5DO9A

Structure of regulator of g protein signaling 8 (rgs8) in complex with alf4-activated galpha-q
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
314
structure length
314
Chain Sequence
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
publication title Structure of the Regulator of G Protein Signaling 8 (RGS8)-G alpha q Complex: MOLECULAR BASIS FOR G alpha SELECTIVITY.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 117
structure length 314
sequence length 314
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 5do9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5do9A01
1WQ1R 2AKYA 2CNWD 2E9SA 3QKUA 4OJKA 5FH9A 3D3QA 4Q1AA 1E2HA 1AA9A 1ZM2A 5EUMA 4V0OA 4LBYA 1D6JA 3QIAA 4QGHA 4B71A 1ANKA 3PUXA 1TQ4A 2I1VB 2P0EA 4L5BA 3CONA 3CNLA 1W1WA 2DWQA 1MO4A 1KI6B 3HP1A 1VDZA 1VHTA 3RRNA 2J5XA 5AJYA 1YZNA 2WWWA 1QHNA 3EC1A 3LFUA 4YMUA 3R8FA 1E4YA 1XTRA 1JXMA 2IS6A 3TGPA 1S9HA 2ZR0A 3H2YA 3H86A 3IPYA 1F60A 2IYUA 3CPEA 1RE0A 1AZSC 1PUJA 2BMDA 3HR7A 2G3YA 4YMVA 2NPFA 1C9KA 3FMOB 2UVQA 4MYTA 3C5CA 3TSWA 5H70A 2XTMA 3IIKA 1OYYA 4OKSA 2RGCA 3OEHD 4JYBA 5JCZA 1G64A 3SDZA 1Q12A 1OIXA 1S1MA 2QAGB 2Q3HA 4ZO4A 3ECCA 2QE7A 4NPHA 3GFTA 2A30A 4OQLA 1XEWX 2Q21A 2A7QA 1I2DA 2FSHA 4BEBA 1YZTA 2DFNA 3DL0A 1G5PA 1JQJC 1YVDA 2CDNA 4JT4A 4OI0A 3LV8A 5J4KA 4PC2A 1LB1B 4L9SA 3GFOA 2ZI4A 3RWMB 5SZKB 3KTAA 5GADl 1IONA 1FMJA 2W6JD 2MSCB 3RS3A 3ZYCA 2J7PA 4IDQA 4QG7A 5B2ZA 4DT1A 3WHLA 1U99A 2F55A 2IT1A 2ZROA 4N1AA 3A4LA 2WBLC 3CRVA 2WWHA 1TF5A 1IBRA 3IIJA 1R0WA 1R5OA 4M1SA 2TMKA 4DLSA 3PEVA 5BN5A 4CEJB 3BH7A 1HTWA 2CL0X 4KITB 4QHTA 5JEDA 3H0KA 1M7BA 3LAWA 2C95A 2ATVA 5FUWA 5KO2A 1RPZA 4LJ9A 4HB3A 3AF1A 2W00A 4DWJA 3B1XA 1N25A 2EFEB 1CR1A 4GL2A 3ZZTA 1Z0DA 4US0R 3GLFE 3WNCA 2IYZA 3I1FA 1SVOA 4G5QA 2ZJAA 4JVNA 4LX0A 3G5UA 4W7SA 5CDFE 3MUFA 4HDQB 1QHHB 1Q1BA 1E1RD 1YZGA 1JPNA 4LYJA 4TT3D 1SKYB 1IHUA 4LJAA 2NO6A 2VF8A 3SS8A 3EXAA 4WOPA 3T1QA 3R9XA 4JSTA 1N0UA 1M74A 3UMRA 1QBKC 1XD9A 1NBMA 1QHXA 4RFVA 3Q7PA 4AC9A 1Z28A 4TMTA 2JGNA 2XOKA 2QTHA 2BJVA 2J46A 3LXXA 3PCRB 4W5HA 2CE7A 5EP1A 3X1DA 5SZHB 1W5TA 4Q5IA 5HKKA 3AKEA 2HYIC 2YOGA 4DCUA 1LVGA 2WKPA 3AF3A 1ZCBA 3SN6A 4FWTA 1M6NA 3NWJA 2OBNA 4KV9A 3PITA 1T0JB 1KSJA 4AURA 1P73A 1RW4A 2HXSA 4IOMA 2W2XA 4CRWB 1FFHA 5FUYA 3ADBA 2Z4RA 2ZU0C 4WBSA 3RRYA 3BOSA 4NONA 2FPLA 3NG1A 4TQ9A 1ZINA 1ZP6A 4V0ME 3TIFA 4DLXA 5J4HA 3QUSA 2KB0A 3FDIA 3PEWA 1OKKD 1ELOA 2DR3A 2ZJ5A 3A4MA 3TMKA 4UXHA 1X1RA 4Q4HA 5BQ5A 1R4AA 5A5GA 2OESA 5TV2A 4EPXA 2O8EB 4II7A 5BYJA 3RABA 3K0CA 2JLUA 5DLQC 1D5CA 4FN5A 4US1R 5CLQA 1KDTA 4LJ5A 4EFLA 2BBOA 4A6PA 4ILEA 4Z51A 2G6BA 2Z4SA 3ZVRA 4QJ4A 4P4TA 1G291 4HI0E 4E22A 1DARA 3BB1A 1XMJA 2RH5A 1M1YE 4MUAA 5FOXA 2ZJ8A 1ZUIA 4ZCLA 4LJ8A 3EZ9A 1AKYA 3KQLA 2PJRA 1G4AE 1Q0UA 2JDIA 2IC5A 1W0JA 1KKLA 1VCIA 1J90A 3EARA 1VG9B 5AJWA 1Z0IA 4MYCA 1PV4A 1FZQA 1HT1E 4DEXA 1P61B 1AZTA 2FNAA 2L0XA 3K09A 1UJ2A 1EXMA 4LK2A 4I1SA 1JECA 2OO7A 3CNNA 2GHIA 3M1IA 2XXAB 3RHFA 2VLIA 2RGXA 2WJGA 4AWXA 3KQUA 5HR5A 2ZUCA 1E9CA 1LFDB 5IRCD 2HCBA 4A0FA 5BXQC 4DCNA 1G3MA 4Q00A 3VMFA 2O0JA 4FINA 4HLDA 1OXUA 1OJLA 1ZNZA 5KOYA 2NTYC 4Q9KA 3UWOA 2BOVA 4LBVA 3FFBA 5C2JB 2IYQA 1LF5A 2ZREA 3QJYA 3K70D 1KY2A 2C96A 3C41J 5EZ6B 4IVQA 4AKGA 2YC4C 2RAPA 2NO0A 4W5JA 2PL3A 3JZMA 1X3SA 3O47A 5E7IA 4D4JA 4F4JA 3TR5A 2FX3A 1KK2A 1Z6XA 3AKCA 4HAUA 2ZQ5A 3DDCA 4QOSA 5FBVB 1Q1ZA 3T1OA 4D26A 4P0TA 3EPLA 1R2QA 3ZVLA 1HURA 1KDPA 1P75A 1R5BA 2AXPA 3GLIB 1NSFA 2RHDA 1KZGB 3IEUA 4D6PA 4C0JA 1RYHA 2ZRCA 3LWNA 4CEIB 1F2UA 2QEQA 4R2IA 5FPYA 5GVSA 4TTPA 3SQWA 1VG0B 3C8UA 3AV0B 3MAAC 1A2BA 2CJWA 2GKSA 4Q19A 2FSIA 4FW9A 3SU8A 3FYHA 4DZZA 4CDGA 1W46A 2Z6VA 5D3QA 4NP6A 4A8JA 2MMGA 1NF3A 3AKYA 4FI3C 5AJZA 4EPVA 3RS2A 4CEHB 4Q01A 4JBYA 3H1TA 5L3QA 2G9NA 3RDPA 1UDWA 5KDDA 1I2MA 5FFMA 2YZ2A 1SXJA 3HJNA 4Q7JB 4CEIA 2GEVA 5TARA 1T3SA 2ANCA 2RGBA 2ZRGA 5LD2B 1XU4A 4A9AA 4IVRA 4M0LA 2RGDA 2GJSA 4M9ZA 3OIVA 1HA3A 1UM8A 1JXOA 5K8TA 2ZIAA 1IJEA 4FMBB 2REBA 4QNMA 5M04A 4TMZA 3C7KA 5DO9A 4B73A 1P2VA 1Z63A 1E2FA 4L15A 4DDVA 3VX3A 1G3IA 2B21A 4Z54A 3BFKA 4NH0A 2OLKA 1OLOA 3TQCA 1W36B 2FWRA 2PT7A 4B76A 4MRVA 3IO3A 2BM1A 2V4ZA 2XB4A 2BKEA 3UKDA 1NBMD 2W0SA 1II9A 2GXQA 4LY6A 3ZD6A 3WXMA 2O8FB 2BEKA 5FTMA 2WMOB 4D0GA 4LJ7A 4HLUC 4XIGS 3IO5A 1W47A 4M1YA 5HKKD 1GOTA 1OXVA 1WA5A 1NN3A 1EWQA 4Q47A 2VYFA 3BJIC 1A7JA 4MYHA 3C16C 4TSFA 4BLRA 4ITRC 1PLJA 3WRXC 1GKUB 2FPMA 1XCGB 3LDAA 3I73A 4DKXA 4GSYA 4JLPA 4TL6A 3RRZA 1U0LA 1G16A 2O0HA 2ZVPX 2AKAB 3KUDA 1NSTA 5FL7A 1ONBA 4CVNA 2FH5B 5CYPA 4DCVA 1WMSA 2P5SA 3U6BA 3GPLA 1AJEA 1RRGA 1T91A 1SVIA 4FMCB 4YDSA 2IUSA 3T15A 2IHYA 2IF2A 3AVOA 1E2PA 4GFDA 4OHWA 2B7BA 3GMTA 2FDCA 3JVUA 2Z0MA 1QDEA 2ATXA 3QNUA 4LJ4A 4IHQA 3B7GA 4EPYA 1KZ7B 1GITA 2ZSAA 4NE2A 3TAHA 1UBEA 1U9IA 3T34A 5BW8A 1KTVA 3D8BA 4MKHA 5CYOA 1BMFD 2BM0A 3EPJA 3KXIA 4JT2A 3Q5EA 5FTJA 3ZS8A 5AUPB 3O8BA 2IUUA 2DFKB 5DNYB 3ND8A 4D81A 1ZYUA 2G88A 4LBZA 1YZQA 2N46A 1YQTA 2WJHA 4R2HA 4FD2A 2ZAMA 1E2GA 4C3ZA 1JR3A 4WIAA 2JDID 2ZI5A 4Z8XA 5JJIA 2O8BA 4DIEA 1US8A 2FOLA 3ASZA 3KJEA 1KK0A 1G41A 2CVFA 2FSGA 1ZC4A 3SYLA 3EASA 4JLJA 3KXLA 4ZKEA 2F9MA 1T4GA 3CX8A 4TMXA 2CCKA 3E1SA 2Z43A 4BLPA 4DSNA 1U0JA 1N0WA 1U90A 3RC8A 1TUIA 3L43A 2QQEA 1ZVQA 3Q8XB 1J70A 4FWIB 1QHIA 1LTQA 5HTKA 2D7CA 2AWOA 3CX7A 1G7CA 3LBIA 3M4YA 4Q7LA 2C77A 3EIEA 1CR2A 4HATA 3L0SA 3DM9B 3WNDA 3ZD7A 2AD1A 2QY9A 5P21A 4AKHA 1N6IA 2RGGA 1TQDA 4NDZA 3CKLA 2ZJYA 2ZU6A 5KPDA 1EFTA 3MSXA 2OFOA 4HSEA 2VO1A 5HZHA 2F43B 2DB3A 2JAQA 4JL5A 4PXAA 2IYYA 2VP5A 3WYGA 2CE2X 4WXPA 1RRPA 4UJ3A 2YKGA 4QM6A 1KI1A 2RGNC 3WMGA 3OFNA 3VHLB 2HF8A 4ZI2A 1GL9B 3FHCB 3OIYA 3PENA 4GOJA 1KKMA 3TLXA 2H16A 4G01B 3OAAA 5UKDA 4LPKA 4A4DA 2JEOA 5J47A 1X86B 3BB3A 3FPAA 5EE1A 1XXHA 3ASYA 4M9XA 3PG5A 3EPKA 1COWA 3V00A 4M1WA 4J0QA 3RLFA 3ZH9B 3BS4A 2ZS9A 1NN5A 2FEOA 2VHCA 4OI2A 4D4MA 4MGIR 2Z5FA 4CW7A 2DFLA 2JJ2A 2R44A 3KKOA 1GILA 1W4RA 1M2OB 3A1WA 3BGWA 4LHVA 4MGYR 4PHFA 4Q4LA 5BN4A 2MSEB 1NG9A 4RZ2A 3UG6A 4M2LA 3V9PA 1P72A 3GLGB 4LHXA 1P62B 1NY6A 4LOAA 2BHRA 1DEKA 3AVUA 3D7MA 1Z0KA 2JLVA 1ZM3A 4MRPA 4PHGA 3NKVA 2VHJA 3A8TA 1GRRA 4KSCA 5L3SB 2ZSEA 4IDHA 4KFRA 3TW4A 1TU3A 1AS2A 3F0TA 2GVZC 4BZPA 2IS1A 4C0QC 2AK2A 1WBBA 4NU0A 4KVAA 4NBSA 3GLGA 1G17A 3TSOA 4TSFD 4LC0A 2XAUA 3VFDA 2J0QA 2GJKA 3SBDA 3TW8B 3GJ5A 1A1VA 4BASA 3I3SR 4EJSB 1BO6A 4US2R 3RS0A 5JI2E 3KZ1E 3TR0A 5F98A 2WPDA 3U44B 3L0OA 2ODEA 1KDOA 5FBLB 4PC6A 5FL7D 3B2EA 2ZSFA 3QVUA 4HUQB 4IEEA 2HXYA 5DN6D 1GVNB 5FOSA 4TZ0A 3FWYA 3MFYA 4MDFA 3HWSA 1C1YA 4BEJA 1FOEB 4E5UA 4MKFA 5JRJA 4A15A 1K5DA 5DI3B 5B64A 5KPJA 5G41A 1I4LD 4TMKA 5EE5B 1DAHA 3THOA 4BRWA 4DJTA 1T3LA 2WSSD 4RD1A 2ZETA 5EQTA 1NKSA 3KKQA 2JA1A 1MABA 1RYFA 4XVRA 4HEJA 3W5JA 1JEEA 2FFQA 4CF7A 2GBLA 2ZRBA 1QHSA 2W2TA 2CLSA 4HAYA 5LB4A 1GDDA 1E9SA 1Z6AA 3QXJA 5AK0A 3ZDQA 3NHAA 5KTYA 4DB4A 1XTSA 3GJ7A 4PC3A 4XTCS 3BRWD 2ODBA 2WHXA 2AN9A 1VECA 1FPMA 4Z1MA 3EWSA 1S1CA 3CRMA 2WKQA 2F1JA 1O87A 1ZBDA 2GK7A 2GZHA 4QFMA 3RSLA 2JLZA 2FE4A 3FTQA 2IYLD 5DSZA 3LO5A 3W6NA 1OH8A 2XNSA 3DOFA 4KO8A 2Q6TA 3SFVA 1NG1A 2LKDA 1WXQA 4R9UC 2GCPA 4AYTA 3RNLA 4M9QA 2BKUA 1CP2A 4TQUS 4DLZA 1Z6YA 4RY2A 3B82A 1U98A 5AUNB 1XEWY 4PFSA 2QP3A 2PZFA 1J8YF 1C4OA 2FEMA 1E1QD 3UMFA 4Q4AA 3U7EB 1E79D 3HU3A 1VCMA 1FTSA 1MV5A 1GM5A 2QENA 1G8HA 4F38A 2ZITA 4R98A 3RWOA 3LBHA 1TEXA 1XRJA 1ZRHA 3QEOA 5FR2A 5DE3A 2VP4A 4KJZA 1LF0A 2QM7A 3AVVA 2RKOA 3AP2A 3KKMA 3X1WA 3CUEF 1T8TA 4BGDA 3N70A 1SKQA 3E70C 1GKYA 5C4GB 3I8XA 4FMCF 4M22A 4UNRA 4JYCA 3VKWA 3NC0C 5EXTA 1GAJA 1M34E 2R6DA 5JECA 4BLTA 4O2LA 2RMKA 2HLDA 3B9QA 4JJZA 2DWOA 1DO0A 1HQYE 4WZBE 2ZUBA 2WKRA 3A1UA 4IRUB 4L8GA 4DCTA 5IT5A 1MR3F 2OE2A 4D25A 2UZIR 4B75A 1PUIA 2BWJA 3CPJB 2ZRPA 1E0JA 3T61A 1RJ9B 2XSZA 1OW3B 1S4QA 5EE3A 4G0NA 3LVRE 4KFTA 3GLFB 2NZJA 4QXAA 3IDQA 4LGMA 5TXGA 4YXWD 3F8TA 1D2NA 1A82A 1OHHD 2CL7X 1GZSA 2R62A 1W48A 3P4YA 3NC1C 3A36A 1COWD 4OJQA 3W8NA 2OM2A 2OAQ1 2JLYA 2PX3A 4IEIA 5JBQA 1G7RA 1CKEA 2H5EA 3CLVA 5DYGA 1RJ9A 4TLAA 3Q5DA 2J0UB 1T6NA 2ZANA 3GJ0A 4M4SA 4KODA 2PZEA 2VP9A 2QMEA 3L8ZA 4DUGA 2O8CB 5J40A 4BFYA 4LHYA 3AVWA 1ZD8A 2ZXUA 1W49A 1KI6A 3PR1A 1NMYA 2B92A 3AF0A 1CS4C 3BH0A 4WAUA 2QL6A 3M6AA 3PIRA 4B33A 2OHFA 2RB4A 1IAQA 1CTQA 3I8SA 2IHBA 2QGZA 5DHFA 1LS1A 2R6AA 4BFTA 4Q1DA 1X6VA 2OEPA 4Q18A 1KJYA 1YRAA 1EK0A 2D3WA 2QRNA 3B1WA 2YV5A 4NCIA 4M8NE 3SHWA 3VX4A 2QMUA 1S3GA 2HF9A 2VRWA 4RJLA 3K0CC 2YOFA 1OH5A 2O8CA 2QNRA 4V03A 3KDSE 5HCIA 5CK4A 3K0EA 4ZPXA 4TZ6A 4JJKA 2IYXA 2QAGA 2X2FA 2OILA 3UG7A 1E2NA 2NO1A 3WP1B 4XD7D 4UNNA 2OCYC 5DISB 2D2FA 4G1UC 2QP4A 5GJBA 1NI3A 3NEYA 2YOHA 1ZNXA 4Q9IA 3TRFA 621PA 5DI9A 3EZ7A 4P4SB 3QPWA 4UKDA 3SQXA 4Q1CA 3PXGA 2HJGA 4O3MA 2A9KA 2JIZA 3K09C 3BD9A 2OCBA 3B6EA 5KSZA 2ZI7A 1LW7A 1BS1A 4QL3A 1CF4A 2A5YB 3GLHB 3MJHA 1N2CE 2D74A 3CR8A 3X1YA 4CEJA 5F3WB 5JWRA 2C2HA 4MITA 2FG5A 2PMDA 3VQTA 5B58C 4KXFB 5KUTA 5FPSA 3AUYA 3Q3JB 4P31A 3AGQA 1G9XA 2BCJQ 1KYIA 4MUBA 1RKBA 4HDCA 1K6MA 2DBYA 1KIMA 1U94A 2ZE6A 3C5HA 3SC3A 4LV8B 3QBTA 2C9OA 2HEIA 1P2SA 3KKNA 1QVAA 1KSHA 3T5GA 3GLHA 2J1LA 4L9WA 2D62A 1KK1A 1XD2B 3RRMA 4B3FX 2BEJA 4XSHA 1Z5ZA 1N6NA 4Z8YA 3IHWA 1QHHA 3BK7A 4X8OA 2VSXA 3MJRA 3SJAA 4M9SA 3BFXA 3SJBA 2G1JA 1QHGA 3QF4B 4XWAA 2XNDD 4IDOA 1G8FA 2WICA 1J2JA 2W0MA 2QAJA 5L3RA 4P33A 2VQSA 1JNYA 3CO5A 1W0KA 1XTQA 2NG1A 3CBQA 2EFHB 1JQLB 1NJFA 2V7QA 4A8JC 2PMKA 1TTTA 1W2GA 2GF0A 3CH4B 3O8RA 1XD2A 1VMAA 2EQBA 3FMIA 5KDLA 1HH4A 4RZUA 4L16A 3SFZA 1WB9A 5EZ5A 1Z08A 1AGRA 1YZLA 3EW9A 4H9GA 1SXJC 1HYQA 4RCYA 3QF4A 1RRCA 2H8KA 1OH6A 4BFXA 4ZDIA 5JJLA 1T8UA 2NO7A 2WJVA 3JZAA 4UJ5A 2ZRAA 4UNSA 5CJ2A 1Z0JA 2IXFA 3KB1A 1GG2A 3LRPA 2HLDD 1E2LA 3EA0A 5FUXA 5TDHA 2QI9C 3CNOA 3NBZC 3AVPA 4KHZA 1GNPA 1TUEA 4RD4A 1I4DD 2ODNA 3QKRB 3TK1A 1R0YA 2YWHA 5IK2D 4FIDA 3LQRA 3WP0A 3R20A 4WA7A 4OK3A 1GWNA 1UFQA 2N42A 3D6TB 3LY5A 3NVAA 3QKSB 5FOWA 4O0MA 4CYMA 2BIFA 1G4UR 2O8EA 1EG7A 2PH1A 4NKRA 1E96A 1OSNA 4QKQA 4YQFA 5L8VA 5LD2C 5F9FA 3K0SA 2IEZA 1NJGA 4KYUA 4PAQA 4FCVA 4EPRA 2JASA 4MGZR 1XMSA 2OUKA 1OXTA 5HE8A 1H8EA 2WJJA 4D80A 4F93B 1Y3AA 5JHHB 1IN6A 1NBME 4XJXA 1E9EA 4WW0A 1EWRA 1XZQA 1XJQA 2WVJA 3T5DA 3AVXA 1TPZA 5DH9A 2Q3FA 1NMXA 4URVR 2AK3A 2G0NA 3HYTA 4HDOB 2OFWA 3IBYA 2YHSA 2ZRKA 2ODWA 3WNBA 4C7OB 4NTZA 4H1VA 4NCJA 1XTIA 2XZPA 3LNCA 1P3JA 4OK5A 2WAYA 2JJ1A 1Z8FA 3RS7A 4TTQA 5JSZB 2XXAA 2QE7D 2VBCA 3A1SA 3CB4A 1CULC 1JAHA 4Q03A 3ETLA 4E03A 1OPXA 2B8WA 2XTNA 3NH9A 1DTSA 3VR4A 2ZSBA 3QPUA 4BE7B 1U9IC 1JJVA 2KE5A 1PJRA 1S3SA 3KL4A 3I5YA 4A0GA 1Q22A 5GJWC 1HUQA 3ZVNA 1NNEA 3DPUA 4X8HA 5KSPA 4UNPA 2J7PD 4PTLA 1SVLA 1P6XA 4C0AC 4EQ6B 6Q21A 2Q0HA 2WM9B 2C03A 5AUOB 4WZAE 3OZXA 5JWHA 3I5XA 1P2TA 3D31A 3GLIA 3ND9A 1ZD1A 2CL6X 2ZTSA 3W9YA 4DDTA 4MKIA 3C15C 1MO3A 1E9BA 3U7HB 2RGEA 3IGFA 4HAVA 4OYHA 2C04A 3KFXA 3MWKA 3GEHA 4EQ6A 2G0TA 2X1VA 3TE6A 2GZAA 1PLKA 3EA5A 4P3YA 3VNVA 4NCNA 3ZGXA 3K53A 1CRQA 4NHOA 2GJAA 4NYMR 4Q4JB 5H68A 4CEHA 2ERYA 4BLSA 5DGXA 1KI9A 3U4QB 4LCBA 2ANBA 4ASUA 1G19A 2IUTA 4DDWA 4AI6A 3LD9A 3THWB 2FGJA 3G0HA 1MOZA 4Y0VA 3I61A 1TAGA 2R8RA 1XP8A 3FKQA 2YJTD 3QXHA 3AVQA 1N6LA 2XOKD 5EXPA 1SVMA 2YNMA 3MLEA 2QPOA 1KO1A 3EIQA 2ZRLA 3IEVA 2IS2A 3BORA 1E9RA 3P4XA 4GMXA 4Q4JA 4AG6A 2ZYTX 1T0HB 5CIWA 5AJXA 2GCNA 1VIYA 3LQQA 4PZLA 2V1UA 2IL1A 3X1XA 2AL7A 2ZPTX 1Z0AA 5EE0A 1TX4B 2BMEA 4I1VA 1U8YA 3THWA 3P32A 1PVOA 1N0VC 1OFHA 2WOJA 3FVQA 5G40A 1DS6A 1FW6A 2P65A 2QG6A 2V8OA 3PEUA 1ZJ6A 4G3XA 2O8FA 2V7QD 1MKYA 2A5DA 3W90A 1CRPA 3K0FB 4JBWA 1N5KA 1IN5A 5ANRB 3U7GA 3N2IA 3H84A 4EPTA 2DY1A 2CLDX 1II8B 3T35A 1TQ2A 1ZUNB 1RC8A 3F5FA 1CLUA 2R6CA 4LUCA 4TMVA 2VHTA 4QNRA 2C5LA 1RRFA 4JKIA 4TL7A 2BMJA 2EVWX 3SBEA 2WWYA 1FP6A 2XITA 3TVDA 1YHNA 4TYPA 3VR1A 4ZI3A 1SXJE 4A0HA 3C4JA 4DLRA 5C18A 4LJ6A 2IS4A 2DFTA 2ZS7A 1F6BA 3DMDA 2DCUA 5TMPA 3AKDA 4PAOA 2GVDC 3AH8A 1VG1A 3BIFA 2GCOB 5C46F 1Q44A 1K5GA 3S1AB 1GP2A 4TYQA 2HJVA 1TL7C 1MO5A 1W0JD 4IFBA 4ZCMA 2DYKA 4JMPA 2H7VA 1E2EA 4PPFA 2V54A 1N6RA 2ZRFA 1KI8A 4PX9A 1VYTA 3Q72A 1ZNWA 3RYTC 3VR2A 4URYR 1QZXA 2A5JA 2ZR9A 5LB2A 1ZAKA 2DPXA 3RS5A 4OI1A 2JLRA 1AS3A 2ZUDA 1DADA 1E6CA 4QGGA 1Z2CA 2YINC 2CK3A 2AR7A 3EG5A 4P32A 1DAIA 4XVUA 1KI2A 5EP4A 1SHKA 5JS7A 2FF7A 1IXZA 1UBFA 3P26A 4GP7A 4EIWA 4HLQB 3RANA 4GDFA 4B43A 4JL6A 1KI4A 1NLYA 3SOPA 421PA 2A2ZA 1ZD9A 4HB4A 3T06B 3HPRA 4GBMA 3EX7C 1OT3A 1TNDA 3IQXA 2WAXA 4RD2A 2FJUA 4TLEA 1CEEA 3R9IA 3EC2A 5EXXA 4P4UA 2F1IA 2R6FA 4ZDWA 2Q3MA 2QBYB 3SI7A 4S2EA 3ICQB 5FBWB 2H17A 1JJ7A 2XB2A 4QBGB 2VIIA 4HZUB 1ZIPA 2BV3A 1N6PA 3ZIAA 2IYRA 1HQCA 4OHYA 2XTZA 1TU4A 4V02A 4ACBA 3HR8A 3B60A 1R8QA 4DCSA 1OF1A 3QENA 2GBLC 2C99A 3FHOA 3WYFA 1OE0A 1JBKA 1ZCAA 3I62A 1FQKA 2V6JA 5D3MB 1L7VC 3E2IA 3UIEA 3AF2A 1BYUA 1CJMA 4FXPA 4E09A 2QBYA 3L0IB 1WE2A 1QHYA 1XFAA 1XEXB 5DIFA 1OB2A 1Z0FA 3IUYA 3U3JA 2IK8A 1RFLA 4ZKDA 4B32A 3NIBA 3A1VA 3FKSA 3OIWA 2LKCA 2F43A 3O8DA 1SXJD 1NMZA 4KBFA 821PA 3KB2A 5BN3A 1FNMA 1PZNA 1UF9A 5E4FA 4M1KA 4YONB 4F4IA 4BLOA 2ZE7A 2CNWA 1JR3E 1FUUA 5FOVA 3UK6A 1XPUA 3VAAA 4Q7KA 1GIAA 5KNBA 1KO8A 1IXSB 1E0KA 2JLSA 1W44A 3QPVA 4L4UA 1T5LA 2J3EA 2ZJZA 2GAAA 3IKJA 4F7WA 3ICEA 3AUXA 3QY0A 1TQ6A 3TBKA 1X1SA 3SR0A 4ASUD 1U0HC 2H18A 4BUJA 4ZIRB 3QG5A 2VSOA 5E95A 3VR5A 2O52A 4CIDA 4ARZB 2ZSDA 1NLZA 2BMFA 2ORIA 4Q1FA 1MO6A 1G1MA 4QGAA 2XX3A 4DRZA 2G83A 4B74A 3LX5A 1D2MA 1UDXA 3PJRA 1E69A 3BFVA 4NCHA 3NTUA 3JVVA 1G3QA 4I1UA 4S35A 3ZQJA 3QE0A 2ZJBA 1G3RA 2ZYWX 2XGJA 1ZM4A 2GJ8A 1QG4A 3OEHA 4RFSB 2CLCX 1UADA 2VHQA 4WXRA 3SE0A 3DO6A 1E2JA 2F7SA 2GEDA 3EAQA 1D8TA 1OXXK 4HAWA 3KUCA 1Q3HA 5JZVA 2V3CC 5KYKA 4D0NA 1NIJA 5TB5A 2X77A 5CB6A 1DAKA 1N5IA 5L3SA 1E4VA 1XJCA 4D4LA 5KSYA 3Q9LA 3QSYA 3QG1A 4RKEA 3TVTA 2YYZA 1Z47A 4POAA 1JI0A 1Q3TA 2PZGA 4JVSB 2RGAA 2AX4A 2MSDB 2WV9A 4RFSA 1LY1A 3FHTA 2OBLA 1HEIA 3WBKA 3VNUA 1E9FA 2FV8A 4EJSA 5BYKA 3C14C 3QXXA 2OXRA 2WWFA 1S2MA 4PPGA 4D4KA 4BFWA 1Q1EA 3U44A 4LHZA 1H8HA 5CITA 2W83A 2VA8A 4HUQA 1XXHE 2HUPA 3NBYC 1QF9A 1N5JA 4Y0AA 1E9DA 2KI5A 3J81k 4PR0A 4ERNA 1P9WA 2KSQA 1SHZA 1ZU4A 3T12A 5DI3A 1FP7A 1HY3A 1VCOA 4BQSA 2NO9A 3THXB 1JR3D 2C98A 3ZS9A 1CJVC 1VCNA 1XPOA 4AK9A 1A4RA 1SULA 2B6HA 2C9YA 5HCNA 1KI3A 3BE4A 4XOIA 2Q9AA 4MGKR 1IY1A 1MH1A 4GI7A 1NVUQ 2QT1A 5TY0A 1E1RA 1VYVA 4DLWA 3UATA 4TT3A 4PSAA 3UXMA 1KSFX 1EX6A 1KOFA 1KJZA 1G8GA 1RZ3A 3B5JA 2HT6A 2VHUA 2XJ9A 4YMSA 5FPKA 3BERA 4BPBA 5JEEA 1AGPA 1GTVA 3AM1A 3THXA 1GNRA 1KNQA 2RHMA 3ZLJA 3PUWA 4KAXA 4M1MA 4A0RA 4IXNA 1UKVY 1E2KA 1DG3A 2QAGC 3SHFA 3GLGE 3QOFA 1OFTA 2E1RA 4R71A 3VKGA 3CF2A 4CZ2A 3OE7A 3CR7A 5B57C 4RKFA 4QJ5A 3AGPA 4D2IA 2REXB 1CJUC 1Q21A 2IYSA 2IW3A 3FMFA 3H4MA 4AKEA 2WWGA 1G6HA 1ZW6A 1OFIA 1P5ZB 2F3TA 4LBWA 3ZJYA 3DZDA 3AEZA 4GZMA 4YMWA 5H1YA 2GNOA 5CM9C 5A0FA 5FOTA 1Q57A 3W6OA 1CIPA 2X2EA 2O8DB 4IOJA 2P6RA 3NDBB 3EZFA 2C8VA 3PFIA 3OFND 1OKKA 4DSUA 1JB1A 3B13B 4BFZA 3GQBA 3OAAD 3A1TA 5HE9A 3BXZA 1N3BA 2EFGA 3K8YA 5J4VA 4B6EA 4JL8A 4D82A 4A1FA 2ZM5A 3RAPR 4GPTA 4KLZA 3EZ6A 1DO2A 4BRUA 3LBNA 1YR8A 2P5TB 2YWEA 4MYUA 3ZZUA 4ESVA 4JLOA 1N6HA 3LXRA 1UEJA 1VIAA 2P6NA 1EFUA 2YWGA 4NYJR 1EFRA 1AQYA 1KO4A 3P1JA 5JS8A 1L4UA 2O8DA 4JLMA 4HB2A 5SZIA 1BIFA 2QPAA 1IOZA 4Q9HA 3DMNA 2FGKA 4NL4H 2JJ2D 5CB8A 1X8KA 1S0UA 4DB2A 2XZLA 2KWIA 1ZUHA 3DOEA 1BKDR 3WMEA 1OYWA 2GILA 3KKPA 1EGAA 3GLFA 2QM8A 4QC2A 4OHZA 3K70B 2IYTA 3ZZ0A 3DZ8A 1EFCA 3DEFA 1IQPA 2B7CA 5CDFA 4PQRA 4TYWA 4MQBA 1VHLA 3KX2A 1XMVA 1DVRA 1E2DA 3LW7A 2BC9A 1DELA 1GKIA 2W2VA 3A58B 5GVRA 1KO7A 4NYIR 3GJ3A 4PC7A 4OQFA 1F5NA 1G8PA 1CXZA 4HB0A 3LX8A 2ZVQX 2J59A 2WZQA 3KXKA 4PQYA 4Q21A 3RSOA 1DAMA 3SYNA 4IDPA 4TTRA 3TKLA 2J0UA 2ZRDA 4U00A 4F92B 4OHVA 3KTAB 4QHYA 1YE8A 2GXUA 2OLJA 4LC1A 4CGZA 5J4LA 4URWR 1N6KA 4AD8A 1K8RA 3GEIA 4U02A 1UPTA 5KU1A 3L2OB 2X19A 3HDTA 4DT1B 1VTKA 2G77B 2OT3B 3LVQE 2FFHA 4Q1EA 4W9MC 2FPKA 221PA 4UXIA 4ZDKA 5DYIA 3TH5A 3VHXA 3SNHA 2WPDD 4TLBA 2LCFA 2GDJA 2QN6A 4QJ3A 1G3UA 1CJKC 1EESA 3NHBA 1DBSA 4WZ6A 2NGRA 1TEVA 3A4NA 3B1VA 3NDPA 2REOA 1ESNA 3K9HA 4R7ZA 1O3YA 2A78A 1J8MF 4O25A 3BAFA 4JSYA 2KBEA 1Y63A 4V0MA 1XEFA 721PA 1EFHA 1B0UA 1KK3A 1VYUA 1KDRA 1Z6GA 4B35A 3THYB 1M7HA 3SJZA 3B85A 2PT5A 3FE2A 4IJMA 2WOOA 3IILA 2C9CA 4MH0R 4MA4A 2AD5A 2PLRA 1VKJA 1H8HD 2JCSA 4O2RA 4DLUA 4BFVA 3CZQA 2CVHA 1J99A 3UMSA 1YZKA 2CCJA 4BWYA 3O8CA 3OESA 2GF9A 5AUQA 4P4SA 4QRHA 4BFSA 1RVDA 3KJHA 4DXAA 1NN0A 2ZRHA 5TVKA 4Z1MD 1Q1QA 2BBTA 1P2UA 2P6UA 1KJWA 3L8YA 5K8IA 5LBIA 1MT0A 3N5CA 4F4CA 5JLJA 3SYKA 3THYA 2IA5A 4OQXA 1W7AA 2ZRJA 4LYFA 3GFPA 4C2TA 2CHVA 5FBQB 2QP9X 1ZIOA 1Z6TA 2VP0A 3MWJA 4TQAA 1YRBA 2J41A 2QTFA 2ZRMA 4OBEA 3RVBA 1GFIA 2R2AA 3TAUA 1ODFA 4U5XA 1OV4A 4LV6A 3L0PA 1GRNA 2CCGA 1AK2A 3CM0A 2OSBA 1KSGA 2SHKA 2QSYA 1VG8A 2FZ4A 1ESMA 2EFDB 4LJYA 4PZZA 4G5SA 2Q9BA 2GXAA 1H65A 1Z29A 3RC3A 8OHMA 1FNNA 1NIPA 4V0NA 1ZNYA 5CK5A 2EYQA 4QGFA 4DLYA 1KY3A 1U81A 4QM7A 3A6PC 1WP9A 3AVYA 3U5ZB 2ZRNA 3U3RA 5G53C 3IBGA 1KNXA 3OE7D 2CEAA 5EP3A 1IM2A 4HLCA 4B48A 4DHEA 3W5IA 3DHWC 4HUTA 5K8UA 2Q9CA 3KQKA 1CU1A 1XX6A 4PHHA 4Q4HB 3T1TA 4NYJQ 3HYRA 2IXEA 4NZYA 5FPHA 4C0KA 1B23P 2V55B 4IOLA 2XJ4A 2YC2C 3VU9B 2FU5C 1XCPA 2NOAA 2W6IA 2WWIA 3BBPA 2Z83A 3TQFA 4YMTA 3HPQA 4RD3A 1NN1A 1Z2AA 5B30A 4HAZA 1AN0A 2OCPA 3LH5A 2CHQA 1GSIA 2IF0A 3KJIA 1AS0A 3U7FB 3MWLA 2J45A 1G5RA 3CF0A 5J4YA 4TWZA 1KI7A 4RZXA 2EYUA 1A5TA 2XSZD 4JLVA 4PAMA 1OIWA 1XF9A 3B78A 4Q7MB 2BBWA 2BCGY 3TSZA 4NYIQ 1BMFA 4OK6A 1JEDA 3VU9A 4LPSA 1Z3IX 5CM8B 1LNZA 2J0VA 1E98A 4TMWA 2ASEA 2PJZA 4HYYA 3B1YA 4K81B 5FI1B 2X8AA 5CIQA 1F2TB 1EFRD 2GWHA 3QKRA 4KSBA 2QMOA 2QSZA 4PO9A 1Z06A 3N2EA 4A36A 3TJZA 2KJQA 2V1XA 4IDNA 4PPNA 1Z22A 2NPIA 3W8RA 2NMVA 4PO8A 521PA 2P3SA 1R7RA 2VEDA 3QKTA 5C4MA 3GLHE 4N0EA 4ZCIA 3QKSA 5A4JA 3MWYW 4JBXA 1W36C 2P67A 2QUZA 2WSMA 3GJXC 2FMXA 4DUGD 5GJCA 1V43A 3IPXA 4Q48A 4YLGA 4BZXA 3DM5A 3FGNA 4XWOA 3KQNA 3TUJC 1IJFA 1YR7A 3SEAA 1SKYE 3W6PA 2KBFA 2OAP1 5JMTA 1F2TA 4PSKA 2VP2A 2J0SA 4QBIA 5SZJA 4Q1BA 5IHPA 3EZ2A 3K1JA 4M53A 4UQOA 2H92A 2I1QA 2WMNB 1QVRA 4Q02A 3AF4A 2JJ8A 1F2UB 1XD8A 3REGA 4BZQA 1YKSA 2VTKA 1G18A 1IY0A 3ZQ6A 1FQJA 2JLWA 4C7OA 3QEJA 1IY2A 2CJWB 3CF6R 2IBMA 4X8LA 4YDHB 5FTKA 4LZZA 1OFUX 1NKTA 4PPQA 1JR6A 4A8JB 3QI2A 2GXSA 2OBMA 5JSZA 1FL9A 1DAFA 1V5WA 5L3QB 1N6OA 3G82C 3VR3A 1KHTA 3R9WA 1A2KC 4C0SA 3BWDD 2C78A 3MGCA 3PUYA 3GP8A 1Q20A 2R6GA 2ORVA 4B3BA 2QROA 1SXJB 3K0AB 3ONWA 2GESA 2VSFA 4PSVA 1ZM9A 1MRNA 5JFGA 2JIZD 3UPUA 1SGWA 2NQ2C 1G21E 3AP1A 3TUIC 4AG5A 4QHSA 1OH7A 1SQ5A 3FB4A 4OQMA 3PV0A 4B3CA 1R0XA 3MD0A 1W2HA 2A3RA 1HE8B 1GL6A 2D2EA 5GJVC 5KHOC 2IYWA 2H57A 2ORWA 2F6RA 2WIBA 2VF7A 3WBJA 4DBLC 3FMPB 4PC1A 2ZRIA 2ZS8A 4GNKA 2UZ3A 1G5TA 2WIAA 1G20E 1GL7A 2VP6A 3Q85A 3HU1A 4B3DA 1MRSA 3K0AA 2FN4A 1CJTC 4EKDA 2HV8A 1PLLA 4LRWA 2IX3A 1Z07A 1U2RA 2ZI9A 4GZLA 4IW3B 1CR4A 2ZYUX 2FA9A 2O5VA 2IWHA 5DHAA 4C0BA 5EUQB 5CJPA 3CIOA 2ZR7A 4AY2A 1XBTA 3WYAA 4B47A 3VR6A 1F3OA 4H1UA 4A92A 3U4QA 2EWWA 2GEUA 3LW8A 3I92A 1S96A 1YR9A 1IN7A 4DVGA 2J7KA 2YVUA 4NCKA 1WRBA 3ADKA 4AKIA 4MKGA 4DC9A 4DIDA 4XTRA 4WVFA 4AIIA 2P2LA 1DE0A 1II0A 1XJ0A 4TN1A 2AHOA 3CRRA 1W0KD 4FMDB 5K8LA 1E2MA 1S8FA 4RSGA 1D2EA 3PQCA 4OI4A 4EAQA 4URXR 4DSOA 2QQ0A 3EWAA 3IHLA 1NRJB 1JALA 3AP3A 1XCMA 3WY9A 2AFIE 1WCV1 2CBZA 4XVQA 1R0ZA 2F1RA 1E9AA 4LV5B 1BOFA 4K46A 2QRZA 3IQWA 3Q7QA 5FTNA 4QBFA 2FSFA 1DG1G 3BH6A 2BDTA 4K8OA 1YR6A 2PLFA 2GJ9A 4JIMA 4N3NA 3KJGA 4KFSA 1KAGA 4IFEA 4IXMA 3GLIE 2EWVA 1S9DA 4TL8A 4DSTA 2W6ID 2N1BA 4I81A 5F9HA 1I4TD 3U6KA 1JAIA 4RVCA 5DN6A 5ELXA 1TADA 1DAEA 3K0FA 1QG2A 1UKEA 3TUZC 1T5IA 1ZU5A 5E7MA 2OG2A 4OHXA 4TLCA 4NMMA 1FMLA 1NVWQ 3GEEA 1E3MA 4C2UA 2PCLA 2WSSA 4PHTA 5HZKA 1II8A 3CW2A 1AIPA 2F9LA 2A5FA 2QORA 3W3AA 2O8BB 1X8LA 1US8B 4JLNA 2HYDA 2F3RA 4C9BA 4EFMA 5FOUA 3W34A 3K9LA 3QXSA 2XZOA 1U8AA 5JWOA 1XPRA 1F48A 2QTVB 1TF2A 2BBSA 3CRW1 4KVGA 2QMHA 1ZM7A 1M7GA 4E07A 1NVVR 3GCGA 4JKYA 5JI3E 1H8ED 4M1TA 5CLLA 4JVMA 2GA8A 2ZI6A 3AVTA 5EE9A 4B3GA 2GCOA 3CWZA 4IVPA 1D9ZA 3HU2A 3S1AA 4B34A 3QXCA 4LSGA 5EJEA 1SVSA 1Z83A 1NL3A 3CH5A 4AYXA 2ERXA 2ZJOA 4LI0A 4KU4A 4LYHA 1R5NA 3B9PA 5FI0B 2A5GA 3K9NA 4V0KA 5JCPA 2W58A 5KDOA 1KMQA 5AWFC 2JJ1D 2HCJB 4BLQA 4UXJA 4BFUA 1NY5A 2GRJA 4IKEA 2IEYA 1G8YA 2OCAA 5FR1A 3CX6A 3OIUA 1OXSC 3NBFA 4EFNA 1E1QA 3NH6A 4MRSA 3UANA 3ZVMA 4A6XA 2ONKA 1E79A 2BJWA 2ZI3A 4ESHA 3PEYA 4EDHA 4JZKA 4DLTA 5IF9A 3CRQA 1YJ5A 4NYMQ 4FCTA 5G3ZA 4EJSC 1W4CA 2OV2A 3AQ4A 1P9RA 2FFAA 4G5RA 3R8CA 1L2TA 3X2SA 3OEEA 2V9PA 5E3HA 1CBUA 1UEIA 4ACAA 2XEXA 4HLUA 1IN8A 2FFBA 1OIVA 3WRYC 4JS0A 2ZAOA 4GRAA 2J9RA 1EX7A 5FUVA 3CPHA 2EU8A 2FZLA 2ZYVX 4HZUA 1J7KA 2CMKA 2QT0A 1XXHB 1NP6A 1T3HA 2AXNA 3T1VA 2ZJ2A 1AQUA 4F91B 3LLMA 4ZV4A 4KBGA 1UKZA 4LHWA 4OQNA 3R7WB 3WHKA 2E87A 4JLBA 3NBXX 1WF3A 2GAOA 3RS4A 2HDNB 2YWFA 3WMFA 4B2IA 4D0LB 2D4HA 3OF5A 3M0EA 2WWXA 4IOKA 4KYIB 4Q9JA 5D3MA 1OB5A 1KMHB 3EPHA 2B8TA 2NZ8A 4XWKA 3KFVA 2O0KA 4JVLA 3EIHA 1XEXA 2V6IA 1BYIA 2RCNA 4YXWA 2ZE8A 1JPJA 3GD7A 1E0AA 4B2LA 4QBHA 1RIFA 1OHHA 1R6BX 1XTJA 4KI0A 5G3YA 1AKEA 1IXRC 1GUAA 2CXXA 2JLXA 3NEJA 4RD6A 4EUNA 4Q9LA 3PUZA 1XZPA 2DWPA 2VL7A 1HT2E 3R7WA 5EXSA 2MMCA 1G7SA 1UKYA 4A2PA 4TLDA 1CR0A 4UNQA 2IYVA 2GTPA 1KMHA 1WDTA 4M21A 3U3KA 2OZEA 1BH2A 4GMDA 4LWZA 3LLUA 1G7TA 5FTLA 2AWNA 3GJ6A 4LYAA 4TYNA 2ZE5A 1ZMXA 4PZYA 5F2EA 3U61B 3FOZA 2PX0A 2G1KA 2ECKA 4ZIRA 3PUVA 1SZPA 1E2QA 1P9NA 4ARZA 2I3BA 1W36D 4G5OA 2R65A 5FBRB 4BECA 3E5HA 1TF7A 1DOAA 2F1HA 5JRZA 3PVSA 4TYYA 4AYWA 4KFUA 1LS6A 3FFAA 4FCWA 121PA 2OFXA 3LA6A 1E0SA 5KNCA 5C1BA 4MRNA 4B44A 1M8PA 5BWMA 3TNFA 1SVWA 4PANA 4URUR 3V4FA 2W6JA 1UAAA 3CWQA 2NIPA 5FPTA 1P4SA 5E7JA 4U7DA 2EW1A 1E2IA 1GNQA 3VKHA 1GRQA 1UBGA 1FX0B 1MABB 2QZ4A 1DPFA 1NVVQ 1AM4D 4RCZA 4DLVA 5LDDC 1TMKA 4XD7A 3W3ZB 1T9HA 4I1OA 4B3XA 4C0LA 2D06A 2IWRA 1XDBA 4TL9A 3REFA 2IXGA 5L3VA 1R10A 2D7DA 2QU8A 2UKDA 3VTKA 2GK6A 4G5GA 4C30A 5AJVB 1XTKA 5KSOA 2ONJA 4URZR 5JHGB 1KAOA 1D9XA 1FTNA 4JLKA 3ADCA 1U8ZA 1HV8A 4M1OA 4GT1A 4ZDJA 1ETUA 3B8HA 2HT1A 1W4AA 1QRAA 1IN4A 3U2QA 1W5SA 4ON9A 1P60A 2ZEJA 1FX0A 3V4RA 3QQ5A 4JLDA 1HE1C 1KO5A 4Q66C 2WJYA 1G6OA 4OL0A 1L4YA 2I4IA 2RGNA 2PBRA 2WJIA 3GJ4A 4I99A 4DDUA 3U3OA 4C4PA 4KCGA 4A2WA 1X8JA 1W4BA 2QPTA 2QA5A 2JATA 1WBDA 4ABYA 2J87A 4A82A 3K70C 3DKPA 2BVNA 4XH9B 2CK3D 1FUKA 1N5LA 2AFHE 3I4LA 1UBCA 4Q4AB 4XSGA 4DEYA 3U3MA 1YZUA 3UWKA 3OHMA 4MDEA 3A37A 2DHRA 4GOXA 3F3YA 5IDVA 2QGNA 3L82B 3MRSA 1E32A 3GJ8A 1E94E 3SJCA 2GETA 3QVVA 1XWIA 1XB2A 2H1LA 3BC1A 4V0LA 2OXCA 3AB3A 3DKVA 3P20A 4HZIA 3QF7A 3MMPA 5J5CA 4CT5A 3I72A 3SZRA 4FMDF 1XNJA 2WTUA 2XNDA 1P7CA 3X1ZA 1NVXQ 1E99A 3DVLA 2JLQA 3ZIAD 5JJKA 1SVKA 4RZ3A 2GZDA 2PEYA 3U60B 4PQFA 1L8QA 2PCJA 4CT4B 5HPYB 5EP2A 1LV7A 4LDJA 5FL3A 5H8WA 3K9GA 4KLNA 2R9VA 2K5UA 1R8SA 4RD0A 4N0DA 3B1ZA 3OEED 3I32A 2LWIA 1DAGA 2Y8EA 3CZPA 5AR1A 3IIMA 1NLFA 3MCAA 2VPPA 1ZC3A 4GOKA 3ADDA 4X8MA 4MRRA 4A2QA 3KQHA 2EFCB 3BB4A 4YC7A 1VPLA 3P27A 4I4LA 4JLAA 4W5WA 4B2PA 4EPWA 1KGDA 2CHGA 3FKSD 1YU9A 4HAXA 5KNDA 3NXSA 4B6FA 4GP6A 2PEZA 3QBVA 4C0HA 5LPNA 1XMIA 5IK2A 4PO1A 3MG9A 2VH5R
chains in the Genus database with same CATH superfamily
3OZ7A 1EBFA 3WLIA 3OWHA 4U5QA 2NYRA 3EZLA 1M2EA 3D3QA 3DQPA 2ST1A 4Q1AA 5EUMA 1N75A 1Y3HA 2JGIA 1J0DA 4LBYA 1D6JA 5JFTA 1QOPB 1U1IA 1U2GA 1ILWA 2P0EA 4H3VA 4NAVA 2I1WA 3BTSA 1MO4A 3GI1A 5KWIA 3H8VA 4I0WB 4WESA 1XRNA 3WADA 3DDUA 3CSDA 3QQPA 5LQAA 3HQ4O 1KH3A 1J1UA 1MJFA 2X0NA 2VAWA 4LRTB 3RYHA 1QHNA 2L17A 4YMUA 2CV1A 3LYHA 1FF9A 4NENA 5C5EA 1AOXA 2DC1A 4YVFA 5LVAA 1TT5B 3IJPA 2TSYB 3EC7A 1RE0A 3F90A 2QDXA 4UM8B 5BVHA 5JBNA 2G3YA 1YD7A 2NPFA 2HQRA 1DFHA 1C9KA 2AUNA 2NZVG 2UVQA 4HBGA 3B6ZA 5CBKA 2X7JA 2UXBB 3I64A 3HYLA 1N7JA 3KJXA 4HPXB 4MUGA 5PGMA 3ZGLA 5K03A 3PQ2A 3IXLA 2RGCA 4UE3S 5K99A 5JCZA 3REQB 1Q12A 3G6WA 3ZWXA 13PKA 3ISVA 4MS1A 2Q3HA 2VDUE 2QE7A 5CVVA 3GRKA 2A30A 1Y3IA 4OQLA 4QAQA 2Q6IA 2QJWA 5I4IA 4FGUA 2O2EA 3H1FA 5DHQA 1K92A 4D6YA 3KZXA 2DBVO 1NUPA 1WXDA 3GGSA 3O83A 3RC9A 3EE6A 3LV8A 4KWCA 2ZR8A 3RJMA 3U7JA 2BYTA 5CJJA 2ID4A 3LX4A 5C5DA 4CMCA 1GCGA 3CURA 5SZKB 3KTAA 4OREX 3HJAA 2W6JD 4MMYB 1DOZA 2IEGA 3A1EA 3AR5A 3SLGA 2X8BA 1LX6A 2J7PA 4JWTA 2ZJ4A 4E31A 2UYHA 1PJCA 3REQA 3A6EA 4B4DA 4DT1A 3WHLA 1OILA 3LDFA 1U99A 2F55A 2VDVE 4C0WA 4GAEA 2WBLC 3PZBA 5WRFA 1L7MA 1C9EA 2EEZA 2VA9A 1R0WA 3ITDA 4HYEA 4M1SA 1FNSA 4RKQA 3VMMA 5F7OA 5LP6B 2WC1A 5IJZA 3BZUA 2A88A 3L8HA 1PHPA 2GN1A 1E4EA 3L7BA 3JWJA 4XVHA 2D5CA 2IHUA 3AYZB 1L5KA 2Y67A 2OPHA 1FTWA 5K0LA 3PFHA 2W00A 4GW3A 3MCTA 4BX3A 1IHXA 4EY7A 1RAIA 4DGQA 4US0R 1HF3A 3ASUA 4ZVNA 3ADPA 5B1SA 2G4VA 4PTZA 3ZTTA 5A5VA 3ADDA 3GLFE 2IYZA 3PXDA 4FFWA 4JJGA 4N6NA 4YLYA 1IZ7A 2ZJAA 1Y7IA 3JQBC 4JVNA 2YH2A 1UQRA 1BC5A 1KJ9A 5CDFE 4RTOA 4PICA 1HSZA 1QHHB 4HDQB 1T13A 3AJEA 5J59A 2HDWA 1H1TA 2GEBA 3VDNB 2IBTA 4IDEA 1I10A 3B12A 1ISGA 2WUEA 4F56A 3EXAA 3R9XA 1NJSA 3T1QA 5JS1A 5KZMB 1UMBB 5JXGA 1XD9A 1K97A 4RFVA 5GOTA 3U3DA 4AC9A 3PCRB 3KYDB 2QTHA 2QUBA 1Z39A 4E6PA 5IKMA 4KQEA 3X1DA 2OMKA 3DE1X 5SZHB 4WACA 5B4TA 1Z7EA 1NOIA 2IPMA 4GOND 1I7DA 1WXFA 3B38A 4RF2A 3UAXA 4EJ0A 1SKAA 3KTOA 1C7JA 4TKUA 2XA1A 4E7OA 3GG2A 1QYRA 1T8RA 1YRWA 1R12A 2WD7B 4KEAA 1PQWA 1HDYA 3AF3A 4X3PA 1ZCBA 5A6SA 3BXEA 4FWTA 1M6NA 1KXJA 1V16B 2YHBA 2ADFA 3P9CA 4MI1A 4EL0A 3TLGB 5BP7A 4BUCA 4GPIB 2A14A 4PS1A 1V7CA 2W2XA 4XGRA 4ZAXA 4TXHA 5DGTA 3WK7A 1WZ2A 1FFHA 3G9ZA 1C0IA 4LZLA 2Z4RA 2ZU0C 4XM2A 1XLVA 1IUKA 4TQ9A 3PWSA 1JZSA 4V0ME 3TIFA 1OLSB 1F0PA 4GM4A 3TI9A 3TR6A 3VNAA 5KWJA 2ZWIA 3PEWA 1DRWA 1KAEA 1ELOA 1I1NA 1OKKD 3RIGA 3TMKA 1HRDA 1TMOA 4I7EA 1SD1A 2G1PA 1R4AA 5A5GA 2UDPA 4KXUA 5TV2A 1MTZA 3GWZA 3Q3GE 3VYRB 2BI7A 1E1KA 4AO7A 3A6DA 3OOHA 2ZB2A 4HDNB 3RABA 3K0CA 2AEFA 2FOXA 5DLQC 5A1TA 1AXRA 2NVWA 2P90A 1RI1A 3IJ5A 2CDCA 3SBXA 3IB6A 4U7PB 1G20B 4LJ5A 3WGHA 4EFLA 4ZYTA 3ZCUA 3ZOKA 3W0LB 4D9EA 5H7XA 1DKOA 2OENG 5FORA 3HV0A 5AW4A 5EMNA 2RJNA 3BB1A 1XMJA 2RH5A 1M1YE 3MINB 3ZG6A 2ZJ8A 4YWJA 3HB9A 5KQPA 5F21A 3EZ9A 5DWQA 5BV7A 3EGXA 4B3TB 3ELWA 4PVDA 1XZEA 3OZGA 3EXIA 4FHDA 5A7FA 1K4YA 1KKLA 5K6RA 1HLFA 2QGFA 3CEMA 1J90A 3EARA 1PV4A 4HDNA 4FJ0A 3TQSA 16PKA 1HT1E 1QF7A 4Y3UA 3CZ9A 2Q4DA 3MBOA 1IHDA 4PXSA 2JGDA 3CZRA 2A86A 3WL6A 5CCDA 1DHRA 2X3YA 3T7AA 2GAFA 5J2TA 2YJ4A 4KRFA 3M1IA 2C5SA 3KHSA 3RHFA 1WCXA 3NCHA 4AWXA 1TB4A 1ZMTA 2CN1A 2O8VA 4UE2A 4ER6A 2WG0A 4M0PA 2ZUCA 3NHFA 1I2BA 3HHPA 2HCBA 1KEZA 2IQ5A 4LRQA 1GUZA 3HJRA 3TLBA 5BXQC 5GIPE 4YJ2B 3COPA 1TFRA 4TZKA 1XZIA 2QZ9A 3R6DA 1H9AA 1TZMA 2NTYC 5F1KA 3T52A 3WYCA 4AY3A 4LBVA 5A9RA 3FFBA 3F2IA 5C2JB 1U0TA 2IYQA 2ZREA 5AKIA 5DHRA 3C41J 4FW8A 1T3ZA 3AERA 1WSBA 3W4IA 3ZW7A 2RAPA 3K94A 1R9MA 5EVJA 5LQNA 1X7YB 4PYKA 1L7PA 3O47A 1CJCA 1BFDA 1NHGA 3FX2A 3TR5A 4NXMB 3DEJA 1R0LA 1KK2A 1Z6XA 1JXAA 1KJJA 2FX3A 2BFDA 2G4LA 3DDCA 3DPIA 4G0ZA 5AXCA 3ESXA 5E4TA 3L0YA 7REQA 2Z2ZA 4Z6KA 4D26A 3FW1A 3O4FA 4GBGA 3I39X 4Q6WA 1KDPA 2AXPA 4YP6A 4A10A 3GLIB 4UBIA 3SC2A 3IERA 1G2QA 4XLLA 4RY8A 5GGYA 5KYXB 4IX1A 2H65A 4E5NA 3DZHA 1TCAA 4PFQA 5SYAA 1DV1A 2A0YA 2X6TA 5JOQA 1S2OA 1WPXA 2WU3A 1VG0B 3B20A 3G85A 5FLYA 1TAUA 2D0IA 1N77A 1YAJA 2CJWA 4Q19A 2FSIA 1P17A 4U7WA 1QB7A 1N57A 4TKVB 1EXVA 4AWBA 3VSEA 4MW4A 1NF3A 3C3EA 3KV3O 5AIBA 3DFKA 1JG2A 4UNIA 4C6HA 4ETWA 1HRKA 3OLYA 3WB2A 1IOLA 3FMGA 3ET4A 3H1TA 5AKLA 4AM8A 1QFXA 3AETA 3VC7A 5JATA 2Q5CA 4ZCSA 4NK4A 1Z73A 1KOGA 3G0GA 1JLLA 3HJNA 2H31A 4BGEA 4BNYA 2GEVA 3IPCA 4ZZ2A 2QS9A 2ANCA 4YRCA 4Q12A 2ZRGA 1UP4A 4ZCRA 2M9MA 4I9UA 5EFOA 4OY3A 4XXHA 4Q9AA 1L4BA 2ZBGA 4OA8A 1NNSA 4K2AA 3PPXA 1NYTA 4KRYA 4EYSA 3S7ZA 4BE4A 4ZOBA 1H6BA 2BEUB 2H2AA 3N8IA 3PYLA 4CG0A 4TKMA 2HHHB 4WNYA 1YA8A 5CDUA 1SHUX 2FVYA 2VT7A 2ZAIA 1A0OA 5DO9A 1SCKA 1Z63A 1P2VA 1MTOA 1T1RA 1JHRA 2FR8C 2QTGA 3AUFA 1JEOA 4L15A 4PSUA 2B21A 1MO2A 4UBLA 4BX9A 3G2JA 4DDVA 4CT0A 3TRJA 1FLVA 3HUUA 3RSSA 3WWPA 4QYWA 4A27A 1DIHA 2XB4A 3UKDA 2Q2NA 2W0SA 4G85A 2YICA 5DV9A 5K0ZA 1A4UA 1EK5A 2EF0A 3ET5A 4NLLA 1BFUA 2RC6A 2XWBF 4RIEA 2J09A 3B3AA 4JI1B 3U7RA 3WXMA 2Q3DA 2WZCA 1VA5A 1FRNA 2RHWA 3IO5A 2HTEA 5HKKD 3HACA 2HU5A 1GOTA 3TG8A 3ZY2A 1RD4A 2WZBA 3RHSA 3EISA 4Q47A 4S1VA 3QUAA 2R11A 1ZR2A 4PM4A 4MYHA 1XA4A 2X9NA 3C16C 4TSFA 4BLRA 4ITRC 1PLJA 2ZKIA 5KJ6A 3WRXC 4P58A 4L73A 4KN5A 4YJGA 3PB3A 1VMEA 2UUAB 4O3FA 3ZV7A 1E7YA 4HQOA 3I73A 5BQFA 4XQGA 5JD5A 1J8FA 4GSYA 1VBKA 2IZ5A 4PE5B 1O95C 3JWPA 3NYWA 1U0LA 2GCEA 1GGHA 4MW7A 5T4BA 4J1SA 2ZVPX 2AKAB 3SXUA 1PNQA 4DRXB 3KUDA 3AL0C 1ONBA 4YALA 1ZHHA 4FOPA 1WMSA 4G84A 4M6WB 4HQ6A 1RRGA 1T91A 5F5XA 3P9SA 4ZVVA 3KSAC 1ORTA 1OZAA 1SVIA 2I3GA 4YDSA 2IUSA 5A71A 2LIPA 3T15A 4FFVA 2BH9A 4DQUA 5DM4A 3SK0A 4ZQIA 3GMTA 3TNYA 1RNLA 2IUYA 2QVXX 5HIIA 1PFVA 5B1IA 1FX1A 2FK8A 3DPSA 4IHQA 4LYDA 3TPFA 3W5UA 1LC3A 3RRJA 2JFXA 5EIEA 5JSQA 4DG8A 2B5WA 2QLNA 2C3MA 4L08A 3T34A 3O1HB 1X14A 2C88A 2RHGB 4MKHA 1RWOA 4QFDA 2BM0A 5C3MA 1MJHA 1W4ZA 4JT2A 3EPJA 5AUPB 4DRXA 4W9RA 4YRPA 4H15A 4QEZA 5C7YA 5DNYB 3JQ7A 3ND8A 1EVIA 1TJNA 1ZYUA 2OZKA 3O0TA 2ZZMA 1AUXA 2H4JA 3Q5GA 4TXNA 3WGVA 4BQIA 4FYIA 4QE3A 3W78A 3COWA 1YQTA 1QIKA 4N82A 5JAIA 1X7DA 2OGWA 3BEDA 3G2OA 3LSTA 1P9OA 4JB8A 5C3UA 4C3ZA 2XUAA 3BSSA 5DK6A 4AXXA 4YUXA 3TXYA 5HX7A 4DBVO 4ZOCA 3CNHA 6LDHA 1FFXA 3TEJA 3ASZA 3PQ3A 1AQ6A 1J07A 2HWWA 3JSAA 3KJEA 5AI6A 3VSBA 4L0MA 1W6RA 3VDQA 5TMEA 3SYLA 4FLEA 4XPIA 4OQEA 4Z9XA 2VYNA 3UK2A 3NTXA 2GAIA 4J4BA 1MH9A 3T3MB 4I1PA 1NFFA 2I91A 4OCZA 4CWAA 2CCKA 2O3RA 2PX2A 4HAIA 5DRTA 2PMBA 4WINA 1NTOA 4E08A 3PQDA 1MENA 3GYGA 5ARCA 3L43A 3DCNA 3S2GA 2OWEA 4FLFA 4FOOA 5T6MA 1J70A 5CLFA 3VDMA 4HK4A 1ZPDA 4QTXA 2HJSA 2W6NA 4KVZA 1QHIA 4J75A 1K6IA 4GQAA 2VEOA 4G25A 2AWOA 4K8RB 3CX7A 1PT7A 1X7XB 1UWCA 3ABQB 4ONEA 2NV2B 3M4YA 1ZJ5A 3QUBA 5CCEA 4FWBA 1NBIA 4F71A 2JI9A 4HQLA 3DGFC 5AW9A 1NX6A 1QIDA 3T3NA 1VJ1A 3NV9A 5EKDA 2AD1A 1GO2A 4WDRA 3ANNA 5REQB 3NNDA 4X7RA 1NW7A 2IOQA 2XECA 3CKLA 5CD1A 4U8HA 2FQXA 2AZXA 1P0IA 3PNPA 1Y3BE 4HSEA 2VO1A 4OSPA 5IJ0B 4OXYA 4C6SA 3M5PA 4TTSA 2OXEA 3NT4A 3EF0A 3ED5A 3WYGA 2VP5A 3A9SA 3OCUA 1O95A 3CUVA 1MT3A 1AGNA 1T2AA 2PQMA 1BN6A 3IQFA 4GIBA 1N2EA 2JI7A 1PAUA 3VHLB 1Z4OA 3LFHA 3FHCB 4L85A 3CH7A 5FEUA 1D1SA 1OREA 2IZ0A 4ZN6A 2GRUA 4G01B 5EKXA 5EKTA 1DI0A 2LP4Y 1VQ1A 4HN9A 2Q50A 1YDGA 3JQFC 2B82A 3UYKA 1XRPA 3V7NA 1GPYA 4MO2A 5EGSA 5AXDA 5REQA 1R6UA 1CY7A 1K68A 2EDCA 1UFVA 4HT3B 5L9AA 3NYIA 4AJIA 2NADA 2WNIA 2H07A 2ZSJA 3AL3A 2JARA 2XUZA 1H9BA 2VDPB 1GN9A 2IYOA 3L6BA 4R16A 1P1IA 1JSRA 1XZGA 1IEWA 3AZQA 1AQIA 3HA7A 1EJ0A 3I09A 3PG5A 4O4HF 5E6RA 3DEIA 4PNZA 3ZHBA 3QWBA 5CDHA 3ZH9B 1NN5A 4OI2A 4X24A 3I9LA 4MGIR 4ZRNA 5AHWA 5FX2A 2C92A 3E23A 4C6TB 2NUBA 1M2OB 4Q4LA 1BVRA 3ZBUA 2VZ0A 3CIFA 5CXQA 3DOIA 1B23P 4C7KA 2CLIB 3NPMA 3Q3IA 4WY8A 4M2LA 4OYLA 4OXIA 4XB1A 4N4AA 4ZANA 1TYEB 4QDOA 5DSTA 5F51A 1NY6A 1CY1A 2FPSA 2EW8A 4RVFA 1SOUA 1JFTA 3D7MA 3MTBA 1D6SA 2IHVA 5IS2A 3C70A 5E3IA 1HDCA 2BF4A 4MQEA 2AQKA 5KWSA 2G5CA 3UZUA 1THGA 1UP7A 2ZATA 3VZQA 1L6RA 1PBNA 1E59A 4YUWA 3DE6X 3DZJA 1BDJA 5BV0A 5KYTA 1AS2A 3PTLA 4G4JA 2GVZC 1Y5MA 1ADJA 1MAHA 1QFJA 4KVAA 4Y0NA 2Q5QA 4B4KA 4C4YA 4GEGA 1DXOA 4AQDA 1LTHR 3R0ZA 3R5KA 4IYJA 4CLRA 1DJPA 4RZIA 2DWCA 2Q1YA 3G2QA 2B9VA 3VFDA 1W87A 4LCJA 4BASA 1Z6PA 3VISA 1VJCA 1BO6A 3RS0A 3D4IA 5JI2E 4RIGA 1NQ5A 3L0OA 2VPIA 1HL7A 4MDFA 1C8VB 5AH0A 1KDZA 5KNBH 4PC6A 1QP7A 3W2IA 4HUQB 1QHFA 1SPXA 2ZQZA 5T3YA 4XFDA 5IU6A 3QFHA 2HH9A 4HMQA 2X0RA 1GARA 4BC1A 5BSGA 1T6YA 1DFGA 3HWSA 4C3VA 1G0OA 2R4QA 4IG9A 1K7FB 4KK4A 2CL5A 2FPGA 4TMKA 3THOA 3PLRA 2C2BA 4YGXB 4B82A 1LV8A 2FQQA 4HF7A 3VGPA 4BV2A 1V48A 1JPVA 4EK9A 1MABA 4UTOA 3BQNB 1OT5A 1SQGA 1Q84A 4HG2A 4YP9A 1PWYE 4CKWA 3OE1A 1AB5A 2Z58A 2ZRBA 4HS4A 1MQ8B 3M1YA 5DN9A 1LBHA 5FDFA 4F4IA 1PHRA 5LB4A 5T3UA 2XYRA 5AK0A 4MYSA 1YUBA 1VYHA 3BGSA 1AHNA 3KRTA 3GJ7A 5A7HA 4XTCS 2N1MA 2WHXA 1HNZB 1VECA 2HD4A 4Z1MA 1Y5RA 2Y4OA 3IUBA 1RLOA 1S1CA 3RKRA 3R3XA 2F1JA 4HWSA 3A6GA 3EQZA 1Y8RB 1Y9ZA 3WB1A 4BNHA 1DC5A 1A88A 1IXKA 5KAPA 3WK8A 4OFXA 3D4NA 3FTQA 3PD0A 2IYLD 3LO5A 2JFWA 3DOFA 2OZPA 2Q6TA 3P5BA 3SFVA 3RRFA 4HDKA 2QTTA 4R9UC 4LEIA 1QLWA 3WGJA 5J58A 2BKUA 3UOGA 1PR3A 4RY2A 2DECA 1U98A 3JRXA 5LMNB 5E6UA 1L5RA 4PFSA 3VZBA 3PCXA 2QP3A 2PZFA 4MWDA 4KR6A 4IKPA 1J8YF 2IDZA 3OQ6A 4GDMA 5BWBA 2W2KB 4PRLA 3R5XA 1Y8RA 5I51A 2YJNA 3C1AA 2YN2A 3HU3A 4ARUA 5DLPA 5K0TA 4EG4A 1O77A 4I5DA 2QM3A 3AILA 1PBTA 3PI6A 1FEZA 3LBHA 1RABA 3QEOA 4JKOA 5DE3A 4H6VA 1M2VB 4QUGA 3PRJA 3ON5A 3NASA 1JU3A 2QV7A 4RF5A 1U8FO 5AM3A 1RI2A 1H69A 1WU7A 1ZJZA 1JDBC 1ONNA 1SKQA 1XVLA 2PMCA 2X0JA 1Y1QA 5EPEA 4E4TA 4FMCF 5IJ9A 4R0VA 4UNRA 1CUYA 2OV4A 4EY5A 5K4GA 2R6DA 5A5DA 4BLTA 1ZD5A 3B9QA 4Y18A 4QQNA 5KI6A 1QLHA 1QYDA 4AO6A 1HQYE 1SK9A 1YDWA 1RC1A 4ZQEA 4JELA 4EB6B 5IT5A 1JXQA 2XVXA 2OE2A 3G0IA 4QDTA 4CQLB 4REOA 5FO0A 1Q92A 4GVPA 2I03A 1X7HA 1UIRA 1CUAA 1M2VA 4KXLA 3NFRA 4MKRA 3G7SA 2ACWA 1ESEA 3O26A 4XDGA 5A3SA 1JG1A 1XVUA 3T61A 2FPXA 3UKOA 4F6RB 1AKRA 2P9ZA 4G0NA 3LVRE 4QTTB 2WJ6A 2Z2JA 3PDUA 3IDQA 2GUWA 4TSRA 5EKUA 2V6BA 3ZVKA 3C8HA 2JW5A 3F8TA 4FTWA 1O6FA 1U5AA 4QOGA 2CL7X 5AP9A 3AC0A 1WXGA 2R62A 2WT4A 4JI0B 3ZE6A 1J2RA 3NC1C 4AKTA 1J5EB 3LUHA 3P52A 2J0EA 4L3WA 4KZPA 2BEVB 2ZTHA 3KQTA 1J42A 2R87A 1ZGCA 3H18A 4OL9A 1SEPA 1WMAA 2OAQ1 2JLYA 3PA8A 1B6SA 5JBQA 2EP5A 3U09A 3BF8A 4JI3B 1CKEA 3O4VA 1A98A 3F9CA 4TLAA 2VWGA 4GUDA 1RQNA 1T6NA 1XQWA 4L8LA 3SS9X 3TQIA 1T0IA 2YZNA 3EYWA 4QTUB 4A6DA 4ZZ3A 2DLDA 2QMEA 1JTVA 2O2IA 1W75A 2UVPB 1I2CA 1K6JA 4WK2B 2IYPA 1VB3A 4Q05A 2ZXUA 2BFBB 2P30A 4O2BF 2IGTA 4W9NA 1ND6A 3AF0A 4WAUA 2XQGA 3V7WA 5K6AC 4N40A 2YW2A 2GGSA 4K9NA 2OHFA 2XWPA 3B70A 5LOVF 4V1CI 2WKWA 1A4XA 3INGA 1F06A 1IAQA 1CTQA 1Z15A 2IHBA 1CR6A 3D7RA 3QI7A 5D5PA 4RTQA 2QGZA 4JI2B 2M32A 5FD8A 2BLLA 3AUTA 3M6FA 4GBED 3LPCA 4B5LA 3NTLA 4Q1DA 1Z4KA 5FQNA 1EK0A 2QRNA 3B1WA 2YV5A 4UEQA 1QGYA 5IG2A 1S3GA 4XSVA 3U39A 4UU7A 2MYPA 2YOFA 2J3LA 3FCSB 3FZYA 2UVPA 4EUKA 4W8HA 3EGDB 3VPAA 4O1HA 2SKEA 1UH5A 4HH4A 4KKXB 1V26A 1YB6A 2H1WA 5DCUA 1KFJB 4BYGA 1VRWA 4WCFC 1E2NA 4XD7D 4WVLA 4HXFB 3U48A 4KGZA 1NI3A 2DQ4A 3NEYA 3ZJTA 4KIUA 1XDDA 3HY6A 1XMXA 4IUDS 4XB6B 4NE7A 3TI7A 3TRFA 2PRKA 4D6XA 1PR1A 4YJ3A 4UKDA 4J16C 5KYUA 3WO0A 4RTSA 2A9KA 2V0CA 3AUUA 1QGZA 3I6ZA 3VTZA 4GLOA 5LWHA 1JDTA 3K09C 1D04A 1AUPA 2PKWA 3EGDA 1JG4A 2AVNA 2B2CA 1R6TA 4I4IA 1CF4A 3R4CA 3V55A 3ROXA 1UOEA 3ETHA 3MJHA 1A9SA 4OH1A 5HJ5A 1PFUA 4I5EA 1UMDA 1XQXA 5JWRA 2C2HA 1ZSVA 4L0CA 2FG5A 2ES4A 1G2PA 2QF7A 4R8MA 2PMDA 2BGWA 2R1TA 5BW5A 1CUCA 4KXFB 3O1JC 4TUYF 3EOAI 2W6ZA 3AUYA 2H2IA 4E13A 3AGQA 3RASA 4BP3A 2W2LD 5M5BA 1G9XA 4FHEA 2RE8A 4E2ZA 1GPJA 1P39A 1UKCA 3CKYA 4J4TA 1K6MA 2J85A 5DGDA 3HKCB 4K2HA 1H6DA 3GDOA 1QIJA 1ADGA 4DMUB 1XQ9A 2NSYA 1T35A 2HXGA 2C07A 3QBTA 3IUEA 4F97A 1DCMA 1QVAA 2VJBA 3GMSA 8LDHA 4HVTA 3TQTA 3IKMB 1XMPA 3AJ9A 3JQAB 1P5HA 4IF6A 3BIJA 4Z8YA 1GPMA 4JOSA 3R8XA 1HYEA 2RCYA 3ZCQA 3S70A 3H5LA 1W94A 3PP8A 3BK7A 4X7MA 5LUAA 3MC1A 3WX0A 1D1TA 4BMZA 6GPBA 1SXIA 2PMWB 4M9SA 1SRQA 2C4VA 3RVOA 1RXUA 2G1JA 1QHGA 2EZTA 4XX0B 4ZJYA 1XI2A 3RYFB 1J2JA 2PUJA 2W0MA 4I1YA 1VM6A 2PZAA 4OP2A 1UC8A 4LF7B 2NWQA 2XCOA 1EDEA 5CTAA 4CMEC 4QAJA 4YP5A 1ISSA 1T9GR 3NAGA 5K6AA 4A8JC 3GC6A 2AT1A 1T4BA 4NNJA 1EVKA 5AVRA 3PL1A 1FP4A 1VL1A 1UJ4A 3PWZA 1T2CA 2ZYRA 1HH4A 4TS1A 5BNTA 1EINA 1G21B 5D86A 3STWA 4ENTA 1QPGA 1WB9A 2P6OA 1A5SB 1Z08A 5EZ5A 1XTUA 3EW9A 2A9JA 1SXJC 1HYQA 1RQLA 2A84A 1RWNA 3N8HA 1TQHA 1RPTA 3PK0A 3R76A 3PNOA 2R86A 5JRDS 4NS1A 3F49S 4D79A 5GY7A 5JJLA 2WJVA 2ZRAA 2XUKA 1ETHA 2O50A 3GBSA 4UNSA 1FPQA 3KB1A 3LRPA 3ZYZA 1GAWA 5FH9A 1TUEA 4HPJB 1DC4A 1V35A 5AOVA 3LA8A 3V32A 5TQVA 1EVZA 4RH1A 2DPGA 3R20A 1G21A 1ZLYA 4O4HB 2EBWA 4UMEA 3ZEAA 2QSUA 1GWNA 3LY5A 4TOIA 3QKSB 4BQRA 2X3FA 4O0MA 1NYQA 1DCFA 3IXMA 3MCZA 3P9NA 1TKAA 2WFLB 4RMGA 2C4HA 1R15A 3SJ7A 4DR6B 3NTOA 1GT91 1TVMA 2OECA 4IJWA 4V3CA 1E96A 2J07A 3LVFO 4G5HA 4BQFA 4Y9UA 1DEOA 1NP7A 2I55A 3K0SA 5JRJA 2B20A 2C5BA 3D2CA 1NBAA 2JASA 4MGZR 1XMSA 3SYTA 4BU0A 5HFNA 5HM8A 1OXTA 4IINA 3W2TA 4D80A 3KYCA 1AHPA 3I37X 1ID8A 5CDTA 1ZVMA 3LPLA 4QOHA 1NBME 3K1ZA 3UAOA 5F35A 1N1GA 2PUTA 3QMMA 3A04A 2UXCB 1A72A 3SHTA 3E82A 1NMXA 2EJTA 3ES9A 4PS0A 4R5HA 4E70A 2Y3IA 1B00A 2AK3A 2G0NA 3BGDA 3ZHQA 2D8MA 3G1WA 4HDOB 4DQXA 5K4HA 2YHSA 2ZRKA 1I4WA 4HCJA 4MX8A 5EA2A 3U19A 3KJQA 4YROA 4C7OB 4J6FA 4H1VA 2Q5LA 2Y05A 2XZPA 1EHCA 3TFOA 5ITWA 2VUTA 5C7LO 3R0JA 2NLOA 2JJ1A 1Z8FA 5EYPA 3RS7A 1V1JA 5G02A 1X1QA 3T3IA 1FY2A 4EA8A 4PXYA 2IUFA 3FBWA 5BN1A 1JEAA 2QE7D 2PWPA 3C3XA 4KACA 4JSRA 4DY6A 5J5AA 3RD5A 5TS2A 3CB4A 1CULC 4TROA 1CIVA 1J23A 2NZXA 3ETLA 3L02A 4Q03A 1V4NA 3QVTA 2XTNA 3S3TA 4E03A 5B7QA 3N59A 4DMCA 1DTSA 3EQ6A 2BR4A 4D8XA 1OLXB 1DINA 3HA3A 2ZSBA 1YQEA 4FNAA 4O2AB 1U9IC 2J8ZA 3QA3E 4COKA 5MF6A 3WGMA 2ROQA 1D2AA 1Q22A 3DSRA 4Q6BA 4U3JA 5GJWC 4A0GA 1P5RA 3QNWA 4RZSA 1KQFA 1MNQA 1NLUA 1SVLA 2J7PD 3JQPA 4K7JA 4PTLA 4EQ6B 5HIAA 4NIMA 3UCXA 3HK2A 4CMEA 3G5AA 2HIAA 3D9QX 4JA2A 1YRLA 4M1ZA 2OXIA 4C76A 1CZRA 1LSOA 4Y1RA 1WVIA 3BXGA 5JWHA 1ITZA 3FLEA 4BNXA 4BY9E 3GJSA 3GAZA 5A06A 1P0QA 1ZGHA 3ND9A 4UZEA 3PDWA 1G38A 4YRBA 2RH4A 4M60A 2R96A 2QTZA 1YL6A 4XIYA 4OQDA 1OU0A 2NXNA 1XVVA 2HA4A 3AEKA 5BXYA 3WSTA 1G5FA 1E9BA 5B55A 3FOFC 2OFPA 2WLSA 1NJ5A 3AEUB 1EFVB 4P0PB 5F7XA 1Z0SA 2RGEA 5TPWB 4AP9A 5ITSA 2C04A 2F1KA 4GEKA 3GEHA 3LC2O 3L6CA 4EQ6A 1IPHA 3A0UA 1B0PA 3FPHA 3JPWA 4GICA 4YAIA 4OIFA 1ZQ9A 3K53A 1CRQA 2Q45A 2XY4A 4DCPA 3ZDQA 3PLNA 3WNZA 4FGSA 1Z18A 4Z1OA 1U9CA 2HMSA 2ANBA 4GNRA 4RGYA 4XQ0A 4F3NA 1JMVA 4RETA 1BQ4A 1FUEA 2IUTA 2PLNA 3ILYA 3I1YA 4M36A 4V2IA 4MP6A 3W2FA 3WRWA 4N7BA 2P8SA 2QD4A 3GZNB 3LUCA 1YAHA 1IULA 3EW7A 4S1WA 2FGJA 1H0HA 5LZ4A 2XMZA 4PYMA 4Y0VA 4QU8A 2JI8A 3RAEC 3FKQA 2FJ0A 5TPWA 3AVQA 5EXPA 4JLWA 1G4HA 4AECA 4B7AA 1FUYB 2YNMA 1J97A 2QPOA 1KO1A 3UMGA 2ZRLA 3SQDA 1PL7A 3DMTC 2V5UA 4GMXA 2GJ4A 4ZAWA 3OVMA 1USGA 1NQAO 2JI6A 2XRFA 5AJXA 1KVRA 2G9VA 1EVEA 3UVEA 4IHKA 1O5IA 1N8SA 4FYMA 3HBFA 4RK4A 1EBUA 3X1XA 2V1UA 3T5TA 2QIPA 4NJEA 1TX4B 2PA0A 3FCAA 1CETA 4I1VA 3P32A 1O94A 2WOJA 3OFKA 4P3NA 3ROGA 3W5BA 4ND8A 4BJHB 4DA7A 3NIDB 3VHRA 1WCIB 4AJNA 2QW0X 4ZICA 2KHZA 1FW6A 1PFWA 1RAFA 2P65A 3RUCA 4UUNA 2D8AA 2WF6A 3PEUA 5I01A 4ZD6A 3ZWQA 1HKHA 2PX6A 2V7QD 1DKPA 3NI2A 4QX6A 3JYLA 2P0YA 1AO0A 2QG4A 1PR0A 1DFIA 1N5KA 3EX7C 1IN5A 4R54A 4E30A 3KVOA 3CB2A 3I2IA 3N2IA 4NATA 1E6KA 5AHOA 2FPRA 4RF3A 1O96B 2FF5A 2HWKA 4QU9A 1YA4A 2I9PA 4R1SA 1C7FA 4TMVA 1O6BA 1HWYA 1RIIA 4E5SA 4LVNA 2VVTA 2GZ1A 1K27A 4MQ4A 1P29A 3ZC3A 1FFWA 4HZGA 3OQMA 4H7JA 1WZCA 4JX8A 2DUNA 2P9BA 1YHNA 3VR1A 3ZCVA 1QO7A 2NU6B 4CMIA 2YBDA 1KJQA 3ZWPA 4A0HA 3HH8A 3DE4X 1LZLA 3IA2A 1WUHS 4G0PA 4YUYA 1F6BA 3NM5A 3PNMA 4UDOA 1JR2A 5L40A 5TMPA 2VHXA 4Z4EA 1JLKA 2GVDC 1Q95A 3AIKA 3IE0A 5C46F 3CC8A 5GTDA 1L7OA 1O96A 3CO0S 4TYQA 2PU5A 3KSBC 1IBSA 2GPNA 2DYKA 5FWYB 4F2HA 1NI5A 3EUAA 1Y4ZA 1ADCA 4ND2A 2ZRFA 4K9LA 4PX9A 2VBIA 1VYTA 1VPVA 2Z9BA 1Q0LA 3UK7A 3CR3C 3QX8A 2OV6A 4B81A 1E77A 3N8DA 3OIFA 4L5IA 2ZR9A 4LX8A 3DO8A 4U7GA 3HXMA 3ELYA 3R3HA 3RS5A 4OI1A 2JLRA 1XCJA 3EVFA 4DN6A 3VO1A 4QGGA 2EGHA 3AU8A 4MUNA 4WKBA 5IBCA 4O2BB 4P32A 1DAIA 2ID9A 4FDLA 3D81A 3LDGA 4KDEA 5ENDA 3I28A 4Q3OA 4MV3A 1T24A 2VF2A 2VQFB 5JU6A 3OQOA 5JS7A 4GP7A 1UBFA 4NQZA 1CHDA 3T5PA 1EIZA 3UH0A 3BF7A 3OP4A 1BG6A 4HLQB 4LS3A 1KI4A 3LP6A 2ZIZA 2VI5A 3GO4A 1ZD9A 3K31A 4JMLA 2BZ0A 5IUJC 4JY7A 3S40A 5KTKA 3IT3A 4GBMA 2O7SA 4WSOA 5CVCA 1TNDA 4R81A 4OHOA 3H2BA 4L74A 1FK8A 5IFLA 1WL8A 2DHEA 4FYJA 3R9IA 5C5CA 1CEEA 5EXXA 5LMCA 2F8TA 4HWRA 1QWOA 2OMEA 3F4LA 3KVNA 3R7AA 1FDSA 5FBWB 3W3AH 1Y7PA 3K6SB 5EWJB 1TTQB 4Z4QA 1VI2A 1QOQB 2WUDA 2E3JA 2X42A 1BGWA 1JZTA 2AUMA 2AG1A 4OQPA 4ZC8A 3ENVA 3H7AA 4FHFA 3RM3A 4PRYA 3THSA 1ECGA 5AD1A 1TU4A 3TNLA 5A4IS 4ACBA 4DCMA 1WHTB 4QFBA 5LOVA 1R8QA 4BFLA 2O23A 4TWJA 4MUXA 3QENA 1ZG3A 2GBLC 1Z35A 3ZLVA 3ODPA 2Q4EA 4F96A 5CG1A 4RABA 1XK6A 4MI6A 1SUPA 2V6JA 3HN2A 3K5WA 5D3MB 3ENKA 5AKXA 1XLTA 2X0EA 3PFWO 2VUSA 3WB0A 3UIEA 3AF2A 4IUCS 4FXPA 5AJHA 3LUJA 2D13A 4OB6A 1K4KA 4F6CA 3Q2KA 1XEXB 3QKWA 4DWVA 2L19A 3LYAA 4OLFA 4MI3A 2PKQO 3OPNA 5K4AA 4ZI7F 1DOHA 2I7VA 5I5GA 3ICWA 4B32A 3IXQA 2Q1TA 2Y76A 4YR7A 5JH7F 3LY7A 1B73A 4YHHB 3LX6A 5JBIA 4DIUA 4R1UA 1WHTA 4KBFA 4NE9A 2FX5A 821PA 1FXWF 3KB2A 4HV4A 3UTDA 2AW5A 3LZDA 3DEZA 3FZQA 3N28A 3ZV6A 2AFHB 2BMAA 4TUYB 4C4XA 1VLJA 4F3KA 5FOVA 3GLRA 3VAAA 3GQVA 5ENVA 3N74A 5JAPA 3TL2A 1T5LA 1PE0A 4XYBA 1YRYE 4YRTA 3TBKA 4X65B 3WV4A 1QH1A 4KO3S 1M0TA 3QG5A 5AVJA 1YBHA 1JLSA 3QLUC 2IU4A 4JAVC 3DD5A 5E95A 1GGMA 3P94A 2O52A 3N3AC 4G2TA 4CIDA 2A0FA 4AJ9A 2ZSDA 3PFFA 5H4GA 4Q1FA 1FVFA 2GUGA 3WA6A 2FN9A 4Z4FA 3RIEA 3H99A 1JWAB 1IJKA 5AKKA 4XOUA 2HHJA 1D2MA 4M8SA 5LU9A 3BFVA 1LTKA 4UW9A 1PTKA 4PO3X 4H2DA 4R69A 4WERA 4EW1A 4I36A 2O9JA 3E5NA 1FTQA 4I1UA 1GPBA 3WLRA 1O2DA 3D54D 2IGBA 4F4HA 4Y2PA 3QE0A 1FMTA 1G3RA 1U2TA 1JJAA 2V7TA 2GJ8A 4BN5A 1QG4A 1SBHA 3OEHA 4EG3A 2QRJA 3E27A 4HGYA 3DO6A 1I3OA 3EAQA 3C6QA 1OXXK 1W5BA 3KUCA 1Q3HA 3B3QA 1QVZA 2H2GA 3BKWA 4JEUA 4BNLA 1QGAA 3AR6A 4D0NA 1NOKA 5K9ZA 2OLEA 3BTUA 3HXOA 1KOLA 3F71A