5DO9A

Structure of regulator of g protein signaling 8 (rgs8) in complex with alf4-activated galpha-q
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
314
structure length
314
Chain Sequence
b'RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
molecule tags Protein binding
source organism Mus musculus
publication title Structure of the Regulator of G Protein Signaling 8 (RGS8)-G alpha q Complex: MOLECULAR BASIS FOR G alpha SELECTIVITY.
pubmed doi rcsb
total genus 117
structure length 314
sequence length 314
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 5do9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5do9A01
3LXRA 3WRXC 1A2KC 3WYGA 4RCZA 5KTYA 1C9KA 1GTVA 1N6OA 2WJIA 3C41J 3WP0A 2W2VA 5EZ6B 2IL1A 3MFYA 4EIWA 3OFNA 2ONKA 4AIIA 5FOVA 1YU9A 2WJHA 1OFUX 4GP6A 4ZO4A 1KZGB 5EXXA 4QGGA 4GNKA 3EA5A 1Z83A 1KAGA 2Q21A 4K8OA 4HUTA 3OFND 1Z6TA 1KNXA 3SR0A 2NPIA 2H92A 2N42A 1TUEA 3TMKA 4GSYA 1GKUB 2XNDD 2ZRPA 3L0SA 4DCSA 3NTUA 1KGDA 5G40A 1IY0A 1WRBA 3S1AA 2XB4A 4L8GA 3QVVA 5DI9A 3LAWA 5FH9A 5JLJA 2VSFA 1EFTA 121PA 3FB4A 1T3LA 4G5GA 3W34A 3RS5A 3DKPA 3HR8A 3KFXA 3T61A 1R0WA 4OHZA 4OQMA 2OHFA 2WWIA 2WWHA 1W0JA 4CEIB 5CLQA 1OXSC 3RSLA 2QTFA 2OM2A 2ZJZA 4OK3A 5LDDC 5DSZA 4D80A 1MKYA 4JYBA 4PQYA 1XTKA 3FKQA 4D0LB 2WJGA 1Z2AA 1UBGA 2ZVPX 4DUGA 5GJWC 4EPXA 2NO9A 3W6NA 1WCV1 2GDJA 3EW9A 2C8VA 2QP9X 3IQXA 2X77A 1E2EA 3PVSA 4IKEA 1W4RA 2HXYA 4RJLA 2GXAA 2V9PA 3RAPR 4IFBA 2ZJYA 2W6JD 3QOFA 3K70C 4C2TA 1CJMA 3KKQA 2E1RA 2QQ0A 1ONBA 1R4AA 4DIEA 5L3VA 4A0RA 2AXPA 1IONA 3QE0A 2FGKA 3CF6R 2IEYA 1T4GA 2VYFA 5SZHB 1ZNWA 4CW7A 4EJSC 4KXFB 4BFSA 2GAOA 2ZE8A 1SZPA 1E1QD 1MO5A 2QY9A 4TLBA 3O8BA 1PLJA 4DLWA 3ZVMA 3THXA 1EWQA 4JKYA 3TKLA 4ZKDA 1GZSA 1OKKA 2KB0A 2ZRFA 3TLXA 4PHTA 3R20A 1WP9A 4FWTA 3L43A 1S96A 4A2QA 4V0NA 3DEFA 2WZQA 4Q4HA 1E79D 5FTNA 4LHVA 2XTZA 4TQUS 2ZI3A 1XF9A 2IXGA 4NCIA 1P4SA 4OBEA 2DHRA 1M7BA 2D2EA 1JBKA 2OILA 1SGWA 4Z51A 4GP7A 2XOKA 2Z0MA 4HLUA 5LPNA 1JJVA 1ZD8A 2IF0A 4QKQA 1E9SA 4LWZA 4CEHA 4DEXA 5K8LA 4P4SB 1BO6A 4NCKA 4C4PA 2ZSFA 1A82A 1ZD9A 1Z6GA 1E2MA 1HV8A 4Q01A 1B0UA 1KI8A 2H5EA 3K0CC 3T5GA 4EFMA 1J99A 3ICQB 3WNDA 1AGPA 4BE7B 1JQLB 4UNSA 3ZZTA 2A5GA 1NG9A 3BERA 1XTJA 3VR1A 3VHLB 2ZRLA 5TVKA 3LXXA 3MWYW 1G8HA 4QGAA 4AC9A 4TYPA 2C2HA 3C15C 1YKSA 1I2DA 2QI9C 1IN8A 2CHVA 5FOXA 1ZU5A 1UBFA 1QHHA 5JECA 4TYYA 1WA5A 1KSHA 5JZVA 1FW6A 3EIQA 5J47A 3R7WB 3RS0A 3FFAA 1Q3HA 1G5TA 1D6JA 1W2GA 2ZJOA 3W8RA 5FPKA 4P4UA 1E79A 3MAAC 4F7WA 1N6KA 2ZRBA 4PANA 2IT1A 5HE8A 5KU1A 1JR3D 1Q1BA 1KO8A 4LJAA 2IYQA 3SYKA 5JI2E 3QF7A 3K0FB 4P4TA 1WF3A 4W5JA 2PX0A 3SDZA 2V3CC 2AFIE 1FQKA 1HTWA 2FPKA 1G19A 1OXVA 3GFTA 2ODEA 4BZXA 4EQ6B 3VTKA 5CM8B 4ZI2A 4TL8A 2C98A 1D5CA 3LO5A 5AJWA 4FMBB 4MGZR 3IO3A 3M1IA 1G18A 4HB2A 2ZREA 1Q1ZA 3MG9A 3CB4A 5G3ZA 4OHVA 4B3GA 1U98A 2GA8A 2WKPA 3K09C 1KI6A 2G88A 3G0HA 3QXXA 2QAGC 4KYUA 5AJVB 5SZKB 4RD0A 1DARA 2OCAA 1H65A 3NDBB 3CKLA 5HKKA 4FMCF 3GFPA 3TQFA 2UKDA 1NNEA 4A92A 2OZEA 4PC7A 2OE2A 5BXQC 1NKTA 1FL9A 1VDZA 3NBZC 3F0TA 4KLNA 2ZSDA 2CHQA 3ZYCA 2MMCA 2ZU6A 5J5CA 2A2ZA 4P0TA 2FZLA 3UMRA 5A5GA 3PR1A 2X1VA 4DIDA 1TEVA 3NBXX 3LRPA 4YMTA 1S0UA 4XVRA 3D31A 1DE0A 4M9ZA 5ANRB 3I5XA 3N2IA 3H86A 1N3BA 2A9KA 4IVPA 3WYAA 1HE8B 1G21E 1G1MA 3FE2A 4Q1CA 2CL0X 1YZNA 4EKDA 3V9PA 2F9LA 4HAYA 2P2LA 1CLUA 3QNUA 4WVFA 3ND8A 4BLRA 3QY0A 2EYQA 1Q3TA 2IXFA 3UANA 3UIEA 2NO7A 4V0KA 2FE4A 3N5CA 1KSGA 4IRUB 5L3QA 1QVRA 1WBDA 3F8TA 3QEOA 1LS1A 2ZPTX 4BFZA 3HR7A 3GFOA 3LNCA 4BFXA 1CJKC 2J7PA 3QF4A 3A6PC 1EX7A 1US8A 4AI6A 2HCBA 3S1AB 3ZZ0A 4NCNA 3KKNA 4Y0VA 4IOKA 4NPHA 3BIFA 1Z8FA 1HE1C 1SVWA 5EXTA 3EPLA 2D7DA 4JLMA 2W6JA 1E2IA 3CH4B 2IC5A 5J4KA 2PEZA 1S1MA 1HUQA 3KTAB 4FI3C 4B3BA 1IOZA 4W7SA 1E9AA 1A7JA 1OH7A 3TIFA 4ZDKA 2IA5A 4GL2A 2BKEA 3BB1A 2QPTA 3U44B 4RD4A 2WSMA 5FI0B 3W8NA 3AF0A 3SYNA 4DUGD 1UJ2A 4G0NA 1ZU4A 1CR4A 2ZRGA 1MOZA 1SVIA 5IHPA 4HATA 4PO9A 5DE3A 5HTKA 1W0JD 5C18A 1E1RA 3B9PA 4TLDA 2NQ2C 1KKLA 1MO6A 1Q1EA 3FKSD 2ERYA 1KMHA 3GEHA 1N6HA 3VR6A 1AGRA 2DFTA 4HLCA 3KX2A 3VHXA 2QQEA 3KB1A 3U7EB 1ZP6A 4JVNA 3T1TA 1UDXA 4IDNA 4KBGA 1OIXA 2ATXA 2QA5A 3BFKA 4IOJA 5K8TA 2OO7A 1E32A 1E94E 4FCWA 2VH5R 2CL6X 3DL0A 2N46A 3QPWA 1GRNA 1RRCA 4KLZA 1NSFA 5E7JA 3RS7A 2GXQA 1TX4B 3QKUA 2R8RA 4A8JA 1GUAA 1P2UA 3PITA 4MA4A 1NLZA 4DLXA 3B6EA 1RE0A 5KYKA 5EP3A 2E9SA 4AD8A 1BYIA 1L4YA 3T34A 2AHOA 1AKEA 2BKUA 3HP1A 4JLKA 2G3YA 4ZIRA 1XJQA 4II7A 2NO1A 5DO9A 3U3KA 4DDTA 4ACAA 4QM6A 4PQRA 3MCAA 2ZI9A 5CYOA 3PFIA 4KSBA 5DISB 1NLFA 4EPRA 5GJCA 3HYTA 4M0LA 4BGDA 2QTVB 3OIYA 4JYCA 4LYAA 3IEVA 3P4XA 1G9XA 1N25A 1XU4A 4PQFA 4W5WA 5AJYA 4YXWD 1U8YA 3QG1A 4TL9A 1HT2E 1TAGA 1YVDA 3CRQA 3L8ZA 4I1OA 2CE2X 4BFYA 1N2CE 3W3AA 2GKSA 4E5UA 3U4QB 4RCYA 1Z47A 3V00A 4GMDA 1ESMA 1PVOA 2OV2A 2VP4A 3WXMA 3TUZC 2GBLA 1UPTA 1NVVR 2G83A 1JXOA 2AK3A 4FINA 4B2LA 3BFXA 4QHYA 4AKIA 1WXQA 3TQCA 4JLNA 4UXHA 2WMNB 2R2AA 3NBFA 2GK7A 2XSZD 2ZS7A 4Q4HB 2ZU0C 2ZJBA 1JR6A 1F2UA 2CK3A 1FNMA 1CEEA 3PEUA 4B34A 3OHMA 3DHWC 1XPUA 1YZKA 5EP1A 3I5YA 5CDFA 4BLOA 4L15A 1D9ZA 2NZ8A 2H16A 3VNVA 1E4YA 1AN0A 3QKTA 4LOAA 1XTRA 1S3GA 2C99A 2DFKB 3NBYC 4JLJA 4C3ZA 5AUNB 2C9YA 1M7HA 4LYHA 1L2TA 4PSVA 1UEJA 3ZLJA 1ZUHA 1ZUNB 4ABYA 1I4DD 4GOXA 4D4MA 3QEJA 1ZM3A 5CB8A 4URUR 2FSIA 2JLRA 2G6BA 4K81B 1K6MA 3T15A 1TQDA 1UKEA 2WWXA 4G5QA 1SVLA 1YZUA 2HV8A 4C0BA 4HLUC 1F6BA 1TU4A 1KI1A 3I73A 4KFUA 2G0TA 4V0MA 1KJZA 2W0MA 4BLPA 1T0JB 3BC1A 1VG1A 2ORWA 2CLDX 2GBLC 1ANKA 2WWFA 1JR3E 2OLKA 1ZVQA 2F3RA 1S3SA 2C9OA 3DZDA 4LBZA 4I1SA 3THOA 4DDUA 3QJYA 2QBYA 1YZLA 3EAQA 3P1JA 4O25A 4PHGA 4L9SA 3GJ8A 4NBSA 2V7QD 3IBYA 4PC1A 1RKBA 2YYZA 2IYSA 4URYR 1UDWA 1GRRA 3PENA 1RJ9B 5C1BA 1X8LA 5F2EA 3NEYA 4PZYA 3I3SR 3EZ7A 5J40A 1E4VA 4MGIR 2GVDC 3QVUA 3RANA 4MDEA 3AVWA 1R0ZA 2ZIAA 4PFSA 4BFWA 3VX4A 5FTMA 1FUKA 4LJYA 1X8JA 4A6XA 1XP8A 3BH6A 3G5UA 3O8DA 2C04A 5KUTA 4I4LA 1E2PA 1NLYA 4Q7MB 4YC7A 4F4CA 2KBEA 1NN1A 4S2EA 5JWHA 5JMTA 2Q0HA 3A58B 521PA 1ZM9A 4LJ9A 3Q5DA 3K0EA 2XAUA 3W6OA 4PO8A 2IS2A 3VKGA 721PA 3WHKA 1JAHA 2HF8A 1JR3A 2W58A 1K8RA 2FZ4A 1MO4A 1TUIA 1VHTA 1TPZA 5FFMA 1E6CA 5J4YA 4U7DA 3SBDA 1VG8A 2BC9A 2YOHA 3P32A 4KSCA 3VR5A 4PO1A 3DOFA 3GLHE 1BMFD 3KUDA 2O8EB 3RVBA 1T3SA 3GJXC 3EPHA 1N0WA 4EFLA 2GJAA 3B1WA 2DY1A 5BN3A 3BBPA 2JLVA 2H18A 4GRAA 4W9MC 1KYIA 2V54A 1ZCAA 2GCPA 1Y63A 5FUXA 1Q12A 3KTAA 5IDVA 1UBCA 4UKDA 4TYNA 3LV8A 4A15A 4MRRA 3THYB 4PAOA 4F4JA 1ZNZA 4PZZA 1VG0B 2A78A 4C9BA 3I72A 3UPUA 6Q21A 2EVWX 4Q1AA 4C0HA 2XXAA 2XTMA 4QRHA 5K8IA 2EU8A 4HAXA 2O8FB 1UF9A 4GT1A 3DM9B 4D0NA 4PHHA 2JLZA 1XCPA 2FF7A 2VSXA 4KFRA 1VIYA 5FOUA 1TQ4A 2XGJA 2D06A 4IXNA 3B8HA 1VCMA 1OSNA 1T8TA 1TF5A 2GEUA 4LI0A 3SN6A 4B2PA 4DXAA 5EJEA 3HPQA 4MYCA 4UNQA 4UNNA 3QPVA 4KFSA 1GM5A 2QMHA 4EPVA 2WSSD 2VRWA 4P3YA 3EARA 2UZIR 4AYTA 1A1VA 1JJ7A 4Q1FA 3EG5A 1N6RA 3RRNA 3LBHA 3LFUA 4Q66C 1EFRA 1ZIPA 3AQ4A 5IK2A 5JRJA 3OEED 1N5KA 2AX4A 1RYFA 2W00A 4M1OA 1UKVY 5HR5A 5GADl 1E2NA 3D6TB 1LS6A 3NXSA 4LYFA 5FPSA 1ZM4A 3ZIAD 3IIMA 1VKJA 4EJSA 2CLSA 2A3RA 3MWJA 1ZM7A 2R6GA 3HPRA 3B1VA 2ZR9A 4ESVA 4G5RA 2ZSBA 2FFAA 4PX9A 3P26A 4IXMA 1H8HA 2GK6A 4X8HA 1NSTA 4YDSA 5BYKA 2DCUA 2ODNA 4F91B 3SOPA 2FDCA 4URXR 4MKIA 3GJ6A 3Q3JB 1MABB 3IDQA 3WMFA 2VP0A 2RCNA 1U8ZA 1SKYB 3QBTA 2V55B 5CK5A 2QN6A 4C30A 2YOGA 1LY1A 4OL0A 4XD7D 1BKDR 4D0GA 3KXLA 2J0UB 3C4JA 3QXHA 2G0NA 1T3HA 4OQFA 4EPTA 3I62A 2Z6VA 4TTPA 1YRBA 221PA 3PEYA 5AJXA 2KI5A 4IOMA 1E2GA 3U3JA 4EFNA 2I1QA 4PPNA 4UJ5A 4Z1MD 1LTQA 2QPAA 5LB4A 4TT3D 4HEJA 3SJAA 5CITA 1W1WA 3ZIAA 3ONWA 2VBCA 4D2IA 2VTKA 2F43A 4POAA 4URVR 1T8UA 3FVQA 4Q1DA 4R2HA 3VU9B 2GF9A 4TTRA 2QENA 4B3XA 1QHXA 3A1WA 4RFSB 1KJWA 1S2MA 3KB2A 4AK9A 4BFTA 3RDPA 1JNYA 2IYLD 2HDNB 4DDVA 5B57C 4A6PA 5KNBA 2QE7D 1R5BA 4Q7JB 3IGFA 1W36B 1NMZA 1IXZA 4MKGA 4TSFD 2B7CA 4Q1BA 2QAGB 3LQQA 2NO6A 2WSSA 4H1UA 4TLAA 1XTQA 3U6BA 2CVFA 2BHRA 4UNPA 5BQ5A 5DI3A 1PLKA 4PC3A 4PZLA 2ASEA 2BDTA 1II0A 4RZ2A 2NO0A 1B23P 3K9LA 2PBRA 1OYWA 1NVVQ 3HJNA 4QJ4A 2JJ1A 4KFTA 3WHLA 3A1UA 1DEKA 3OIVA 4KJZA 4XJXA 2DPXA 1KTVA 4G3XA 5AUPB 2ZROA 4A2PA 2OCBA 4HDOB 3FHTA 1KI2A 1OFHA 2FU5C 2NZJA 2QNRA 2QAJA 4TMWA 3NH9A 1AS2A 2D4HA 3SU8A 3QBVA 2VIIA 3KKPA 4JLAA 1WB9A 3FHOA 4TMVA 5JEDA 5AUQA 3PJRA 1SVSA 2AKYA 1XXHE 4LBYA 2ZS9A 4OYHA 2EFCB 5P21A 2IHBA 1MR3F 2IBMA 3Q7QA 5EE1A 2JASA 4LPKA 1XJ0A 5DI3B 2YZ2A 1XNJA 1KI4A 1BMFA 5FUWA 4GDFA 4C0KA 2BBTA 2VHUA 1BIFA 4JVLA 1G64A 5CB6A 4XTRA 4AG5A 5DGXA 5JBQA 1KNQA 2ZRDA 1XWIA 1UBEA 4JBWA 4DCNA 3LH5A 3UWKA 2CCGA 3SJZA 4HAZA 4B48A 5EUQB 1CU1A 2XX3A 1XZQA 2ZM5A 1NMXA 2AD5A 1L4UA 2ZI7A 3UK6A 1YR6A 4QM7A 2QM7A 2V8OA 1IY2A 3CZQA 1DAFA 3CRVA 3SJCA 1SXJC 2J87A 3AVQA 4KVAA 1JPJA 4Q4JB 4OI1A 2J7KA 3NHBA 1E98A 4NDZA 1LVGA 2WICA 1JECA 4DEYA 2P6UA 2QU8A 5DHFA 5UKDA 2GESA 2JDIA 4JLVA 1FTSA 3TJZA 4O2RA 2NIPA 2P0EA 1EFUA 3BS4A 1Q44A 2ZUDA 2OXCA 4NU0A 4BEBA 3FHCB 4EJSB 1XEXB 4GI7A 1W4BA 3KQNA 4N1AA 1G8PA 2J0QA 5JS8A 2IF2A 3CPEA 1KDPA 1GKYA 1YZQA 4BEJA 3ZD6A 3B1YA 2OESA 1Z0KA 4AURA 1IAQA 3AUYA 3GP8A 3I61A 3CLVA 1QHGA 2BOVA 4YQFA 5HZHA 2FFBA 2WVJA 3I4LA 1W44A 4Q9JA 4KVGA 5L3RA 5C46F 3AEZA 5M04A 4H9GA 4C0SA 1N6PA 1G7SA 3E1SA 4OKSA 4XTCS 1AKYA 5FUYA 2Q3FA 2QSYA 5JEEA 1N6IA 2HYDA 1GILA 2OLJA 1PUIA 3IHWA 5FBWB 4YMWA 5GVSA 5GJVC 1II8B 4CEIA 2JJ2D 2EFHB 2NGRA 3DMDA 3L0OA 5FPHA 3QIAA 5DN6A 3IHLA 4B35A 5L3QB 4IDPA 4DLUA 3SHWA 4F38A 3K70D 3P27A 2HCJB 5JFGA 4XSGA 4IW3B 4CEJA 2DFNA 2WPDD 3ZDQA 4A8JC 3KJIA 1SHKA 3CONA 2OEPA 2X8AA 1OB2A 2YKGA 5JHGB 2GETA 3VMFA 1Q1QA 2H57A 2JEOA 2GZAA 4P4SA 2ODWA 4NYJQ 5H8WA 3PIRA 2AWNA 4C2UA 4R9UC 2LWIA 2CE7A 1UEIA 2HT1A 4FXPA 1VMAA 1CJVC 4IDHA 2F3TA 3DO6A 1U9IC 3TSWA 3U44A 2NG1A 1R0YA 1G291 821PA 1YJ5A 4Q9LA 1G7TA 2GXSA 4JJKA 2Y8EA 3JVVA 4OQXA 3R9IA 3EPJA 2AKAB 3DKVA 1SXJA 1Y3AA 4TLCA 2C78A 2CJWA 3DOEA 4P33A 2JJ1D 2WIBA 5KNDA 2R9VA 5F9FA 4D81A 3D8BA 5JSZA 1G20E 5AR1A 2CL7X 3HDTA 4YLGA 1RC8A 4E22A 4UJ3A 1OPXA 2R6CA 1DAMA 1P61B 1Z63A 2P6NA 3KJGA 1R5NA 2ZAOA 2ANBA 2MMGA 1G8GA 3BJIC 5DH9A 1V5WA 2GXUA 3C5HA 5IT5A 1G7RA 4M9SA 4XOIA 5LD2B 4CDGA 2W0SA 4XWAA 2O8CB 1MABA 2FV8A 3CIOA 4YMUA 1D2NA 1Q20A 3QQ5A 3GLIA 1JXMA 3BH0A 1W47A 1Z22A 3N2EA 5E7MA 2ZYWX 3DVLA 3FWYA 4QBIA 5C4GB 1GWNA 4OI4A 1P60A 3CZPA 5CYPA 3KQHA 3GCGA 3CW2A 4JS0A 2BIFA 4FN5A 1GITA 1U99A 5KDLA 3DZ8A 1HH4A 2YWEA 2GJ8A 3HU1A 2XZPA 5BYJA 3EC1A 5G41A 1WMSA 2GEVA 4PPQA 1X1RA 4MUAA 3OESA 4ARZB 1ZUIA 3BH7A 3TW8B 2XJ9A 3RSOA 5EE0A 2O0KA 2DWPA 2HUPA 2VL7A 5FUVA 2LKDA 5L8VA 1D9XA 4U00A 4A2WA 4CYMA 5E95A 3A1VA 3ZZUA 4DJTA 3REFA 3FKSA 3GJ0A 1UFQA 2ORIA 3U3MA 3A1TA 1J8YF 1KSJA 3ADDA 2BBOA 4UXIA 5CJ2A 2G1JA 1FOEB 3X1DA 3AV0B 2DBYA 4BECA 1Q57A 5EP4A 4A0HA 3K9HA 1IN4A 4C7OA 3TRFA 5FPYA 1QF9A 1XCGB 4A82A 2NMVA 2F9MA 2JIZD 3A4MA 2G1KA 4OK5A 5F98A 4TL6A 4LYJA 3THWA 4MUBA 1E96A 3U2QA 2OAP1 2ZSAA 2OUKA 2ECKA 4KCGA 4B6FA 3RC8A 2ZTSA 3L2OB 3ZQJA 4DSTA 4M1MA 4TWZA 3GJ5A 3Q85A 4JZKA 2O0JA 1ZW6A 2CDNA 2EFDB 2GJKA 3GD7A 4BLTA 4ZKEA 2A5YB 2PH1A 2F1IA 3NKVA 2HLDD 1X1SA 3GJ3A 2JCSA 4B2IA 3AVOA 5B30A 2WBLC 2QGNA 1IHUA 2EWVA 3H2YA 4FMDB 1D8TA 5CLLA 3MWKA 4B3DA 3LD9A 4LUCA 4A36A 4D4JA 2O8EA 1XXHB 5B2ZA 4D6PA 3T06B 2MSDB 2ZJAA 1XJCA 1P62B 3BE4A 4DKXA 3AP1A 4MDFA 4Q4LA 2QG6A 1XTSA 1DAEA 3VNUA 2C96A 4OJQA 2B8TA 3ZVLA 2BMDA 3BGWA 4HB3A 2QMOA 3UG6A 3I8SA 5KPDA 3EX7C 2XZOA 2YWGA 4O0MA 3K8YA 1Z0FA 1OJLA 1XD9A 1G7CA 1NVWQ 1IM2A 4OI0A 3TVTA 3BFVA 3SFZA 4M9QA 3K9NA 2DYKA 2ZRHA 5FR2A 4BFVA 2G77B 2B6HA 4TZ0A 4BASA 3LWNA 2QPOA 2FG5A 1XBTA 4NCJA 1IN7A 2R44A 3QXSA 3C16C 3C5CA 4AYWA 1SKQA 4RY2A 3I8XA 2GILA 1E2LA 3RNLA 4V02A 3U3RA 2YHSA 1RRFA 1H8EA 3ZQ6A 1YZTA 1KIMA 4CIDA 1J70A 2PT5A 2P5SA 3H4MA 3SEAA 1Z5ZA 4RKFA 2QT0A 3AVYA 1CULC 1RPZA 1G4AE 4TTQA 5HPYB 3IBGA 2ZI6A 4B74A 3T1QA 3LLMA 4D4LA 4GPTA 4DWJA 4MQBA 3GLGA 3CX7A 3FFBA 3DPUA 1II8A 5EUMA 3VR3A 2W6ID 2QP4A 2QMUA 2QRNA 4E09A 1DAGA 2IEZA 3WNCA 5J4VA 1EFRD 1OKKD 1SXJB 2BV3A 4DSUA 2AD1A 3D7MA 3RS3A 3TW4A 1KDOA 3NC1C 4Q21A 1FUUA 2CVHA 2YINC 5FBRB 4DCVA 1VTKA 4FMCB 1BYUA 1QG4A 2L0XA 1IXRC 2ZUCA 1GIAA 1OHHD 1VCIA 1OFIA 1VYVA 1ZC4A 2FFQA 2OAQ1 3U7GA 5L3SB 3G82C 1P72A 3TR5A 2CLCX 2FN4A 1YR9A 3QXCA 2B7BA 5FBVB 4IVQA 4CT4B 3BB4A 3WNBA 1Z07A 3PQCA 4Q5IA 3KKMA 4KU4A 3CBQA 2Z4RA 3AP2A 2FOLA 2IYXA 4TYWA 1FP6A 3CRW1 2HXSA 3CX8A 1G3MA 1GAJA 4A8JB 1AIPA 2QGZA 3GLGB 4YMVA 4WOPA 3LW8A 4R2IA 4URZR 4TZ6A 3FTQA 1XMJA 3JZMA 2V7QA 3PUVA 4BPBA 4JLPA 1KO7A 4DLYA 1AJEA 2WOJA 1VHLA 3LY5A 4ASUD 1D2MA 4OQLA 4PSKA 4WA7A 4B73A 3UKDA 4MKHA 1XEWY 2A7QA 2TMKA 3KL4A 3EA0A 1N0VC 1XMSA 3SJBA 4ARZA 2VP9A 4TMXA 5KPJA 4NZYA 3TR0A 4XVQA 1DAIA 4HLQB 1OH5A 2JJ8A 4YDHB 3T35A 1SVMA 2GZHA 3DMNA 2V1UA 2D3WA 4NCHA 4A0FA 8OHMA 1Q21A 4LK2A 4ON9A 1OT3A 2J45A 4X8LA 5FPTA 3SHFA 3ECCA 4TN1A 1KI3A 5HCNA 1ELOA 2ZVQX 2XNDA 1XD2A 5DN6D 1G8YA 2ZRJA 3GLIB 4KI0A 1V43A 3CPJB 4DRZA 1TTTA 1U0LA 2ZJ2A 1SQ5A 1EESA 2QAGA 4HYYA 4EDHA 3GLFE 2ZYVX 1FP7A 2GEDA 2V1XA 3OE7A 2BM0A 5JJKA 5DLQC 2PZFA 2RHMA 5FTKA 3RHFA 3C7KA 2CK3D 1N6LA 1G5RA 1Z28A 4B33A 2P67A 2FSHA 3KZ1E 1F3OA 3X1YA 1EXMA 3Q9LA 1P6XA 4N0DA 2J3EA 5AWFC 1XCMA 3X1ZA 2JGNA 1DOAA 2RGBA 3U61B 1KI7A 1NF3A 2IYUA 2WJJA 3SQXA 1II9A 3A36A 1BS1A 4RZXA 3U7FB 1XMVA 2O5VA 2RGCA 5HCIA 4XIGS 5TB5A 1IY1A 1XPRA 1XB2A 2EFEB 2GWHA 2BM1A 3PUZA 2VP5A 2WWYA 2H17A 3KQUA 4ZV4A 1L8QA 1U0HC 1CJTC 3TNFA 3Q72A 3BORA 5B58C 2RAPA 4V0ME 2IYRA 2AWOA 1E69A 1NIJA 4LV5B 2WJVA 3W5IA 4Z54A 4FW9A 4RSGA 4AYXA 1ZD1A 1G6HA 1E0JA 1M6NA 4L4UA 3RS4A 1VCNA 5LB2A 3W5JA 3TAUA 4LJ7A 1E2HA 4B32A 1G5PA 2GCOB 5JCZA 2ZANA 1TEXA 4XSHA 4A0GA 2XEXA 1OIWA 1P2TA 4CVNA 4TMKA 3P4YA 1RW4A 1W5SA 4NYJR 5JI3E 1KY2A 2J1LA 3J81k 3WYFA 1DAKA 2H1LA 4MH0R 5FBLB 2VEDA 4ESHA 1P5ZB 3FPAA 4RKEA 3O47A 4ZDIA 3AH8A 2X2EA 1N6NA 1T9HA 1HQCA 4KBFA 3SFVA 1KDRA 4WW0A 4B47A 3KQKA 2ZRIA 5KO2A 1WDTA 4B3FX 2RKOA 4BLQA 3CWZA 4GZLA 2RHDA 4RVCA 2PLFA 3WMEA 2JLXA 4WBSA 4B3CA 4JIMA 2GTPA 2J41A 1YQTA 1Z0JA 2O52A 1JPNA 1M34E 2QT1A 4Q4JA 3R8CA 1KK2A 1XEFA 2Z4SA 3IPYA 2ZE6A 4QHSA 2BJWA 2BCGY 2RGGA 4LJ6A 4LSGA 4F93B 3RABA 3QI2A 1TNDA 2WM9B 1W0KD 3DDCA 1KI9A 1Z0DA 4TMTA 3KQLA 2NOAA 5SZIA 5GVRA 1TU3A 4QBFA 1AS0A 1FNNA 2Z83A 1QVAA 4V0LA 1E1RD 4NH0A 4UNRA 4IDQA 4D4KA 2D74A 1T91A 3VAAA 4ASUA 3KDSE 3W6PA 4LV8B 3X2SA 3N70A 3B9QA 1QHNA 4YXWA 1XXHA 2WWGA 1J2JA 3RWOA 1E2DA 3AKDA 4LBVA 5TXGA 1M2OB 1VPLA 3T12A 3KKOA 1P9WA 4LHZA 1R6BX 2CNWD 1IN6A 1DG1G 3BAFA 1N0UA 1JAIA 3RYTC 4CF7A 5KSYA 3FOZA 2YVUA 1OB5A 4ZCMA 3FMPB 3LDAA 3TGPA 2PLRA 3RC3A 3K0CA 5B64A 2O8BB 2QE7A 2D7CA 2QL6A 4O3MA 1GL6A 3QENA 5JRZA 4Q4AA 3PUWA 1OFTA 1W2HA 3B1XA 5BN4A 2RGEA 4WAUA 4ZCIA 1FX0B 1P73A 2B8WA 2WMOB 3RRMA 3FMOB 1R0XA 3B60A 3QKRB 2FNAA 1OXTA 3B13B 2I3BA 4CRWB 2IS1A 4OHXA 1KHTA 4LBWA 4Z1MA 3LX5A 1CR0A 4O2LA 1W7AA 2J0SA 1Z08A 4KAXA 5DYGA 1Z2CA 3SS8A 1DBSA 1P9RA 3H0KA 4DT1B 4B75A 2QZ4A 4F4IA 2REOA 4GBMA 3OIWA 1LNZA 5A0FA 1KK0A 5JWRA 1U0JA 1L7VC 4PHFA 4DB4A 4R7ZA 2J0UA 3TK1A 2PCLA 3H84A 1E99A 1KDTA 1ETUA 1O3YA 3CF0A 1NL3A 4ZIRB 3CNLA 1G6OA 2CJWB 3BB3A 1LFDB 3ND9A 3W9YA 5C4MA 2EYUA 3U6KA 5CJPA 3M0EA 1Z6YA 4CEJB 5KHOC 5DYIA 2YNMA 2VPPA 1N5JA 2WKQA 3UMSA 1F48A 2IW3A 3NEJA 4Q47A 4TQAA 2CEAA 3ZD7A 1EGAA 1OYYA 3ICEA 4H1VA 4QFMA 2J7PD 2JLQA 3ASYA 4JLBA 2W83A 1W48A 3SNHA 2FSGA 4BRWA 1KZ7B 4NL4H 4QNMA 2JLYA 3AF1A 3X1XA 2UVQA 1NBMA 1OXXK 1DO2A 2C95A 4LJ8A 2CCJA 3LVQE 4TL7A 1EFCA 4QBGB 4QL3A 1EWRA 3AKEA 3L0PA 4LRWA 4Q1EA 3ZJYA 3B78A 3BXZA 1E0SA 1GL7A 4YONB 1N5IA 5TARA 3MGCA 1NBMD 2I1VB 2PJZA 1FPMA 3I32A 421PA 2VF7A 1Z6XA 1FTNA 2R62A 2YV5A 3MLEA 4MITA 4DVGA 3AGQA 2Q9CA 2IUUA 1F2UB 4FIDA 3B82A 3JZAA 5DIFA 5FOSA 2GCOA 2IYTA 5HE9A 5G3YA 1TQ2A 4F92B 1QZXA 3RLFA 4OHYA 3CX6A 4IHQA 4NMMA 4XVUA 4OJKA 1UKZA 2P6RA 4TLEA 1PV4A 1FMJA 3B7GA 4M21A 3GPLA 1W36C 5BN5A 2O8CA 3MSXA 4AWXA 2VO1A 4PPGA 4W5HA 2I4IA 4HB0A 2DWOA 5KDOA 4Q48A 4B44A 4GZMA 2YOFA 1ODFA 1DAHA 1PJRA 4AKHA 2YC4C 2Z5FA 5FTJA 3NHAA 1I2MA 2EQBA 3QPUA 5FOTA 5E3HA 1CBUA 3BWDD 2ODBA 3THWB 4G5OA 2KSQA 2GF0A 1IJFA 1GSIA 4NYIR 2HYIC 5TMPA 4WZBE 3WY9A 1EFHA 4GFDA 1OHHA 2WIAA 5JSZB 1YRAA 1UADA 4YMSA 1KMQA 5TY0A 5IF9A 3ADBA 3CNOA 2A5JA 2CHGA 2YWFA 1RVDA 3KXKA 3U3OA 1NRJB 3M4YA 3VX3A 2C9CA 4NYMQ 4MRSA 4Q7LA 4PC2A 5CDFE 1DELA 3DM5A 5JS7A 2IHYA 2GVZC 2OFWA 2NTYC 3ZVRA 2KWIA 3CNNA 3OEEA 4LJ4A 3CM0A 1GKIA 3EZFA 4C0AC 3GJ4A 2Q9AA 2QM8A 1NVUQ 1Z6AA 1HT1E 1QHSA 2ZR7A 2ZRAA 4KITB 1ZC3A 2VHQA 4M4SA 3RRYA 2ZE7A 1J90A 1Z29A 4DLVA 2ZRCA 5BWMA 3QUSA 2WOOA 3AVXA 2BBSA 3PCRB 2JIZA 1OW3B 3ZH9B 3NH6A 4QJ3A 4U5XA 4Z8XA 3R7WA 2BMFA 4FD2A 4D26A 4ERNA 2AL7A 4Q02A 2DR3A 4DZZA 2ZYUX 1P9NA 2KJQA 4RFVA 2GNOA 1F60A 2VF8A 4UQOA 5LBIA 1R8QA 1D2EA 1CTQA 1Q0UA 1VCOA 2RB4A 3CRRA 4PTLA 2AXNA 2V4ZA 3AF4A 4MYHA 2PJRA 1PZNA 2NPFA 1LF0A 4HAWA 3CH5A 2WV9A 5JCPA 2IYWA 4QOSA 3NC0C 2PMKA 1P3JA 3LLUA 4P32A 4XWOA 2JLUA 4PC6A 3OZXA 4LHXA 3I1FA 4C7OB 1Q22A 1M74A 2O0HA 4CGZA 1J7KA 1KKMA 2XJ4A 4ILEA 2J5XA 1EG7A 2YWHA 3NIBA 2ZI5A 2RGDA 5EP2A 3KJHA 2IUTA 1M7GA 3F3YA 3QXJA 2O8BA 2IK8A 1E9BA 1E0KA 3C8UA 1TADA 5EE9A 4B43A 2YJTD 1C4OA 1T5LA 4M53A 1KK1A 4ZI3A 1K5DA 1FFHA 1E1QA 1NMYA 1AQUA 1VYUA 5H68A 4US2R 2C5LA 1NVXQ 4HSEA 3GLFB 1F2TA 4QC2A 1QDEA 2J9RA 3QKRA 1GDDA 4IEIA 1XD8A 3CR7A 1DPFA 2RGXA 2P3SA 2HF9A 2JJ2A 2A5DA 1M8PA 3RRZA 3QG5A 2ZRNA 2BMEA 4HAUA 3IO5A 4BRUA 3UMFA 1QHYA 3PEWA 1ZCBA 3EIEA 1MH1A 1X6VA 1GL9B 4NP6A 1W4CA 1AZSC 3C14C 3AGPA 1CR1A 3CF2A 4G5SA 1YR7A 4JVSB 4WIAA 2FJUA 2ZRKA 3K53A 3LBNA 2K5UA 4QNRA 4DB2A 5D3MB 3VKWA 4JKIA 1VG9B 2GJSA 3ZS8A 2PEYA 4US1R 1CIPA 1E2KA 2X2FA 3L82B 4ZCLA 5KNCA 1TL7C 3WBKA 1JEDA 1ZAKA 2C77A 4QG7A 4DLRA 3SI7A 2G9NA 4TMZA 2RGNA 1KI6B 1FX0A 2X19A 1IN5A 3GEEA 1W0KA 1W46A 4DSNA 1GRQA 2BEJA 2PMDA 1X3SA 2F6RA 1AQYA 1A4RA 2W2TA 2WKRA 1F2TB 4HLDA 4E03A 1KMHB 2JATA 3IUYA 3M6AA 3OAAD 2JDID 5LD2C 2OFOA 1IXSB 3E5HA 3P20A 2F55A 2XTNA 3IEUA 3L0IB 1Z0AA 3UATA 2XITA 2A5FA 4LDJA 2ZETA 1SXJE 1U81A 1K5GA 1W49A 1SVOA 4LC1A 2AFHE 4HDCA 1E2JA 1W36D 1MRNA 2EFGA 4QXAA 2OSBA 2EWWA 2VHTA 3KFVA 1XMIA 4M8NE 4WXPA 3Q5EA 4AKGA 3GLGE 1PUJA 3HYRA 2P5TB 2WHXA 3EXAA 5CK4A 1GNQA 4RD2A 1E9FA 4BWYA 1W5TA 1A2BA 3TVDA 1G3RA 1OIVA 1COWD 3NDPA 1CXZA 5H70A 2ANCA 2VP6A 3IPXA 3EZ9A 3K70B 2D2FA 1S4QA 2R6DA 4D82A 3ASZA 2QUZA 3IIJA 5AUOB 4P31A 2CMKA 2F1HA 2PL3A 4I1VA 4C0LA 3MJHA 2IX3A 2VSOA 3CPHA 3X1WA 4PAQA 2OCPA 3B1ZA 4IJMA 4NTZA 3LA6A 3EWSA 1Z06A 2VQSA 4I81A 4HUQB 5EZ5A 2WAXA 5CIQA 1IJEA 4M1YA 2XZLA 2IS6A 1NBME 4ACBA 4EAQA 2VLIA 5H1YA 1XD2B 2HJVA 5EE5B 2R6FA 4MYTA 1E2FA 5TV2A 2D62A 1OXUA 4DT1A 2VHJA 1XEWX 2XSZA 4OI2A 5DHAA 5SZJA 5IRCD 5C2JB 1WE2A 2ATVA 3ADKA 2E87A 2J59A 5KSOA 3UWOA 1LW7A 1GVNB 4DHEA 4V03A 2ONJA 3RS2A 4D25A 5CIWA 1Z0IA 4GOKA 2QORA 2QMEA 2KE5A 1X86B 5J4HA 2FWRA 1OV4A 1JEEA 4JT2A 3SZRA 4LJ5A 4U02A 3WP1B 2OFXA 1SKYE 1U8AA 4MGYR 2ERXA 3R9XA 2QBYB 3LX8A 4TQ9A 2Q6TA 2OG2A 3FMIA 3Q7PA 2OT3B 3SQWA 2GCNA 5JHHB 1NN0A 4WZAE 5KSZA 3PXGA 1YHNA 2BBWA 4MRVA 4QJ5A 3MMPA 4NYMR 1UAAA 4TSFA 3B85A 3A1SA 3HU3A 4HZUA 3AF2A 2MSEB 1U94A 2O8DA 2F1JA 2OBMA 3EC2A 1QG2A 3GLHA 4JL6A 4KV9A 4L16A 4NHOA 3GLHB 2C03A 1AM4D 3VKHA 5G53C 1FMLA 4B76A 1P75A 4R98A 2QTHA 1SULA 2OBLA 4KYIB 5EXSA 5FTLA 3O8RA 4IOLA 4Q9KA 3GJ7A 1AK2A 2AK2A 1G4UR 4K46A 4JBXA 4M22A 2B92A 4G01B 4URWR 1GNPA 1G16A 4PPFA 4RD1A 4RZ3A 1H8ED 4TT3A 4PXAA 1S9HA 4ZPXA 1SVKA 3BRWD 1NY5A 3D3QA 2HT6A 3BK7A 1AZTA 5CM9C 2RH5A 2AR7A 4CEHB 5KSPA 2EW1A 1GFIA 1HYQA 1PLLA 2QROA 1ZINA 1VIAA 3K1JA 2AN9A 1CS4C 3K0FA 4FCVA 1Z3IX 5FL7A 3A37A 2CBZA 3EZ6A 4FCTA 4LY6A 5JJIA 5K8UA 4WZ6A 1GP2A 2LKCA 3OEHA 4NONA 5F3WB 3K09A 1NG1A 5JJLA 1MT0A 4DBLC 1G41A 1RYHA 3AP3A 2Q3HA 3I92A 4J0QA 4BUJA 3B5JA 3AVUA 3JVUA 1R7RA 4RD6A 4M1SA 1LF5A 4M1WA 1IBRA 2VHCA 4BZQA 4MYUA 4Q00A 4UXJA 1OE0A 4AY2A 4RZUA 1CR2A 1QHHB 4L5BA 3AKCA 4Q4AB 1KSFX 2ZS8A 4IVRA 4QHTA 2FSFA 1IQPA 1OF1A 2BCJQ 4ITRC 4LHWA 3OE7D 1EX6A 3T1VA 4Q03A 2YC2C 1RJ9A 2OBNA 4QBHA 2ZXUA 3REGA 1QBKC 1AS3A 3SE0A 5IK2D 3EPKA 1ZJ6A 4IEEA 3E70C 1YZGA 3MWLA 3IQWA 4JLDA 4S35A 1MV5A 1HURA 3AVPA 2BWJA 4OHWA 1JI0A 3U60B 4FWIB 3K9GA 3R8FA 4M1KA 3OIUA 3KUCA 3U7HB 3BD9A 5JWOA 2BMJA 5FOWA 1HQYE 4QGHA 3BOSA 3R9WA 2BEKA 4Q18A 4AKEA 1XZPA 3FDIA 4JL5A 2VP2A 1WBBA 3PUYA 1XDBA 1CRPA 2GHIA 1RZ3A 4C0QC 3CR8A 2IUSA 1ZMXA 1TQ6A 2FA9A 1OLOA 1AA9A 4A4DA 4B6EA 5FBQB 4B71A 1CKEA 1H8HD 2V6JA 2WWWA 4V0OA 4L9WA 4BQSA 1KAOA 2VA8A 1CJUC 4LZZA 1MRSA 2PZEA 1US8B 4A9AA 4Q19A 3HWSA 4MGKR 4JSTA 1NI3A 4HB4A 4A1FA 1X8KA 3VR4A 1XFAA 2ZI4A 2PT7A 2V6IA 4MRNA 1NJFA 2FPMA 2RGAA 3LQRA 4EPWA 2JLWA 3MUFA 1C1YA 3ZVNA 1S1CA 4PSAA 1P2VA 1P2SA 4XH9B 5KDDA 3A8TA 1FZQA 2FX3A 2Q9BA 2FGJA 1R10A 2REXB 3U5ZB 1ZNYA 3RWMB 5F9HA 1XX6A 1TMKA 2REBA 2H8KA 1KOFA 2HLDA 3UXMA 3IKJA 3B2EA 1KK3A 1CP2A 2IS4A 5KOYA 4GOJA 4JSYA 1ESNA 1N5LA 3A4NA 4X8OA 1KJYA 1XPOA 4Q9HA 2DB3A 3AVVA 4KO8A 1ZYUA 1SHZA 4HDQB 3GLFA 2H7VA 1NJGA 1JALA 5FR1A 2Z43A 5J4LA 1G3IA 2W6IA 1QRAA 1YR8A 3CRMA 4LCBA 5L3SA 4DCUA 1U9IA 1YE8A 3IILA 1F5NA 3ZGXA 2F43B 1S9DA 4MKFA 1LV7A 1NN5A 1NP6A 2HEIA 5E7IA 5EE3A 3TE6A 4XD7A 2ZJ5A 2IWHA 3MRSA 3QKSA 3MJRA 4HZUB 1JQJC 1HY3A 3QKSB 4GMXA 3AB3A 2P65A 4I99A 3THYA 3UG7A 3PG5A 3SBEA 2GJ9A 5FL7D 1KO4A 3THXB 5TDHA 1VECA 1T5IA 1RFLA 2UZ3A 3O8CA 5HKKD 3LVRE 4G1UC 4JLOA 3TBKA 1J8MF 3MD0A 1JB1A 4EUNA 4KHZA 3CWQA 3TSOA 3W3ZB 1G17A 5AJZA 2QEQA 1T0HB 4LX0A 1XTIA 4X8MA 4M2LA 4NE2A 4HI0E 3VR2A 1TF7A 2QRZA 2XOKD 4M9XA 3SYLA 3A4LA 5D3QA 4N0EA 3LBIA 4DC9A 3EIHA 3FYHA 2WPDA 4E07A 1E9DA 3FGNA 1NN3A 2KBFA 1I4LD 2BVNA 2FEMA 2HJGA 2IXEA 1ZBDA 3AKYA 3K0AA 3EZ2A 3NG1A 2SHKA 2JAQA 3VU9A 4BFUA 2ZRMA 2ZEJA 1GOTA 4TYQA 1BOFA 3SC3A 2OXRA 3E2IA 5EQTA 3IIKA 3AM1A 1G3QA 3ZS9A 4DDWA 2FEOA 1P7CA 4RD3A 3AVTA 1KO5A 2R6AA 3V4RA 3LW7A 2XNSA 1E9RA 2FH5B 1E9CA 1E2QA 2WAYA 4IDOA 2ZSEA 2FPLA 3PEVA 2ZQ5A 4DLSA 3TUIC 1CF4A 3GLIE 5DNYB 2RGNC 3KXIA 621PA 3GEIA 1FQJA 3OEHD 3WRYC 4DLZA 3K0SA 1HA3A 5HZKA 2CXXA 1I4TD 4PAMA 2J0VA 2RMKA 2W2XA 4NKRA 4HUQA 1DS6A 4BZPA 3WBJA 3Q8XB 2QSZA 3K0AB 2N1BA 4JJZA 3F5FA 4RFSA 1W4AA 1R2QA 3ADCA 1DG3A 1EK0A 3U4QA 2IWRA 5FI1B 4NYIQ 1G3UA 5AK0A 3PV0A 1RIFA 4LHYA 3GMTA 3CO5A 1ZNXA 2CCKA 2OCYC 2ORVA 1NY6A 4EQ6A 5FL3A 1A5TA 4LPSA 2J46A 2PCJA 2DWQA 1O87A 2BJVA 4JT4A 1M1YE 3TUJC 4FMDF 3EWAA 1GNRA 1R5OA 3AF3A 2ZUBA 2IYVA 1KY3A 3QSYA 4QGFA 4MRPA 2ZE5A 4US0R 3NWJA 2A30A 4EPYA 3EASA 3GQBA 4JMPA 1OH6A 4ZDJA 4KODA 1DADA 1MO3A 3T1OA 2ZAMA 3TAHA 2IYYA 1COWA 3T5DA 2F1RA 1R8SA 1VYTA 1G8FA 4HZIA 2JA1A 4LV6A 4Q7KA 1NKSA 3ETLA 4ZDWA 4IFEA 3QF4B 4CT5A 3FMFA 3VQTA 1DVRA 5ELXA 1GG2A 1BH2A 2R65A 4PR0A 2ZYTX 3CUEF 4BLSA 4JBYA 4M1TA 3HU2A 2ZITA 1U90A 1XRJA 2O8DB 4I1UA 4CZ2A 3L8YA 5EXPA 2B21A 2LCFA 4AG6A 1T6NA 2ZJ8A 3KJEA 1TF2A 4JL8A 2FMXA 4DLTA 1HEIA 4OK6A 2GAAA 4XWKA 5D3MA 2F7SA 2CNWA 1UKYA 1S8FA 4WXRA 2FFHA 3AUXA 3OAAA 1RRPA 2Q3MA 4JVMA 3W90A 1DO0A 1QHIA 2IYZA 2ZR0A 2XXAB 1ZRHA 3WMGA 2GZDA 2O8FA 4Q9IA 2PX3A 3OF5A 2GRJA 1ZIOA 1NIPA 4Z8YA 1WQ1R 2JLSA 2WJYA 3H1TA 1SXJD 3NVAA 1KO1A 4DCTA 1CRQA 1LB1B 1XEXA 1DTSA 4LC0A 1E3MA 5BW8A 1UM8A 3PUXA 5GJBA 2QP3A 2DFLA 5E4FA 1E9EA 1ZM2A 4HAVA 4N3NA 3V4FA 3VFDA 4R71A 1U2RA 4LGMA 2WTUA 4Y0AA 4OQNA 5A4JA 1RRGA 1OH8A 2XB2A 4C0JA 2PZGA 1E0AA 2MSCB 4DSOA 3TSZA 3TH5A
chains in the Genus database with same CATH superfamily
1QZUA 1P39A 2BONA 4AF6A 4B7ZA 5JLAA 4RCZA 1K7EB 1IBMB 2I2AA 2OPHA 3K15A 4XB1A 1C9KA 1GTVA 1EDOA 1GN9A 2H1IA 3TI7A 3WP0A 3X44A 2IL1A 3PJDA 5LZ7A 4EIWA 3X2EA 3T3GA 2VQEB 3JZFA 4G9BA 3FIJA 3X43A 3EZXA 4DLLA 4KPUA 3FTFA 5EN4A 5FULA 4P7BA 1C80A 4HUTA 2FR8A 1KNXA 2CWDA 1LX6A 1SBQA 2H92A 4GF5A 1IHDA 5BSVA 2XE6A 2X23A 3KYCB 3TMKA 1X1BA 3S3TA 1CWUA 1WZEA 3L0SA 3EXHA 3NTUA 5CLIA 1IY0A 3SQMA 2PJDA 1ONPA 2XB8A 1BE8A 1NZFA 2YDXA 3IXLA 4BP3A 3W7AA 4FE3A 5DFAA 5SICE 2P6RA 2Z04A 5DI9A 2VSFA 4RTOA 2FQXA 4IIXA 3FB4A 4U7HA 3K31A 2O5RA 1AQ6A 3O1HB 3RS5A 2GUWA 1PTJC 3DKPA 3KFXA 4FYMA 3WX0A 4F45A 1VP3A 5HEKA 3RHSA 4D9IA 4OQMA 4OO3A 4C21A 5CBPB 2DP4E 1W0JA 2WDPA 2Q2WA 4EB3A 2OM2A 2E48A 2ZB8A 3QEMB 1DWOA 5E2IA 1JJAA 4KPFC 2HU8A 3EIOA 3GT4A 4PQYA 4D0LB 2X58A 1XHEA 1Z2AA 5EINA 2PYIA 2BP7A 1SOAA 2GDJA 2H7YA 3JPYA 3KHUA 2ZCJA 3DV0A 4KGZA 1E60A 1DDIA 3Q11A 4YPVA 3PVSA 4IKEA 4AQ7A 4B8ZA 3KBOA 4QVKA 1J0BA 5AHWA 4W7HA 4PS1A 4NCXA 2ZSUA 3N5KA 4QUAA 3K70C 3A7DA 1ZX1A 1K88A 2JFPA 3IEMA 4D41A 1GY8A 2XMBA 3D4BA 2AXPA 4IIJB 1Y9EA 2FGKA 1VZ2A 2DSNA 2Q99A 3CLUC 3FNIA 3UAVA 3DDUA 1WLYA 4HUJA 4R5HA 5CYFA 2GFQA 5LM3A 4WQMA 1ZNWA 4EJSC 5LU9A 5LZ5A 4BFSA 1KMMA 5I47A 3MD9A 2JGRA 1NOIA 4XQEA 1SZPA 2GDZA 2JGEA 2QY9A 3H5WA 5GGYA 1HDXA 3F7NA 3NBUA 1PLJA 3SZGA 3ZVMA 3EG9A 2II6A 3W04A 4ECAA 4ZKDA 1VRVA 4J1SA 4FOOA 4X84A 2LIPA 1OKKA 3TLXA 2CYCA 2R1TA 4PHTA 3UK0A 2WHQA 2PLAA 3KPJA 4IV8A 4WBXC 2DLCX 1S96A 2WI8A 2HHJA 2WZQA 4AZ0A 1BX3A 1SD2A 1NXPA 3QVGB 4G8JA 1PTJA 2ZI3A 3ESCA 3AJEA 4MIKA 5T6MA 1GZDA 4N9WA 4RK6A 2GRUA 3QPDA 4B46A 4LJKA 3OZGA 2ESRA 3C3CA 1DKPA 1RRVA 1EINA 1JJVA 1DRKA 2IF0A 1OXBB 3ZWVA 4QKQA 4JBGA 4P4SB 1JWLA 4NCKA 1RKUA 2OSVA 1D09A 2ZSFA 3ND6A 3DD5A 5F3DA 5TJ9A 2H5EA 4BKUA 4EFMA 4I6GA 3UHPA 3T4PA 1Z4PX 5EQJB 4I4IA 3TIIA 4FHCA 1AGPA 1JQLB 4I4TB 2Q62A 4JA0A 3ZZTA 4BCCA 1N2SA 3BERA 1YS4A 4X66B 2OORA 4RVOA 3VHLB 3V97A 1LBIA 1AKTA 1E0DA 4QUKA 2CEKA 1B8NA 3LXXA 4I7EA 2GB4A 1DC6A 5TVKA 1BWRA 1J8DA 2D0OB 2OZLA 2QQ5A 4XPIA 5DP2A 5FAXA 1YKSA 2J9FA 5IU6A 1FS5A 4ND4A 2QRHA 2DT8A 2V7XA 2I65A 1ZU5A 2PLWA 4FPXA 3GUYA 4ER6A 4TYYA 2LXNA 1VQ1A 3A2LA 2AG1A 3G9UA 3V48A 5B36A 1F12A 5JZVA 3EIQA 1NJ1A 4H3KB 3NBKA 4O2AF 3R7WB 4CTMA 3FFAA 4MW2A 1D6JA 3EEOA 3NOOA 4E5YA 4CUZA 1E79A 4RQBA 4G89A 1PEKE 5H16A 2AXQA 2V7UA 2GO7A 1W1IA 2XDYA 5KC8A 4XARA 1XNHA 5IASA 3IRVA 4K7JA 4N3CA 1A2OA 1H5UA 1QNLA 4LXYA 5KU1A 2AKEA 2D2IA 2GUGA 4QGSA 3MN1A 2MINB 3G17A 3HQ4O 4II3A 5JI2E 3E03A 5K4HA 2AUNA 4GM4A 1JFVA 3QUQA 1VLMA 1BGXT 1WF3A 1UQTA 1VPVA 2YV3A 3RJZA 3GVCA 4YS6A 2OVFA 3T5BA 3VTKA 1D1TA 3VOSA 3WB1A 4DANA 3CLRD 2A9PA 2IVFA 1AT1A 1D5CA 5ALIA 1L1RA 4RAQA 3UK2A 2FZCA 2IJGX 1D7OA 4OIMA 3IO3A 2MJLA 3M1IA 4FFDA 4ZYLA 3FD8A 3OQHA 1QMGA 2C5HA 4K9MA 1H1LB 4E08A 2WIKA 4WNCA 5G3ZA 4OHVA 4NBUA 4U0KA 3ZU3A 2Q1TA 3P0EA 4P80A 2GA8A 3K09C 5HF8A 1KI6A 2G88A 5DB4A 4D4GA 5A3JA 4WWHA 4JUDX 1DEOA 2OORC 5AJVB 5SZKB 1DARA 1LDYA 5DBHX 1H65A 1CRPA 1UANA 3OEYA 1J1ZA 3CKLA 4LY0A 2ZAIA 4WD3A 5HKKA 2X13A 2YWDA 3GFPA 5JH7A 4L7QA 3T7IA 5KJFA 1YMVA 5BWNA 2IEBA 2PGDA 1C3VA 2XRYA 3FPSA 3DONA 1FL9A 4BKMA 4KLNA 1PJZA 2CFRA 4RVUA 1CE8B 4AJEA 1Y6JA 3ZYCA 1C5KA 1QX4A 4YT8A 1CUXA 5B1DA 5J5CA 4R0VA 5A5GA 1J5EB 3UMRA 4GKBA 2FY8A 3PR1A 4RUKA 3GA5A 3BIJA 1Z4MA 1TEVA 3NBXX 3LRPA 2V8BA 3ADPA 1DE0A 1G60A 3C8MA 5ANRB 4ZMBA 5KJ1A 2HWKA 3PRYA 4RJTA 1M73E 4IVPA 5EHQA 5K3OA 1ZXXA 4NNJA 1G1MA 1IE3A 1NRIA 2JHFA 3D6UA 4MUYA 4NV1A 4DXHA 2YY5A 5AM1A 1PK9A 1CLUA 1FQWA 3ND8A 1UMKA 1Z5WA 1Q3TA 2EYQA 4MV1A 3EPPA 3JARB 3UJ7A 3WSTA 5J43A 4V0KA 3FX2A 4I19A 2WNHA 3EXG2 4PXSA 1EJBA 5F1OA 5EQDA 5HDBB 4PFJA 2HX1A 2VF5X 4KP7A 3DFFA 5AKEA 1FVXA 3TB6A 1LS1A 4X0EA 5C80A 5F2NA 5AVUA 5DGTA 3L7CA 2IOFA 3WZMA 3GFOA 5JE8A 1UBHS 1CJKC 3K4PA 2CUZA 3VUEA 3ZYZA 4KZPA 3ZKAA 4YJHA 2EDAA 1U04A 1MZVA 1BVHA 4J6EA 1YCFA 2Y2VA 5JRDS 1XXLA 4HRYA 1EUCB 2FZVA 2C2YA 2C82A 1USWA 2HPVA 3S1AB 3ND5A 2V7BA 1V5GA 4HNVA 2F64A 4IOKA 3BHNA 1HE1C 1YB4A 1E6UA 2W6JA 5F5LA 3I01A 3CH4B 1T3ZA 4ZOLF 2GN8A 2NAPA 3OJOA 2FPPA 1TGVA 5BN1A 3ZWMA 5EJ7A 4QSHA 1KQOA 4G67A 2VQFB 4REOA 4DV0B 1FJGB 1U5BA 2IA5A 2BKEA 4DNQA 5KNDD 2YYYA 1MJHA 1W35A 3C3MA 1NULA 2WD9A 3DULA 4KRXA 1J56A 5BNWA 4DUGD 5J23A 5E1DA 1IZ9A 2ET6A 1M1ZA 1PR2A 3EVZA 1NVBA 5IHPA 4F4UA 4PO9A 5HTKA 2O1SA 3B9PA 1AD2A 4TLDA 4V2UA 5AI9A 1CUCA 1XL0A 1T1GA 1GRCA 4NZ9A 1CHDA 1K4MA 2ZB7A 1IJBA 1NP7A 1QG6A 3D6MA 1B16A 3OIDA 3RVSA 3EJWA 1GTZA 1QVZA 1F38A 4XW2A 4GUAA 2QQEA 3OZRA 4KBGA 4NEGA 1DXYA 4FFBB 2MT9A 5BQPA 3AJ8A 2CJXA 1SQSA 3ZGOA 4BB6A 3SIWA 1XWWA 3VU8A 1E32A 1RQXA 2VH5R 3M9XA 2QTMA 3BILA 1GLGA 4MUIA 2VUIB 1EK1A 3CQ9A 3OCXA 1BEEA 4CKBA 1GTSA 4CLOA 1ACJA 3BRCA 3GP3A 7YASA 4MA4A 1KA9H 2Q0SA 2HMAA 3LL7A 3OT4A 2V65A 1DBWA 1H4QA 2P9JA 3UWSA 4KIJA 2E9SA 2I6SA 4JEIA 3RGWS 4Y6OA 4DIFA 1ULZA 1M2FA 1R4MB 5KYWA 2C2GA 1TC2A 2BKUA 2OFPA 1STOA 1ZIXA 1RYEA 2YRXA 3OO1A 4BNIA 2G3YA 5IG2A 1XJQA 2PUFA 1GYPA 1VKZA 3E9NA 3JXEA 3K2BA 2VFAA 4NBRA 4N8DA 1LSOA 1GTL1 3KVRA 2B20A 3U3KA 3V4VB 3MCAA 5E8JA 2N0SA 4KH1A 3TQOA 2PIAA 4DR1B 5LJIA 1EHIA 5GJCA 3GLTA 3HYTA 3AEUB 4EEZA 2QTVB 3C98A 4LZPA 2OM6A 3R7DA 5AJYA 2C9BA 1SUPA 5IJAA 2A6PA 3QG1A 4M55A 1WQ4A 2VWGA 1TAGA 1DINA 1CY0A 1N2CE 2C7PA 1FYDA 1O8BA 3W3AA 5AOCA 4EF4A 3N2GB 4IMIB 4HVTA 4LGCA 1HG1A 4OU4A 4GMDA 1REQA 3ZW7A 1YJCA 1UPTA 1NVVR 2AEJA 3VZCA 1VGVA 4AIRA 4YRFA 2PVCA 4JC0A 4L0MA 4AKIA 4LN1A 3LCCA 3H8JA 4LDRA 4D46A 3HCDA 5FO1A 4OV6B 3MS7A 4YT4A 4WZBB 3NBFA 1XZBA 3R76A 5DT9A 2XSZD 4BO7A 5DM0A 3EOBI 4IIGA 4EGFA 4AJ4A 4XB6B 2XUIA 5LLTA 3FVWA 2BISA 4RF2A 1F2UA 2VDMB 3M83A 5J5VA 1RACA 3PEUA 5ES4B 3OUZA 5EP1A 3I5YA 5CDFA 4F4HA 2NZ8A 2BFEA 2YUTA 2E4YA 5ELMA 2ODAA 2EIHA 1AN0A 1FYEA 5HX7A 3PHIA 4OAQA 3NBYC 4MRMA 1L7EA 1NC3A 4U2KA 1UXIA 1IN1A 5LOVF 2C9YA 4LYHA 3D54D 1J21A 1LJ8A 2D8AA 3W2TA 2EKLA 5EA2A 2FEPA 3EC7A 1Q1AA 2C59A 5DHUA 4ABYA 5CEFA 1ZVJA 4URUR 2FSIA 3BMXA 4K81B 4R8MA 1IU9A 1K6MA 3H11A 1ZY2A 4K9SA 4JUFA 3HMKA 4QLAA 3T15A 3T54A 3V55A 4HYQA 3HJTA 3NRBA 2O1WA 2VUTA 3U56A 1LD3A 4BV8A 2NXEA 2W8BB 3EXEA 2NU6A 2VT2A 3J7TA 3U62A 1X1QA 4BTEA 4YJFA 3I73A 1KJZA 1HWYA 3OIGA 1KAHA 3NANA 3H04A 1T0JB 1VG1A 3GZNB 4ENWA 2AG5A 1CB7A 1JR3E 1OLXA 1WZUA 2FWIA 4FLEA 3VPFA 4Z4CA 1I51A 3PFFA 3CVXA 3DMTA 1VJ5A 1ZLXA 2JARA 3QJ5A 1C8VB 1SQGA 3RYHB 4YQZA 1OLSA 4CQNA 4I1SA 3DBHA 2OV8A 2W4QA 5KVSA 3EAQA 5E0OA 3W6UA 1J23A 3GJ8A 2Z57A 2GEBA 4BEWA 2YJ5A 2WP0A 1RM3A 1QE0A 3L7AA 4TKMA 3D4LA 1EUCA 3RSHA 4BVFA 4PZYA 3EZ7A 4TQGA 1KYZA 5J40A 4ENUA 2GT1A 2IUEA 4BX0A 3EEFA 3C74A 1Y8AA 1ZK0A 3JPWA 1H94A 3QVUA 4TWAA 3RANA 1UKBA 4BO3A 3JASA 4PFSA 1Z17A 4BFWA 4ZGWA 2JVIA 2AQHA 3LUHA 2FPPB 2J6BA 3E7DA 4HS9A 3WIDA 4LYGA 5I4BA 4HWTA 2V7VA 1DAOA 2C04A 4I4LA 4L7VA 1NLYA 2FPWA 4YC7A 2EATA 1LSJA 1GPNA 2QTWB 2XNKA 1RXIA 4BVAA 2QUBA 1NN1A 1SWVA 4S2EA 5BRAA 1KEEA 5EKDA 2Q0HA 3VDRA 5KSWB 2XNHA 1RVV1 4F5EA 3WAGA 5C3MA 2CV0A 1C7IA 1GPDG 3K0EA 3W6OA 3R4VA 5BN4B 1EVEA 3N0XA 2QUKA 1JR3A 2W58A 1PWZA 1FUEA 1TPZA 2N9UA 1E6CA 4K6HA 1KJJA 1NLUA 3DJFA 3K0BA 3SBDA 2XKKA 3VR5A 3BYZA 2L18A 5ADUS 2J31A 1L3IA 1BMFD 4F4FA 2WD7A 1XQ6A 1Y7TA 3GJXC 3L6CA 4LYDA 5JZMA 5TF0A 2CF5A 5COAA 5FJJA 3KJXA 2DY1A 3UHFA 5BN3A 2H18A 3G59A 4TM8A 2EZTA 1JKIA 3DT8A 4GRAA 5I5EA 4W9MC 4DA6A 1KFCB 1CUFA 2DFPA 4RWEA 5JUWA 1ZH6A 3DTVA 3KTAA 4YV2A 1UBCA 4CMIB 1ZHOA 2QTBA 3THYB 4ZQBA 1M5RA 4PAOA 4TUYA 4BE9A 1DJMA 3EMBA 1S6YA 1UBNA 1ZNZA 1TQ8A 3IAHA 1VG0B 4FQ8A 4PZZA 4R8SA 1XDGA 4U1RA 4D3FA 1BX1A 3UPUA 4KX5A 2WLSA 2WVGA 4EJMA 4GKAA 3O84A 4HNHA 1VBNA 3U3XA 2D1TA 1UF9A 3ZU5A 3N8NA 4Z99A 4KPEC 1Y1KE 2VT3A 2VZ8A 2ZQZA 1JN0A 1UC9A 5KINB 4OBXA 2FF7A 4DPLA 5IANA 1Z7WA 5FOUA 1LSUA 4YWHA 1LGYA 2Y0BA 1IUOA 1NWCA 2Q1XA 2X9GA 1Q19A 5AKJA 2D06A 1MENA 3EGDA 1XYYA 4NENA 4QU9A 3WYNA 2XGJA 3JD4A 2GNAA 3KOOA 1IFXA 2RHJA 4HRVA 1TF5A 2GEUA 4B31A 4DXAA 3SN6A 3INTA 4EHFA 4JQYA 4B4VA 4D74A 4E3ZA 5EWJB 1YQ9A 1JLMA 4A6DA 4ARUA 3QPVA 1ZISA 1XTVA 3GJRA 1KJ9A 5LYJF 1KJNA 4EVQA 2DH5A 3VRHA 4CM3A 1U3VA 2HWXA 3FCEA 2AMYA 3D5TA 1Q0TA 3EG5A 5KTPA 4YRSA 3NCTA 3Q6NA 5K05A 2OB1A 3IUBA 5JS2A 4IAOA 4RPHA 1JMKC 3AQ4A 3BULA 3OU2A 5IK2A 1P3Y1 2Q0QA 1RYFA 1SB9A 5GONA 2DFDA 4M1OA 1E7QA 1ZN9A 3PFBA 3QWIA 1LS6A 3NXSA 3K1AB 1FF9A 4GLLA 3UGTA 2JIDA 4M8IA 4UHEA 3ZIAD 4AZ0B 1KDVA 4BS9A 1WOMA 4EJSA 2PBLA 1VMEA 3J81A 1CQZA 1ZM7A 1ZONA 4D57A 1I01A 4P22A 5CB8A 1HRDA 1XFDA 3K2QA 3AONB 2D5BA 2BM8A 3RD5A 1D1SA 5K45A 2JZOA 2FFAA 4OQEA 1J00A 2PQ6A 2FCRA 3EDMA 3RJMA 4ALMA 4CG3A 2ARKA 1H8HA 2VJKA 1W59A 1L1EA 1R9MA 1FP4A 1NSTA 2NXNA 4YDSA 4QRIA 2DCUA 5BYKA 1CFJA 1R15A 2D1SA 1KXZA 3HBNA 4TVBA 3BMOB 5NLLA 5JVDB 3V3KA 10MHA 3IP5A 3Q3JB 1MABB 2ZTVA 3DCJA 3IDQA 3KVYA 3PP8A 3N59A 3QOWA 4RV5A 3EW7A 3RC7A 3U26A 1G98A 1SKYB 1VHJA 1CUJA 4P3NA 1JSLA 2VJYA 2BEWA 2Q4RA 2IPXA 2ZP1A 1Y8RA 3CLSD 1JV2B 4KE9A 3S0JA 1TT7A 2QN6A 4ZTUB 2VYVD 4XD7D 1BKDR 1FMCA 2PQMA 1OLUA 2CXRA 3TAXA 2BKLA 4FGWA 3WRWA 4E51A 4GD3Q 4N01A 3VV3A 5MFZA 3UHOA 2PLNA 3SJUA 3RO7A 1GRVA 2EP8A 1GCIA 3HKBA 3PEYA 1P0FA 5HSGA 2IVZA 3D9QX 2VDPB 1PTKA 1SURA 1E2GA 2KI5A 3U3JA 4EFNA 2I1QA 4RGVA 4AROA 5LB4A 2F4NA 4S04A 3WGVA 1QYDA 3QFSA 4HDNB 4TRRA 1E63A 3BA1A 3DHVA 3QMVA 4LSWA 4C4AA 2J9XB 4KHPB 3FNBA 2F43A 4HOYA 1KETA 1BU8A 5E7QA 1F8XA 4Q1DA 3MPUA 1BCRB 4B3XA 3IT1A 3HUDA 4DV2B 1WHSA 4ALNA 1PEDA 4Z4GA 4C4ZA 1KJWA 3R3SA 3CSSA 3TQSA 3B53X 3G0OA 1B0PA 1QTNA 1V47A 3IR5A 5FT9A 1WKCA 3H5NA 3KQPA 3OOEA 4OATA 2QE7D 1R5BA 3M5WA 2QV0A 1DT5A 4NZMA 1W36B 4B9AA 5FFFA 1IXZA 4B6SA 1OUMA 2UXDB 2B7CA 1HG0A 1UZMA 2QAGB 3ZN2A 5BQFA 4RPGA 4R1SA 2VSQA 3ZBUA 1Z5GA 4JEMA 4ZT6A 4CTKA 5BQ5A 4XFDA 3ANXA 2HWUA 1K06A 4IJKA 2O7RA 2BDTA 3UT6A 3WBFA 2AX3A 4GOMD 2B3TA 4CNQA 2BTEA 1TLFA 3MQFA 4I5EA 3OJLA 2G1PA 1B23P 2R8BA 2HIMA 1RMTA 1UPUA 4PQEA 2Y93A 3ENKA 3DLTA 1CEYA 2P1ZA 4RZQA 4ZYVA 3L4SO 1DEKA 3OIVA 3D3EA 2B25A 4LDPA 2XT6A 3B3AA 3ZGLA 1QO0A 2ONYA 1BEZA 2WTBA 4ZHQF 1GSOA 2EJBA 1JJIA 2ZROA 3Q3IA 1E8MA 4IXWA 4MI6A 5IN4A 2O3SA 4KMMA 3FHTA 4K9LA 4V24A 2C7RA 1OFHA 3HZZA 2BELA 2G5CA 2CF6A 4DTCA 3D0KA 3QBVA 1Q77A 1MB4A 1IULA 3M33A 4TMVA 5JEDA 2OBXA 2AKYA 3GDFA 3H9BA 3M34A 1W76A 1BDBA 2IY7A 3KSRA 4J0IA 1G5IA 1RCTE 2C07A 3E53A 3KAQA 3PNMA 4IF6A 4OYHA 4ZVVA 3TTUA 4GX2A 1DQNA 4F84A 2IBMA 2PUJA 2X0IA 5EY5B 5EE1A 3DP9A 4JI4B 4YDRA 4X91A 2PGIA 1GKKA 1NWHA 4O1MA 4E7OA 2AYYA 4AY5A 2YZ2A 4XGQA 2I76A 5BSMA 4LNUA 1G38A 1S89A 1TIKA 4N39A 3UPDA 1PEAA 1KRXA 1HETA 2I8CA 1JFTA 1XMXA 5BVHA 2AOUA 1OGJA 5T8KC 2NXCA 4JB3A 1GGFA 3AEQA 3ZI4A 4XRGA 3AF5A 4MEBA 2XUOA 3MS4A 4AG5A 3CNBA 4K9DA 5HG0A 1EFAA 4BDSA 1UBEA 1XVAA 4EX6A 3H9QA 5BNFA 1MIOA 2FUCA 1S8OA 2GM3A 1P0PA 3SJZA 1DBVO 2ZIXB 3T7RA 3GF4A 4IZ6A 1JEJA 5DT2A 4B48A 5EUQB 2XX3A 2ZM5A 1NMXA 2VHXA 3CYFA 1E6WA 3VC7A 4ENTA 4JDPA 1L4UA 4J94A 3EEBA 4BGIA 2VPWA 2R7NA 4QM7A 2QM7A 3LI2A 3CZQA 5IAEA 2J87A 3RSQA 1YULA 3WWDA 2B1RA 4Q4JB 4OI1A 3E1KA 4GUDA 3HBAA 4JYAB 4YCNA 2OXIA 1E98A 1LVGA 1NATA 4DNOA 8GPBA 2OLEA 1JECA 4IIUA 1M8KA 2P6UA 5DHFA 1R6DA 3EF3A 3ENNA 5BR7A 5CBKA 5UKDA 3JTMA 5E1OA 2UXBB 2C8LA 2MDTA 3IT2A 4ZU1X 4EF5A 5FDFA 4O2RA 3K1AA 3NP9A 4BBZA 4XJTA 3BCSA 3NM5A 4EABA 4MYRA 1L5VA 3EHEA 1X94A 3FHCB 4EJSB 5JAUA 4FDMA 1M0TA 3KQNA 1USIA 1G8PA 2VJOA 5JS8A 3HS3A 3LHSA 2J0QA 1CZNA 3SR3A 3SR4A 1C1DA 4Y6RA 1YZQA 2VJMB 2I33A 3B89A 1Z0KA 4M54A 3AG5A 3RUPA 1T1SA 1FPQA 4BZZA 1B3RA 3AUYA 3GP8A 5A2QA 2H1CA 3GEPA 3F6SA 1QHGA 2BOVA 2B61A 4L28A 2FFBA 2WVJA 3I4LA 3KLNA 3LT1A 1U7TA 4X1YB 3RLIA 5M04A 1YQUA 2HPZA 3KAJA 3HB4X 4FYIA 1E18A 1N6PA 3A3KA 4H9GA 2IW1A 4MTLA 5CA1A 1AKYA 2I7DA 2I7VA 3OHSX 3ZY6A 1JB9A 2Q3FA 2ZJ0A 5JPDA 1N6IA 1P80A 2AEFA 1GILA 2OLJA 1PUIA 3E58A 4LSMA 5CHEA 5FBWB 3SEFA 3GL9A 3ITNA 4YMWA 4AULA 2FQQA 2QD1A 3DOUA 4Y98A 1JVNA 1DJPA 1Y8RB 2NGRA 3IUPA 3LGAA 2GN4A 5FPHA 3WJ1A 4D92A 5I6DA 2H4HA 3IHLA 4WL0A 1PZMA 1TZKA 2QUHA 3IMCA 3HJFA 3SF8A 5L3QB 5CW2A 2X6QA 2ZQYA 3SHWA 2QJFA 4GLJA 5FEMA 3BVPA 3WQBA 2HCJB 3I01M 3I37X 1VBKA 2Q5OA 2OWDA 4YCCA 4KFCA 1SK8A 3R0ZA 1ZZGA 2OWEA 1SHKA 3FCYA 3OIFA 1RP1A 2WTEA 4GMFA 4M7OA 4OX9Y 1N5DA 3LG2A 3TO5A 3H1FA 4HGZA 1OZGA 3PIDA 3A6FA 4KX3A 2XODA 1U0NA 5BURA 1NVMB 4WBNA 1NU8A 4S12A 1E3WA 1BZYA 2AR9A 4AZ3B 2MSWA 3PIRA 4TKLA 1J2RA 1FA9A 3NIFB 4C2UA 2XCRB 3OWHA 4IICA 2IHUA 1Z13A 2XIJA 5ITZB 2CE7A 4CM8A 1BDJA 3JQ9C 4RPJA 1P45A 1TW2A 2JVKA 4CN9A 3DO6A 5I4KA 1K3UB 1WJGA 3QSGA 4RELA 5JOQA 4DYDA 821PA 2ZTUA 4EGQA 5LZ9A 1GTRA 1G7TA 3SY8A 1R3DA 3EIXA 1R4NB 2VZ9A 1ZJ5A 4NESA 3RU9A 1Y3AA 2VXYA 2GZRA 2XQGA 4OJNA 5D01A 4WFKA 5HXAA 1QRRA 3DOEA 4P33A 5KNDA 2J9GA 4B4KA 3D8BA 2CL7X 1ZGGA 2JFUA 2X0NA 4PRZA 2ORYA 4XM2A 2OO5A 4E2FA 1OPXA 2R6CA 2RJNA 4JXXA 3FB1A 1XO1A 2BHTA 1PZGA 4B5KA 3NM4A 3RCBA 1V71A 2J3HA 2WF9A 1ZJWA 1B43A 1G8GA 3BJIC 3M9LA 4UDNA 5JYDA 4A8TA 1QOZA 1AKRA 2QTAA 1EAYA 2I3AA 3C5HA 2AYXA 3G5MA 3PRKE 5DNAA 4QLBA 4PCUA 4R8LA 2BI4A 4XOIA 5LD2B 3P19A 1CRWG 5KI6A 1Q1GA 4JI6B 4UVHA 1DGQA 3QWFA 4HD8A 4LMBA 3ANMA 4RVFA 3RTEA 2WF6A 1EA5A 3M2PA 3MVEA 4I4TA 4B80A 1RPNA 3EXEB 4OGGA 2F67A 1V5FA 3GCGA 5JAOA 2OOSA 1V1RA 4FN5A 3BCHA 5IKOA 2DBQA 4DR6B 1MW8X 2VYND 3IUQA 2XZPA 3P2OA 3OQPA 4BZWA 3SSMA 1O89A 3NHKA 1DMRA 2G4LA 5CEJA 1X1EA 1X1RA 3IB6A 3OESA 4KKXB 3PC7A 3DLIA 2ZIZA 3NW9A 2XCUA 4UAJA 4WERA 3TW8B 5EE0A 1MDFA 1GUZA 2O0KA 1O7JA 2RHGB 2XWQA 3O9ZA 2NO5A 1Y1LA 3JW8A 3P9RA 3UA4A 5C1PA 2K87A 4U00A 1SPXA 3A1VA 3ZZUA 3DEKA 1U8EA 3D64A 5BSEA 3MTIA 3U3MA 3M1YA 1IQUA 3TZ6A 3JQQA 3ADDA 4J4HA 3QU4A 4YREA 3X1DA 4PF1A 1DEXA 2DBYA 3HSSA 2FSUA 3V1KA 2XVYA 1NVAA 1Q57A 2P4HX 3GZJA 5SY9A 3U19A 4OKIA 4NK5A 3K9HA 3WJAA 5EXEA 1IN4A 2HLHA 1JSZA 1U7HA 1BGVA 2FN9A 3BHIA 3TRFA 3AC0A 2YVLA 1DNPA 3ENVA 2JIZD 1TECE 1YL5A 1GPWB 5EYPB 3GVIA 1MDBA 2PZMA 1EH5A 3BK1A 3RFTA 1OWOA 3T9FA 1VB3A 5G2OA 1QP8A 4TL6A 3ZXYA 5LQMA 4MUBA 3NIWA 3RKSA 3U2QA 5DNUA 2OAP1 2OUKA 3RC8A 2ZTSA 2G17A 2DJIA 2ETVA 3GJ5A 4JZKA 5U9CA 2JGLA 2O0JA 4Y1FA 2CDNA 2EFDB 2GJKA 3HBFA 2A5YB 4ZKEA 1V8DA 3QFTA 5HIMA 1UM9A 4B2IA 3C8HA 4QOEA 2P8SA 1M67A 3F3SA 1XAGA 2QJWA 4PYNA 2WBLC 4XIFA 4ZYZA 5JW6A 1GSAA 1TAQA 1IHUA 1X38A 1XHLA 1NQOA 2B69A 3H2YA 5CLLA 1WSBA 1C7ZA 5IT9A 4B3DA 3LD9A 4LUCA 2IH2A 4A36A 4D4JA 2QRGA 1K3FA 4Q9NA 4MEJA 2PX6A 3MCVA 2ZJ1A 2BKVA 2ZJAA 2PRSA 3E84A 4RGYA 4K9NA 3I58A 4AUEA 1T29A 5AW5A 3DLCA 2FW6A 4YV0A 4RHCA 1YE5A 3L6DA 3CUSA 3HCPA 2H0RA 1XTSA 1DAEA 3VNUA 1DAPA 3PVCA 3ENWA 3LMKA 3LP8A 2B8TA 2I71A 3DOHA 2B8JA 4OJQA 4A5OA 4CKEA 5AVSA 4ER5A 1QP4A 3UG6A 3NVKI 1SWWA 2R8YA 3I8SA 2C4MA 1ACLA 1P6UA 4FFNA 3LCVB 4HX5A 4RTMA 1Z0FA 1XVIA 3OPXA 3TXAA 1OJLA 2DGDA 2H48A 3PDIA 1KQ3A 3BAZA 4BNLA 5A5EA 1DCFA 3OU7A 2OQIA 4RK7A 1SG0A 5E9QA 4LHEA 3H5RA 1BC5A 3TVTA 3BFVA 2Z3ZA 1XKLA 3AR4A 5FR2A 5K2OA 4P93A 1A9QA 2NXJA 1S7GA 2FG5A 3HADA 5HWSA 2F3UA 1TJ3A 3ONVA 5KQLA 1NBWB 2R5NA 3DA8A 2AOTA 4IHJB 2HPHA 3QXSA 1NMEA 1SKQA 4B81A 2QVBA 3ML1A 1GD1O 2GILA 3IAEA 1R88A 3DBVO 3ONFA 1C0IA 3U3RA 1YZTA 5CFRA 1CNMA 1JQ5A 5FCDA 2PT9A 1VB5A 3MPOA 1E5XA 4HJXA 2WJ4A 1CUGA 5BWLA 3SEAA 1NW8A 1Z5ZA 3DYIA 1A4UA 4PGAA 5K09A 4ZVOA 1DJNA 2N1MA 4R1TA 4XIJA 1J8VA 3V2GA 5HPYB 2ZI6A 4FB5A 2VSNA 4ZOCA 3LLMA 2W2MA 1C81A 4W5RA 3HGMA 1JILA 4JT9A 4GPTA 5K6AC 2C7OA 3FFBA 3GX1A 3DPUA 3HUUA 5EUMA 3VR3A 5KZMB 4IIEA 3DCNA 4XUGB 1K7FB 2IEZA 3WNCA 5ALHA 3TEJA 3H5IA 1ZPDA 3IR7A 5ITWA 4WTOA 1LI7A 1OKKD 4UZSA 2C2BA 1EVLA 1MBZA 1PJSA 1Y4UA 2NWQA 1QR6A 3I53A 3SSNA 4OXRA 3N8KA 4MS4B 2BR4A 1FUUA 1NBIA 4Q21A 4TS9A 4QUEA 2IH4A 1VTKA 3OTIA 4YJHB 2V0GA 5H9VA 3IKLA 2L0XA 4BNDA 1GIAA 1I6LA 1OJ7A 1W88B 1AH2A 1OHHD 1VCIA 2OAQ1 3INGA 3U7GA 1B1CA 1NF8A 3PCXA 3FCUB 2UU9B 1IHPA 1NJ2A 3HV2A 4P98A 1YR9A 4DR3B 2GAIA 4HTFA 1U2QA 3ZHSA 4EYEA 1W5EA 4EYSA 4U7FA 4CT4B 5LL6P 1JHXA 5CDTA 3PQCA 2C1ZA 4XX1A 3CBQA 3LT2A 2Z4RA 5TE9A 5LQJA 5TQ2B 4MS3A 1FP6A 2KS6A 1BNCA 1AZWA 1HFEL 2HXSA 4CIAA 2GAFA 3NGMA 4CKBB 1AHNA 1SU6A 3T0FA 1SMKA 5FNZA 4YCSA 1JKJA 3U09A 4YMVA 4C4RA 2D6FA 3LW8A 4R2IA 5AW8A 5AW9A 4FW8A 3FTQA 3TMAA 5I8WA 4DILA 3PUVA 4BPBA 2SNIE 3OF2A 1KO7A 4JLPA 4DLYA 3Q6IA 4QQNA 4L4XA 3LY5A 1CUIA 1RXSA 3TQIA 3V8PA 5I51A 4ASUD 1KZ6A 3DDOA 2F00A 4OQLA 4WA7A 3ZX5A 4EKEA 4HBZA 4MUJA 5F1KA 3KL4A 1R66A 1TUBA 2A7QA 3SD7A 3NHUA 1SXQA 1U9JA 4RBNA 5K0LA 1W5FA 8ABPA 2Q0XA 5KPJA 1XV5A 1RYZA 1Q7RA 4HLQB 1FS6A 4QPDA 4RACA 5DMHA 1QRTA 1SVMA 2XD9A 3DMNA 1CPYA 4KC0A 1SC3A 5BORA 3FJ1A 3NHWA 1T5TA 5G1NA 2QUIA 4N5NA 4LK2A 2J45A 4ARIA 1L5YA 4TN1A 3AFNA 5HCNA 3UJAA 4L4RA 1YB5A 3G88A 5EMMA 2WYHA 4I6EA 2JLAA 1QJCA 3WZLA 4CG1A 1N77A 1J06A 1H0HA 4ZC1A 3GLIB 4KI0A 1V43A 3AI7A 2QRVA 3TLMA 5L7TA 4DWVA 2RAVA 1RCUA 5IEBA 3FWKA 4ZOLA 3S2ZA 2QAGA 3IT3A 4U2BA 2AOWA 1XYGA 1PSDA 1NXOA 2ZYVX 5E4YA 4LXXA 5KBYA 5AK3A 3P9SA 3AT1A 1L4MA 5DLQC 2E4ZA 2PZFA 1Z34A 3NT4A 3RHFA 3AUFA 3IV7A 2UYCA 4ND1A 2CK3D 3JVEA 5LA6B 4CM5A 1XZCA 3URMA 3KUKA 4H3SA 4P7KA 5JR3A 5MFPA 5LXTA 4A91A 2FSHA 3HACA 3O3MB 3QTTA 1IC6A 3X1YA 1P6XA 1JYSA 4YYEA 1VCHA 1NX9A 1XCMA 3X1ZA 1W29A 3GMDA 3TCNA 1LW6E 1VC2A 1BCRA 2P11A 4K8RB 3U61B 1NF3A 3VO1A 3PHHA 2MR5A 3L0ZA 1U8FO 4RZXA 3A05A 5AM0A 3WLRA 2O5VA 5HQ3A 4KR7A 4XIGS 4UTZA 4GG1A 1XPRA 1UUFA 2GWHA 2FUG6 3VH1A 5HRAA 4L1KA 2WWYA 3KQUA 1L8QA 2ZCUA 4MW4A 1CJTC 3HLTA 3BORA 1D07A 3G1TA 4EEXA 3BCUA 2IPNA 2J0EA 4WZBA 3JX9A 4BKRA 5DHTA 3F6BX 3E48A 4YMLA 5KWVA 2WJVA 4MQ6A 3UOAB 1PFWA 4IUYA 4U6NA 4WECA 2IDKA 1ZD1A 3IERA 1ICIA 2EKZA 4A0SA 4U8GA 1F0KA 5ALTA 1EFPB 3W5JA 5JCOC 3TAUA 4CDRA 2B82A 4EHAA 4PS0A 4R51A 1CY2A 1OR8A 3HVKA 2FPXA 1OASA 3IVXA 3RUHA 4CF6A 3E8MA 4I5DA 4L4SA 4NYJR 1W5SA 2JFVA 4AJ2A 1NVGA 1YB2A 3WYFA 4J91A 4AXXA 1DAKA 2H1LA 2O23A 3C2QA 3FAKA 3H5LA 4OY3A 3FPAA 4ESHA 3ZHTA 1B6GA 1J7JA 4H0NA 4KO2S 4ZDIA 5JNTA 1ABFA 1T9HA 1HQCA 2Z6UA 3SFVA 1KDRA 2QX9A 1UMDA 3TZLA 1SY7A 1KPGA 4RQAA 3DZJA 4B47A 1WDTA 3DZGA 3KSMA 4B3FX 3WYEA 4DC0A 1DUVG 4N3GA 4DVJA 4WGFA 2JLXA 4U7TB 4LS3A 3DFKA 5IVDA 4RZIA 2QT1A 3I12A 4Q4JA 4HCJA 3IPYA 1XEFA 3GH3A 4G9EA 4HMOA 4JV5B 4QHSA 1G2OA 4LJ6A 4LSGA 3RC1A 4H6VA 5TLSA 1QC5B 4UAUA 2IZZA 3CUVA