5DO9A

Structure of regulator of g protein signaling 8 (rgs8) in complex with alf4-activated galpha-q
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
314
structure length
314
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Structure of the Regulator of G Protein Signaling 8 (RGS8)-G alpha q Complex: MOLECULAR BASIS FOR G alpha SELECTIVITY.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 117
structure length 314
sequence length 314
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 5do9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5do9A01
1N5JA 1DG1G 1WDTA 2DFLA 5FPYA 4Y0VA 2ZSEA 2GF0A 1IN7A 3HU3A 4BUJA 2O0HA 1XNJA 2BM1A 4W5JA 1ZVQA 4DUGD 3BH0A 1IBRA 3Q5DA 4LBYA 4QGFA 3UPUA 1IAQA 1JR3D 1OLOA 4BZPA 1OH8A 4PC3A 1KKMA 1H8ED 3B1YA 4RFVA 3PEYA 1YR6A 1E9AA 4FCTA 2P5TB 3GFTA 3RRNA 3IBYA 3T34A 1QVRA 2ZRBA 1O3YA 1HT2E 2DFTA 4TMZA 4M1WA 2ZRPA 2FSGA 4R2IA 1CJKC 1R0WA 4EPWA 1N6KA 2WPDD 3GJ3A 3UG7A 3KQNA 3CRVA 4ZKDA 4F4CA 3ZD7A 1GP2A 1JI0A 2O8DB 2IYXA 4AI6A 5DIFA 3F3YA 4Q03A 1C4OA 2ZS9A 3PUYA 4Z8YA 3CM0A 3W34A 3QPVA 1FW6A 5JJKA 1KK1A 2P6UA 1E0SA 1W46A 1NVWQ 3K09A 5FUVA 3FMIA 3KFVA 2JIZD 4TL8A 2IT1A 1NNEA 3K0CC 3U4QB 2Z43A 4KYUA 4M9QA 3OF5A 2W6JD 1G8HA 1KNQA 2G1JA 1Q57A 2BDTA 1MO5A 1ZIPA 4EJSA 4G5OA 4TZ0A 3EA0A 3T15A 2RCNA 3I8SA 1LY1A 2OBLA 1G3MA 3RDPA 1NVVQ 1R10A 4L9SA 4QBIA 2N1BA 5CIQA 2ATXA 3AF0A 4MKIA 3TR0A 1SVMA 1TPZA 3I92A 1ZNYA 5DNYB 2VH5R 3CX7A 1NI3A 2PX0A 4C2TA 5L8VA 2GCPA 3BAFA 1E1QA 4Q9IA 3A4MA 5DH9A 4XJXA 2ONJA 3FKQA 1ZD8A 2ZJOA 3L0SA 4LPKA 2ZITA 4C0KA 2V1XA 1SHZA 3NIBA 3W6PA 1P60A 3T61A 1NVVR 1E79A 4RD0A 4UQOA 3TIFA 4ZIRA 5K8IA 4AKHA 3SBEA 3QXXA 3RVBA 1TF7A 4G01B 2WWIA 3T5GA 1XCMA 1GOTA 2X77A 4R7ZA 1VYVA 3C41J 3NBXX 1CLUA 2C9YA 1SVKA 1W44A 2TMKA 1G1MA 2OSBA 2YC4C 3QNUA 1NRJB 3AVTA 4PPQA 2AFHE 4JT2A 4M8NE 4E22A 3K0EA 5C1BA 1SHKA 1XXHA 3OHMA 3QY0A 4OHVA 5KNCA 4TSFD 3WMGA 2CCJA 3CF6R 1XXHE 5AUQA 3RLFA 1RFLA 1YJ5A 4WA7A 3RNLA 3SZRA 4BRUA 3EZ9A 3I3SR 1E6CA 1OXTA 2HF8A 4IOJA 3K0SA 5LB2A 1GKYA 1UFQA 1YZNA 1KKLA 2XZPA 3EXAA 1E1RA 4MDFA 1GRQA 2NO9A 4PANA 1E9CA 1FTNA 3OFNA 3ZQ6A 2ZJ2A 2QMHA 3PENA 1NMZA 1Z0DA 1US8B 3K9NA 5TDHA 2WSSD 4F93B 5LB4A 1G7TA 3W3ZB 4O2LA 3NTUA 1ZMXA 3T5DA 3B1WA 2IW3A 1EFRD 1FUUA 3P32A 3QKSB 3ND8A 1KTVA 1MO4A 1XTRA 3T1VA 3VAAA 3VU9B 3CH5A 1A4RA 1ZC3A 2BOVA 2IHYA 3LRPA 1OKKA 5FI1B 4PSVA 3OIUA 3M0EA 4Q7JB 4Z1MA 3ZVLA 4Q01A 1JBKA 1XTKA 3CZQA 4ZCIA 4JL5A 5E7JA 2QSZA 4KJZA 5AJZA 3I5XA 2YC2C 4TTPA 3ZZ0A 1FP7A 2REXB 2NO0A 1XCGB 4Q21A 3DZDA 3C8UA 5L3VA 1OFUX 1L7VC 1KNXA 2FX3A 3DKPA 3KJEA 2ZQ5A 3L8YA 4PFSA 4JVSB 5TXGA 5LD2B 3R9XA 5H68A 3KXLA 2WSMA 1DBSA 1M7GA 4AG5A 4RFSB 3K0FB 1NY5A 2B21A 1K5GA 2EU8A 2P2LA 3ZZTA 2ZJAA 2V1UA 2FDCA 1DAFA 3GLHA 3TGPA 3W5IA 3AH8A 5J4KA 1XJQA 5H70A 5JCPA 2XJ4A 2BMFA 4P4TA 1OF1A 4WBSA 5EE0A 1Z6TA 3L2OB 4IXNA 4MKGA 1DTSA 2IEZA 4G1UC 3AVXA 2GAOA 2NGRA 1ESMA 1XTJA 1I2MA 3T35A 4XVQA 3TSWA 1T4GA 4URVR 4Q5IA 4B76A 2D7DA 4KU4A 2CL0X 5FL7D 1G5TA 3CF2A 4FWIB 4YMWA 1T9HA 1NF3A 5TARA 3ADBA 3M4YA 3KB2A 1P72A 3KJGA 3VR5A 4HDOB 3FVQA 3GQBA 2QGNA 3AVPA 5B58C 2RMKA 5DHAA 3SYNA 3RSOA 3MG9A 4V0MA 4TYPA 1VYTA 4HLCA 4ZKEA 2ZRHA 3CZPA 2QTHA 3EC2A 4AC9A 3NBFA 5KDOA 4V0ME 3OEEA 5AUPB 5GVSA 4GOJA 2FV8A 3AGPA 4URZR 3R8FA 3B1VA 3LFUA 1L4UA 4ZV4A 5B64A 4LC1A 1JALA 5EP3A 2ANBA 2FN4A 3CIOA 2B8WA 1D2EA 3VNUA 1W4BA 5B30A 2VLIA 2YHSA 2AHOA 1JAIA 1VDZA 4M53A 1OIXA 4U00A 2H8KA 5DI3A 1COWD 5G53C 3D3QA 3ND9A 3EIHA 4L5BA 2WBLC 2WHXA 1T3LA 2RKOA 4GZLA 2G88A 1M1YE 2PZFA 4Q4HB 2JLYA 4NBSA 4C0HA 2O52A 6Q21A 3ZS9A 1UKYA 3TAHA 3ZIAA 1QHSA 3B13B 4A1FA 1Z47A 2ZM5A 4N3NA 2BWJA 4HUTA 1NBME 4M2LA 4TWZA 1XJCA 4WAUA 3OAAA 2RB4A 2HLDD 2ZAOA 2OXCA 5FI0B 2WWGA 2OO7A 3A4NA 4BFSA 1FPMA 1GRNA 3NDPA 2HYIC 4TL9A 4LJ8A 1Q3HA 4IEIA 1GZSA 3QKRB 2PEYA 1Z6AA 2QN6A 3A58B 4JBXA 5FPTA 5J4HA 1U90A 4P33A 3MSXA 4ARZB 3THXB 4LOAA 1AM4D 3SOPA 3IPXA 1AZTA 3S1AB 5LD2C 1E2HA 2ZI4A 1CRQA 3ZDQA 4YLGA 3FOZA 1E4VA 3BS4A 2F9LA 5LDDC 4RSGA 2ZTSA 1HE1C 3OIWA 4F4JA 2F7SA 1YVDA 2QU8A 4JL6A 5K8LA 4BGDA 1W4AA 2OUKA 1MABB 1TEXA 2GEVA 4DEYA 1J8YF 3MJHA 4CT5A 1OSNA 1NN3A 1ZYUA 2V4ZA 3ONWA 2IF0A 3EZ2A 1SVIA 2QM8A 1ZD1A 2J7KA 4A2QA 1GNPA 1FX0B 4AYWA 1NN0A 1KJZA 5JCZA 4KFSA 4BZXA 4LHYA 3TE6A 4B33A 1DADA 1OE0A 3SYKA 1RYHA 1AKYA 1SVOA 3AGQA 3WYFA 4QM6A 1N6RA 4Q1EA 2F6RA 4DSUA 1NY6A 1KDRA 2XEXA 5DE3A 4B2PA 2O8BA 2BKUA 4LZZA 1XMIA 2J0SA 2IF2A 1XEWY 4F38A 2OAP1 3IQWA 2HDNB 2ZR9A 4TMWA 2GXUA 2O8CA 3SJAA 3CLVA 2EWWA 1EX6A 2AXPA 3LLUA 3H86A 1XD2A 4URXR 4KFRA 2ZI3A 2GK7A 521PA 2JLSA 2JLQA 2A9KA 1NL3A 1BMFA 4RVCA 1H8HD 1YRAA 2QT0A 2QRNA 4NPHA 4OQLA 3RS4A 4BFTA 2O8FA 3C4JA 2CJWB 4AYXA 1P61B 3MCAA 4NYJQ 3X1YA 4IDPA 4Q00A 4IVPA 1EXMA 4Q19A 2ASEA 2VL7A 4XVUA 3MGCA 3QSYA 5G3ZA 1GTVA 2X2EA 5CYOA 5FTKA 1NVUQ 1MKYA 3AEZA 3TK1A 1FOEB 4RZ3A 1I4DD 5TV2A 1JXMA 2V8OA 3W3AA 4M1TA 4P4SB 2QROA 2AKYA 1OXXK 2WWFA 4TLAA 2LKDA 3K9GA 1SKYE 1EFCA 4EAQA 4LRWA 4NYJR 3GLFB 5HCIA 1KY3A 3QXHA 3I32A 2Q9CA 3AKDA 3QE0A 1VCMA 1Z8FA 2OEPA 2ZRLA 1RW4A 4TYYA 4Q1FA 1G6HA 2QL6A 1AGPA 2R6DA 3W8NA 2IXEA 821PA 2WZQA 5KSPA 2OXRA 4BFXA 5GJBA 2XOKA 2ZEJA 3QF7A 1LB1B 1MR3F 1YZQA 1Z2CA 3B78A 2KB0A 1G9XA 1WB9A 1ZBDA 3MFYA 1DO0A 1N6OA 2B7BA 3QOFA 4KCGA 4PXAA 3U7FB 1P2SA 1YZUA 4YONB 1WBDA 3ZD6A 2ERXA 1XD9A 4D4MA 3SFVA 5AJXA 2R6CA 4CW7A 4MYHA 2G83A 3DDCA 3IO3A 2IK8A 2L0XA 4PSKA 1DAKA 1VCNA 1RPZA 3MWYW 5EXPA 2C96A 5E95A 1X8KA 4FIDA 2FJUA 2LWIA 3QEOA 4I1UA 1FZQA 5FUXA 3W9YA 4U02A 2EFEB 3ZVNA 4M9XA 1UEJA 3NH9A 2PMKA 3BE4A 4L16A 1Q1QA 3U3MA 4BZQA 1Q1BA 2GZAA 2AK3A 2PLFA 2GETA 4M22A 4A0GA 2BM0A 2G0TA 2AR7A 2VP2A 3GFPA 4ZI3A 3SQWA 2H17A 1KJYA 3CW2A 5J4YA 3VKHA 1P9WA 4DLTA 2ZREA 1Z63A 1UBFA 2PMDA 4OJQA 4C0AC 4QXAA 4NZYA 4BLQA 3HWSA 1U98A 1S2MA 5CLQA 3ADDA 5B57C 3DOFA 1MO3A 4HLUC 1VHLA 3SJBA 1R8SA 3GMTA 4B75A 2ZR0A 3BFVA 3ECCA 4IHQA 3IDQA 2IS4A 1T5IA 1KJWA 2F1IA 2XJ9A 5K8UA 1JJVA 2NPIA 1T8TA 3HU2A 2F3TA 3IIJA 4NCIA 4Q4AB 4HAUA 3TVDA 4XWOA 4I1SA 1DAIA 3F5FA 1AS3A 2YOGA 4V03A 1KAGA 4O0MA 5FPHA 2FWRA 3GLIB 1RRGA 2OFWA 5F3WB 2QENA 1F2UA 2CXXA 1OIWA 5JMTA 2VSXA 3HYRA 3MLEA 5AUNB 3BERA 2GVZC 1N5LA 1GITA 1E2GA 1OIVA 2K5UA 2GF9A 2CNWD 1UKVY 3U7HB 2WMNB 2JLWA 2KE5A 4KV9A 3MMPA 3WP0A 5KUTA 5FR1A 4LK2A 3ZYCA 3I62A 3FWYA 1KO5A 2HCBA 1YKSA 1PVOA 1JEEA 2B8TA 4ZDJA 4OK6A 1E2LA 3VX4A 4M1SA 1GRRA 5AJVB 2LKCA 1CR4A 1Z0AA 2V7QA 1QDEA 1I4LD 3W8RA 5L3QB 1J90A 1O87A 3REFA 1NG1A 5HKKA 1JQLB 1XJ0A 4FCVA 3AVUA 2V6JA 1E9BA 2JA1A 4NCKA 2OV2A 2YWHA 2OLKA 5SZHB 3LX5A 3PEVA 2UKDA 1XB2A 4A4DA 1D2NA 2IYQA 2JJ2A 2F1RA 5FBRB 1E0KA 1X6VA 2VYFA 2YV5A 4Q47A 1AS2A 3E1SA 2NPFA 3QG5A 1NSTA 1Q3TA 4Q1DA 4WZBE 2FFQA 4FCWA 4DLYA 1N6PA 2H92A 3TRFA 5JLJA 1R5BA 4TT3A 1PLLA 1OH6A 2OCBA 2VP5A 1L8QA 4DLUA 4TMTA 4GNKA 3DM9B 5EXSA 4FMDB 5HTKA 4PQFA 4XWKA 4DBLC 1DAGA 1C1YA 2QG6A 3LXXA 4BLPA 3OEHD 3TR5A 3D7MA 1XD8A 4DUGA 4P31A 1G3QA 2MSDB 2R9VA 1D9ZA 1XTSA 2BMEA 2EW1A 4FI3C 4C4PA 4R9UC 1JR3A 3THWB 2E1RA 3DZ8A 3MRSA 1H8EA 1P7CA 4QKQA 3UWKA 2YWGA 2OAQ1 2RAPA 4URWR 4B3BA 4CEJB 1TQDA 2WTUA 2AX4A 4I1VA 2ZE5A 1QHIA 3FTQA 2WPDA 4FINA 4ZDWA 3GJXC 3QPWA 5EXTA 3ADKA 3U3KA 3V9PA 2J0UB 3I4LA 3K9HA 2Z4RA 3PEUA 3GLGA 3B82A 1CR2A 4CRWB 2FSHA 1TU4A 1ZNXA 5CB6A 5FBVB 1DVRA 2ZRNA 4I4LA 2J9RA 3CONA 2ZE6A 3I8XA 2IS1A 3GLGE 3Q8XB 2P5SA 1KSFX 3QKTA 3LV8A 1XEXB 2P6RA 1SXJB 3O8BA 3NHBA 1LVGA 3TKLA 1M8PA 3N2IA 2JIZA 3DVLA 1ANKA 1PV4A 3SYLA 5DN6D 2W6JA 4ACAA 2AWOA 2JASA 2VSFA 1EFHA 2PLRA 3KUCA 4GI7A 2N46A 2YJTD 3TMKA 1FL9A 2A5FA 2V54A 1HTWA 2WJHA 4DCNA 5EE1A 1WRBA 4NCNA 4QM7A 3EPHA 3CR7A 3R9WA 2QE7D 5A5GA 4YXWD 5BW8A 4PHGA 2D06A 1S96A 1G4UR 5HZHA 4X8HA 4B2IA 4TMXA 2WIAA 1CS4C 4MRRA 3H84A 4OBEA 5EUQB 1LS1A 3PUWA 2VA8A 2IWHA 4D6PA 4QJ5A 4HI0E 2GXQA 4RD6A 1UBCA 1G3IA 4G5GA 4E5UA 3C16C 2XGJA 2WMOB 3TLXA 5FPSA 4DSNA 3K0AB 5GVRA 5H8WA 3RABA 1MRSA 2NZJA 4RFSA 2IHBA 3IQXA 1JECA 4ZCLA 1YZKA 1SVLA 3BFKA 4GP7A 3P26A 4Q7KA 4BFZA 4C7OB 2BHRA 1W0JD 4Z8XA 4U7DA 1E9DA 1HYQA 2FH5B 1FUKA 1N6IA 4CYMA 1WA5A 3PIRA 2YKGA 3RSLA 2BEJA 3VR1A 3G5UA 4TSFA 5FFMA 1OXUA 3CRW1 1SVSA 3X2SA 1TADA 1QHHB 2CK3D 5HE9A 2R6FA 5EXXA 4B48A 2ECKA 1LF0A 3PV0A 3SFZA 1EK0A 4EPRA 2FMXA 2D62A 4WZAE 5CYPA 1XCPA 2C9OA 3AF1A 1XPRA 2PJRA 3VX3A 1XWIA 3U6KA 3SR0A 5BXQC 1UDXA 4PX9A 1KGDA 4D4KA 5EJEA 2W0MA 3HR7A 4M9SA 1W1WA 4ESVA 2QORA 2WSSA 2ZSAA 3A1WA 2OCYC 2IYLD 2ZS7A 5E3HA 3OE7D 2Y8EA 1FNNA 3IEVA 4EDHA 1Z06A 1K8RA 1EFRA 2IYZA 4JKIA 3NWJA 3IEUA 3L0PA 2QP9X 1MO6A 3VKWA 3VR4A 4H9GA 3A6PC 1W2HA 5CK5A 5ANRB 4RZ2A 1S3SA 4JLAA 4A8JA 5FTLA 2AXNA 1EWQA 2YZ2A 3C5CA 3GFOA 4JIMA 5GJVC 1P4SA 4HB2A 4ZO4A 4PHHA 4RJLA 2CE7A 3B6EA 1TQ4A 2IC5A 3R8CA 3AVWA 3L43A 1HQCA 5JWOA 1SXJC 1HUQA 3WHKA 1XPOA 3NC0C 2D74A 2I1QA 4XTRA 4C30A 1ZD9A 4EQ6A 2WWYA 2F43A 1IN6A 2J7PD 2AWNA 2ZRJA 5BN4A 3QXCA 1Q1EA 4TYWA 1D6JA 4UNPA 4DDVA 2PJZA 2WOOA 1OB2A 5EP4A 3CR8A 1G4AE 2OZEA 5DO9A 1NMYA 4Q4HA 3TW4A 3IGFA 2JLXA 1HY3A 1S9HA 3FHTA 3U6BA 1B23P 3CWQA 2YINC 4M0LA 5KNBA 1NLZA 1P9NA 2VHCA 2VPPA 4D4LA 1KK3A 1NJFA 1CR0A 4E03A 1NMXA 1F2TB 3ZGXA 3JVVA 4EPXA 5CITA 1TNDA 3NHAA 2GXAA 1OXVA 1HV8A 2WAXA 2JJ8A 1RVDA 2B6HA 2FFBA 2QP4A 1VMAA 4BLRA 2X19A 1KZ7B 5FL7A 4LUCA 4XH9B 5JHHB 4NU0A 4CEIA 2E87A 2HXSA 2QTFA 2I1VB 1KI9A 3PUXA 4D81A 3KQHA 3EPJA 421PA 2JDID 4ARZA 2QI9C 3THXA 1V43A 3B7GA 3B1ZA 4DDTA 1CU1A 2QMUA 4Q4JB 4WZ6A 2KWIA 3S1AA 5E7IA 1F5NA 1K6MA 2D2FA 1E32A 4BPBA 1DPFA 2DCUA 4XVRA 3LDAA 2A7QA 3HPQA 3P20A 2GJKA 1X8JA 1TQ6A 1ZM9A 1X1RA 4V0KA 3ZS8A 5JWRA 2YOHA 4KAXA 4YMVA 4UNNA 3R7WB 1E2MA 1MABA 2WV9A 2CE2X 4ZDIA 1M74A 2WJVA 5JWHA 3FB4A 2OG2A 3I61A 2OT3B 1U0HC 2GWHA 1A2KC 1FX0A 1NLYA 2ZI6A 4OQNA 2P0EA 2PX3A 4URYR 1P2VA 2ZROA 3VR6A 4IDHA 4DLZA 4QGGA 4Z54A 3QG1A 2FSIA 2J87A 2JATA 4QBGB 3KQUA 3LW8A 3U44B 1COWA 1W0KD 2QSYA 3W6OA 5KDDA 5JSZB 3DL0A 4NE2A 5FOWA 2ZRKA 3WY9A 1DAEA 1G8FA 1ZM3A 1OYWA 2AFIE 1TTTA 1DS6A 3UXMA 2IUTA 2ZRDA 4DDUA 3AVYA 621PA 1RJ9A 1E2FA 1NLFA 4ABYA 3GJ7A 1G20E 1HH4A 2Q9BA 3CNOA 2HLDA 4LCBA 1VTKA 4GPTA 3GLHE 2IBMA 5DLQC 5D3MB 2B7CA 2CJWA 2ZETA 4TYQA 5EE3A 3CX8A 1RC8A 2VF7A 2QPOA 4J0QA 5AJWA 5CDFA 1EFUA 4CEHA 4N1AA 4OQXA 2QT1A 2IYWA 4DCTA 5JS8A 4ZDKA 1E3MA 2QNRA 1FP6A 3BFXA 4LYAA 2NOAA 1UADA 5CDFE 2IUUA 1RIFA 3DEFA 4JLNA 1P3JA 5F2EA 2HEIA 4L4UA 4D0GA 5GJCA 5KPJA 2CLSA 4LHZA 4RZXA 2GCOB 3B9QA 3P1JA 2ODEA 4P4SA 4XSGA 1R6BX 3KJIA 3SJCA 2VIIA 2YWEA 1N2CE 3E2IA 5IDVA 2DFNA 2YWFA 3GJ0A 5DYIA 1XTQA 5JJIA 2HF9A 2WIBA 3EA5A 4HSEA 3EPLA 3FKSD 4FMBB 4JYCA 1QZXA 2GA8A 4DT1B 3GLFA 3AUYA 4AY2A 4DLXA 1ZINA 2R6AA 4O3MA 5EP2A 2PEZA 1D9XA 2RGGA 3SHFA 4Q7MB 4R71A 2FEMA 1UJ2A 4S2EA 4IRUB 4BFVA 2ZAMA 4FWTA 3EIEA 1IN4A 1JPJA 3LW7A 4JS0A 4JJZA 3AP1A 1ETUA 3PFIA 2P67A 1T0HB 4DEXA 1QBKC 3RRZA 2ZSBA 4V0NA 1X86B 2GTPA 1OFIA 1I2DA 1DG3A 1DELA 2QAJA 2CHVA 3REGA 2Q0HA 4DB2A 2I4IA 2GHIA 5A4JA 1ONBA 2RGNC 4CT4B 4H1UA 3THYB 2J3EA 3MD0A 1XMVA 1CR1A 3HR8A 4HATA 1E9RA 2C5LA 2JJ1D 4JJKA 3H2YA 1BO6A 2QQ0A 1Q22A 2FGJA 2QQEA 4LC0A 3TSOA 3ADCA 3FFBA 3KXKA 4D2IA 2IS6A 4JBWA 4B32A 4TMVA 2QPAA 1JJ7A 2RGXA 4A2WA 2DWPA 3IUYA 1Z29A 5C46F 2G6BA 2GBLC 1KSGA 3UK6A 1GVNB 2GEUA 1XEWX 4Q48A 4MDEA 3ZVRA 4RD3A 4EIWA 2QBYA 1H8HA 1M7BA 2V3CC 1JNYA 3LVRE 4M1OA 1MV5A 1CJVC 2E9SA 2IYYA 3PQCA 5AR1A 4D0LB 1J7KA 2W2XA 2AKAB 1PUJA 1PLJA 1TUEA 2F1JA 3K1JA 4MA4A 4ZIRB 4I1OA 5HZKA 4IKEA 1SQ5A 2VF8A 4IVRA 3NBZC 3GJ5A 1QHGA 2FPKA 2UZ3A 3P4YA 1WCV1 1NP6A 4B3XA 5P21A 1OV4A 4Z51A 4G5QA 221PA 1T6NA 1GL6A 2ZU0C 3SDZA 1XXHB 3CH4B 1N0WA 4Q7LA 5JECA 1XP8A 3IIKA 4NL4H 2HT1A 4PQRA 4QNMA 5L3SB 2VHUA 3GD7A 4JLBA 5CM9C 1SKQA 3Q85A 1VG0B 3QBVA 3TVTA 2CDNA 3O8CA 1E99A 3U5ZB 3ZJYA 2IUSA 2ZVPX 2OHFA 4IOLA 5JRZA 2FPLA 5EZ6B 3VKGA 4F7WA 1U8YA 1QHXA 2HCJB 1AQUA 3TUJC 3RC8A 4M21A 4OI1A 1U2RA 2MSEB 2QAGA 4PPFA 1S9DA 2Z5FA 5EQTA 1CEEA 2HJVA 3EZFA 1UDWA 2VHJA 3UWOA 3GLIA 2C98A 4GOXA 4BFUA 2HV8A 3T1OA 1W36C 1W2GA 4IXMA 2F55A 5FOUA 1TF2A 3UATA 2Q21A 4BWYA 1OT3A 3SEAA 3KTAB 3AKYA 2SHKA 4DCUA 2GZDA 2V6IA 3M1IA 4RD1A 3HJNA 4WXPA 5BYKA 2EFGA 4IEEA 8OHMA 2I3BA 1SGWA 1AIPA 4CIDA 2G0NA 4PZYA 3EW9A 4BEJA 4GOKA 4DLRA 3TUIC 3K09C 1Z2AA 3KKNA 2W83A 3PR1A 3GPLA 1G5PA 2GRJA 1EG7A 3C7KA 3VHLB 2GKSA 3D31A 3BORA 1I4TD 1KI1A 1RKBA 3LBNA 3NBYC 1Z3IX 4MRNA 4JVNA 2CMKA 4HB4A 3FHCB 3SHWA 1NBMD 2IYSA 1S3GA 5C4GB 5JEDA 2FU5C 2OFXA 3V00A 1DE0A 2FF7A 3ZH9B 5GJWC 2JAQA 2O8EA 1X1SA 3AM1A 2A5YB 1D8TA 5IK2D 4MRSA 4C0SA 1A1VA 3ZVMA 1RRFA 4BFWA 2XITA 3SU8A 5HE8A 3FE2A 1D5CA 4UNRA 1Q1ZA 3VQTA 1KYIA 1FTSA 2A30A 4KFTA 2IYTA 1KI3A 1KHTA 2AL7A 2ZJYA 2IWRA 3GEEA 3T12A 4DLVA 2QEQA 4M1MA 1FMLA 1R0ZA 4MUAA 4QJ4A 2BV3A 4LPSA 1OFTA 4AKIA 1OHHD 3HDTA 4MH0R 3C5HA 2YNMA 1Z83A 1E0AA 4LYJA 4D80A 1Z6GA 3CO5A 3K0CA 4MGZR 2XB2A 2ZJ5A 3M6AA 5SZJA 3ASZA 4HDCA 1ZNZA 3THWA 3HU1A 4JKYA 1G64A 2RGAA 3DMDA 3V4RA 1D2MA 1RRCA 4CEJA 1KO8A 2WOJA 1TMKA 1LFDB 3EIQA 1CIPA 3PVSA 5TY0A 2GCNA 2VSOA 5UKDA 2P3SA 4ZPXA 2A5JA 3PUZA 2A3RA 4U5XA 3BGWA 5J4VA 2DHRA 2CNWA 5KSYA 2J0UA 4LJ5A 3OIYA 1N6NA 1EESA 4EFLA 2H1LA 3EARA 1KSHA 2ZPTX 1W7AA 5DI3B 4BFYA 5F9FA 4A82A 2H18A 1XEXA 1R7RA 3CRMA 4DIDA 2OILA 2H16A 3W6NA 1A82A 1EX7A 3VHXA 2DY1A 3MUFA 2FSFA 2W0SA 2IEYA 4BE7B 3L8ZA 3TW8B 3WHLA 1IQPA 2XXAA 4BLSA 2C95A 4MYTA 1IOZA 4LJ6A 4LWZA 2DWOA 4JLMA 1XZQA 3E5HA 5FR2A 2CHGA 1XFAA 2B92A 3JVUA 1ZUIA 4PHTA 4P0TA 3VFDA 1S8FA 3A36A 5FUYA 4HLDA 2JLUA 1K5DA 3EWSA 4ZI2A 3Q72A 1IY2A 2BCGY 4TLCA 1E9EA 5KDLA 1TEVA 4GRAA 2FGKA 1VG8A 4LJ4A 1NKSA 4ESHA 5JHGB 3WBJA 2CLDX 3UG6A 3WRXC 3C14C 2ZSFA 3H4MA 3NH6A 2O0JA 4QBFA 2QPTA 4JLPA 4L15A 1S1MA 2RGDA 1XRJA 3QVUA 4XD7D 2XX3A 1N6HA 1TUIA 1OFHA 1QF9A 3QENA 1U8ZA 5JI2E 3OEHA 2DPXA 5KYKA 4WXRA 3CWZA 3UKDA 4CGZA 1KIMA 3K0AA 1XBTA 4I81A 2G77B 4GT1A 4PC7A 2ZRGA 2OFOA 4P32A 4AKEA 1T3HA 4HAXA 5B2ZA 2QA5A 1HA3A 1OH5A 2WJYA 1U9IC 4AWXA 2IA5A 2C8VA 2CHQA 5FTJA 3EC1A 1WP9A 2D2EA 2MSCB 4Q1CA 3RANA 3PG5A 4MYCA 1CP2A 4DHEA 1BYUA 1P2TA 1KZGB 1MRNA 1KMQA 1QHHA 2ODBA 2C2HA 4OJKA 2O8DA 5JJLA 4DLSA 1PZNA 4UXIA 1E2NA 4OQFA 2BBTA 3WBKA 1FQKA 1KK0A 1IY0A 1SXJD 1NIPA 1Z5ZA 4DC9A 2BBOA 4II7A 5CLLA 3CNLA 4B3CA 2CLCX 5DN6A 3CRRA 4KBFA 1XD2B 5AUOB 3U4QA 2Z0MA 1C9KA 2KJQA 1RYFA 1NVXQ 4Y0AA 1G17A 1W4RA 4HZUB 2IYVA 4A0HA 4IDNA 4YQFA 2C9CA 1GILA 1L2TA 1T3SA 1ZAKA 2WICA 4H1VA 4JVLA 2QE7A 4NKRA 4YXWA 5EP1A 2O0KA 4DLWA 1ZCAA 4PO8A 2MMGA 3O8RA 1UAAA 2ZUDA 4TQ9A 1B0UA 3U7EB 1R4AA 2XTZA 3K53A 4AG6A 2R8RA 1RE0A 3QQ5A 1J8MF 3AVQA 4LHWA 2YOFA 5HR5A 4R98A 1U0JA 4AIIA 1SKYB 2WJIA 2BMJA 1ZJ6A 3B1XA 4B47A 4HB3A 1FNMA 2VP4A 2FEOA 1W5SA 3N2EA 4JSYA 1Q20A 3CNNA 4OHXA 1EGAA 2XTNA 1UKZA 2FOLA 2ZI9A 1TQ2A 4GMXA 1UBEA 4Q9KA 1AGRA 4DSTA 1CKEA 2NG1A 4AK9A 1W0JA 4IOMA 4HDQB 2MMCA 2DB3A 1JR3E 1WE2A 2R6GA 2FZLA 1IXRC 2ERYA 3PCRB 3TJZA 4OI0A 3X1WA 2G3YA 2DR3A 4B74A 1WXQA 4ASUD 5G3YA 4EUNA 1MOZA 1W49A 1F2TA 3ZLJA 2OE2A 4S35A 2WWXA 4AURA 5IF9A 4P3YA 5SZKB 3RS7A 2VBCA 2CK3A 2GXSA 2NZ8A 3FGNA 5G41A 4JMPA 4UJ3A 5DGXA 3KX2A 5FBQB 2Q3HA 1NKTA 3BD9A 3PITA 1Z0FA 4NMMA 4A92A 2QGZA 2REBA 3N5CA 1A7JA 3RHFA 2KSQA 3WYGA 4C0LA 1XMSA 4FMCF 4Q4JA 3OZXA 1CRPA 5A0FA 3LA6A 3BC1A 3QXSA 4G5SA 3LBIA 4R2HA 1US8A 2IL1A 3BRWD 4QL3A 4RKFA 3OE7A 1LNZA 1G7SA 1GL7A 3GJ8A 4GP6A 1P62B 3SS8A 2QTVB 1ZW6A 3QKSA 4G5RA 1N6LA 4X8OA 2ATVA 3K70C 4W5WA 4TN1A 3VU9A 4EPVA 3R20A 4B6EA 1KK2A 2ZE8A 2RGCA 5F9HA 1QVAA 5HCNA 1P6XA 1VYUA 3ICEA 4LDJA 2JCSA 4B71A 1G3RA 4NYIQ 4LGMA 1AA9A 4DRZA 3IKJA 4NONA 2Q6TA 3EASA 1QHYA 2DBYA 4BLTA 1G8GA 1VIYA 4ERNA 4KBGA 4W5HA 2PCLA 1KI2A 1N25A 5EE9A 2CEAA 2ZRIA 3MWKA 3U44A 2AN9A 5JSZA 2XNSA 2J7PA 2KI5A 5FBWB 3OESA 4NCHA 3SNHA 1E2DA 3AB3A 2W00A 1AKEA 3K0FA 4WIAA 4MRPA 1T8UA 4NYIR 1GL9B 2QY9A 4FW9A 3P27A 2BKEA 2WWWA 1J99A 5LPNA 4A15A 4C0JA 1OXSC 2BJWA 5DHFA 5JBQA 2JGNA 2ORIA 3X1DA 1IN8A 4MYUA 4QG7A 4L9WA 2NO7A 3MWJA 4BRWA 1R2QA 2ZJ8A 3AKCA 2C03A 5FOVA 5D3MA 5KOYA 4Q9HA 1LF5A 5K8TA 2KBEA 1U94A 2FFAA 1NIJA 2J45A 2W6ID 2ZU6A 4DWJA 4EKDA 1OW3B 1YRBA 2A2ZA 1AQYA 1F2UB 2CL7X 4V0OA 2ZXUA 2JDIA 3A8TA 2GCOA 2VP9A 3KL4A 1W5TA 1ZM4A 2HUPA 1Z6YA 2VP6A 1P75A 2OBNA 3KDSE 1L4YA 1E98A 4NP6A 4JVMA 2EFDB 5J40A 4TMKA 4PO9A 4DT1A 3VR3A 2FG5A 4DIEA 4HUQB 4WOPA 4LBWA 1UEIA 3LQRA 1DAMA 1HE8B 3Q5EA 2XNDD 5CJPA 4YMSA 1GNRA 2QMEA 4IJMA 2PBRA 2AD5A 4LY6A 3WNCA 3CF0A 1QHNA 1HQYE 2GJSA 1VG9B 4PAQA 3LVQE 3KKOA 2XSZD 4YC7A 1QRAA 4FN5A 1S0UA 2GVDC 1ESNA 2R62A 2XZLA 4KFUA 5HPYB 4Q18A 3H1TA 5KSZA 3AV0B 4PPGA 3THYA 2CBZA 1W0KA 2AK2A 3L0IB 4M1KA 3GP8A 1KAOA 4KSCA 1UF9A 1ZUNB 3UANA 1DAHA 1KO4A 1M34E 3WNBA 1IN5A 2C04A 2EFCB 3OIVA 3QUSA 4ON9A 2BBWA 4JYBA 4HAVA 4QHYA 4DJTA 4RD4A 5JEEA 1YE8A 2GESA 4O2RA 3QXJA 2GJ9A 4K81B 4PZZA 1AJEA 5FTNA 2OBMA 4MQBA 5FTMA 1OB5A 3AVOA 3MJRA 3QKUA 1KO7A 3RRYA 3DMNA 2RHMA 1UM8A 4B43A 3BB4A 2OESA 2YYZA 4GBMA 5FBLB 1PLKA 4NH0A 3QKRA 4US1R 1Q12A 2NIPA 1F6BA 1KMHB 1M2OB 1N3BA 3BJIC 1KI6B 3IPYA 3TH5A 4NHOA 4XOIA 1W36D 1E96A 4BLOA 5FOTA 2BBSA 1YHNA 1T91A 2BJVA 3A4LA 4NCJA 4KXFB 3MAAC 3P4XA 3GLGB 3FKSA 1AZSC 4TLEA 2J5XA 5L3SA 1GG2A 1CBUA 2FA9A 3Q9LA 1Z22A 1FQJA 1BIFA 4N0DA 3FMFA 3BBPA 1X3SA 2VP0A 2ZJBA 3H0KA 1HT1E 3QF4B 4K46A 4IFEA 4I99A 1G41A 4F92B 5J4LA 3WMEA 5F98A 1GAJA 3E70C 1JQJC 2W2TA 3IHLA 1XDBA 4QGAA 1EFTA 4KVAA 1II8B 5FPKA 3TUZC 2ZYUX 2KBFA 4MGYR 3UMRA 1N0UA 2CVFA 3T1QA 4POAA 3HPRA 3CB4A 1JPNA 1OJLA 1YR9A 1WBBA 3DOEA 4M4SA 2JEOA 2JJ1A 2ZE7A 4MUBA 1Y3AA 5TVKA 5KPDA 1KI7A 1UKEA 2F9MA 4F91B 2X1VA 2ZR7A 1DO2A 2CCKA 4Q4LA 3KQKA 1W47A 4KHZA 4MRVA 3KTAA 5GADl 3RS2A 2VQSA 2A5DA 4HLUA 3R9IA 4OQMA 3GEHA 4PAOA 2BIFA 4W7SA 3WYAA 1GKIA 3LWNA 3NKVA 2XB4A 3TQFA 1E1QD 4GMDA 3LXRA 4M9ZA 4BEBA 4NTZA 1F48A 1F60A 1IJEA 3V4FA 5C18A 1VCIA 1YZTA 3DKVA 4RY2A 4EPYA 1WF3A 1E79D 4D25A 2OM2A 1E9SA 4F4IA 2ZUCA 4P4UA 5BYJA 2JLRA 2FZ4A 4A6XA 1ODFA 1JXOA 4A6PA 1U9IA 2DFKB 3BB1A 3RAPR 2ZYTX 2J59A 5BQ5A 3QBTA 2CCGA 2GK6A 3A1UA 1XPUA 1TAGA 2PCJA 4EFMA 1XZPA 4MKHA 4TTRA 5DYGA 4B34A 1N5IA 5JRJA 1OPXA 5FH9A 2UZIR 3FMPB 5KTYA 2HXYA 2PZGA 4CVNA 2D7CA 1MH1A 1YU9A 3KZ1E 3RC3A 4LI0A 5EE5B 4IFBA 4D82A 5CB8A 2A5GA 3GLFE 1CF4A 4XTCS 4TZ6A 2WKPA 4MKFA 1CXZA 1MT0A 3NEJA 1SULA 4L8GA 1E1RD 4X8MA 1YR7A 1V5WA 2GNOA 3ICQB 1U0LA 1Z6XA 3OFND 1ZU4A 1ZCBA 3JZMA 2VHQA 3QJYA 3TBKA 4HB0A 3B85A 2FE4A 4V02A 3LO5A 2C78A 4LX0A 2PT5A 2BEKA 1VKJA 2GILA 2ZYWX 4EJSB 1CJMA 3PJRA 2ZYVX 3VNVA 1N0VC 4GFDA 5JI3E 4LV6A 3ZQJA 3NVAA 2REOA 1TU3A 5M04A 4C9BA 1IJFA 3KFXA 5BWMA 1PJRA 4TYNA 1Z07A 4LJYA 1SVWA 3BH6A 4A8JB 4TL7A 4UXHA 4AD8A 4YDSA 4A36A 1OKKD 4C3ZA 4B3GA 3DHWC 721PA 4HLQB 4Z1MD 1G21E 4HAWA 3U61B 3ETLA 3W5JA 4TLBA 3NEYA 1KO1A 5JZVA 3CKLA 4DCSA 1JB1A 1ZIOA 4JLJA 4EQ6B 4XWAA 2F43B 2WWHA 2ZJZA 1WQ1R 4PR0A 1CJTC 2WM9B 4BECA 1H65A 3L0OA 2ZIAA 2D3WA 1DARA 4NYMQ 3UMFA 4PPNA 1ZNWA 5FUWA 1NBMA 3L82B 1EWRA 4KITB 3BWDD 2NTYC 4LSGA 4GZMA 4YDHB 5LBIA 3QPUA 1BH2A 5FL3A 3UMSA 5IK2A 3KQLA 1W48A 4O25A 3LNCA 2IS2A 2OLJA 4ZCMA 3WMFA 4TL6A 1P73A 4PAMA 5DI9A 2CL6X 2GZHA 2PT7A 2D4HA 4Q1AA 3B2EA 1XEFA 2ZRCA 3G0HA 4NYMR 2VRWA 2J41A 2GAAA 4URUR 4AKGA 3QEJA 1GKUB 4CEIB 2NO1A 1LS6A 1FFHA 3I73A 2UVQA 1G18A 1NG9A 1OHHA 1IY1A 2ORVA 3FDIA 4KVGA 4PC6A 4Q4AA 2ZUBA 4UXJA 2P65A 4W9MC 4JL8A 2YVUA 4JT4A 1ZP6A 3AUXA 3RS5A 1KDTA 4UKDA 1E9FA 3K8YA 1R8QA 4A0RA 3OEED 3FYHA 3I72A 3KJHA 3O47A 3AF3A 3GLIE 2IYRA 5JFGA 3AKEA 4QC2A 2VTKA 121PA 3A1SA 1GUAA 3AQ4A 3ASYA 4HAYA 4LBZA 4QRHA 1BOFA 2ZS8A 3EPKA 3SJZA 1VPLA 2ZANA 4D0NA 4JLDA 4XSHA 4OI4A 4C0BA 1YQTA 3CRQA 3I5YA 2G9NA 1KI8A 2Q3MA 4ITRC 4LV8B 4PC2A 4XIGS 1GFIA 4DXAA 1TF5A 2HT6A 3CUEF 2PH1A 5G40A 2EWVA 2EFHB 4LJ7A 1G5RA 4GL2A 4HZIA 4IW3B 3IO5A 4QJ3A 3LBHA 5IRCD 3Q7PA 2ANCA 2H5EA 3KUDA 1A5TA 1ZUHA 2H7VA 2Z6VA 3HP1A 5C4MA 5L3QA 4EJSC 3LQQA 1G6OA 4HZUA 1RJ9B 2EYQA 3GLHB 2LCFA 3ZIAD 4NDZA 4OHWA 1Z0IA 3BXZA 3D8BA 4OKSA 1S4QA 4TQAA 2J0VA 3VMFA 3OAAD 4LHXA 5AK0A 4B44A 1OH7A 4UNQA 4A8JC 1E2EA 2DWQA 2V9PA 5BN3A 4TQUS 1DOAA 2ZSDA 4MGKR 1RZ3A 1XMJA 4CEHB 1E2IA 3AF2A 3U3OA 4DCVA 4MITA 4PC1A 1HURA 3WP1B 1Z08A 4XD7A 3B9PA 5C2JB 4OK3A 2Z4SA 2Q9AA 4RZUA 2ZRAA 2WKQA 1P5ZB 3WRYC 1HEIA 2WKRA 3KKQA 5KU1A 1XX6A 3FHOA 2N42A 4DSOA 1E69A 4WW0A 3EZ6A 1LW7A 1CULC 3LD9A 4HEJA 2QMOA 1KDOA 2BVNA 3SI7A 3X1XA 1ZM7A 4ILEA 1Q44A 4BASA 1LTQA 1ZU5A 2QUZA 1JEDA 2PZEA 3BH7A 4KI0A 4X8LA 4CDGA 3K70D 1GM5A 1KSJA 2X8AA 3KB1A 3F0TA 3DO6A 3CX6A 2RGEA 3MWLA 1G16A 4M1YA 1T5LA 2RH5A 1AK2A 1P2UA 3NG1A 4KO8A 5FOSA 3A1VA 1W4CA 2GJAA 3B8HA 3PUVA 3EX7C 1U81A 5IT5A 4KSBA 1AS0A 1SXJA 2NO6A 4E07A 4B73A 3LLMA 3B60A 3NC1C 1M6NA 4KYIB 4Q9LA 3NXSA 1RRPA 1VHTA 2OCPA 2BMDA 1BYIA 3FFAA 3RRMA 5J47A 1SXJE 1BKDR 4PZLA 4Q1BA 4B3DA 2W2VA 3T06B 2F3RA 2ODNA 4OYHA 3U60B 2P6NA 3PEWA 1XTIA 1QG2A 1II9A 2R2AA 2QBYB 3VTKA 5J5CA 3X1ZA 1BMFD 3U2QA 4DDWA 4G0NA 1G291 1BS1A 3BB3A 2IXFA 4TTQA 4A0FA 5ELXA 3SQXA 1GSIA 2HYDA 1ZC4A 2QM7A 3RYTC 1G8YA 3TNFA 2Z83A 4Q02A 1Q0UA 4LYHA 4DB4A 1E2JA 1KI4A 3U3RA 2QP3A 3BK7A 4LBVA 4PQYA 1U8AA 4LJ9A 4DKXA 4K8OA 4RCYA 1GDDA 1NN5A 4HAZA 1R5OA 2JLVA 2VO1A 2GEDA 4TLDA 3SC3A 3K9LA 1YZGA 3N70A 2C77A 3CPHA 2CVHA 4IOKA 2ZRMA 2VHTA 4N0EA 4QHTA 3ZZUA 4OK5A 2WVJA 3GJ4A 1Y63A 2VEDA 3KKMA 4PO1A 5TMPA 2ORWA 3A37A 4PHFA 3W90A 3SN6A 1E2QA 4GDFA 3IBGA 1IHUA 4C7OA 2AD1A 1YZLA 1S1CA 5CJ2A 3FMOB 1CTQA 4UJ5A 4GSYA 3FPAA 2IXGA 1XF9A 2J0QA 1TL7C 3EG5A 1G7CA 3Q3JB 2J46A 4QOSA 3K70B 3LH5A 4QHSA 3Q7QA 1UBGA 1ZM2A 1G3UA 3TSZA 4ASUA 4DVGA 1IM2A 1Q21A 4D4JA 1A2BA 4EFNA 1N5KA 2QAGB 4LJAA 1R5NA 2XOKD 5AJYA 5CM8B 3KXIA 3DPUA 3U3JA 3LX8A 1E0JA 4V0LA 4B35A 2H57A 4US0R 1ZRHA 1II0A 2O8BB 3G82C 4OI2A 2RHDA 3UIEA 4QBHA 2F1HA 4Q9JA 1IXSB 1R0YA 2IYUA 3EAQA 3I1FA 1Z0JA 3F8TA 4FD2A 2XZOA 2R65A 2O8CB 5E7MA 4FXPA 3AVVA 2R44A 4IVQA 1VIAA 4HYYA 1G8PA 1Z28A 2BC9A 2PL3A 1J70A 3CPEA 4CF7A 2WAYA 1E2KA 1P9RA 4A9AA 1G19A 5EZ5A 5IHPA 4OHYA 5TB5A 4B6FA 4JLVA 4US2R 4IDOA 4C2UA 1KY2A 2EVWX 4HUQA 4PSAA 1SZPA 2ZI5A 4QNRA 5SZIA 3CPJB 5JS7A 1WMSA 4JSTA 3PXGA 2O8FB 4YMTA 3GEIA 1E94E 2OCAA 5E4FA 3T1TA 2HJGA 3NDBB 1T0JB 1TX4B 2DYKA 2FFHA 4FMCB 4JBYA 4AYTA 3QVVA 2RGBA 4MGIR 4B2LA 2FPMA 5BN5A 3AF4A 4RD2A 3HYTA 2GJ8A 4BQSA 5L3RA 4QFMA 2NQ2C 1X8LA 3AP3A 3BOSA 5KHOC 5KSOA 1YR8A 4DZZA 3IILA 2O8EB 2ODWA 3GCGA 3QIAA 4D26A 4OL0A 5D3QA 3O8DA 5AWFC 2ZRFA 2QRZA 1NSFA 1CJUC 1VG1A 1M7HA 1NJGA 2IX3A 1IXZA 4Q66C 4YMUA 2ZVQX 3THOA 2A78A 2XTMA 2ONKA 3GJ6A 1GNQA 5H1YA 3RS3A 4JLKA 3C15C 1J2JA 2ZI7A 3TQCA 3DM5A 2Q3FA 4LYFA 2QZ4A 5DISB 2FNAA 1ELOA 5CK4A 2NMVA 3LAWA 3KKPA 2W6IA 1Z0KA 3A1TA 3IHWA 2RGNA 1U99A 4IDQA 4OHZA 1KMHA 1VECA 3SBDA 3VR2A 3BIFA 1KI6A 2W58A 3IIMA 3EWAA 1KOFA 3SE0A 1JR6A 2X2FA 2WJGA 1IONA 5KNDA 2WJJA 5CIWA 4B3FX 1R0XA 2GBLA 3WXMA 4KLZA 1NN1A 2XAUA 4RKEA 5FOXA 1UPTA 4QGHA 2XNDA 1KDPA 5EUMA 4KLNA 1W36B 4UNSA 1GWNA 1GIAA 3QF4A 3R7WA 2O5VA 1E4YA 1LV7A 3AP2A 4EPTA 1FMJA 2QAGC 3LY5A 4PTLA 4C0QC 2XXAB 2EYUA 1VCOA 4CZ2A 2XSZA 5KO2A 1QG4A 3CBQA 1II8A 2J1LA 4G3XA 2V7QD 3B5JA 2JLZA 3TAUA 3WNDA 4WVFA 1AN0A 5HKKD 3D6TB 4RCZA 1PUIA 3RWMB 1JAHA 3U7GA 4LV5B 2BCJQ 3EZ7A 3QI2A 3JZAA 3RWOA 4FMDF 1DEKA 2EQBA 2JJ2D 4JLOA 2G1KA 2V55B 4JZKA 3RS0A 1G7RA 5DSZA 2GDJA 4A2PA 4LHVA 1E2PA 4KODA 4ACBA 3J81k 1OYYA 1XU4A 2C99A 4E09A 1F3OA 4TT3D
chains in the Genus database with same CATH superfamily
1P7VA 4HD8A 3F4BA 2B94A 3AR9A 1BVUA 1DG1G 4HGNA 4LZOA 1UJ6A 2DFLA 1BKSB 3JATB 2PX4A 4WJZA 3WLQA 1IN7A 3NTLA 4KWIA 4MW4A 3C3PA 3A14A 1XDUA 3LCMA 1XNJA 4FEEA 3E2PA 1XDWA 3II6X 3IVRA 4Q3LA 1ZVQA 4W5JA 4DUGD 1Y48E 1A9YA 1LC3A 3BWMA 4EW1A 2AFRA 2I9PA 3AI3A 3PRHA 1FQWA 3PR2B 1R9JA 3DWIA 1L4NA 3ZBUA 1GCIA 4FZ3A 2OZVA 4RFVA 4KXNA 3UWMA 3WI7A 1E9AA 1KFJB 2XCLA 3RRNA 5FJIA 3LWZA 3KWMA 1KS2A 3L41A 2DFTA 3S7TA 2ALJA 4TMZA 4I1PA 4JEIA 3DWEX 5FX2A 1R0WA 4YRBA 1N6KA 5CBPB 3UG7A 4G56A 1ONOA 3KCQA 2H85A 3FRHA 2JAOA 4QRDA 3W05A 2A1IA 2X2OA 3KQNA 5EPUA 1F8GA 3WGQA 3IQEA 4UARA 4N9WA 1JI0A 4AI6A 1DV2A 1Z5WA 2JANA 5IDWA 2PXHA 3F3YA 5K0ZA 3A6KA 1SUBA 2G36A 2A14A 4LOHA 1MF7A 1FXUA 3DBVO 2W8ZA 3LT5A 1XZFA 1ZGGA 2ZXEA 4K9OA 5ALDA 1TM5E 2P6UA 1E0SA 1O54A 1W46A 4JIGA 4Q12A 2WWTA 1L7QA 4NS4A 4V0RA 1VA4A 5E9WA 1N9ZA 1XZGA 4TS1A 5FUVA 2O3TA 3UAWA 1NNEA 2JBWA 1WKBA 2W8BB 2Z43A 3OF5A 1E8MA 2W6JD 1KNQA 1D3AA 4G5YA 4PY2A 5HG0A 3SF8A 2G1JA 3DTNA 1SJ9A 2RJNA 5FIUA 3DPSA 1UBMS 3NP9A 4RPJA 5BVHA 3TNJA 4R2MA 1S5PA 2YHAA 5E3IA 3GCDA 3RT1A 3C6MA 3EA0A 1H3EA 1JHUA 3ROMA 2RCNA 1VE3A 3KQPA 1GLVA 2O2SA 1KMCA 2NU9A 1G3MA 2CXQA 2OBLA 1YDWA 2QI9F 3G5MA 3CKKA 4PLCA 5AKZA 3RPEA 4QBIA 1N0IA 3T9FA 1UK8A 3ZHXA 4B46A 2D5IA 2GTHA 4H3VA 1GU7A 4G8CA 2P9YA 5F51A 2BHSA 1FTYA 1D6MA 4HWGA 3JRWA 4FSXA 5IAKA 2UXCB 2HI0A 1FFCA 1KWKA 4WESB 1NW9B 3N2NA 1KE1A 3WFZA 4R4JA 4NX2A 6LDHA 5L8VA 1E1QA 2D1YA 3TQQA 1E7RA 1W9MA 2HJRA 4UTZA 3CNBA 4ZHQF 2Q5CA 4MGHA 3KETA 2ZITA 4E5MA 2JZNA 3NIBA 4Y1FA 1P60A 1EEXB 3GNSA 2R1VB 3W6PA 1NVVR 2JIDA 2V59A 2P3LA 5B53A 5JISA 3SBEA 4OJMX 5IJZA 1YKFA 5IS2A 1OI4A 1TF7A 1XZEA 3SLRA 3V55A 5LIPA 3IEIA 3T5GA 3VOBA 1GOTA 2HDWA 1ECBA 1W6UA 2GEKA 1QB8A 3PFCA 2C9YA 4R05A 1SVKA 1EAMA 2RK4A 4IJQA 5HZMA 5BW5A 2V4MA 1NQVA 4MRAA 3AVTA 3QNUA 5JDCC 3AEYA 3WL4A 3K8QA 5AH0A 4EHJA 5C1BA 1SXHA 1UODA 3QELA 3W77A 3EH2A 2VBGA 2ISCA 3DVAA 3JW8A 4TSFD 1HYHA 2GLTA 3WMGA 2FUNB 5CFRA 5AUQA 2HDOA 2BN4A 2G5GX 1FVXA 4F4FA 1DDGA 4QTXA 3KJNA 3RNLA 3SZRA 3I3SR 3QTLA 4ED9A 4IOJA 3WWPA 3AR2A 1GKYA 1YZNA 2EX4A 3EXAA 1Z2OX 3FR8A 4M0FA 1AQJA 3TMAA 3KKLA 4JV5B 4PANA 1E9CA 1Z17A 3GARA 3OFNA 3U0BA 5B7GA 1CUJA 4YP5A 5FULA 2QMHA 1DMSA 3G8CA 1X3LA 3WLKX 3HA3A 1Z0DA 3EBLA 4MLPA 1US8B 2OB2A 3K9NA 2QV7A 4FGUA 3S0JA 4F93B 1CVRA 3U62A 3HYLA 1A5SB 3DCNA 3R3UA 4PIPA 4UREA 5EJMA 3T5DA 5J2TB 4CL3A 2VAPA 4O4IA 2YHIA 2HADA 5A02A 2PX2A 3MTQA 2WPNA 4PZDA 4H6VA 1VGQA 1JLLB 1VFNA 1XTRA 1ODKA 3VU9B 2GFQA 1T3GA 4ZYWA 4LMBA 1U7PA 4GOMD 5JZOA 1QNLA 2HHCA 2KYRA 1OKKA 2PSHA 5SY9A 4JA2A 3TIXB 1QLJA 3F78A 3TDNA 3L4SO 1T26A 3DD1A 4MLCA 1EVLA 1Z4QA 4D46A 1DTWB 1NWCA 4GO1A 3EEFA 2XUKA 4WY5A 4JL5A 2HMSA 2B25A 5DGHA 4BNIA 5AJZA 4W9RA 2YC2C 3AZQA 5JD4A 1TO6A 3I5XA 1UZUA 4Q3BA 3JQQA 2AFIA 1IXYA 2WD9A 1Q95A 3KJEA 3SD7A 5TXGA 4CF4A 4QYIB 3UH0A 4PFSA 1CQXA 1XCLA 4MV9A 5H68A 4PSDA 1F9AA 3G23A 1DBSA 1U04A 4ENVA 5EIXA 3QX8A 4DBZA 1G8SA 1NY5A 1PW5A 1U0OC 2B21A 5DNDA 4U2GA 4D9HA 2O05A 3ITKA 3BJEA 2NV2B 3ZZTA 1XAJA 1XVIA 1YKGA 3FPGA 1K6XA 1PJZA 1XNRB 1JLMA 1P7YA 3TGPA 5JNVA 1GRVA 4YRIA 1H69A 1F0PA 1EA5A 1F2DA 1XJQA 4H7PA 1Y3IA 5IBPA 5JCPA 5EI5A 5H3LA 5KNBD 1DKNA 3LECA 2FPIB 4OMFG 1OF1A 5LC1A 2P2ZA 3BYZA 4IXNA 4RTSA 4TRRA 4KH1A 4N5IX 1XDZA 5K6AC 3AVXA 4E32A 1ESMA 1I2MA 1I6KA 3LZCA 3E84A 1SAYA 3WGZA 1B6SA 3A1CA 3E3LA 4B76A 4NBVA 5FL7D 3HC7A 1DI0A 4V3BA 3VZCA 1G5TA 5FHRA 4R69A 3K3PA 3AHCA 1NF3A 2H63A 3KB2A 5B37A 4DB4A 3GQBA 5FAXA 1JSLA 2IEDA 2H8GA 4KW7A 1DLIA 4OFZA 4X45A 2PGDA 3RSOA 2PRIA 3A9TA 1C30A 2JAWA 3HDVA 3MG9A 4O4JF 1AXEA 1VYTA 2I1WA 3ILVA 4HLCA 3RIEA 4KXQA 2OQ2A 5K8JB 5L40A 2Z1MA 4UAJA 1N57A 5KTPA 1QP7A 2QTHA 3EC2A 4AC9A 4V0ME 5H59A 3ZZ1A 5GZ1A 4H3SA 4URZR 2W6ZA 3SJ7A 3LFUA 3OZGA 2VUSA 2Q5HA 5AXAA 1Q19A 3EQ9A 4BJ6A 2BEUA 4RIFA 3ZJ4A 2ISQA 1K6IA 3S5UA 4Y2YA 2AHOA 1JAIA 1E0DA 1EUCB 1T5HX 3NCHA 4JT8A 3VR6D 4M53A 2H4XA 5DX1A 3ZKWA 4TN5A 5IZCA 2FP3A 2FP4B 5DI3A 1QSGA 5K4GA 5KI6A 2IEAA 4BNNA 4Y2VA 4CM1A 5JS1A 4F1WA 3D3QA 5D51S 5BN4B 2ONCA 4KYTA 4L5BA 1OOEA 5M34A 2NZYA 1ZN8A 3OTIA 4LXUA 4PRZA 3ONFA 4G07A 4H7FA 2JIBA 4DVJA 5KKCA 2G88A 5K3AA 2O07A 1I7QB 1M1YE 4Q4HB 4CKWB 4NNOA 3LBAA 2BKLA 1T3ZA 4C0HA 1C0IA 2OLEA 5D5QA 4F2HA 1F7VA 1H2EA 1OZ0A 3ZS9A 3AEQA 6Q21A 3EVEA 3T7SA 4AS1A 4MRRA 2DFVA 1Z47A 2BWJA 1U3GA 1YHZA 2I8AA 1NBME 4F2PA 5B3JC 1S2OA 4R8KA 4ND8B 1JEJA 5ERYA 5IASA 2ZAOA 1H2XA 1X1EA 3ES9A 3F9IA 3TNLA 5FLXA 4YQZA 3OJEA 4J94A 3C1TA 2K2WA 5AKJA 4BFSA 1FPMA 1GRNA 2I5PO 4EVSA 3DHEA 3ZXSA 4MI3A 4TL9A 1OAOC 3ONNA 4XYEA 4EZIA 5HIKA 2ZWPA 1ABBA 3TOSA 2DM6A 3IJEB 2BFEB 3RU2A 5KC9A 5K3BA 4FE3A 4JBXA 5KHLB 1BXKA 2Q29A 3RYHB 5J4HA 1TTPB 2LR0A 2BFWA 3HMQA 3DTVA 4PVDA 1LWOA 4OAOA 5GM2A 1MORA 4HGRA 3SOPA 3QP9A 4UM9D 3E58A 1P77A 5ICGA 5LD2C 1Y0BA 2OXIA 1E2HA 1CRQA 2YY5A 4Q82A 3HKCB 5CFNA 1QDUA 5BQFA 3P0FA 4M88A 4QYWA 5IDYA 3IEMA 1SG9A 3W5AA 2XWBF 4XYBA 4YLGA 1JE0A 1XRNA 2H2HA 2JFPA 1YS7A 3BS4A 2F9LA 1DIOB 3GDHA 2G40A 3I39X 2NAPA 3WLJA 4ARIA 3EMKA 5AM5A 1UBOS 3MLAA 4KV7A 2XW6A 4D3FA 2VYVD 4G9BA 1JSRA 4BGDA 1MABB 3A3KA 1TEXA 1L7RA 2GEVA 1L7PA 4DEYA 1N32B 1XWFA 4TUYA 1NW7A 4CT5A 1ZVVA 2IF0A 3EZ2A 4NBNA 2JH3A 5TIIA 3GRFA 1OWNA 1P3DA 4K9KA 1FX0B 4FUTA 4AYWA 1NN0A 4K5QA 2CJXA 2D1SA 2KM1A 1D1TA 5JCZA 1QZ3A 2HIMA 3H75A 3UOGA 5A1JA 3H17A 4HFMA 1J0AA 4M8SA 4XJTA 3SXUA 3AGQA 1SVOA 3SYKA 3HCOA 5DWVA 1N6RA 1C7RA 1K6EA 3EOZA 1KDRA 1JDVA 1EYZA 2XEXA 3KVNA 4HEQA 4B2PA 3WIOA 4LZZA 1Q16A 4MQLA 5ALUA 4WOJA 2QRVB 4F38A 1U2PA 4JP1A 5A4IS 5C8YF 4TMWA 2DERA 2GXUA 2PWPA 1YE3A 1V8ZA 3Q9NA 2O8CA 1NAHA 3SJAA 3CLVA 4ENTA 1GUZA 2EWWA 4JT9A 4M7PA 1ADBA 3QBEA 3LLUA 3QVOA 1BG6A 5SYNA 5ES3A 1XD2A 4DCMA 4URXR 1ZH6A 2ZI3A 4MVWA 2I4TA 4UHEA 2JGDB 5E9QA 4D3DA 5H9WA 2C84A 3EWNA 2QX7A 3I30X 521PA 3EXIB 2R7KA 2O8NA 1I9GA 1USWA 2BTOA 4KE6A 2E5LB 2JLQA 4RVCA 1KYYA 1B2RA 4K6FA 3C48A 4XM1A 1V5IA 1I1QB 4YAFA 4CETA 2DQZA 4QQRA 6ABPA 5I7HA 5A5DA 1I80A 2FZEA 1CY8A 4CM6A 3QVMA 3MCAA 2ZYSA 3X1YA 4Q00A 1XMQB 4IVPA 3D8SA 4Q19A 4E5DA 2J9YB 4XVUA 1TJ4A 3JZIA 2VFAA 3U13A 3IRUA 1UZMA 3RGWS 1K8YB 2QDKA 3OQVA 4FT2A 5G3ZA 3DBHA 5KOIA 3A10A 3GVIA 3HXLA 3ILYA 4GNRA 2DHEA 3KAKA 4P3PA 4X62B 3U19A 3B1FA 5KCMA 4M1TA 2OPHA 3LT4A 1C80A 2WWFA 4TLAA 4UAUA 2XMZA 5BV1A 5F5LA 3DAPA 3S68A 1EFCA 2OV3A 4EAQA 3V5NA 2RBKA 2GZRA 4B6QA 3WZLA 1YQGA 1UOQA 2F59A 4GKAA 2DCMA 2VDOB 3GLFB 1KY3A 2YHBA 2REQA 1XQ1A 2FYTA 5IM5A 3I6MA 2B78A 4PG8A 1YQWA 2ID7A 3IRVA 4ATNA 3HXMA 1K97A 1F5SA 2J4FA 4UU8A 2ZRLA 3ZGLA 4Q16A 1GQ2A 5DIZA 2N1MA 1AGPA 2HU2A 3A9WA 3QYPA 821PA 4CDRA 1JMVA 2OXRA 1QGYA 1QOQB 2XOKA 3VJKA 4CM9D 1TKBA 3FFXA 1GCOA 3L7BA 3PKIA 3QF7A 3QVLA 3U9LA 1Z2CA 2C4KA 2FE1A 2ZB4A 1DO0A 4HDRB 5E2AA 4PXAA 3U7FB 2V0GA 3QUBA 1WBDA 1F14A 2ERXA 2Q3JA 2P9GA 3OD5A 3SFVA 2H3EA 3QVTA 3K30A 3NTOA 4MYHA 4BO7A 3JQGA 2AQKA 1VCNA 1ZIYA 3MWYW 3P2YA 5EXPA 2YBDA 3ODPA 4PR3A 1Y8AA 4WN9A 4FIDA 4IWXA 1I51A 1KWGA 4IH9A 1JLSA 4D5EA 1PNVA 1M76A 5AW3A 4BNGA 4I1UA 4QUDA 4F5YA 2B4QA 1C4WA 1BVYF 2PSDA 2EFEB 2PX6A 2IEIA 3GFSA 4LWQA 4PFJA 3UXYA 2DQYA 3VVBA 4L28A 1PL7A 1NBEA 3L7AA 4M9XA 3RVPA 3VNSA 1LTHR 2NUTB 3NH9A 1I5RA 1QXSA 4J03A 1Q1QA 1DJPA 1TJYA 1W6RA 1YIOA 3GFFA 1W0CA 3IDZA 4UZEA 3U3MA 4M22A 1DL5A 3QVXA 1LLQA 4X6UA 1NNUA 1H66A 2AR7A 3CH7A 1R3UA 5I4CA 3AHFA 3V1LA 1FTWA 1KJYA 3CW2A 2QVCA 3DDUA 5M5BA 4QREA 2XBMA 3PFNA 1IEXA 2H7XA 2HJWA 3CX4A 1Z63A 1UBFA 4W63A 1GNLA 3BN3A 4J4TA 3AG5A 1PG0A 3IE1A 1FS4A 4HMQA 5DGIA 4BLQA 4TXLA 4YRAA 1WSDA 2DUUA 3ORHA 3OA0A 1ORVA 2GSDA 1GEEA 1YUNA 3P2JA 1TVEA 2I54A 3HGMA 4HLUC 3HZRA 4U9IS 1GTG1 1B2LA 5EEGA 4ER3A 1BFDA 3SJBA 5FBKA 2ASVA 3ECCA 4AULA 2FTKE 1VSUA 3B6ZA 3P0HA 5CFMA 2IS4A 4EENA 2XV1A 2JFQA 5K8UA 3ICWA 1B3BA 3TLCA 3J7AC 1T8TA 3BXEA 1MA3A 1DV1A 2F3TA 3Q7EA 3D8RA 3W1WA 4OAQA 2V6GA 2BGKA 4XWOA 2DUWA 4I1SA 3NKFA 1DAIA 2DPLA 2PUVA 4RTJA 5JSUA 5FPHA 1JA9A 3UICA 4UVHA 3GJTA 1N33B 3UC5A 3A0RB 1MAVA 4G9EA 5EHNA 3HKEB 1AGYA 1SCUA 3BL6A 4QT0A 2FRVA 3JSXA 3AY6A 2XCOA 3IYLW 5LBTA 4RJJA 5AUNB 3NWOA 2WI8A 3JYNA 1CC1S 3SZUA 3DVQX 3WL3A 3VC1A 2QQGA 2K5UA 1V25A 1KZHA 1HNXB 3RK0A 5J5VA 1E6LA 1WY5A 2YMQA 5K51A 2AG0A 1YZFA 1NUTA 2VNJA 4PWZA 3U0VA 5K45A 3GRUA 3PPXA 1Z16A 3TM5A 2KE5A 1AXGA 1I1OA 2R3SA 2Z2JA 4CFZA 1MJGA 1TLTA 5A4AA 4YDQA 1EIZA 4IYJA 5EJAA 1BCRB 1IIBA 1WG8A 2XBUA 3O31A 3A31A 1DFHA 3B2NA 5KYGA 3KOZA 4ZDJA 5BUSA 4OK6A 4ZC1A 1QK5A 4M46A 3EW7A 1UZLA 3IBCA 5EJGA 5TSDA 2LKCA 1Z0AA 3FYTA 1JA1A 5IT9A 5L3QB 3GNTA 1LBHA 3G8AA 3NS7A 1SXPA 1NG1A 4Z2YA 4DA8A 5GPBA 1C8VB 1JQLB 2JIOA 2A8YA 1XJ0A 4IIJF 4DLKA 3VR5H 3EQ7A 5CDYA 2PUJA 3AUJB 3ZV6A 3CNQS 4MZDA 2IDJA 2UKDA 2VJYA 4LDRA 4AJKA 4BN5A 5LU8A 1LPAB 4OPMA 2WE7A 4OXRA 1M6HA 4YV2A 5FBRB 1X6VA 3ZY5A 3VPGA 4Q47A 4DLBA 5HNKA 1NZFA 5H7XA 2HJSA 1T5OA 3E1SA 5K6AA 1N8KA 1NSTA 1X77A 1P4HA 4HQLA 2N47A 5AW2A 4RZIA 2HU5A 1C9YA 4J0KA 2AHRA 2COEA 2FFQA 3G68A 3WJ2A 2H92A 2FJPA 2YQZA 1R5BA 2PLWA 3D6MA 4NAVA 3DMHA 2DTXA 1KZ9A 1E6MA 4MLDA 4TS9A 4PQFA 2JFFA 1UM9A 3LXXA 4OUDA 3KTFA 4PYIA 3KTDA 1N5RA 1XD8A 4BMSA 3W8DA 4P31A 4BIIA 3O9ZA 4FI3C 3CMMA 2BMEA 4C4PA 2EW1A 3WS7A 3HRKA 4R9UC 4D4HA 2E1RA 4L3VA 4DAEA 1H8EA 1P7PA 2PWBA 1H2RS 1UP7A 2AT1A 3PDJA 3S2UA 3LC0A 3UAXA 4CEJB 3AIKA 2OAQ1 3FJOA 3WK4A 4BATA 4D56A 1TQDA 1YR2A 4YUWA 1NFRA 3GR6A 1NYLA 2O1WA 2Q0SA 4I1VA 3NKLA 1RPNA 4FINA 4JHXA 4PBRA 4Y6PA 2P3OA 4ZDWA 5K3CA 1T0BA 3U3KA 1Q2UA 2FHPA 4XR4A 3V9PA 4BJHB 3KOOA 5A1TA 1WVMA 2O2GA 3GLGA 2O2YA 3AWIA 4N48A 3B82A 1CR2A 1JQ5A 4CIVA 1V45E 4HDKB 4CRWB 4OATA 4PX5A 1AUVA 1DVRA 3P9KA 5A3VA 4I4LA 5EJIA 4OQYA 2XHEA 2IS1A 1YJBA 1X7YA 1VOTA 1LDNA 1NXSA 2C8LA 5C8VA 1SXJB 3AI2A 3MWDB 1Q77A 3O8BA 4UEJA 3H13A 3EQ6A 1NP7A 3VHXB 3WDLA 5CMLA 1MB2A 1PI3A 3F5DA 1NXTA 1QF7A 4JNKA 4CTJA 1ANKA 2ACVA 3ND6A 1ZJJA 3UJNA 2XLBA 5AM1A 1WNFA 2JASA 4AUKA 5HBGA 1EFHA 1MDBA 3ED5A 2YJTD 3TMKA 1FL9A 2C31A 2FG6C 1I8TA 3O91A 1IN1A 3VYUB 3GRZA 3LA8A 4NCNA 3EPHA 2VHWA 3U7RA 5A5GA 2F4NA 3DUFB 3QI7A 3F6EX 1KMNA 1I36A 3GUHA 5LQJA 1SBZA 5FEMA 1RP7A 1DX6A 2BR4A 3BD6A 3BWBA 3PVCA 4MHOA 3RD5A 4DC1A 2W2KB 2A6PA 4O1MA 1DIRA 2WIAA 3KYIB 5C1DA 2RK6A 2VNKA 2O57A 2Y0DA 3DFIA 3OZCA 2P2DA 1Z62A 4KDFA 3ETCA 3GGGA 3OZWA 3B70A 5FWYA 2IWHA 3V1KA 3WRVA 3F6RA 1JHPA 5ELLA 3CG0A 3BGSA 3HY4A 4IBOA 3LY8A 4C6TA 1Y7LA 1FC0A 4DV5B 1G3IA 2G82A 3EDRA 3PE4A 5DM0A 4E5UA 3C16C 4EUEA 1ODIA 5BSFA 3IUPA 4NENB 4NBUA 5IUKC 3TLGA 2XGJA 4KH0A 2VTBA 4J43A 3EH1A 4XARA 4PZUA 4HH3C 3WMRA 1NXQA 3OF2A 4KREA 1C7QA 4K1XA 3FGOA 1YT5A 5IPFA 3K7EA 4GP7A 3ZEIA 3RYIA 1QTNA 4QEZA 4KWTA 4UCQA 4FFBA 3GPIA 5BW6B 2AN4A 3FNBA 4KQXA 2PWYA 3CEMA 5CGQB 4YAEA 3JARB 4NMWA 1DAPA 1FRQA 3FZQA 2QLMA 4U2DA 1FDIA 3TSYA 1DQZA 4FFLA 1GSAA 4Y6QA 1JDUA 10MHA 3K2BA 4HGQA 4AQDA 4E2YA 3RC8A 2PXCA 3AW8A 3FHJA 3CF4A 4TVKA 1FY2A 3HBFA 1SVSA 2GUWA 2HN9A 1M6YA 2MDTA 1TADA 1IH8A 1QHHB 3R09A 2C92A 2ZIGA 3R4CA 5IAJA 1B8PA 4BQOA 4CM7A 5CB4B 1U63A 4YRKA 4KNVA 3C39A 1LF0A 1W76A 1AD2A 1EK0A 2JA2A 2PGIA 3FLEA 3IAXA 1Y7HA 2ZYIA 3AF1A 1GGJA 4X3CA 3U3XA 2PJRA 2DT5A 3GFGA 2Q7XA 3NEPX 3N6RA 3SR0A 3PGJA 4EUKA 1U1IA 5EJEA 4UPVA 1YO6A 1Q5PA 1OX5A 4M9SA 1W1WA 1BQ4A 4MW7A 1TMOA 3ZV4A 2PS3A 3H9BA 4D4IA 2WSSA 4W7IA 4C6SA 4RJIA 4IILA 1DIBA 2AQIA 2OV1A 4QQNA 4JDPA 1GGHA 4ZEXA 2DKNA 3W3AH 4I3GA 1FNNA 4E5NA 1GPLA 3BE6A 4M7WA 5CNMA 4OF4A 3IQZA 4JP5A 1MO6A 1MPXA 1PTJC 1X19A 1QQBA 1V26A 5HGXA 1NF2A 3IDFA 5C0OE 3VVMA 3A6PC 4MCJA 4RZ2A 1S3SA 4PCAA 3IKLA 5CX1A 4CMGA 1M6VB 5B1IA 3ZWPA 3HVRA 2EBHX 4X20B 4XVHA 1EWQA 3ROEA 3LUPA 5BN5B 3W6ZA 2GCIA 3GFOA 1WPXA 1P4SA 4RFLA 4RA9A 4ZO4A 8AT1A 4ZYYA 4G4JA 3OKCA 1LDEA 4AECA 3TF5A 2ZSJA 1FJGB 1P9OA 4TKZA 5JO9A 4YP6A 3WHKA 5JWOA 5EWLB 1NE2A 3NHMA 3NC0C 2I1QA 2OXEA 2PKWA 3A70A 3FRIA 3MT8A 4KIUA 2F43A 2R1UA 2CXOA 3Q8WA 4TMYA 1ETHA 1JX6A 1E7YA 2BMVA 1H1DA 4MRMB 2CSXA 3LHKA 4DR6B 4TYWA 3H19A 3RR2A 2BMAA 3D1JA 3CR8A 5EWJA 5F21A 3UA3A 2OZEA 1NMYA 4FHCA 3ZCUA 2OZKA 3O93A 2VXOA 1JU4A 4NXMB 3MWEA 3QMVA 1TYBE 1WR8A 2XXBA 4JQSA 3U6BA 1Z7WA 2YINC 1Q0RA 1EMDA 2C59A 3OT1A 1NLZA 2Q4TA 3D02A 5GOZA 1XRQA 3O1LA 4PCLA 5I7AA 1GPMA 2QTGA 1NMXA 5E1MA 4IUDS 1H4SA 5A2QA 3PNOA 1Y89A 3GGJA 2HQRA 5I7RA 4AVYA 2IVFA 1GQSA 2PGOA 2WAXA 2XLCA 5BUQA 2FFBA 4BLRA 1VZ3A 2IDKA 4XH9B 4F7DA 4D57A 1NA5A 3EGXA 1LLFA 1PJ3A 1I0LA 2E87A 2FZGA 2HXSA 1YF3A 4CEIA 2QTFA 1KI9A 3QOXA 3EPJA 3KQHA 2QT9A 2JDID 3THXA 1QPZA 1V43A 1TC2A 5IP5A 5I4BA 1CU1A 3W5DA 5AIBA 3S1AA 2YRWA 5E7IA 4RPLA 4J16A 3U48A 4BPBA 4BE9A 1DPFA 1TM2A 4JKOA 4XVRA 4C78A 5K4AA 2ODTX 3HXKA 3HPQA 8LDHA 2ZBGA 1JIJA 2W6CX 4MDYA 3CKMA 4MW9A 2H9YA 5AJUA 1FYDA 2GJKA 3H5AA 3UFXA 2PKXA 3OZ7A 1X8JA 4HNAA 4BNFA 5IABA 4O02B 3TNYA 5I9NA 5JWRA 1CY1A 3NWPA 3F3SA 4UNNA 3G8DA 3DW1X 2W6OA 3V34A 1IMJA 1J24A 1BWQA 2HWWA 4J2OA 4R0NA 1CB7A 1X80A 4H0FA 1NJSA 2A92A 3IX7A 3BSSA 3I61A 3UGTA 4DIEA 4ZAXA 2C8JA 2P0EA 3RASA 1P2VA 1Z25A 2D4AA 2CLMB 4G1CA 5ECDA 4JJAA 3D54D 3ZE7A 1E3EA 1WXHA 2FMIA 5BNFA 4WCDA 4BMZA 5NLLA 3WGVA 1W0KD 3IBSA 3L04A 3LXUX 3ZJ5A 1Q0HA 5JSZB 5I5GA 4B09A 2ZRKA 3ZV7A 3JX9A 3CNHA 3DNFA 1C2YA 3TD9A 2AFIE 4TWRA 4EFDA 3U26A 2AW5A 3SIXA 1KIAA 1DS6A 5H16A 1BXRB 3UXMA 1DKRA 1N1GA 2P8JA 3T3OA 1L4FA 1TVKA 4LXXA 2ZT8A 3ZHZA 4K40A 3ZU4A 1BMDA 3ZWXA 1RJ9A 4ZVPA 4RHEA 3TI7A 4ABYA 4YT8A 5DGTA 4PGFA 3UMVA 2ZQZA 5FDFA 4CLOA 3W5VA 1I24A 3KBBA 5CLGA 3VTZA 3WO0A 4LCBA 1VTKA 2XDYA 2IPOA 5CEEA 4QXOA 2IBMA 1ZCFA 2JFNA 2OTCA 5EE3A 3MILA 3UCFA 1RC8A 3HRIA 4DZRA 3KB6A 1EFUA 3RIMA 4DCTA 3AQIA 3PQFA 1E3MA 2QNRA 4AT1A 1EP9A 2B37A 4LYAA 1X1AA 4DCCA 5CDFE 1KPGA 3AHGA 2C20A 4E5VA 1M2HA 3L8CA 3UB3A 3GBPA 1NTRA 2FZKA 4JLUA 4D0GA 3ASVA 1B15A 1A8HA 3SJCA 4CMCA 2MR5A 2YWEA 3F47A 1M0WA 2C42A 3GYGA 4IO0A 2AQHA 4AMYA 3FOCA 2OD2A 3RYCA 3NHUA 3EVGA 4MVJM 1KBQA 4F8JA 1SA0B 3KBOA 5EZQA 5EZSA 3NAQA 5JNLA 1GQFA 2R6AA 3OTGA 3KQOA 4YJKA 5E8JA 3ILXA 4O3MA 2RGGA 1M9NA 4V0QA 4X7BA 3SHFA 1P1BA 3D0QA 2FEMA 3LU1A 2P41A 6PFKA 4DW8A 1UK9A 3UC9A 2H1IA 2QIOA 3AP1A 3RSHA 1ETUA 4YA6A 4MV0A 1T0HB 2XYVA 4HK4A 1QBKC 3FPKA 1PT9A 4ETMA 2AKEA 2OP1A 5JAUA 4EJ6A 1GZ3A 4WFKA 4Q3EA 4EGJA 3BMOA 1A4XA 2C2MA 3MD0A 1RBQA 1UANA 1XRMA 3HR8A 4Y6LA 2HA0A 5CB0A 2R84A 3H2YA 3NUQA 5AQ1A 1C0EA 5F77A 2VCEA 3R0VA 5ADWA 3DT8A 3W2IA 4BP8A 2R1TA 2XGGA 4EY8A 4D2IA 2IS6A 1FYWA 3E8SA 1ZOLA 5C46F 3UK6A 2GBLC 3DLTA 4KP7A 3WLPA 2HKIA 2O7VA 4HY3A 1NZDA 4MDEA 4XQCA 4BQEA 4FW8A 3TRHA 3VV3A 1M7BA 3EJ6A 2P6PA 1QRTA 2AN3A 1JNYA 4G85A 1U28A 1QV6A 1WLYA 1DHRA 3LVRE 3MAJA 4ZOLB 5EGNA 2WYHA 5AOAA 4WOBA 5HMMA 2O7NA 5LP6A 4N6NA 2A0YA 3EVDA 3B9BA 2YXLA 3EVCA 3ENWA 2F1JA 1PUJA 4A8HA 1TUEA 4ZIRB 1JHYA 2RG1A 4QPJC 4I1OA 4FYYA 4U0KA 1Z4MA 3B1KA 5J2UB 4UHHA 1ENZA 5HZKA 1WZUA 4P82A 1OU4A 4BPRA 1LI5A 5CFLA 3L5KA 2FPKA 3NIGB 3SQNA 3BF7A 3R0QA 3JAKA 1XQYA 1OV4A 2KLBA 3HB4X 4EARA 3WSWA 3RKSA 3UAVA 1T6NA 4LDQA 1GL6A 4RTLA 2YFYA 3K05A 3NBMA 3TX2A 1HLPA 1EGMB 1XXHB 1N0WA 4XGKA 4Z4IA 5FP0A 4QQ8A 5BQOA 1EB8A 2PGNA 1HR0B 3IIKA 2GVNA 5F64A 2WDPA 3QY9A 1X1TA 4FFWA 1WMAA 2NSYA 4MYRA 3ESDA 4JLBA 5CM9C 1FUYB 2WUEA 4WBNA 3JZFA 3GHHA 4Y30A 5HJ7A 2CDNA 3O8CA 1AB6A 2QN7A 3PF9A 4ENWA 1VL1A 1PEKE 4V3CA 2MCFA 3K9FC 2I71A 1H5NA 3FMVA 1NVEA 2ZVPX 3VMMA 2UUCB 3VKGA 5EZ6B 1QC5B 1RWQA 4DQDA 1WUKS 3QMWA 1U8YA 5KVQA 3TUJC 1AQUA 2HWKA 4ILKA 3U7QB 2I3GA 4FK8A 2LIPA 3D7KA 4EG3A 5KTNA 1PNRA 5IXJA 2F64A 2MSEB 2NUAA 3EGDA 4FGLA 3H7AA 3C7CB 2Z5FA 3EVNA 3GZ4A 3D3WA 3FWKA 2J3QA 5HBRA 4RMHA 4DZTA 3B53X 4DM3A 4DRXA 1Y4ZA 2O6LA 2IXBA 3UWOA 3WIBA 3GLIA 4GOXA 4BFUA 4H7EA 5ICMA 2QB5A 3T1OA 1GYRA 4C3OB 1YZYA 1W73A 4Q3AA 1QGZA 2F3UA 1YZ3A 3L40A 4HNTA 2HGSA 2Z4TA 5IFKA 1LK5A 2Q21A 2WTXA 4WJKB 4BWYA 1OT3A 2DHDA 2QR2A 5T8KA 5KYTA 3KTAB 1REQA 2VHZA 4DCUA 3VVLA 5JQWA 5MN6A 3O5AA 3EZXA 3LUFA 4RD1A 4LKRA 4DN6A 2OMEA 3HJNA 4WXPA 5EQDA 4ME6A 3ZCPA 2EFGA 3HV2A 3PX2A 8OHMA 2GYUA 3LO8A 1H6CA 4JELA 3JYPA 5TVGA 4CIDA 2EDCA 1TZBA 1RC1A 5HA5A 2HREA 4RANA 5BR8B 3G5LA 3DLIA 5CPFA 4DLRA 4RGVA 3H6GA 1Z37A 5K8CA 3SDBA 2A0UA 4DA9A 2VPIA 5LVAA 2GRJA 5FLEX 4W1SA 2Q27A 3AJ9A 2XRMA 4ID9A 5IMSA 1YL6A 1JP7A 2D2VA 1I4TD 1RKBA 3LBNA 3LZ6A 4MJXA 3MMNA 1K8XB 3PHHA 2HU7A 4HDNA 3DYVA 3CUYA 2OHXA 3FHCB 4HWOA 2JFYA 1S3GA 1RYEA 3TO5A 2D5LA 4B7CA 1JBEA 2Z6QA 3V00A 1DE0A 2XUHA 4S1WA 1OA0A 3OCVA 2JAQA 4C08A 4YAKA 7AT1A 1D8TA 3ENQA 4RKQA 4MB6A 2LE0A 4C0SA 1U0EA 5IK2D 4XDYA 2R4QA 3GL9A 1FFBA 4BKRA 4YCJA 2XE4A 1U2SA 2YY7A 2IU3A 2XITA 3L0DA 3QSGA 4DLNA 4UNRA 1R4MA 4GMKA 5DTQA 4FNOA 1VJ0A 1Y5LA 1ZGZA 1MIOB 2A30A 3R0JA 1FRNA 1BD4A 4Q3OA 2IYTA 4UVEA 2H3HA 5ALYA 1KHTA 3CUKA 4PBSA 4KYVA 4DYVA 2IHVA 3VR4H 4FKMA 3M6MD 1R0ZA 5AW0A 5CNIA 5KX5F 3O4FA 4QJ4A 1C81A 4MNTA 5EWMA 4B7XA 4ZTBA 1SOUA 4YJ3A 4DJ5X 1U7HA 4OHUA 2CJFA 1OFTA 1V4NA 1OHHD 3OWXA 4X3PA 1QJ4A 5JRDS 1W25A 1C1DB 1PT6A 4RV9A 3C5HA 5DLYA 4UDNA 3N2GB 3UH1A 2YXDA 1GY8A 4OA8A 2M6KA 1Z6GA 3GO4A 4ZXFA 2XB2A 1J9EA 1ZVJA 4F8EA 1TZ2A 3M6AA 5BMOA 2ZFUA 3ZBPA 3BA6A 5F2KA 3I2HA 3AEXA 1IY8A 4QFCA 1ZL0A 3HU1A 3QPCA 3V8VA 2QJRA 1OC2A 4I4TF 3DMDA 4ZOBA 4LNAA 1R15A 4L57A 3U4DA 5F2NA 2MYNA 1KO8A 1TMKA 1T43A 3GZTB 1YQDA 3EIQA 2QW8A 2VSOA 3M5WA 3Q2OA 3WL6A 2ZCJA 5UKDA 1J0XO 4ZPXA 3AO0B 3AERA 4HG2A 5D8DA 1WB4A 1IBSA 2E6UX 5D3ZA 5J4VA 5KSYA 2J0UA 1L5FA 2AIRA 4I50A 3EARA 1QDLB 3G8YA 3SE7A 5ADHA 1YBFA 2ZPTX 2X4GA 4BRSA 4S12A 2GHTA 4BFYA 1KMMA 5IANA 4TTTS 4WH0A 2NV6A 3N0WA 4A82A 2VUUA 2YRXA 3I01M 4P92A 4E3WA 2I91A 2H18A 2C2ZA 1MQSA 1WU7A 1ZEMA 4DIDA 4Z1OA 2H16A 1A82A 3FNGA 4YLYA 1QONA 2W0SA 2IEYA 4BN4A 1IQPA 2JHCA 3RTDA 4BLSA 2E48A 3HABA 4D9CA 5HJEA 3TS1A 1ZI8A 2QRHA 3OOHA 4LQDA 3WLEA 3I6QA 2I6GA 3A36A 5FUYA 4Z0NA 1TT7A 3DZGA 4JI3B 3EWSA 4L2IB 2C7GA 4OBWA 4TTSA 3ZN2A 4BO9A 3Q72A 3FGZA 2V7UA 4JY7A 1QG6A 4GRAA 1L7XA 4MYDA 5CX4A 2JI8A 3OCZA 5AW5A 2VPQA 4R8MA 4V1CB 2EL9A 3HLTA 5K3OA 1LQUA 3D6JA 2G06A 2YIDA 2W2LD 4G37A 1V9SA 4GGOA 3WBJA 4RJTA 3WRXC 1LBEA 3X1KA 2WZCA 4AZTA 3NH6A 4FLMA 2C9MA 5B1SA 4QBFA 2QPTA 1RDFA 1S1MA 2RGDA 3IVXA 3TB6A 1IRIA 2XX3A 4B6OA 1IU9A 1IB6A 1TCBA 2XMDA 3D8UA 2CV1A 1OFHA 2RHLA