3LEXB 2WIIB 3V5KB 2V9RA 4KK5C 3VXRE 2VLKE 3FO0H 4M7LL 5FOJA 1QBML 1TZIA 5GRYA 1M05B 4PJAB 1UM6H 5H2BB 2R8SL 1QEWA 2YWYA 2BC4A 4UU9A 4X98B 5ERWB 5BXFB 5A3ID 2IPKA 1FH5L 4OCRH 3MLTB 3PJSB 4YGVA 1AR1D 5A16A 3OKMB 5E08L 4X83A 5IMMB 5EU3B 3ZKXB 1CF8H 3WXVL 1N6VA 5BS0B 2GJZA 5ICYB 2FATH 4UDTA 4HUWB 4QHUB 4NQSA 4LDEB 4Q9QH 5I1CH 3BKYL 1KIQB 4IRJA 5JQ6L 1MIML 1JI2A 4LPTA 4X8JB 1OTTC 5C0RL 3IGAB 5IHZA 2ZUXA 5GS2H 5IBUB 1RZJH 5F6HJ 4OBSA 1LK3H 5B8CC 1QP1A 5D1XA 4DVRH 1OY3B 4D9RE 1JFQL 4P57B 2FBJL 2BCKB 3OGOE 4OB5H 2Z31B 3NGBB 3B9KB 3TN0D 3MRIA 3WFHA 2R1WB 2W60A 1Y0LA 4FTVE 3WFEL 5ACLA 1T66C 3GMRA 2FX8H 3C6SA 4HXAH 1HK6A 1AO7B 3QUYC 2VLJD 5FYJL 5DF0A 2BSED 4JJ5B 1T0PB 1QPXA 3ARGD 5DRWB 4UIKH 4OLXH 5DJZA 1UZ6E 1VFUA 4PJHE 1S3KL 4WTZA 3G6DL 1I9IH 1KF9B 4ZD3H 3FRUB 1L0XA 1JN6B 4OD1H 2YKLL 5GSVB 2DQIH 4FMFA 3NABH 3D25B 1CXKA 4K9EH 1FZMB 4IOIA 4JFFD 4R2GB 1E28A 3TJEH 5EO0B 4POZC 2K3TA 4MB4A 5JW4Q 5E6ID 1T3FA 4P2RE 5BOPA 4APQB 3MNVB 1INQB 2KUTA 4OZ4B 4U1KA 3MOAL 5I2IB 3B9EA 3NCJH 2AK4A 4NQXA 4CU8A 3WNOA 4NWUL 4MJID 4A6YH 5BVPH 2NY7L 4NNYB 5IB1B 1P4LB 4Y4KC 5DVNA 3BKML 3GSNH 4PGDB 4J2XA 4D9LH 3ZYJA 1FSKC 2Q76A