5DPSA

Crystal structure of plekhm1 lir-fused human gabarap_2-117
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
DEWVNVGSKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family M member 1,Gamm
publication title Structural and functional analysis of the GABARAP interaction motif (GIM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 122
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dpsA00
3SDLC 3W1YA 3AU5A 1WRDB 4E74A 1WMHA 3APCA 4KVGB 4EEWA 4ICVA 2MQJA 3N30A 4K7SA 4M8NA 2RR9A 3IFWB 3QCAA 1UD7A 1Z5SB 2KFKB 3QK0A 5EDSA 3DVGY 4A3OA 2WDTB 3VAWA 2AYOB 1VCBA 2LVQA 1RRBA 1WX9A 2JT4B 2CR5A 2J7QB 1HE8A 2EMTA 2DAJA 3APFA 3PREA 4GU2A 1ISNA 3WIMA 3A33B 2NS5A 3DDCB 2WWZA 5G55A 1WX8A 2AL3A 2JXXA 2D07B 3EECA 2LXAA 3PV1A 2C7NB 3P2BA 3KYCD 4W9KA 4WQOB 4ZYNA 4BOSC 2MLBA 1D3ZA 4MGYE 4HPMB 2BWFA 1V6EA 1WZ0A 4KZ0A 3L0WB 1J0GA 2CS4A 5E6OA 4TKNA 1WF9A 3X0WA 2OOBB 4NQKE 4CHKA 2L76A 4MH0E 2KJHB 4BBNC 3HK0A 4AOFA 2KLGA 4XX5A 4ZDVA 3R3MA 2KKCA 4K1RB 2XBBC 3M62B 1V5TA 3DVNU 2DZKA 2L8JA 3DQVA 4MM3A 2MA9B 3CMMB 1NDDA 2HJ8A 3LDZE 3PRMB 3VFKA 2ZNVB 2KFKA 1J19A 4M0WB 3ML8A 1Y8RC 2K6DB 2MP2B 1P3QU 1WJNA 2FAZA 3OAWA 4GMVA 2IO1B 4IM0A 2IYDB 1V5OA 5IAAC 2OJRA 2L00B 5DPTA 3PRPB 1EO6A 4DHJD 2ZVNA 3PLUA 1E90A 3PSEB 2N4FA 4DXAB 1V49A 4BKSA 3K9OB 4PS8A 3QJZA 3ZO5B 4PS7A 2KTFA 4CYEA 2GBJA 4FN2A 4HJKA 4NAWB 2JF5A 2KHWB 2KWCA 1P98A 2WX1A 3EC8A 4NJ6A 5DCNA 2CHZA 2KC1A 4WWNA 2YVCA 4WWPA 2LXCA 1VD2A 5CHVC 3RULA 2MSED 4EZLA 1EF1A 4RM8A 5L95C 2NBUA 2L7RA 3W1SA 3KYDD 4EFOA 3DBRI 2N9XA 3H7PA 2RD0A 4JQWC 4HXDA 2KC2A 1P0RA 3PGEA 2R2OA 2JRIB 2N7DA 4GDKA 1BT0A 2MP2A 3ZUNA 2KXJA 3CSFA 4JLCA 3SD5A 1KM7A 3PT2B 2NPTB 4LDTD 2N1VA 3C0RB 2LJ5A 2CU1A 1WGHA 1WY8A 3DOWA 5J18A 2LZ6A 4DHZB 2KLCA 3QC8B 2V4LA 3AI5A 2KTRB 2N9EB 4HCNB 4BKSD 2Z0DB 1TTNA 2MRPA 3ZIMA 3PZDA 2ZPYA 5KHOA 2IY1B 2ZZPB 4DBGA 4W9CA 2LGYA 4B95A 2B3AA 2BGFA 3TL5A 2ASQA 2C7MB 2DX5B 2KDFB 3N3KB 3VTUA 2LGDA 4KSLC 5TR5A 2J0KA 1UBIA 4TQ1A 4II2B 4BFRA 1UH6A 2DZIA 3AU4A 4DHJB 3UIOB 3VTWA 4ANXA 1YJ1A 2DYBA 3H9DA 3QAQA 2DZMA 4W9EA 1ZGUB 3L10B 4W9LA 4DK5A 4HLEA 1L2NA 4IM2A 2MBEA 2KO3A 3ONSA 4EOYA 2YLMA 2KNBA 4W9FA 2G3QB 5DPRA 3VTVA 4W9DA 3AXCA 2PJHA 2KTRA 2NCNA 3JSVA 1EF5A 4GIVA 2BYEA 4IC7B 2JWZA 4EZKA 1WFYA 3DBLI 4ZRJA 3PHXB 2D10A 1KOTA 2KMAA 4G50A 2HE7A 3VXWA 4LJOB 3WAPA 2VRRB 2KANA 3I3TB 1F9JA 1YD8U 2BWES 2ZJDA 1WGYA 4RMAA 3PTFC 2GMIC 3A9KB 4I6LB 1Z2MA 4NJ7A 2PE9A 2Z59B 1E8XA 2IBIB 4ZRIA 3ZNZB 1E5WA 4LDTB 3UINB 1WI0A 1YIWA 1LXDA 4NNJB 1C3TA 5LXIB 4GSWA 3SU8X 2GBRA 2IY0B 1ZW7A 2MBQA 1Q5WB 4YL8A 1H8CA 4OVUA 2HD5B 2WYQA 4MJSB 2KJRA 3Q3JA 4PYZA 4LJPB 2MW5A 4CO7A 3L08A 4X57B 3VVWB 2BYVE 2IO3B 3L13A 3RT3B 1GJZA 1SGHA 2J0JA 3VHTC 3EFUA 3L54A 3ZDMC 2LD9A 1GG3A 4MSQB 4EUTA 3R66C 3ZVVA 1JRUA 3ZDTA 2G4DB 5C1ZA 2GBNA 4JGHB 2FIDA 2JZ3B 2KX0A 2CHXA 2AEHA 2K8HA 4DHZE 3H1UA 3H7PB 1WE7A 2O6VD 3A9KA 2W9NA 4K81A 1CMXB 4GDKB 2MBBB 4ANUA 4K7UA 3DBHI 4URKA 1I42A 4AWJA 1KJTA 1WIAA 5JZEB 3OLMD 4K7WA 5GMVA 2BF8B 1GUAB 5LXHA 4W9GA 3H6NA 1WE6A 3N32A 1WR1A 1XQQA 3MHSD 4MJSA 2QHOA 2REXA 2BPSA 3T8MA 2NR2A 3RZFA 4GN1A 2NBVB 3QX1A 1OTRB 1V80A 1WYWB 1X1MA 4FJZA 2I1KA 1GC6A 1WJ4A 2PPHA 5CHWA 3QHTA 1WM3A 5E6NA 3CSTA 3W1SC 2I1JA 1WGGA 2JY6A 4PS3A 1RAXA 2MX2A 5CX3A 3KW5B 3WANA 2ZNVC 4I6NB 3V60A 1C1YB 5J2RA 4MEMA 1QZEA 3PVLA 2C7HA 3ZNID 1WH3A 5C23A 4A20A 4RM9A 1YX6B 4FADA 3B08A 2FCMA 4BBNF 2LRWA 2IO2B 3APDA 3OJ4B 1E7VA 4J6IA 4MELA 4TQ0A 3M95A 1IP9A 2Y5BB 5D2MB 1IYFA 3S2AA 3NOBA 2RPQA 3JSVB 2JRHA 3ALBA 3R7QA 4W9IA 1E8YA 1Q0WB 1YQBA 2Z0EB 2A4ZA 3ECIA 2KJ6A 2JZZA 2O6VB 4II3B 4E3CA 1WXSA 3AULA 3B1LX 5AZGA 5L83A 4NPNA 4AJYB 3L17A 2DZJA 2XK5B 3RCZA 3OJ3A 2NBWB 4HK2A 5AZHA 1M94A 1GNUA 2K8CA 1L7YA 4GGQA 4DDGD 4KIKB 5BO4B 3UGBB 3ZTCA 2LUEA 1IPGA 4BOZB 2D3GA 2KVRA 1WXAA 5HKHA 1PQSA 2KOXA 2FUHB 2LWPA 4W9JA 1WJ6A 1WXVA 3H7SA 3NZUA 3R7RA 3KH0A 4G0NB 4FHJA 2UYZB 4MDKE 4WJQA 1U4AA 3VH3B 2G45B 3GOEA 3KUCB 2KWVB 3TMPB 1V86A 4JIOU 1H4RA 4WJNA 2L3ZA 5CHFA 3UQBA 3RD2A 2N7EA 3PLVA 2KWUB 2KZRA 1E7UA 2O6VA 5DPSA 2KDEB 1UGMA 2XEWA 5JHAA 5J17A 2LGXA 2XK5A 2C9WB 5DPWA 1NBFC 2KQ7A 3PS6A 2DAFA 3TIXA 3QIJA 1UBQA 3BY4B 4TV3A 4IWPA 4KIKA 3VUYA 3V6EB 2R2QA 4FJVB 4M8MA 3IG3A 1LFDA 3KUZA 3ZTDA 2AWTA 5G2NA 4WAAA 4N9F4 4GOCA 4WJPA 2V1YA 1XD3B 2ZCCA 1J8CA 4IG7B 3A9JB 3QQ8B 4FLHA 1G6JA 3NY5A 1S1QB 2KQSA 2K8BA 1OEYJ 4MGKE 2K6QA 3M63B 3ZRCA 3TJPA 3DPDA 2ZEQA 2BKFA 5AZFA 3HM6X 1FXTB 3IVFA 4EZJA 4HDOA 1XT9B 2M1MA 1LM8B 4MSMB 2LASA 1V2YA 2N9PC 1TZ1A 5JH5C 4ASWC 2C5LC 1UZXB 3LJ3A 3KUDB 3GZNI 2DENB 3TBLD 3D32A 4IWQA 4KDLB 4FULA 2M4NA 2JVCA 2C60A 1AARA 3HHMA 5E6PA 3VDZA 2O2VA 1OQYA 3B0AA 2K1FA 3RYTA 2DYMA 4B9KA 2K25A 2MWSB 3QWZB 1WGRA 5D7GA 3BINA 3VQIA 1EUVB 3U8ZA 1I35A 2KX3A 2UWQA 2IZVB 2GBKA 4KV2A 4WWOA 3EHVA 4XZ4A 3K9PB 3QARA 4JL9A 4HDQA 3O65B 2MBOA 3A9JA 4MGZE 3RUIB 2LI5A 2M8SA 1WJUA 4ICUA 4ANVA 3Q3FA 4LCDE 3DBSA 4MGIE 2ZVOA 5CTRC 2FCQA 4BKGA 2N1WA 2V3SA 2KD0A 1YX5B 4B6WA 4FBJB 2IO0B 2FCNA 3A4RA 2RGFA 4GDLB 4HPLB 4NQLB 2PE6B 2KDBA 5D6JB 2KDIA 4KDIC 2BKRB 4OVVA 2WX0A 1V9JA 4HWIB 2HTHA 3A4SC 3VH4B 3U30A 4AUQC 1V81A 3HIZA 2BYFA 3ML9A 3ZNHB 5AEKB 2ZPNA 4TUUA 3SHQA 3IBEA 2L0TA 1K8RB 1E8ZA 1SE9A 3WAMA 3WALA 1RFAA 4HVBA 1R4MI 1UELA 4FA6A 5D94A 2MBHA 3L16A 3ZW3A 3WAOA 3WA0A 1A5RA 3T9LA 4FHKA 2K39A 3DVNV 1R4NI 4AP4C 3PHWB 4ANWA 2KMCA 2M17A 4G11A 5FR6A 4EKUA 1LQBA 3MJWA 2PEAA 4F7ZA 4F8CB 3CF6E 1S3SG 1WX7A 4WJOA 1TGZB 2JPHA 2D2QA 2EKEC 2FIFA 3PPAA 4DDID 1KLVA 4GDLA 2MCNB 5KHQA 1WZ3A 4W9HA 4IUMB 2GOWA 2KN5A 1T0YA 1NI2A 2LVPA 2LVOA 3JW0X 2FNJB 4IM3A 3ZNGC 2KK8A 2EMSA 4KZCA 1P1AA 1RLFA 2ZCBA 3VUWA 1MG8A 3NHEB 1WXMA 4ZRKA 4BVUC 4NAWA 3HM3A 3TCAA 5JHBA 1OEYA 4PYUA 4GB9A 3UIPB 3A1QB 3JVZX 3PRZA 4I6PA 4F1SA 1WGDA 1WR6E 4P7IA 3V61A 4HCPB 1WMHB 1GC7A 3ZLZA 2CHWA 2LRUA 3UF8A 3V62A 2G4SA 2RSUA 4NY0A 3KVFB 4GXBA 2FCSA 3X23A 3UQAA 4E71A 5LLIA 3NS8A 5IA7A 3IHPC 3DVGX 2AL6A 2DYOA 2L0FA 1ZKHA 4DWFA 4FJYA 4IWOA 2M0XA 1TBEA 2J0MA 3JYUA 3U7DA 1Q1OA 1P9DU 4AJWA 3ZRFA 2GBMA 3MTNB 4XC2A 3V6CB 3ZKJC 2L05A 2CKHB 3NZSA 4G3XB 3ENEA 2NPTA 4BKTA 3QA8A 3M3JA 2NVUI 2JUOA 2O2VB 2D11A 4IW0A 3VUXA 1SIFA 3DCGA 4A3PA 1WM2A 4KSKC 1OGWA 3A1QA 2DHZA 1E8WA 3RZWC 2KFJA 2A5UA
chains in the Genus database with same CATH superfamily
3W1YA 1WRDB 1DOXA 1ZP0B 1QOFA 4K7SA 4MM3B 2BS2B 2RR9A 4ZRQA 1Z5SB 3GS2A 4N59A 2J52A 1C4AA 3DVGY 3Q3OC 4PK1A 1WX9A 2CR5A 2KWDA 3AH7A 2QEJC 3DDCB 1C76A 2AL3A 4W9KA 3U52E 1AWDA 1KLVA 1BUIC 4S17A 2MLBA 3AEGB 4N6EB 5E6OA 4L2YA 4NQKE 1EWCA 2KLGA 1EU3A 4ZDVA 2KKCA 2X8XX 3P42A 3M62B 1V5TA 4MM3A 2MA9B 1NDDA 3CIRB 2DNFA 1J19A 2UU7A 2K6DB 3ETRA 1FNVA 1P3QU 2IDYA 1TS5A 5HHDG 2L00B 5DPTA 2ZVNA 4US8A 2XNAC 1MJDA 3QJZA 3KWVA 4FN2A 5C3JB 1I4PA 2WX1A 2CHZA 4WWNA 4WWPA 2JSVX 1VD2A 1ZDXA 4EZLA 2NBUA 1JALA 1K53A 3L4PA 3DBRI 4JQWC 4HXDA 2KC2A 3PGEA 4RGTA 2N7DA 2V3NA 4KX6B 1QOBA 1BT0A 4JLCA 3CSFA 1KM7A 1XF5L 2AQ3B 3PT2B 5LNK1 2CU1A 1WGHA 5J18A 4FXCA 1V1PB 2Y5PA 2KTRB 2N9EB 3AEAB 2MRPA 4KGRA 3ZIMA 1MG4A 2ZPYA 3MJ5A 4W9CA 4JPSA 2BGFA 2KDMA 5IN7A 5TR5A 1UBIA 1VZ7A 2EKIA 3VTWA 4ANXA 2DZMA 2K3UA 4DK5A 2YLMA 2LHEA 2G3QB 1PFDA 3VTVA 2N0SB 1V1PA 4LNIA 3AE4B 2RMMA 1JCKB 2KTRA 2BYEA 1PGBA 4ZRJA 4ARCA 2KMAA 3TSSA 3N9YC 3HVZA 1YD8U 3PTFC 1T6BX 1KRHA 4LDTB 3UINB 1WI0A 3SU8X 1ET9A 4OVUA 1GB1A 1JRPA 3VVWB 4P6VF 1SGHA 1STEA 2J0JA 5FK9C 4MSQB 4LNFA 2G4DB 2PTLA 3DHIC 2FIDA 2KX0A 2CHXA 3AE7B 4YSYB 2W9NA 4K81A 4ANUA 2G1EA 1KJTA 5JZEB 3OLMD 2BF8B 1ACCA 3N32A 1TIFA 1XQQA 3MHSD 1WRIA 4GN1A 1V80A 1X1MA 4FJZA 2JXTA 1JROA 3QHTA 2Y3AA 1GPXA 2I1JA 3RNEC 2MX2A 3WANA 2QDFA 3TEWA 5E6JA 1XLPA 1YQ3B 2QCZA 4A20A 3ZJUA 3NZ3A 4RM9A 1WSPA 1EWYC 2N9LA 2BVCA 1N5XA 1E7VA 4A9AA 4MH8A 1IYFA 3S2AA 2Z0EB 3ECIA 2JZZA 1C78A 4XE0A 5AZGA 2DLBA 3L17A 3RCZA 5AZHA 2WXQA 4C7ZA 1L7YA 4GGQA 1FO4A 4KIKB 2KVRA 2K9XA 3AECB 3N1YC 1SF0A 2FUHB 3NZUA 2HJ1A 3AE5B 4C56C 2UYZB 3NVVA 1YN4A 2KWVB 1HZ6A 4JIOU 3UQBA 2D3AA 5DPSA 1ZUD2 1D5ZC 2INNE 5J17A 2CJNA 2K5PA 2I2YA 2ACZB 5DPWA 4YWGG 2DAFA 3TIXA 1GOZA 3QIJA 1JWBD 1UBQA 1RM6C 2K22A 4KIKA 3V6EB 2IGGA 1LFDA 2WDVB 4WJPA 2D3CA 2V1YA 3DHHC 2J42A 3QQ8B 2AQ2B 3EUB2 3NY5A 1T0SC 3M63B 1FCLA 1FXTB 2LFIA 3IVFA 2Y5CA 1VLBA 1V2YA 3GZNI 1TYGB 4XGAB 4A6QA 2M4NA 2JVCA 4HPPA 3HHMA 5E6PA 3VDZA 2DYMA 1YMHE 3VQIA 2V0GA 4N58A 4KV2A 2GBKA 4WWOA 3EHVA 1YJIA 5EE1A 3RUIB 2N9KA 2KD0A 2IO0B 3A4RA 2RGFA 4YSZB 1FRRA 4KDIC 4OVVA 1V9JA 4HWIB 4WAFA 2KYWA 1E8ZA 4ZRPA 4YTMB 4HVBA 1C77A 2J4XA 4FA6A 2MBHA 3L16A 3ZW3A 3WAOA 3WA0A 4FHKA 3PHWB 1QF6A 3MJWA 3Q2AC 5BMGA 1S3SG 4WJOA 1TGZB 2EKEC 1N60A 2LVPA 4REZA 4IM3A 4KGTA 2EMSA 4KZCA 2VH2A 1RLFA 1MFWA 1FEHA 1MG8A 3NHEB 1WXMA 4NAWA 5JHBA 2MEKA 4GB9A 3UIPB 1WGDA 2WS3B 4P7IA 1WMHB 3ZLZA 3N1ZC 3EA6A 4GXBA 1VDVA 2FCSA 3DVGX 2DYOA 1HXYD 2L0FA 1ZKHA 4DWFA 4FJYA 4IWOA 2M0XA 3JYUA 3N1XC 1Q1OA 5C2TB 3NVZA 3WCQA 3ENEA 3RNAC 2HDEA 3QA8A 3M3JA 2O2VB 2IPKD 3RNBC 4MELA 1HZ5A 3SDLC 3AU5A 1WMHA 1Y56A 3RN9C 4HEA1 4EEWA 1XEEA 3QCAA 4DQOC 1MHHE 2KFKB 3PZ7A 3QK0A 5EDSA 4A3OA 2WDTB 3VAWA 2LVQA 3RNGC 1RRBA 3P63A 1HE8A 4GU2A 3A33B 2WWZA 5G55A 1WX8A 1N5WA 2JXXA 5JXVA 2D07B 2LXAA 2C7NB 3P2BA 3KYCD 4UDUC 1D3ZA 4GLSC 3W2DA 1FFUA 3L0WB 4YTPB 4LNKA 4TKNA 1CZPA 3Q6BA 1DGJA 5GXGB 2OOBB 4CHKA 1XLNA 4MH0E 2WXFA 2JX5A 3GE3C 4BBNC 1J7CA 3HK0A 4XX5A 1L5PA 3R3MA 1T0RC 1PDXA 4K1RB 3DVNU 1IBXB 3DQVA 3CMMB 3PRMB 2KFKA 4BZAA 1Y8RC 1WJNA 1C4CA 2FAZA 5IAAC 3AB5A 3PRPB 1E7PB 1EO6A 4IOIE 4DHJD 2KMMA 2N4FA 4PS7A 2KWCA 3KWLA 4RNAA 2WXPA 1D4BA 2KC1A 2KACA 5EE9A 2MSED 1T5XD 3P4QB 4ACFA 2RD0A 3Q8BA 4YT0B 4GDKA 3NG0A 2LHDA 1VZ6A 2OEDA 4MT5A 2VH1A 2LJ5A 2PVGC 3QC8B 3AI5A 3DWMA 1TTNA 2ZZPB 4LNOA 4B95A 2C7MB 2DX5B 3N3KB 1V8CA 1QOGA 2DZIA 4YSXB 3I63C 1YJ1A 4HJGE 2DYBA 3H9DA 1ZGUB 1L2NA 4IM2A 2KO3A 2KNBA 5DPRA 3BK1A 3ZQ4A 2PVOD 3IAM1 1TS4A 3AXCA 2PJHA 3JSVA 4H2AA 1WFYA 3PHXB 3DBLB 2KANA 2BWES 2ZJDA 5HFYA 1WGYA 3A9KB 1Z2MA 2PE9A 2Z59B 1T0QC 4NNJB 2GBRA 3P4SB 1ZW7A 4YL8A 1Q5WB 1L6UA 3Q3JA 4LJPB 2MW5A 4CO7A 3L08A 4X57B 2BYVE 4DXGA 1GJZA 1NVID 2BS4B 3EFUA 4OW0A 1UUPA 1TS2A 2GBNA 4ZHPA 2DWQA 5IO9A 2YEPF 3H1UA 2ON8A 4QAYA 3A9KA 1TKGA 1CMXB 2I38A 2MBBB 3DBHI 1DOYA 1AW7A 4AWJA 1D5MC 5GMVA 4C7YA 3ZGZA 1D5XC 4O1NA 3H6NA 1WE6A 3T8MA 5I4DA 1MPEA 2NR2A 2I1KA 1GC6A 5AUKA 1B9RA 1L6VA 1JWSD 3ZXRA 3TUOA 4XWTA 3W1SC 3V3XA 2NTTA 3MC8A 1WGGA 2JY6A 4PS3A 4OZBA 5BYRA 5CX3A 1MHXA 2ZNVC 1EM7A 3AV8A 1OFFA 2RPVA 1C1YB 2L1AA 2C7HA 3AE9B 5IOIA 4FADA 3B08A 4IKGA 4BBNF 3Q8FA 2KQ4X 2WLBA 2QC8A 4XYCA 3U2SC 3ALBA 1YQBA 2A4ZA 4E3CA 3B1LX 2WHIA 4AJYB 2DZJA 1JWUD 2YEPB 3OJ3A 2WXMA 1FRDA 1NYRA 4ZHOA 1M94A 3RMKC 3I57A 2K8CA 1JW9D 3UGBB 1M4VA 1IPGA 1WXAA 1PQSA 3H7SA 1WWTA 4MDKE 3VH3B 3KUCB 4JWSC 3TMPB 2L3ZA 5CHFA 2N7EA 4KKIA 3OWEB 2KDEB 2XEWA 3SEBA 1L0YB 2WXIA 4MACA 2GLSA 2KQ7A 3PS6A 3BY4B 4TV3A 3VUYA 4J3OD 2JQRB 1RWSA 2R2QA 1MI0A 4FJVB 3KUZA 4WAAA 4N9F4 1PGXA 2ZCCA 4XWWA 1G6JA 1S1QB 4MGKE 2K6QA 3ZRCA 3DPDA 2ZEQA 2Q5WD 2KT7A 4HDOA 1LM8B 4MSMB 1WXQA 2FE8A 3HRDD 1TZ1A 3LJ3A 1K50A 3FKYA 4FULA 4S0RA 1J7BA 3NVYA 1F1HA 2K25A 2MWSB 3Q3NC 3C8YA 3BINA 3U8ZA 2KX3A 1SBBB 4XZ4A 4HDQA 2MBOA 4MGZE 3AE2B 2LI5A 1Q10A 2PKOA 4ICUA 4XDCA 3Q3FA 4MGIE 3DBSA 1K51A 1TZOA 2N1WA 1YX5B 3VRAB 4FBJB 3Q69A 1F2RI 1L4DB 2JYEA 1NI3A 4GDLB 2PE6B 4NQLB 5D6JB 1UNSA 4USAA 4JWUC 3VH4B 4AUQC 2TSSA 5AEKB 4TUUA 3SHQA 1JQ4A 4RF0A 3EFCA 3WAMA 1L4ZB 3BWUD 3BZDB 1R4MI 2OJWA 1UELA 5D94A 1TS3A 3BYYB 2K39A 1R4NI 1N6ZA 4ANWA 3MFGA 2KMCA 3GB1A 4F8CB 1WX7A 1YNTE 2JPHA 1B1ZA 4GDLA 1WZ3A 4W9HA 2WXHA 4IUMB 1IGDA 1T0YA 1NI2A 2H88B 3JW0X 1P1AA 2ZCBA 2BB6A 4WQMA 3AN1A 4C80A 1XLQA 1MVKA 1OEYA 3A1QB 2K0PA 4HCPB 1UF0A 1GC7A 2LRUA 3UF8A 3V62A 2WU2B 2RSUA 2JWUA 3KVFB 3AE1B 3X23A 5IA7A 2LJIA 1TBEA 2ICIA 1VR9A 5G5GA 2NPTA 4M00A 4BKTA 1E6EB 1HA5A 1ZOYB 4IW0A 1SIFA 2ZW1A 3DCGA 3NJTA 3TEYA 1OGWA 2RDBC 3A1QA 1E8WA 3HUIA 4E74A 1JMLA 4ZYSA 3H8HA 4RGMA 2MQJA 3N30A 4M8NA 3IFWB 5FKAC 2AYOB 1VCBA 2J7QB 3APFA 3WIMA 1ISNA 2NS5A 3MHZA 1UWXA 3PV1A 4WQOB 4IDIA 1PGAA 4HPMB 1V6EA 1WZ0A 2IJ0A 1CK1A 1SB3C 3X0WA 2L76A 4AOFA 2M19A 3VR9B 2D5GA 2XBBC 2DZKA 2L8JA 2W82A 2HJ8A 1SIJA 3VFKA 2WXJA 2ZNVB 3ML8A 5H8YE 2IO1B 2IYDB 1V5OA 2W54A 2LGIA 1E90A 3PSEB 4RGNA 1V49A 4BKSA 3ZO5B 2PMVA 5IP4D 2GBJA 4NAWB 2KHWB 1P98A 4NJ6A 3EC8A 3RI7C 3SFDB 2YVCA 2LXCA 5CHVC 1ZXHA 4RM8A 5L95C 3W1SA 1I4RA 2N9XA 3H7PA 1I4QA 2JRIB 1TY0A 4C4VB 2WDRB 3ZUNA 2KXJA 3C0RB 4BAXA 1WY8A 3DOWA 2LZ6A 5T8IA 2KLCA 4DHZB 2XN9C 2V4LA 4HCNB 1TKYA 4BKSD 3PZDA 2IGDA 5KHOA 4DBGA 3BVGA 3TL5A 2ASQA 4R3DA 2KDFB 3VTUA 1FMAD 2J0KA 1DOIA 3LXFA 3CWIA 4II2B 4BFRA 1UH6A 2WU5B 5AUIA 4DHJB 3QAQA 4C4VA 2GRIA 3ABVB 4W9LA 4EOYA 1NEKB 1HQRD 3RNCC 5HG2A 2ONQA 2JWZA 4EZKA 3DBLI 1KOTA 2QIEB 1FPYA 4G50A 1N63A 2WXGA 3V05A 1FD6A 3Q14C 1F9JA 4RMAA 1QILA 2GMIC 4HRSA 4I6LB 4NJ7A 4ZRIA 2IBIB 4LNNA 1E5WA 1YIWA 1LXDA 5LXIB 4GSWA 1H8CA 2EELA 2MHJA 2MH7A 2IO3B 3RT3B 3VHTC 3L54A 2LD9A 3FC4A 4M01A 4EUTA 3GP7A 5EE0A 3ZDTA 2AEHA 2K8HA 1FIQA 1WE7A 2O6VD 3GZNB 3KLSX 4GDKB 2R61A 3W5VB 4K7UA 5H92C 4URKA 3P4PB 1WIAA 4K7WA 4W9GA 1WR1A 2INCC 2REXA 2BPSA 1NENB 3RZFA 1KFYB 3QX1A 4K3CA 1OQRA 1XLOA 5CHWA 1VRAB 5E6NA 1RAXA 2JU6X 2MJEA 2WXOA 4I6NB 3IT4B 1ET6A 3PVLA 2J53A 1WH3A 5C23A 1D6EC 1YX6B 3T3NA 3R2IA 3Q8CA 2IO2B 2WGSA 3APDA 4J6IA 2AQ1B 4YXDB 1QLBB 1WYGA 3NOBA 2RPQA 3JSVB 2JRHA 1SE3A 2VZKB 1WXSA 3P4RB 4B0EA 1VZ8A 2NBWB 1ZDVA 1L0VB 2KAJA 2NMQA 4ZOHC 3ZTCA 3AE6B 1V97A 2LUEA 2WXLA 1J7AA 1EU4A 2D3GA 5HKHA 2SAKA 4W9JA 2LWPA 1WJ6A 1WXVA 2MJDA 4G0NB 4FHJA 3E9SA 2CJOA 1N61A 4WJQA 1U4AA 2V4IB 3AE3B 1V1OA 4WJNA 4NAMA 3RD2A 1F0ZA 5BYQA 3PLVA 2KZRA 5G5HA 1FXAA 3J9CA 2LGXA 1KLUD 2C9WB 4RFBA 3OG5A 1NBFC 2AX5A 4IWPA 2WXKA 4KGSA 1PUTA 3IG3A 1FXIA 3ZTDA 2KN4A 1J8CA 2WXRA 3A9JB 1SJHD 4FLHA 4L23A 1GB4A 2KQSA 2M0AA 2K8BA 1OEYJ 3TJPA 2M1MA 2MJ3A 2N9PC 1RFKA 2VZKD 1GAQB 4IWQA 4KDLB 3FAHA 2OHFA 1AARA 3MC0B 1OQYA 3B0AA 1SSNA 1TY2A 4A55A 5D3IB 4WURA 1I35A 2UWQA 3NRZA 3QARA 3O65B 3A9JA 3B2FA 1QKZA 4ANVA 1WJUA 2WNMA 3IT6B 1VJKA 2FCQA 4BKGA 2JYTA 4B6WA 5EE3A 3SR6A 2CU3A 4HPLB 2KDIA 4M02A 2HTHA 4WH4A 3U30A 1BMLC 2BYFA 3ZNHB 3IBEA 2L0TA 1SE9A 4B0MA 1LO5D 1A5RA 4HKZE 1I4HA 4AP4C 2DBYA 1A70A 1IUEA 2Z8LA 2M17A 4CQNA 4G11A 1BXTA 5FR6A 4EKUA 2PEAA 4F7ZA 2D2QA 1F2RC 1P7FA 2WQYB 4OHJA 2KN5A 1PYWD 1ZXIA 2LVOA 4A90A 3ZNGC 3B9JA 1ROEA 1C9FA 3AEFB 1TKEA 3VUWA 3I9V1 3RNFC 3NS1A 4BVUC 3HM3A 3TCAA 1YJJA 3PRZA 4I6PA 3RPFC 4F1SA 1WR6E 4P16A 3V61A 1KH0A 3BYTB 2CHWA 2G4SA 3AE8B 4NY0A 4E71A 2LUMA 5LLIA 3NS8A 2KVZA 2AL6A 3EGRA 3RFZB 2BYTA 4AJWA 3ZRFA 3FILB 2QMTA 3ZKJC 4OZCA 3LB8C 2NVUI 3E56A 2D11A 3VUXA 3VRBB 3ZJTA 4A3PA 1WM2A 4KSKC 2DHZA 2L32A 3BIID 3R8BA 1L0XB 3APCA 1XO3A 3HVDA 4KVGB 4ICVA 1UD7A 2WP9B 1FM0D 4US9A 4P1CC 2JT4B 2EMTA 2DAJA 3PREA 3FILA 2V3PA 3W9CB 4D2KA 3EECA 4BOSC 4ZYNA 4MGYE 2BWFA 3SFEB 4KZ0A 1J0GA 2CS4A 1WF9A 1JWAD 1QT9A 2GB1A 3Q3MC 1E10A 2KJHB 1FNUA 1SXTA 2LGSA 3AEBB 1K52A 2GI9A 3LDZE 1E9MA 4Q2JA 4M0WB 2MP2B 4GMVA 3OAWA 4IM0A 5HI1A 3DBHB 2OJRA 2IGHA 3PLUA 4LK0M 4DXAB 1QQRA 3K9OB 4PS8A 2KTFA 4CYEA 4HJKA 2JF5A 5DCNA 3Q8AA 3RULA 3U7ZA 1EF1A 4JX1C 2L7RA 3KYDD 2PIAA 4EFOA 2BS3B 4C00A 1SE4A 3DBRB 1P0RA 2R2OA 4M0WA 2QJLA 2MP2A 1N62A 3SD5A 4LDTD 2NPTB 2N1VA 1C79A 4WIPA 5BMIA 4LLGM 1ESFA 1I4XA 2Z0DB 2IY1B 2LGYA 2B3AA 1RYJA 2E6XA 1F77A 2LGDA 4KSLC 1JWMD 4TQ1A 4A8XC 3AU4A 1ZE3D 3UIOB 1YOVB 2RDHA 4WWMA 3URYA 4W9EA 1I7HA 3L10B 4XDDA 4HLEA 1SE2A 3GE8C 2MBEA 3ONSA 5FR3A 4W9FA 1C4PA 4W9DA 2BQQA 3PZ8A 4YTNB 1XCTL 5BMHA 1FFVA 4GIVA 2NCNA 3NVWA 1EF5A 4IC7B 4LTUA 1HTOA 3ZJVA 2D10A 1UGJA 2HE7A 2G9HD 3VXWA 2RDGA 4LJOB 3WAPA 2VRRB 2WDQB 3I3TB 4ITKA 1E8XA 3ZNZB 1FNWA 3LYYA 1C3TA 2PLPA 2IY0B 2MBQA 1YN5A 2HD5B 2WYQA 4MJSB 2KJRA 4PYZA 1AN8A 2FBWB 2V9HA 3L13A 1R7SA 3VR8B 4EE2A 1UWMA 2N7JA 3AMZA 3ZDMC 4HKQA 2LMCA 3IXSA 2QSDA 1GG3A 3W5UB 2BTEA 3R66C 3ZVVA 1JRUA 1AYFA 5C1ZA 4HROA 4JGHB 2JZ3B 4DHZE 3H7PB 1XXGA 1ZPSA 1HEZE 1I42A 3AEEB 3ZXVA 3ZYYX 4RF1A 1GUAB 5LXHA 2INDC 4MJSA 2QHOA 1TJEA 2NBVB 1OTRB 1WYWB 1WJ4A 2BBCA 2PPHA 1WM3A 3CSTA 2INPE 1WGKA 4PT5A 4RCOA 3KW5B 3V60A 5J2RA 4MEMA 1QZEA 3ZNID 3C19A 4L1BA 5MPOA 1R4MB 2FCMA 3N20C 2LRWA 3OJ4B 1SJED 4TQ0A 3M95A 1IP9A 1LGRA 2Y5BB 3DWGC 5D2MB 1R4NB 3R7QA 3AEDB 4W9IA 1E8YA 2M56B 1Q0WB 1TT5B 5TSSA 2KJ6A 3BVMA 2O6VB 4II3B 5L83A 3AULA 1IGCA 4NPNA 2XK5B 3UI3A 4HK2A 1YN3A 1SEBD 1T3QA 1GNUA 4DDGD 4AQ7A 4KKJA 5BO4B 2WXNA 4OVZA 4BOZB 4P1BC 2KOXA 3I5JC 2BT6A 3R7RA 3KH0A 2HTME 2G45B 3GOEA 2BW2A 4ARIA 1KF6B 1P7EA 1V86A 1H4RA 4JE3B 3DHGC 2KWUB 1E7UA 2O6VA 1UGMA 5JHAA 2QILA 2XK5A 5IKCM 3P1MA 3MP9A 1CQVA 4M8MA 4RGOS 2AWTA 1YQ4B 5G2NA 4GOCA 2JZPA 3NUHB 1XD3B 3AM9A 3T3OA 4IG7B 2PW9A 3TEXA 1F52A 2X38A 2BKFA 5AZFA 3HM6X 4K3BA 2W3RA 4EZJA 1XT9B 1NYQA 3KQ4A 2LASA 5JH5C 1HTQA 4ASWC 2C5LC 1DYQA 1UZXB 3KUDB 3TBLD 2DENB 3D32A 2C60A 4TMAB 2O2VA 3RYTA 2K1FA 4B9KA 3QWZB 3BK2A 1WGRA 5D7GA 2L52A 1EUVB 2H89B 3TEZA 2IZVB 2W55A 3K9PB 4JL9A 4NZLB 4TSSA 3BVZA 2M8SA 4LCDE 2ZVOA 5CTRC 1ENFA 2V3SA 3U4EG 1KLGD 5BYSA 1FCCC 2FCNA 3Q8EA 2LEKA 4OZAA 2KDBA 3R2TA 1I4GA 2BKRB 2WX0A 3A4SC 1V81A 1KTKA 3HIZA 4RH6A 3ML9A 2ZPNA 1K8RB 3WALA 1RFAA 1QOAA 4NJCA 2W3SA 3O13A 3T9LA 3DVNV 4AS1A 3MC9A 2E3TA 4DXFA 1LQBA 2ZW0A 1IBXA 3CF6E 3PPAA 2FIFA 4DDID 3IAS1 2MCNB 5KHQA 1OQQA 2GOWA 3B2GA 2FNJB 2KK8A 1XCQL 4ZRKA 2L83A 2FUG1 4PYUA 3JVZX 2SEBD 3UQAA 3IHPC 1E0ZA 5D3DA 1CJEA 2J0MA 3U7DA 1P9DU 2GBMA 3MTNB 4XC2A 3V6CB 2B76B 2L05A 2CKHB 3NZSA 4G3XB 3PO0A 2NTSA 2BB5A 2JUOA 2D3BA 3RZWC 2KFJA 2A5UA
chains in the Genus database with same CATH topology
3SDLC 3W1YA 3AU5A 1WRDB 4E74A 1WMHA 3APCA 4KVGB 4EEWA 4ICVA 2MQJA 3N30A 4K7SA 4M8NA 2RR9A 3IFWB 3QCAA 1UD7A 1Z5SB 2KFKB 3QK0A 5EDSA 3DVGY 4A3OA 2WDTB 3VAWA 2AYOB 1VCBA 2LVQA 1RRBA 1WX9A 2JT4B 2CR5A 2J7QB 1HE8A 2EMTA 2DAJA 3APFA 3PREA 4GU2A 1ISNA 3WIMA 3A33B 2NS5A 3DDCB 2WWZA 5G55A 1WX8A 2AL3A 2JXXA 2D07B 3EECA 2LXAA 3PV1A 2C7NB 3P2BA 3KYCD 4W9KA 4WQOB 4ZYNA 4BOSC 2MLBA 1D3ZA 4MGYE 4HPMB 2BWFA 1V6EA 1WZ0A 4KZ0A 3L0WB 1J0GA 2CS4A 5E6OA 4TKNA 1WF9A 3X0WA 2OOBB 4NQKE 4CHKA 2L76A 4MH0E 2KJHB 4BBNC 3HK0A 4AOFA 2KLGA 4XX5A 4ZDVA 3R3MA 2KKCA 4K1RB 2XBBC 3M62B 1V5TA 3DVNU 2DZKA 2L8JA 3DQVA 4MM3A 2MA9B 3CMMB 1NDDA 2HJ8A 3LDZE 3PRMB 3VFKA 2ZNVB 2KFKA 1J19A 4M0WB 3ML8A 1Y8RC 2K6DB 2MP2B 1P3QU 1WJNA 2FAZA 3OAWA 4GMVA 2IO1B 4IM0A 2IYDB 1V5OA 5IAAC 2OJRA 2L00B 5DPTA 3PRPB 1EO6A 4DHJD 2ZVNA 3PLUA 1E90A 3PSEB 2N4FA 4DXAB 1V49A 4BKSA 3K9OB 4PS8A 3QJZA 3ZO5B 4PS7A 2KTFA 4CYEA 2GBJA 4FN2A 4HJKA 4NAWB 2JF5A 2KHWB 2KWCA 1P98A 2WX1A 3EC8A 4NJ6A 5DCNA 2CHZA 2KC1A 4WWNA 2YVCA 4WWPA 2LXCA 1VD2A 5CHVC 3RULA 2MSED 4EZLA 1EF1A 4RM8A 5L95C 2NBUA 2L7RA 3W1SA 3KYDD 4EFOA 3DBRI 2N9XA 3H7PA 2RD0A 4JQWC 4HXDA 2KC2A 1P0RA 3PGEA 2R2OA 2JRIB 2N7DA 4GDKA 1BT0A 2MP2A 3ZUNA 2KXJA 3CSFA 4JLCA 3SD5A 1KM7A 3PT2B 2NPTB 4LDTD 2N1VA 3C0RB 2LJ5A 2CU1A 1WGHA 1WY8A 3DOWA 5J18A 2LZ6A 4DHZB 2KLCA 3QC8B 2V4LA 3AI5A 2KTRB 2N9EB 4HCNB 4BKSD 2Z0DB 1TTNA 2MRPA 3ZIMA 3PZDA 2ZPYA 5KHOA 2IY1B 2ZZPB 4DBGA 4W9CA 2LGYA 4B95A 2B3AA 2BGFA 3TL5A 2ASQA 2C7MB 2DX5B 2KDFB 3N3KB 3VTUA 2LGDA 4KSLC 5TR5A 2J0KA 1UBIA 4TQ1A 4II2B 4BFRA 1UH6A 2DZIA 3AU4A 4DHJB 3UIOB 3VTWA 4ANXA 1YJ1A 2DYBA 3H9DA 3QAQA 2DZMA 4W9EA 1ZGUB 3L10B 4W9LA 4DK5A 4HLEA 1L2NA 4IM2A 2MBEA 2KO3A 3ONSA 4EOYA 2YLMA 2KNBA 4W9FA 2G3QB 5DPRA 3VTVA 4W9DA 3AXCA 2PJHA 2KTRA 2NCNA 3JSVA 1EF5A 4GIVA 2BYEA 4IC7B 2JWZA 4EZKA 1WFYA 3DBLI 4ZRJA 3PHXB 2D10A 1KOTA 2KMAA 4G50A 2HE7A 3VXWA 4LJOB 3WAPA 2VRRB 2KANA 3I3TB 1F9JA 1YD8U 2BWES 2ZJDA 1WGYA 4RMAA 3PTFC 2GMIC 3A9KB 4I6LB 1Z2MA 4NJ7A 2PE9A 2Z59B 1E8XA 2IBIB 4ZRIA 3ZNZB 1E5WA 4LDTB 3UINB 1WI0A 1YIWA 1LXDA 4NNJB 1C3TA 5LXIB 4GSWA 3SU8X 2GBRA 2IY0B 1ZW7A 2MBQA 1Q5WB 4YL8A 1H8CA 4OVUA 2HD5B 2WYQA 4MJSB 2KJRA 3Q3JA 4PYZA 4LJPB 2MW5A 4CO7A 3L08A 4X57B 3VVWB 2BYVE 2IO3B 3L13A 3RT3B 1GJZA 1SGHA 2J0JA 3VHTC 3EFUA 3L54A 3ZDMC 2LD9A 1GG3A 4MSQB 4EUTA 3R66C 3ZVVA 1JRUA 3ZDTA 2G4DB 5C1ZA 2GBNA 4JGHB 2FIDA 2JZ3B 2KX0A 2CHXA 2AEHA 2K8HA 4DHZE 3H1UA 3H7PB 1WE7A 2O6VD 3A9KA 2W9NA 4K81A 1CMXB 4GDKB 2MBBB 4ANUA 4K7UA 3DBHI 4URKA 1I42A 4AWJA 1KJTA 1WIAA 5JZEB 3OLMD 4K7WA 5GMVA 2BF8B 1GUAB 5LXHA 4W9GA 3H6NA 1WE6A 3N32A 1WR1A 1XQQA 3MHSD 4MJSA 2QHOA 2REXA 2BPSA 3T8MA 2NR2A 3RZFA 4GN1A 2NBVB 3QX1A 1OTRB 1V80A 1WYWB 1X1MA 4FJZA 2I1KA 1GC6A 1WJ4A 2PPHA 5CHWA 3QHTA 1WM3A 5E6NA 3CSTA 3W1SC 2I1JA 1WGGA 2JY6A 4PS3A 1RAXA 2MX2A 5CX3A 3KW5B 3WANA 2ZNVC 4I6NB 3V60A 1C1YB 5J2RA 4MEMA 1QZEA 3PVLA 2C7HA 3ZNID 1WH3A 5C23A 4A20A 4RM9A 1YX6B 4FADA 3B08A 2FCMA 4BBNF 2LRWA 2IO2B 3APDA 3OJ4B 1E7VA 4J6IA 4MELA 4TQ0A 3M95A 1IP9A 2Y5BB 5D2MB 1IYFA 3S2AA 3NOBA 2RPQA 3JSVB 2JRHA 3ALBA 3R7QA 4W9IA 1E8YA 1Q0WB 1YQBA 2Z0EB 2A4ZA 3ECIA 2KJ6A 2JZZA 2O6VB 4II3B 4E3CA 1WXSA 3AULA 3B1LX 5AZGA 5L83A 4NPNA 4AJYB 3L17A 2DZJA 2XK5B 3RCZA 3OJ3A 2NBWB 4HK2A 5AZHA 1M94A 1GNUA 2K8CA 1L7YA 4GGQA 4DDGD 4KIKB 5BO4B 3UGBB 3ZTCA 2LUEA 1IPGA 4BOZB 2D3GA 2KVRA 1WXAA 5HKHA 1PQSA 2KOXA 2FUHB 2LWPA 4W9JA 1WJ6A 1WXVA 3H7SA 3NZUA 3R7RA 3KH0A 4G0NB 4FHJA 2UYZB 4MDKE 4WJQA 1U4AA 3VH3B 2G45B 3GOEA 3KUCB 2KWVB 3TMPB 1V86A 4JIOU 1H4RA 4WJNA 2L3ZA 5CHFA 3UQBA 3RD2A 2N7EA 3PLVA 2KWUB 2KZRA 1E7UA 2O6VA 5DPSA 2KDEB 1UGMA 2XEWA 5JHAA 5J17A 2LGXA 2XK5A 2C9WB 5DPWA 1NBFC 2KQ7A 3PS6A 2DAFA 3TIXA 3QIJA 1UBQA 3BY4B 4TV3A 4IWPA 4KIKA 3VUYA 3V6EB 2R2QA 4FJVB 4M8MA 3IG3A 1LFDA 3KUZA 3ZTDA 2AWTA 5G2NA 4WAAA 4N9F4 4GOCA 4WJPA 2V1YA 1XD3B 2ZCCA 1J8CA 4IG7B 3A9JB 3QQ8B 4FLHA 1G6JA 3NY5A 1S1QB 2KQSA 2K8BA 1OEYJ 4MGKE 2K6QA 3M63B 3ZRCA 3TJPA 3DPDA 2ZEQA 2BKFA 5AZFA 3HM6X 1FXTB 3IVFA 4EZJA 4HDOA 1XT9B 2M1MA 1LM8B 4MSMB 2LASA 1V2YA 2N9PC 1TZ1A 5JH5C 4ASWC 2C5LC 1UZXB 3LJ3A 3KUDB 3GZNI 2DENB 3TBLD 3D32A 4IWQA 4KDLB 4FULA 2M4NA 2JVCA 2C60A 1AARA 3HHMA 5E6PA 3VDZA 2O2VA 1OQYA 3B0AA 2K1FA 3RYTA 2DYMA 4B9KA 2K25A 2MWSB 3QWZB 1WGRA 5D7GA 3BINA 3VQIA 1EUVB 3U8ZA 1I35A 2KX3A 2UWQA 2IZVB 2GBKA 4KV2A 4WWOA 3EHVA 4XZ4A 3K9PB 3QARA 4JL9A 4HDQA 3O65B 2MBOA 3A9JA 4MGZE 3RUIB 2LI5A 2M8SA 1WJUA 4ICUA 4ANVA 3Q3FA 4LCDE 3DBSA 4MGIE 2ZVOA 5CTRC 2FCQA 4BKGA 2N1WA 2V3SA 2KD0A 1YX5B 4B6WA 4FBJB 2IO0B 2FCNA 3A4RA 2RGFA 4GDLB 4HPLB 4NQLB 2PE6B 2KDBA 5D6JB 2KDIA 4KDIC 2BKRB 4OVVA 2WX0A 1V9JA 4HWIB 2HTHA 3A4SC 3VH4B 3U30A 4AUQC 1V81A 3HIZA 2BYFA 3ML9A 3ZNHB 5AEKB 2ZPNA 4TUUA 3SHQA 3IBEA 2L0TA 1K8RB 1E8ZA 1SE9A 3WAMA 3WALA 1RFAA 4HVBA 1R4MI 1UELA 4FA6A 5D94A 2MBHA 3L16A 3ZW3A 3WAOA 3WA0A 1A5RA 3T9LA 4FHKA 2K39A 3DVNV 1R4NI 4AP4C 3PHWB 4ANWA 2KMCA 2M17A 4G11A 5FR6A 4EKUA 1LQBA 3MJWA 2PEAA 4F7ZA 4F8CB 3CF6E 1S3SG 1WX7A 4WJOA 1TGZB 2JPHA 2D2QA 2EKEC 2FIFA 3PPAA 4DDID 1KLVA 4GDLA 2MCNB 5KHQA 1WZ3A 4W9HA 4IUMB 2GOWA 2KN5A 1T0YA 1NI2A 2LVPA 2LVOA 3JW0X 2FNJB 4IM3A 3ZNGC 2KK8A 2EMSA 4KZCA 1P1AA 1RLFA 2ZCBA 3VUWA 1MG8A 3NHEB 1WXMA 4ZRKA 4BVUC 4NAWA 3HM3A 3TCAA 5JHBA 1OEYA 4PYUA 4GB9A 3UIPB 3A1QB 3JVZX 3PRZA 4I6PA 4F1SA 1WGDA 1WR6E 4P7IA 3V61A 4HCPB 1WMHB 1GC7A 3ZLZA 2CHWA 2LRUA 3UF8A 3V62A 2G4SA 2RSUA 4NY0A 3KVFB 4GXBA 2FCSA 3X23A 3UQAA 4E71A 5LLIA 3NS8A 5IA7A 3IHPC 3DVGX 2AL6A 2DYOA 2L0FA 1ZKHA 4DWFA 4FJYA 4IWOA 2M0XA 1TBEA 2J0MA 3JYUA 3U7DA 1Q1OA 1P9DU 4AJWA 3ZRFA 2GBMA 3MTNB 4XC2A 3V6CB 3ZKJC 2L05A 2CKHB 3NZSA 4G3XB 3ENEA 2NPTA 4BKTA 3QA8A 3M3JA 2NVUI 2JUOA 2O2VB 2D11A 4IW0A 3VUXA 1SIFA 3DCGA 4A3PA 1WM2A 4KSKC 1OGWA 3A1QA 2DHZA 1E8WA 3RZWC 2KFJA 2A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDL C;  3W1Y A;  3AU5 A;  1WRD B;  4E74 A;  1WMH A;  3APC A;  4KVG B;  4EEW A;  4ICV A;  2MQJ A;  3N30 A;  4K7S A;  4M8N A;  2RR9 A;  3IFW B;  3QCA A;  1UD7 A;  1Z5S B;  2KFK B;  3QK0 A;  5EDS A;  3DVG Y;  4A3O A;  2WDT B;  3VAW A;  2AYO B;  1VCB A;  2LVQ A;  1RRB A;  1WX9 A;  2JT4 B;  2CR5 A;  2J7Q B;  1HE8 A;  2EMT A;  2DAJ A;  3APF A;  3PRE A;  4GU2 A;  1ISN A;  3WIM A;  3A33 B;  2NS5 A;  3DDC B;  2WWZ A;  5G55 A;  1WX8 A;  2AL3 A;  2JXX A;  2D07 B;  3EEC A;  2LXA A;  3PV1 A;  2C7N B;  3P2B A;  3KYC D;  4W9K A;  4WQO B;  4ZYN A;  4BOS C;  2MLB A;  1D3Z A;  4MGY E;  4HPM B;  2BWF A;  1V6E A;  1WZ0 A;  4KZ0 A;  3L0W B;  1J0G A;  2CS4 A;  5E6O A;  4TKN A;  1WF9 A;  3X0W A;  2OOB B;  4NQK E;  4CHK A;  2L76 A;  4MH0 E;  2KJH B;  4BBN C;  3HK0 A;  4AOF A;  2KLG A;  4XX5 A;  4ZDV A;  3R3M A;  2KKC A;  4K1R B;  2XBB C;  3M62 B;  1V5T A;  3DVN U;  2DZK A;  2L8J A;  3DQV A;  4MM3 A;  2MA9 B;  3CMM B;  1NDD A;  2HJ8 A;  3LDZ E;  3PRM B;  3VFK A;  2ZNV B;  2KFK A;  1J19 A;  4M0W B;  3ML8 A;  1Y8R C;  2K6D B;  2MP2 B;  1P3Q U;  1WJN A;  2FAZ A;  3OAW A;  4GMV A;  2IO1 B;  4IM0 A;  2IYD B;  1V5O A;  5IAA C;  2OJR A;  2L00 B;  5DPT A;  3PRP B;  1EO6 A;  4DHJ D;  2ZVN A;  3PLU A;  1E90 A;  3PSE B;  2N4F A;  4DXA B;  1V49 A;  4BKS A;  3K9O B;  4PS8 A;  3QJZ A;  3ZO5 B;  4PS7 A;  2KTF A;  4CYE A;  2GBJ A;  4FN2 A;  4HJK A;  4NAW B;  2JF5 A;  2KHW B;  2KWC A;  1P98 A;  2WX1 A;  3EC8 A;  4NJ6 A;  5DCN A;  2CHZ A;  2KC1 A;  4WWN A;  2YVC A;  4WWP A;  2LXC A;  1VD2 A;  5CHV C;  3RUL A;  2MSE D;  4EZL A;  1EF1 A;  4RM8 A;  5L95 C;  2NBU A;  2L7R A;  3W1S A;  3KYD D;  4EFO A;  3DBR I;  2N9X A;  3H7P A;  2RD0 A;  4JQW C;  4HXD A;  2KC2 A;  1P0R A;  3PGE A;  2R2O A;  2JRI B;  2N7D A;  4GDK A;  1BT0 A;  2MP2 A;  3ZUN A;  2KXJ A;  3CSF A;  4JLC A;  3SD5 A;  1KM7 A;  3PT2 B;  2NPT B;  4LDT D;  2N1V A;  3C0R B;  2LJ5 A;  2CU1 A;  1WGH A;  1WY8 A;  3DOW A;  5J18 A;  2LZ6 A;  4DHZ B;  2KLC A;  3QC8 B;  2V4L A;  3AI5 A;  2KTR B;  2N9E B;  4HCN B;  4BKS D;  2Z0D B;  1TTN A;  2MRP A;  3ZIM A;  3PZD A;  2ZPY A;  5KHO A;  2IY1 B;  2ZZP B;  4DBG A;  4W9C A;  2LGY A;  4B95 A;  2B3A A;  2BGF A;  3TL5 A;  2ASQ A;  2C7M B;  2DX5 B;  2KDF B;  3N3K B;  3VTU A;  2LGD A;  4KSL C;  5TR5 A;  2J0K A;  1UBI A;  4TQ1 A;  4II2 B;  4BFR A;  1UH6 A;  2DZI A;  3AU4 A;  4DHJ B;  3UIO B;  3VTW A;  4ANX A;  1YJ1 A;  2DYB A;  3H9D A;  3QAQ A;  2DZM A;  4W9E A;  1ZGU B;  3L10 B;  4W9L A;  4DK5 A;  4HLE A;  1L2N A;  4IM2 A;  2MBE A;  2KO3 A;  3ONS A;  4EOY A;  2YLM A;  2KNB A;  4W9F A;  2G3Q B;  5DPR A;  3VTV A;  4W9D A;  3AXC A;  2PJH A;  2KTR A;  2NCN A;  3JSV A;  1EF5 A;  4GIV A;  2BYE A;  4IC7 B;  2JWZ A;  4EZK A;  1WFY A;  3DBL I;  4ZRJ A;  3PHX B;  2D10 A;  1KOT A;  2KMA A;  4G50 A;  2HE7 A;  3VXW A;  4LJO B;  3WAP A;  2VRR B;  2KAN A;  3I3T B;  1F9J A;  1YD8 U;  2BWE S;  2ZJD A;  1WGY A;  4RMA A;  3PTF C;  2GMI C;  3A9K B;  4I6L B;  1Z2M A;  4NJ7 A;  2PE9 A;  2Z59 B;  1E8X A;  2IBI B;  4ZRI A;  3ZNZ B;  1E5W A;  4LDT B;  3UIN B;  1WI0 A;  1YIW A;  1LXD A;  4NNJ B;  1C3T A;  5LXI B;  4GSW A;  3SU8 X;  2GBR A;  2IY0 B;  1ZW7 A;  2MBQ A;  1Q5W B;  4YL8 A;  1H8C A;  4OVU A;  2HD5 B;  2WYQ A;  4MJS B;  2KJR A;  3Q3J A;  4PYZ A;  4LJP B;  2MW5 A;  4CO7 A;  3L08 A;  4X57 B;  3VVW B;  2BYV E;  2IO3 B;  3L13 A;  3RT3 B;  1GJZ A;  1SGH A;  2J0J A;  3VHT C;  3EFU A;  3L54 A;  3ZDM C;  2LD9 A;  1GG3 A;  4MSQ B;  4EUT A;  3R66 C;  3ZVV A;  1JRU A;  3ZDT A;  2G4D B;  5C1Z A;  2GBN A;  4JGH B;  2FID A;  2JZ3 B;  2KX0 A;  2CHX A;  2AEH A;  2K8H A;  4DHZ E;  3H1U A;  3H7P B;  1WE7 A;  2O6V D;  3A9K A;  2W9N A;  4K81 A;  1CMX B;  4GDK B;  2MBB B;  4ANU A;  4K7U A;  3DBH I;  4URK A;  1I42 A;  4AWJ A;  1KJT A;  1WIA A;  5JZE B;  3OLM D;  4K7W A;  5GMV A;  2BF8 B;  1GUA B;  5LXH A;  4W9G A;  3H6N A;  1WE6 A;  3N32 A;  1WR1 A;  1XQQ A;  3MHS D;  4MJS A;  2QHO A;  2REX A;  2BPS A;  3T8M A;  2NR2 A;  3RZF A;  4GN1 A;  2NBV B;  3QX1 A;  1OTR B;  1V80 A;  1WYW B;  1X1M A;  4FJZ A;  2I1K A;  1GC6 A;  1WJ4 A;  2PPH A;  5CHW A;  3QHT A;  1WM3 A;  5E6N A;  3CST A;  3W1S C;  2I1J A;  1WGG A;  2JY6 A;  4PS3 A;  1RAX A;  2MX2 A;  5CX3 A;  3KW5 B;  3WAN A;  2ZNV C;  4I6N B;  3V60 A;  1C1Y B;  5J2R A;  4MEM A;  1QZE A;  3PVL A;  2C7H A;  3ZNI D;  1WH3 A;  5C23 A;  4A20 A;  4RM9 A;  1YX6 B;  4FAD A;  3B08 A;  2FCM A;  4BBN F;  2LRW A;  2IO2 B;  3APD A;  3OJ4 B;  1E7V A;  4J6I A;  4MEL A;  4TQ0 A;  3M95 A;  1IP9 A;  2Y5B B;  5D2M B;  1IYF A;  3S2A A;  3NOB A;  2RPQ A;  3JSV B;  2JRH A;  3ALB A;  3R7Q A;  4W9I A;  1E8Y A;  1Q0W B;  1YQB A;  2Z0E B;  2A4Z A;  3ECI A;  2KJ6 A;  2JZZ A;  2O6V B;  4II3 B;  4E3C A;  1WXS A;  3AUL A;  3B1L X;  5AZG A;  5L83 A;  4NPN A;  4AJY B;  3L17 A;  2DZJ A;  2XK5 B;  3RCZ A;  3OJ3 A;  2NBW B;  4HK2 A;  5AZH A;  1M94 A;  1GNU A;  2K8C A;  1L7Y A;  4GGQ A;  4DDG D;  4KIK B;  5BO4 B;  3UGB B;  3ZTC A;  2LUE A;  1IPG A;  4BOZ B;  2D3G A;  2KVR A;  1WXA A;  5HKH A;  1PQS A;  2KOX A;  2FUH B;  2LWP A;  4W9J A;  1WJ6 A;  1WXV A;  3H7S A;  3NZU A;  3R7R A;  3KH0 A;  4G0N B;  4FHJ A;  2UYZ B;  4MDK E;  4WJQ A;  1U4A A;  3VH3 B;  2G45 B;  3GOE A;  3KUC B;  2KWV B;  3TMP B;  1V86 A;  4JIO U;  1H4R A;  4WJN A;  2L3Z A;  5CHF A;  3UQB A;  3RD2 A;  2N7E A;  3PLV A;  2KWU B;  2KZR A;  1E7U A;  2O6V A;  5DPS A;  2KDE B;  1UGM A;  2XEW A;  5JHA A;  5J17 A;  2LGX A;  2XK5 A;  2C9W B;  5DPW A;  1NBF C;  2KQ7 A;  3PS6 A;  2DAF A;  3TIX A;  3QIJ A;  1UBQ A;  3BY4 B;  4TV3 A;  4IWP A;  4KIK A;  3VUY A;  3V6E B;  2R2Q A;  4FJV B;  4M8M A;  3IG3 A;  1LFD A;  3KUZ A;  3ZTD A;  2AWT A;  5G2N A;  4WAA A;  4N9F 4;  4GOC A;  4WJP A;  2V1Y A;  1XD3 B;  2ZCC A;  1J8C A;  4IG7 B;  3A9J B;  3QQ8 B;  4FLH A;  1G6J A;  3NY5 A;  1S1Q B;  2KQS A;  2K8B A;  1OEY J;  4MGK E;  2K6Q A;  3M63 B;  3ZRC A;  3TJP A;  3DPD A;  2ZEQ A;  2BKF A;  5AZF A;  3HM6 X;  1FXT B;  3IVF A;  4EZJ A;  4HDO A;  1XT9 B;  2M1M A;  1LM8 B;  4MSM B;  2LAS A;  1V2Y A;  2N9P C;  1TZ1 A;  5JH5 C;  4ASW C;  2C5L C;  1UZX B;  3LJ3 A;  3KUD B;  3GZN I;  2DEN B;  3TBL D;  3D32 A;  4IWQ A;  4KDL B;  4FUL A;  2M4N A;  2JVC A;  2C60 A;  1AAR A;  3HHM A;  5E6P A;  3VDZ A;  2O2V A;  1OQY A;  3B0A A;  2K1F A;  3RYT A;  2DYM A;  4B9K A;  2K25 A;  2MWS B;  3QWZ B;  1WGR A;  5D7G A;  3BIN A;  3VQI A;  1EUV B;  3U8Z A;  1I35 A;  2KX3 A;  2UWQ A;  2IZV B;  2GBK A;  4KV2 A;  4WWO A;  3EHV A;  4XZ4 A;  3K9P B;  3QAR A;  4JL9 A;  4HDQ A;  3O65 B;  2MBO A;  3A9J A;  4MGZ E;  3RUI B;  2LI5 A;  2M8S A;  1WJU A;  4ICU A;  4ANV A;  3Q3F A;  4LCD E;  3DBS A;  4MGI E;  2ZVO A;  5CTR C;  2FCQ A;  4BKG A;  2N1W A;  2V3S A;  2KD0 A;  1YX5 B;  4B6W A;  4FBJ B;  2IO0 B;  2FCN A;  3A4R A;  2RGF A;  4GDL B;  4HPL B;  4NQL B;  2PE6 B;  2KDB A;  5D6J B;  2KDI A;  4KDI C;  2BKR B;  4OVV A;  2WX0 A;  1V9J A;  4HWI B;  2HTH A;  3A4S C;  3VH4 B;  3U30 A;  4AUQ C;  1V81 A;  3HIZ A;  2BYF A;  3ML9 A;  3ZNH B;  5AEK B;  2ZPN A;  4TUU A;  3SHQ A;  3IBE A;  2L0T A;  1K8R B;  1E8Z A;  1SE9 A;  3WAM A;  3WAL A;  1RFA A;  4HVB A;  1R4M I;  1UEL A;  4FA6 A;  5D94 A;  2MBH A;  3L16 A;  3ZW3 A;  3WAO A;  3WA0 A;  1A5R A;  3T9L A;  4FHK A;  2K39 A;  3DVN V;  1R4N I;  4AP4 C;  3PHW B;  4ANW A;  2KMC A;  2M17 A;  4G11 A;  5FR6 A;  4EKU A;  1LQB A;  3MJW A;  2PEA A;  4F7Z A;  4F8C B;  3CF6 E;  1S3S G;  1WX7 A;  4WJO A;  1TGZ B;  2JPH A;  2D2Q A;  2EKE C;  2FIF A;  3PPA A;  4DDI D;  1KLV A;  4GDL A;  2MCN B;  5KHQ A;  1WZ3 A;  4W9H A;  4IUM B;  2GOW A;  2KN5 A;  1T0Y A;  1NI2 A;  2LVP A;  2LVO A;  3JW0 X;  2FNJ B;  4IM3 A;  3ZNG C;  2KK8 A;  2EMS A;  4KZC A;  1P1A A;  1RLF A;  2ZCB A;  3VUW A;  1MG8 A;  3NHE B;  1WXM A;  4ZRK A;  4BVU C;  4NAW A;  3HM3 A;  3TCA A;  5JHB A;  1OEY A;  4PYU A;  4GB9 A;  3UIP B;  3A1Q B;  3JVZ X;  3PRZ A;  4I6P A;  4F1S A;  1WGD A;  1WR6 E;  4P7I A;  3V61 A;  4HCP B;  1WMH B;  1GC7 A;  3ZLZ A;  2CHW A;  2LRU A;  3UF8 A;  3V62 A;  2G4S A;  2RSU A;  4NY0 A;  3KVF B;  4GXB A;  2FCS A;  3X23 A;  3UQA A;  4E71 A;  5LLI A;  3NS8 A;  5IA7 A;  3IHP C;  3DVG X;  2AL6 A;  2DYO A;  2L0F A;  1ZKH A;  4DWF A;  4FJY A;  4IWO A;  2M0X A;  1TBE A;  2J0M A;  3JYU A;  3U7D A;  1Q1O A;  1P9D U;  4AJW A;  3ZRF A;  2GBM A;  3MTN B;  4XC2 A;  3V6C B;  3ZKJ C;  2L05 A;  2CKH B;  3NZS A;  4G3X B;  3ENE A;  2NPT A;  4BKT A;  3QA8 A;  3M3J A;  2NVU I;  2JUO A;  2O2V B;  2D11 A;  4IW0 A;  3VUX A;  1SIF A;  3DCG A;  4A3P A;  1WM2 A;  4KSK C;  1OGW A;  3A1Q A;  2DHZ A;  1E8W A;  3RZW C;  2KFJ A;  2A5U A; 
#chains in the Genus database with same CATH topology
 3W1Y A;  1WRD B;  1DOX A;  1ZP0 B;  1QOF A;  4K7S A;  4MM3 B;  2BS2 B;  2RR9 A;  4ZRQ A;  1Z5S B;  3GS2 A;  4N59 A;  2J52 A;  1C4A A;  3DVG Y;  3Q3O C;  4PK1 A;  1WX9 A;  2CR5 A;  2KWD A;  3AH7 A;  2QEJ C;  3DDC B;  1C76 A;  2AL3 A;  4W9K A;  3U52 E;  1AWD A;  1KLV A;  1BUI C;  4S17 A;  2MLB A;  3AEG B;  4N6E B;  5E6O A;  4L2Y A;  4NQK E;  1EWC A;  2KLG A;  1EU3 A;  4ZDV A;  2KKC A;  2X8X X;  3P42 A;  3M62 B;  1V5T A;  4MM3 A;  2MA9 B;  1NDD A;  3CIR B;  2DNF A;  1J19 A;  2UU7 A;  2K6D B;  3ETR A;  1FNV A;  1P3Q U;  2IDY A;  1TS5 A;  5HHD G;  2L00 B;  5DPT A;  2ZVN A;  4US8 A;  2XNA C;  1MJD A;  3QJZ A;  3KWV A;  4FN2 A;  5C3J B;  1I4P A;  2WX1 A;  2CHZ A;  4WWN A;  4WWP A;  2JSV X;  1VD2 A;  1ZDX A;  4EZL A;  2NBU A;  1JAL A;  1K53 A;  3L4P A;  3DBR I;  4JQW C;  4HXD A;  2KC2 A;  3PGE A;  4RGT A;  2N7D A;  2V3N A;  4KX6 B;  1QOB A;  1BT0 A;  4JLC A;  3CSF A;  1KM7 A;  1XF5 L;  2AQ3 B;  3PT2 B;  5LNK 1;  2CU1 A;  1WGH A;  5J18 A;  4FXC A;  1V1P B;  2Y5P A;  2KTR B;  2N9E B;  3AEA B;  2MRP A;  4KGR A;  3ZIM A;  1MG4 A;  2ZPY A;  3MJ5 A;  4W9C A;  4JPS A;  2BGF A;  2KDM A;  5IN7 A;  5TR5 A;  1UBI A;  1VZ7 A;  2EKI A;  3VTW A;  4ANX A;  2DZM A;  2K3U A;  4DK5 A;  2YLM A;  2LHE A;  2G3Q B;  1PFD A;  3VTV A;  2N0S B;  1V1P A;  4LNI A;  3AE4 B;  2RMM A;  1JCK B;  2KTR A;  2BYE A;  1PGB A;  4ZRJ A;  4ARC A;  2KMA A;  3TSS A;  3N9Y C;  3HVZ A;  1YD8 U;  3PTF C;  1T6B X;  1KRH A;  4LDT B;  3UIN B;  1WI0 A;  3SU8 X;  1ET9 A;  4OVU A;  1GB1 A;  1JRP A;  3VVW B;  4P6V F;  1SGH A;  1STE A;  2J0J A;  5FK9 C;  4MSQ B;  4LNF A;  2G4D B;  2PTL A;  3DHI C;  2FID A;  2KX0 A;  2CHX A;  3AE7 B;  4YSY B;  2W9N A;  4K81 A;  4ANU A;  2G1E A;  1KJT A;  5JZE B;  3OLM D;  2BF8 B;  1ACC A;  3N32 A;  1TIF A;  1XQQ A;  3MHS D;  1WRI A;  4GN1 A;  1V80 A;  1X1M A;  4FJZ A;  2JXT A;  1JRO A;  3QHT A;  2Y3A A;  1GPX A;  2I1J A;  3RNE C;  2MX2 A;  3WAN A;  2QDF A;  3TEW A;  5E6J A;  1XLP A;  1YQ3 B;  2QCZ A;  4A20 A;  3ZJU A;  3NZ3 A;  4RM9 A;  1WSP A;  1EWY C;  2N9L A;  2BVC A;  1N5X A;  1E7V A;  4A9A A;  4MH8 A;  1IYF A;  3S2A A;  2Z0E B;  3ECI A;  2JZZ A;  1C78 A;  4XE0 A;  5AZG A;  2DLB A;  3L17 A;  3RCZ A;  5AZH A;  2WXQ A;  4C7Z A;  1L7Y A;  4GGQ A;  1FO4 A;  4KIK B;  2KVR A;  2K9X A;  3AEC B;  3N1Y C;  1SF0 A;  2FUH B;  3NZU A;  2HJ1 A;  3AE5 B;  4C56 C;  2UYZ B;  3NVV A;  1YN4 A;  2KWV B;  1HZ6 A;  4JIO U;  3UQB A;  2D3A A;  5DPS A;  1ZUD 2;  1D5Z C;  2INN E;  5J17 A;  2CJN A;  2K5P A;  2I2Y A;  2ACZ B;  5DPW A;  4YWG G;  2DAF A;  3TIX A;  1GOZ A;  3QIJ A;  1JWB D;  1UBQ A;  1RM6 C;  2K22 A;  4KIK A;  3V6E B;  2IGG A;  1LFD A;  2WDV B;  4WJP A;  2D3C A;  2V1Y A;  3DHH C;  2J42 A;  3QQ8 B;  2AQ2 B;  3EUB 2;  3NY5 A;  1T0S C;  3M63 B;  1FCL A;  1FXT B;  2LFI A;  3IVF A;  2Y5C A;  1VLB A;  1V2Y A;  3GZN I;  1TYG B;  4XGA B;  4A6Q A;  2M4N A;  2JVC A;  4HPP A;  3HHM A;  5E6P A;  3VDZ A;  2DYM A;  1YMH E;  3VQI A;  2V0G A;  4N58 A;  4KV2 A;  2GBK A;  4WWO A;  3EHV A;  1YJI A;  5EE1 A;  3RUI B;  2N9K A;  2KD0 A;  2IO0 B;  3A4R A;  2RGF A;  4YSZ B;  1FRR A;  4KDI C;  4OVV A;  1V9J A;  4HWI B;  4WAF A;  2KYW A;  1E8Z A;  4ZRP A;  4YTM B;  4HVB A;  1C77 A;  2J4X A;  4FA6 A;  2MBH A;  3L16 A;  3ZW3 A;  3WAO A;  3WA0 A;  4FHK A;  3PHW B;  1QF6 A;  3MJW A;  3Q2A C;  5BMG A;  1S3S G;  4WJO A;  1TGZ B;  2EKE C;  1N60 A;  2LVP A;  4REZ A;  4IM3 A;  4KGT A;  2EMS A;  4KZC A;  2VH2 A;  1RLF A;  1MFW A;  1FEH A;  1MG8 A;  3NHE B;  1WXM A;  4NAW A;  5JHB A;  2MEK A;  4GB9 A;  3UIP B;  1WGD A;  2WS3 B;  4P7I A;  1WMH B;  3ZLZ A;  3N1Z C;  3EA6 A;  4GXB A;  1VDV A;  2FCS A;  3DVG X;  2DYO A;  1HXY D;  2L0F A;  1ZKH A;  4DWF A;  4FJY A;  4IWO A;  2M0X A;  3JYU A;  3N1X C;  1Q1O A;  5C2T B;  3NVZ A;  3WCQ A;  3ENE A;  3RNA C;  2HDE A;  3QA8 A;  3M3J A;  2O2V B;  2IPK D;  3RNB C;  4MEL A;  1HZ5 A;  3SDL C;  3AU5 A;  1WMH A;  1Y56 A;  3RN9 C;  4HEA 1;  4EEW A;  1XEE A;  3QCA A;  4DQO C;  1MHH E;  2KFK B;  3PZ7 A;  3QK0 A;  5EDS A;  4A3O A;  2WDT B;  3VAW A;  2LVQ A;  3RNG C;  1RRB A;  3P63 A;  1HE8 A;  4GU2 A;  3A33 B;  2WWZ A;  5G55 A;  1WX8 A;  1N5W A;  2JXX A;  5JXV A;  2D07 B;  2LXA A;  2C7N B;  3P2B A;  3KYC D;  4UDU C;  1D3Z A;  4GLS C;  3W2D A;  1FFU A;  3L0W B;  4YTP B;  4LNK A;  4TKN A;  1CZP A;  3Q6B A;  1DGJ A;  5GXG B;  2OOB B;  4CHK A;  1XLN A;  4MH0 E;  2WXF A;  2JX5 A;  3GE3 C;  4BBN C;  1J7C A;  3HK0 A;  4XX5 A;  1L5P A;  3R3M A;  1T0R C;  1PDX A;  4K1R B;  3DVN U;  1IBX B;  3DQV A;  3CMM B;  3PRM B;  2KFK A;  4BZA A;  1Y8R C;  1WJN A;  1C4C A;  2FAZ A;  5IAA C;  3AB5 A;  3PRP B;  1E7P B;  1EO6 A;  4IOI E;  4DHJ D;  2KMM A;  2N4F A;  4PS7 A;  2KWC A;  3KWL A;  4RNA A;  2WXP A;  1D4B A;  2KC1 A;  2KAC A;  5EE9 A;  2MSE D;  1T5X D;  3P4Q B;  4ACF A;  2RD0 A;  3Q8B A;  4YT0 B;  4GDK A;  3NG0 A;  2LHD A;  1VZ6 A;  2OED A;  4MT5 A;  2VH1 A;  2LJ5 A;  2PVG C;  3QC8 B;  3AI5 A;  3DWM A;  1TTN A;  2ZZP B;  4LNO A;  4B95 A;  2C7M B;  2DX5 B;  3N3K B;  1V8C A;  1QOG A;  2DZI A;  4YSX B;  3I63 C;  1YJ1 A;  4HJG E;  2DYB A;  3H9D A;  1ZGU B;  1L2N A;  4IM2 A;  2KO3 A;  2KNB A;  5DPR A;  3BK1 A;  3ZQ4 A;  2PVO D;  3IAM 1;  1TS4 A;  3AXC A;  2PJH A;  3JSV A;  4H2A A;  1WFY A;  3PHX B;  3DBL B;  2KAN A;  2BWE S;  2ZJD A;  5HFY A;  1WGY A;  3A9K B;  1Z2M A;  2PE9 A;  2Z59 B;  1T0Q C;  4NNJ B;  2GBR A;  3P4S B;  1ZW7 A;  4YL8 A;  1Q5W B;  1L6U A;  3Q3J A;  4LJP B;  2MW5 A;  4CO7 A;  3L08 A;  4X57 B;  2BYV E;  4DXG A;  1GJZ A;  1NVI D;  2BS4 B;  3EFU A;  4OW0 A;  1UUP A;  1TS2 A;  2GBN A;  4ZHP A;  2DWQ A;  5IO9 A;  2YEP F;  3H1U A;  2ON8 A;  4QAY A;  3A9K A;  1TKG A;  1CMX B;  2I38 A;  2MBB B;  3DBH I;  1DOY A;  1AW7 A;  4AWJ A;  1D5M C;  5GMV A;  4C7Y A;  3ZGZ A;  1D5X C;  4O1N A;  3H6N A;  1WE6 A;  3T8M A;  5I4D A;  1MPE A;  2NR2 A;  2I1K A;  1GC6 A;  5AUK A;  1B9R A;  1L6V A;  1JWS D;  3ZXR A;  3TUO A;  4XWT A;  3W1S C;  3V3X A;  2NTT A;  3MC8 A;  1WGG A;  2JY6 A;  4PS3 A;  4OZB A;  5BYR A;  5CX3 A;  1MHX A;  2ZNV C;  1EM7 A;  3AV8 A;  1OFF A;  2RPV A;  1C1Y B;  2L1A A;  2C7H A;  3AE9 B;  5IOI A;  4FAD A;  3B08 A;  4IKG A;  4BBN F;  3Q8F A;  2KQ4 X;  2WLB A;  2QC8 A;  4XYC A;  3U2S C;  3ALB A;  1YQB A;  2A4Z A;  4E3C A;  3B1L X;  2WHI A;  4AJY B;  2DZJ A;  1JWU D;  2YEP B;  3OJ3 A;  2WXM A;  1FRD A;  1NYR A;  4ZHO A;  1M94 A;  3RMK C;  3I57 A;  2K8C A;  1JW9 D;  3UGB B;  1M4V A;  1IPG A;  1WXA A;  1PQS A;  3H7S A;  1WWT A;  4MDK E;  3VH3 B;  3KUC B;  4JWS C;  3TMP B;  2L3Z A;  5CHF A;  2N7E A;  4KKI A;  3OWE B;  2KDE B;  2XEW A;  3SEB A;  1L0Y B;  2WXI A;  4MAC A;  2GLS A;  2KQ7 A;  3PS6 A;  3BY4 B;  4TV3 A;  3VUY A;  4J3O D;  2JQR B;  1RWS A;  2R2Q A;  1MI0 A;  4FJV B;  3KUZ A;  4WAA A;  4N9F 4;  1PGX A;  2ZCC A;  4XWW A;  1G6J A;  1S1Q B;  4MGK E;  2K6Q A;  3ZRC A;  3DPD A;  2ZEQ A;  2Q5W D;  2KT7 A;  4HDO A;  1LM8 B;  4MSM B;  1WXQ A;  2FE8 A;  3HRD D;  1TZ1 A;  3LJ3 A;  1K50 A;  3FKY A;  4FUL A;  4S0R A;  1J7B A;  3NVY A;  1F1H A;  2K25 A;  2MWS B;  3Q3N C;  3C8Y A;  3BIN A;  3U8Z A;  2KX3 A;  1SBB B;  4XZ4 A;  4HDQ A;  2MBO A;  4MGZ E;  3AE2 B;  2LI5 A;  1Q10 A;  2PKO A;  4ICU A;  4XDC A;  3Q3F A;  4MGI E;  3DBS A;  1K51 A;  1TZO A;  2N1W A;  1YX5 B;  3VRA B;  4FBJ B;  3Q69 A;  1F2R I;  1L4D B;  2JYE A;  1NI3 A;  4GDL B;  2PE6 B;  4NQL B;  5D6J B;  1UNS A;  4USA A;  4JWU C;  3VH4 B;  4AUQ C;  2TSS A;  5AEK B;  4TUU A;  3SHQ A;  1JQ4 A;  4RF0 A;  3EFC A;  3WAM A;  1L4Z B;  3BWU D;  3BZD B;  1R4M I;  2OJW A;  1UEL A;  5D94 A;  1TS3 A;  3BYY B;  2K39 A;  1R4N I;  1N6Z A;  4ANW A;  3MFG A;  2KMC A;  3GB1 A;  4F8C B;  1WX7 A;  1YNT E;  2JPH A;  1B1Z A;  4GDL A;  1WZ3 A;  4W9H A;  2WXH A;  4IUM B;  1IGD A;  1T0Y A;  1NI2 A;  2H88 B;  3JW0 X;  1P1A A;  2ZCB A;  2BB6 A;  4WQM A;  3AN1 A;  4C80 A;  1XLQ A;  1MVK A;  1OEY A;  3A1Q B;  2K0P A;  4HCP B;  1UF0 A;  1GC7 A;  2LRU A;  3UF8 A;  3V62 A;  2WU2 B;  2RSU A;  2JWU A;  3KVF B;  3AE1 B;  3X23 A;  5IA7 A;  2LJI A;  1TBE A;  2ICI A;  1VR9 A;  5G5G A;  2NPT A;  4M00 A;  4BKT A;  1E6E B;  1HA5 A;  1ZOY B;  4IW0 A;  1SIF A;  2ZW1 A;  3DCG A;  3NJT A;  3TEY A;  1OGW A;  2RDB C;  3A1Q A;  1E8W A;  3HUI A;  4E74 A;  1JML A;  4ZYS A;  3H8H A;  4RGM A;  2MQJ A;  3N30 A;  4M8N A;  3IFW B;  5FKA C;  2AYO B;  1VCB A;  2J7Q B;  3APF A;  3WIM A;  1ISN A;  2NS5 A;  3MHZ A;  1UWX A;  3PV1 A;  4WQO B;  4IDI A;  1PGA A;  4HPM B;  1V6E A;  1WZ0 A;  2IJ0 A;  1CK1 A;  1SB3 C;  3X0W A;  2L76 A;  4AOF A;  2M19 A;  3VR9 B;  2D5G A;  2XBB C;  2DZK A;  2L8J A;  2W82 A;  2HJ8 A;  1SIJ A;  3VFK A;  2WXJ A;  2ZNV B;  3ML8 A;  5H8Y E;  2IO1 B;  2IYD B;  1V5O A;  2W54 A;  2LGI A;  1E90 A;  3PSE B;  4RGN A;  1V49 A;  4BKS A;  3ZO5 B;  2PMV A;  5IP4 D;  2GBJ A;  4NAW B;  2KHW B;  1P98 A;  4NJ6 A;  3EC8 A;  3RI7 C;  3SFD B;  2YVC A;  2LXC A;  5CHV C;  1ZXH A;  4RM8 A;  5L95 C;  3W1S A;  1I4R A;  2N9X A;  3H7P A;  1I4Q A;  2JRI B;  1TY0 A;  4C4V B;  2WDR B;  3ZUN A;  2KXJ A;  3C0R B;  4BAX A;  1WY8 A;  3DOW A;  2LZ6 A;  5T8I A;  2KLC A;  4DHZ B;  2XN9 C;  2V4L A;  4HCN B;  1TKY A;  4BKS D;  3PZD A;  2IGD A;  5KHO A;  4DBG A;  3BVG A;  3TL5 A;  2ASQ A;  4R3D A;  2KDF B;  3VTU A;  1FMA D;  2J0K A;  1DOI A;  3LXF A;  3CWI A;  4II2 B;  4BFR A;  1UH6 A;  2WU5 B;  5AUI A;  4DHJ B;  3QAQ A;  4C4V A;  2GRI A;  3ABV B;  4W9L A;  4EOY A;  1NEK B;  1HQR D;  3RNC C;  5HG2 A;  2ONQ A;  2JWZ A;  4EZK A;  3DBL I;  1KOT A;  2QIE B;  1FPY A;  4G50 A;  1N63 A;  2WXG A;  3V05 A;  1FD6 A;  3Q14 C;  1F9J A;  4RMA A;  1QIL A;  2GMI C;  4HRS A;  4I6L B;  4NJ7 A;  4ZRI A;  2IBI B;  4LNN A;  1E5W A;  1YIW A;  1LXD A;  5LXI B;  4GSW A;  1H8C A;  2EEL A;  2MHJ A;  2MH7 A;  2IO3 B;  3RT3 B;  3VHT C;  3L54 A;  2LD9 A;  3FC4 A;  4M01 A;  4EUT A;  3GP7 A;  5EE0 A;  3ZDT A;  2AEH A;  2K8H A;  1FIQ A;  1WE7 A;  2O6V D;  3GZN B;  3KLS X;  4GDK B;  2R61 A;  3W5V B;  4K7U A;  5H92 C;  4URK A;  3P4P B;  1WIA A;  4K7W A;  4W9G A;  1WR1 A;  2INC C;  2REX A;  2BPS A;  1NEN B;  3RZF A;  1KFY B;  3QX1 A;  4K3C A;  1OQR A;  1XLO A;  5CHW A;  1VRA B;  5E6N A;  1RAX A;  2JU6 X;  2MJE A;  2WXO A;  4I6N B;  3IT4 B;  1ET6 A;  3PVL A;  2J53 A;  1WH3 A;  5C23 A;  1D6E C;  1YX6 B;  3T3N A;  3R2I A;  3Q8C A;  2IO2 B;  2WGS A;  3APD A;  4J6I A;  2AQ1 B;  4YXD B;  1QLB B;  1WYG A;  3NOB A;  2RPQ A;  3JSV B;  2JRH A;  1SE3 A;  2VZK B;  1WXS A;  3P4R B;  4B0E A;  1VZ8 A;  2NBW B;  1ZDV A;  1L0V B;  2KAJ A;  2NMQ A;  4ZOH C;  3ZTC A;  3AE6 B;  1V97 A;  2LUE A;  2WXL A;  1J7A A;  1EU4 A;  2D3G A;  5HKH A;  2SAK A;  4W9J A;  2LWP A;  1WJ6 A;  1WXV A;  2MJD A;  4G0N B;  4FHJ A;  3E9S A;  2CJO A;  1N61 A;  4WJQ A;  1U4A A;  2V4I B;  3AE3 B;  1V1O A;  4WJN A;  4NAM A;  3RD2 A;  1F0Z A;  5BYQ A;  3PLV A;  2KZR A;  5G5H A;  1FXA A;  3J9C A;  2LGX A;  1KLU D;  2C9W B;  4RFB A;  3OG5 A;  1NBF C;  2AX5 A;  4IWP A;  2WXK A;  4KGS A;  1PUT A;  3IG3 A;  1FXI A;  3ZTD A;  2KN4 A;  1J8C A;  2WXR A;  3A9J B;  1SJH D;  4FLH A;  4L23 A;  1GB4 A;  2KQS A;  2M0A A;  2K8B A;  1OEY J;  3TJP A;  2M1M A;  2MJ3 A;  2N9P C;  1RFK A;  2VZK D;  1GAQ B;  4IWQ A;  4KDL B;  3FAH A;  2OHF A;  1AAR A;  3MC0 B;  1OQY A;  3B0A A;  1SSN A;  1TY2 A;  4A55 A;  5D3I B;  4WUR A;  1I35 A;  2UWQ A;  3NRZ A;  3QAR A;  3O65 B;  3A9J A;  3B2F A;  1QKZ A;  4ANV A;  1WJU A;  2WNM A;  3IT6 B;  1VJK A;  2FCQ A;  4BKG A;  2JYT A;  4B6W A;  5EE3 A;  3SR6 A;  2CU3 A;  4HPL B;  2KDI A;  4M02 A;  2HTH A;  4WH4 A;  3U30 A;  1BML C;  2BYF A;  3ZNH B;  3IBE A;  2L0T A;  1SE9 A;  4B0M A;  1LO5 D;  1A5R A;  4HKZ E;  1I4H A;  4AP4 C;  2DBY A;  1A70 A;  1IUE A;  2Z8L A;  2M17 A;  4CQN A;  4G11 A;  1BXT A;  5FR6 A;  4EKU A;  2PEA A;  4F7Z A;  2D2Q A;  1F2R C;  1P7F A;  2WQY B;  4OHJ A;  2KN5 A;  1PYW D;  1ZXI A;  2LVO A;  4A90 A;  3ZNG C;  3B9J A;  1ROE A;  1C9F A;  3AEF B;  1TKE A;  3VUW A;  3I9V 1;  3RNF C;  3NS1 A;  4BVU C;  3HM3 A;  3TCA A;  1YJJ A;  3PRZ A;  4I6P A;  3RPF C;  4F1S A;  1WR6 E;  4P16 A;  3V61 A;  1KH0 A;  3BYT B;  2CHW A;  2G4S A;  3AE8 B;  4NY0 A;  4E71 A;  2LUM A;  5LLI A;  3NS8 A;  2KVZ A;  2AL6 A;  3EGR A;  3RFZ B;  2BYT A;  4AJW A;  3ZRF A;  3FIL B;  2QMT A;  3ZKJ C;  4OZC A;  3LB8 C;  2NVU I;  3E56 A;  2D11 A;  3VUX A;  3VRB B;  3ZJT A;  4A3P A;  1WM2 A;  4KSK C;  2DHZ A;  2L32 A;  3BII D;  3R8B A;  1L0X B;  3APC A;  1XO3 A;  3HVD A;  4KVG B;  4ICV A;  1UD7 A;  2WP9 B;  1FM0 D;  4US9 A;  4P1C C;  2JT4 B;  2EMT A;  2DAJ A;  3PRE A;  3FIL A;  2V3P A;  3W9C B;  4D2K A;  3EEC A;  4BOS C;  4ZYN A;  4MGY E;  2BWF A;  3SFE B;  4KZ0 A;  1J0G A;  2CS4 A;  1WF9 A;  1JWA D;  1QT9 A;  2GB1 A;  3Q3M C;  1E10 A;  2KJH B;  1FNU A;  1SXT A;  2LGS A;  3AEB B;  1K52 A;  2GI9 A;  3LDZ E;  1E9M A;  4Q2J A;  4M0W B;  2MP2 B;  4GMV A;  3OAW A;  4IM0 A;  5HI1 A;  3DBH B;  2OJR A;  2IGH A;  3PLU A;  4LK0 M;  4DXA B;  1QQR A;  3K9O B;  4PS8 A;  2KTF A;  4CYE A;  4HJK A;  2JF5 A;  5DCN A;  3Q8A A;  3RUL A;  3U7Z A;  1EF1 A;  4JX1 C;  2L7R A;  3KYD D;  2PIA A;  4EFO A;  2BS3 B;  4C00 A;  1SE4 A;  3DBR B;  1P0R A;  2R2O A;  4M0W A;  2QJL A;  2MP2 A;  1N62 A;  3SD5 A;  4LDT D;  2NPT B;  2N1V A;  1C79 A;  4WIP A;  5BMI A;  4LLG M;  1ESF A;  1I4X A;  2Z0D B;  2IY1 B;  2LGY A;  2B3A A;  1RYJ A;  2E6X A;  1F77 A;  2LGD A;  4KSL C;  1JWM D;  4TQ1 A;  4A8X C;  3AU4 A;  1ZE3 D;  3UIO B;  1YOV B;  2RDH A;  4WWM A;  3URY A;  4W9E A;  1I7H A;  3L10 B;  4XDD A;  4HLE A;  1SE2 A;  3GE8 C;  2MBE A;  3ONS A;  5FR3 A;  4W9F A;  1C4P A;  4W9D A;  2BQQ A;  3PZ8 A;  4YTN B;  1XCT L;  5BMH A;  1FFV A;  4GIV A;  2NCN A;  3NVW A;  1EF5 A;  4IC7 B;  4LTU A;  1HTO A;  3ZJV A;  2D10 A;  1UGJ A;  2HE7 A;  2G9H D;  3VXW A;  2RDG A;  4LJO B;  3WAP A;  2VRR B;  2WDQ B;  3I3T B;  4ITK A;  1E8X A;  3ZNZ B;  1FNW A;  3LYY A;  1C3T A;  2PLP A;  2IY0 B;  2MBQ A;  1YN5 A;  2HD5 B;  2WYQ A;  4MJS B;  2KJR A;  4PYZ A;  1AN8 A;  2FBW B;  2V9H A;  3L13 A;  1R7S A;  3VR8 B;  4EE2 A;  1UWM A;  2N7J A;  3AMZ A;  3ZDM C;  4HKQ A;  2LMC A;  3IXS A;  2QSD A;  1GG3 A;  3W5U B;  2BTE A;  3R66 C;  3ZVV A;  1JRU A;  1AYF A;  5C1Z A;  4HRO A;  4JGH B;  2JZ3 B;  4DHZ E;  3H7P B;  1XXG A;  1ZPS A;  1HEZ E;  1I42 A;  3AEE B;  3ZXV A;  3ZYY X;  4RF1 A;  1GUA B;  5LXH A;  2IND C;  4MJS A;  2QHO A;  1TJE A;  2NBV B;  1OTR B;  1WYW B;  1WJ4 A;  2BBC A;  2PPH A;  1WM3 A;  3CST A;  2INP E;  1WGK A;  4PT5 A;  4RCO A;  3KW5 B;  3V60 A;  5J2R A;  4MEM A;  1QZE A;  3ZNI D;  3C19 A;  4L1B A;  5MPO A;  1R4M B;  2FCM A;  3N20 C;  2LRW A;  3OJ4 B;  1SJE D;  4TQ0 A;  3M95 A;  1IP9 A;  1LGR A;  2Y5B B;  3DWG C;  5D2M B;  1R4N B;  3R7Q A;  3AED B;  4W9I A;  1E8Y A;  2M56 B;  1Q0W B;  1TT5 B;  5TSS A;  2KJ6 A;  3BVM A;  2O6V B;  4II3 B;  5L83 A;  3AUL A;  1IGC A;  4NPN A;  2XK5 B;  3UI3 A;  4HK2 A;  1YN3 A;  1SEB D;  1T3Q A;  1GNU A;  4DDG D;  4AQ7 A;  4KKJ A;  5BO4 B;  2WXN A;  4OVZ A;  4BOZ B;  4P1B C;  2KOX A;  3I5J C;  2BT6 A;  3R7R A;  3KH0 A;  2HTM E;  2G45 B;  3GOE A;  2BW2 A;  4ARI A;  1KF6 B;  1P7E A;  1V86 A;  1H4R A;  4JE3 B;  3DHG C;  2KWU B;  1E7U A;  2O6V A;  1UGM A;  5JHA A;  2QIL A;  2XK5 A;  5IKC M;  3P1M A;  3MP9 A;  1CQV A;  4M8M A;  4RGO S;  2AWT A;  1YQ4 B;  5G2N A;  4GOC A;  2JZP A;  3NUH B;  1XD3 B;  3AM9 A;  3T3O A;  4IG7 B;  2PW9 A;  3TEX A;  1F52 A;  2X38 A;  2BKF A;  5AZF A;  3HM6 X;  4K3B A;  2W3R A;  4EZJ A;  1XT9 B;  1NYQ A;  3KQ4 A;  2LAS A;  5JH5 C;  1HTQ A;  4ASW C;  2C5L C;  1DYQ A;  1UZX B;  3KUD B;  3TBL D;  2DEN B;  3D32 A;  2C60 A;  4TMA B;  2O2V A;  3RYT A;  2K1F A;  4B9K A;  3QWZ B;  3BK2 A;  1WGR A;  5D7G A;  2L52 A;  1EUV B;  2H89 B;  3TEZ A;  2IZV B;  2W55 A;  3K9P B;  4JL9 A;  4NZL B;  4TSS A;  3BVZ A;  2M8S A;  4LCD E;  2ZVO A;  5CTR C;  1ENF A;  2V3S A;  3U4E G;  1KLG D;  5BYS A;  1FCC C;  2FCN A;  3Q8E A;  2LEK A;  4OZA A;  2KDB A;  3R2T A;  1I4G A;  2BKR B;  2WX0 A;  3A4S C;  1V81 A;  1KTK A;  3HIZ A;  4RH6 A;  3ML9 A;  2ZPN A;  1K8R B;  3WAL A;  1RFA A;  1QOA A;  4NJC A;  2W3S A;  3O13 A;  3T9L A;  3DVN V;  4AS1 A;  3MC9 A;  2E3T A;  4DXF A;  1LQB A;  2ZW0 A;  1IBX A;  3CF6 E;  3PPA A;  2FIF A;  4DDI D;  3IAS 1;  2MCN B;  5KHQ A;  1OQQ A;  2GOW A;  3B2G A;  2FNJ B;  2KK8 A;  1XCQ L;  4ZRK A;  2L83 A;  2FUG 1;  4PYU A;  3JVZ X;  2SEB D;  3UQA A;  3IHP C;  1E0Z A;  5D3D A;  1CJE A;  2J0M A;  3U7D A;  1P9D U;  2GBM A;  3MTN B;  4XC2 A;  3V6C B;  2B76 B;  2L05 A;  2CKH B;  3NZS A;  4G3X B;  3PO0 A;  2NTS A;  2BB5 A;  2JUO A;  2D3B A;  3RZW C;  2KFJ A;  2A5U A; 
#chains in the Genus database with same CATH homology
 3SDL C;  3W1Y A;  3AU5 A;  1WRD B;  4E74 A;  1WMH A;  3APC A;  4KVG B;  4EEW A;  4ICV A;  2MQJ A;  3N30 A;  4K7S A;  4M8N A;  2RR9 A;  3IFW B;  3QCA A;  1UD7 A;  1Z5S B;  2KFK B;  3QK0 A;  5EDS A;  3DVG Y;  4A3O A;  2WDT B;  3VAW A;  2AYO B;  1VCB A;  2LVQ A;  1RRB A;  1WX9 A;  2JT4 B;  2CR5 A;  2J7Q B;  1HE8 A;  2EMT A;  2DAJ A;  3APF A;  3PRE A;  4GU2 A;  1ISN A;  3WIM A;  3A33 B;  2NS5 A;  3DDC B;  2WWZ A;  5G55 A;  1WX8 A;  2AL3 A;  2JXX A;  2D07 B;  3EEC A;  2LXA A;  3PV1 A;  2C7N B;  3P2B A;  3KYC D;  4W9K A;  4WQO B;  4ZYN A;  4BOS C;  2MLB A;  1D3Z A;  4MGY E;  4HPM B;  2BWF A;  1V6E A;  1WZ0 A;  4KZ0 A;  3L0W B;  1J0G A;  2CS4 A;  5E6O A;  4TKN A;  1WF9 A;  3X0W A;  2OOB B;  4NQK E;  4CHK A;  2L76 A;  4MH0 E;  2KJH B;  4BBN C;  3HK0 A;  4AOF A;  2KLG A;  4XX5 A;  4ZDV A;  3R3M A;  2KKC A;  4K1R B;  2XBB C;  3M62 B;  1V5T A;  3DVN U;  2DZK A;  2L8J A;  3DQV A;  4MM3 A;  2MA9 B;  3CMM B;  1NDD A;  2HJ8 A;  3LDZ E;  3PRM B;  3VFK A;  2ZNV B;  2KFK A;  1J19 A;  4M0W B;  3ML8 A;  1Y8R C;  2K6D B;  2MP2 B;  1P3Q U;  1WJN A;  2FAZ A;  3OAW A;  4GMV A;  2IO1 B;  4IM0 A;  2IYD B;  1V5O A;  5IAA C;  2OJR A;  2L00 B;  5DPT A;  3PRP B;  1EO6 A;  4DHJ D;  2ZVN A;  3PLU A;  1E90 A;  3PSE B;  2N4F A;  4DXA B;  1V49 A;  4BKS A;  3K9O B;  4PS8 A;  3QJZ A;  3ZO5 B;  4PS7 A;  2KTF A;  4CYE A;  2GBJ A;  4FN2 A;  4HJK A;  4NAW B;  2JF5 A;  2KHW B;  2KWC A;  1P98 A;  2WX1 A;  3EC8 A;  4NJ6 A;  5DCN A;  2CHZ A;  2KC1 A;  4WWN A;  2YVC A;  4WWP A;  2LXC A;  1VD2 A;  5CHV C;  3RUL A;  2MSE D;  4EZL A;  1EF1 A;  4RM8 A;  5L95 C;  2NBU A;  2L7R A;  3W1S A;  3KYD D;  4EFO A;  3DBR I;  2N9X A;  3H7P A;  2RD0 A;  4JQW C;  4HXD A;  2KC2 A;  1P0R A;  3PGE A;  2R2O A;  2JRI B;  2N7D A;  4GDK A;  1BT0 A;  2MP2 A;  3ZUN A;  2KXJ A;  3CSF A;  4JLC A;  3SD5 A;  1KM7 A;  3PT2 B;  2NPT B;  4LDT D;  2N1V A;  3C0R B;  2LJ5 A;  2CU1 A;  1WGH A;  1WY8 A;  3DOW A;  5J18 A;  2LZ6 A;  4DHZ B;  2KLC A;  3QC8 B;  2V4L A;  3AI5 A;  2KTR B;  2N9E B;  4HCN B;  4BKS D;  2Z0D B;  1TTN A;  2MRP A;  3ZIM A;  3PZD A;  2ZPY A;  5KHO A;  2IY1 B;  2ZZP B;  4DBG A;  4W9C A;  2LGY A;  4B95 A;  2B3A A;  2BGF A;  3TL5 A;  2ASQ A;  2C7M B;  2DX5 B;  2KDF B;  3N3K B;  3VTU A;  2LGD A;  4KSL C;  5TR5 A;  2J0K A;  1UBI A;  4TQ1 A;  4II2 B;  4BFR A;  1UH6 A;  2DZI A;  3AU4 A;  4DHJ B;  3UIO B;  3VTW A;  4ANX A;  1YJ1 A;  2DYB A;  3H9D A;  3QAQ A;  2DZM A;  4W9E A;  1ZGU B;  3L10 B;  4W9L A;  4DK5 A;  4HLE A;  1L2N A;  4IM2 A;  2MBE A;  2KO3 A;  3ONS A;  4EOY A;  2YLM A;  2KNB A;  4W9F A;  2G3Q B;  5DPR A;  3VTV A;  4W9D A;  3AXC A;  2PJH A;  2KTR A;  2NCN A;  3JSV A;  1EF5 A;  4GIV A;  2BYE A;  4IC7 B;  2JWZ A;  4EZK A;  1WFY A;  3DBL I;  4ZRJ A;  3PHX B;  2D10 A;  1KOT A;  2KMA A;  4G50 A;  2HE7 A;  3VXW A;  4LJO B;  3WAP A;  2VRR B;  2KAN A;  3I3T B;  1F9J A;  1YD8 U;  2BWE S;  2ZJD A;  1WGY A;  4RMA A;  3PTF C;  2GMI C;  3A9K B;  4I6L B;  1Z2M A;  4NJ7 A;  2PE9 A;  2Z59 B;  1E8X A;  2IBI B;  4ZRI A;  3ZNZ B;  1E5W A;  4LDT B;  3UIN B;  1WI0 A;  1YIW A;  1LXD A;  4NNJ B;  1C3T A;  5LXI B;  4GSW A;  3SU8 X;  2GBR A;  2IY0 B;  1ZW7 A;  2MBQ A;  1Q5W B;  4YL8 A;  1H8C A;  4OVU A;  2HD5 B;  2WYQ A;  4MJS B;  2KJR A;  3Q3J A;  4PYZ A;  4LJP B;  2MW5 A;  4CO7 A;  3L08 A;  4X57 B;  3VVW B;  2BYV E;  2IO3 B;  3L13 A;  3RT3 B;  1GJZ A;  1SGH A;  2J0J A;  3VHT C;  3EFU A;  3L54 A;  3ZDM C;  2LD9 A;  1GG3 A;  4MSQ B;  4EUT A;  3R66 C;  3ZVV A;  1JRU A;  3ZDT A;  2G4D B;  5C1Z A;  2GBN A;  4JGH B;  2FID A;  2JZ3 B;  2KX0 A;  2CHX A;  2AEH A;  2K8H A;  4DHZ E;  3H1U A;  3H7P B;  1WE7 A;  2O6V D;  3A9K A;  2W9N A;  4K81 A;  1CMX B;  4GDK B;  2MBB B;  4ANU A;  4K7U A;  3DBH I;  4URK A;  1I42 A;  4AWJ A;  1KJT A;  1WIA A;  5JZE B;  3OLM D;  4K7W A;  5GMV A;  2BF8 B;  1GUA B;  5LXH A;  4W9G A;  3H6N A;  1WE6 A;  3N32 A;  1WR1 A;  1XQQ A;  3MHS D;  4MJS A;  2QHO A;  2REX A;  2BPS A;  3T8M A;  2NR2 A;  3RZF A;  4GN1 A;  2NBV B;  3QX1 A;  1OTR B;  1V80 A;  1WYW B;  1X1M A;  4FJZ A;  2I1K A;  1GC6 A;  1WJ4 A;  2PPH A;  5CHW A;  3QHT A;  1WM3 A;  5E6N A;  3CST A;  3W1S C;  2I1J A;  1WGG A;  2JY6 A;  4PS3 A;  1RAX A;  2MX2 A;  5CX3 A;  3KW5 B;  3WAN A;  2ZNV C;  4I6N B;  3V60 A;  1C1Y B;  5J2R A;  4MEM A;  1QZE A;  3PVL A;  2C7H A;  3ZNI D;  1WH3 A;  5C23 A;  4A20 A;  4RM9 A;  1YX6 B;  4FAD A;  3B08 A;  2FCM A;  4BBN F;  2LRW A;  2IO2 B;  3APD A;  3OJ4 B;  1E7V A;  4J6I A;  4MEL A;  4TQ0 A;  3M95 A;  1IP9 A;  2Y5B B;  5D2M B;  1IYF A;  3S2A A;  3NOB A;  2RPQ A;  3JSV B;  2JRH A;  3ALB A;  3R7Q A;  4W9I A;  1E8Y A;  1Q0W B;  1YQB A;  2Z0E B;  2A4Z A;  3ECI A;  2KJ6 A;  2JZZ A;  2O6V B;  4II3 B;  4E3C A;  1WXS A;  3AUL A;  3B1L X;  5AZG A;  5L83 A;  4NPN A;  4AJY B;  3L17 A;  2DZJ A;  2XK5 B;  3RCZ A;  3OJ3 A;  2NBW B;  4HK2 A;  5AZH A;  1M94 A;  1GNU A;  2K8C A;  1L7Y A;  4GGQ A;  4DDG D;  4KIK B;  5BO4 B;  3UGB B;  3ZTC A;  2LUE A;  1IPG A;  4BOZ B;  2D3G A;  2KVR A;  1WXA A;  5HKH A;  1PQS A;  2KOX A;  2FUH B;  2LWP A;  4W9J A;  1WJ6 A;  1WXV A;  3H7S A;  3NZU A;  3R7R A;  3KH0 A;  4G0N B;  4FHJ A;  2UYZ B;  4MDK E;  4WJQ A;  1U4A A;  3VH3 B;  2G45 B;  3GOE A;  3KUC B;  2KWV B;  3TMP B;  1V86 A;  4JIO U;  1H4R A;  4WJN A;  2L3Z A;  5CHF A;  3UQB A;  3RD2 A;  2N7E A;  3PLV A;  2KWU B;  2KZR A;  1E7U A;  2O6V A;  5DPS A;  2KDE B;  1UGM A;  2XEW A;  5JHA A;  5J17 A;  2LGX A;  2XK5 A;  2C9W B;  5DPW A;  1NBF C;  2KQ7 A;  3PS6 A;  2DAF A;  3TIX A;  3QIJ A;  1UBQ A;  3BY4 B;  4TV3 A;  4IWP A;  4KIK A;  3VUY A;  3V6E B;  2R2Q A;  4FJV B;  4M8M A;  3IG3 A;  1LFD A;  3KUZ A;  3ZTD A;  2AWT A;  5G2N A;  4WAA A;  4N9F 4;  4GOC A;  4WJP A;  2V1Y A;  1XD3 B;  2ZCC A;  1J8C A;  4IG7 B;  3A9J B;  3QQ8 B;  4FLH A;  1G6J A;  3NY5 A;  1S1Q B;  2KQS A;  2K8B A;  1OEY J;  4MGK E;  2K6Q A;  3M63 B;  3ZRC A;  3TJP A;  3DPD A;  2ZEQ A;  2BKF A;  5AZF A;  3HM6 X;  1FXT B;  3IVF A;  4EZJ A;  4HDO A;  1XT9 B;  2M1M A;  1LM8 B;  4MSM B;  2LAS A;  1V2Y A;  2N9P C;  1TZ1 A;  5JH5 C;  4ASW C;  2C5L C;  1UZX B;  3LJ3 A;  3KUD B;  3GZN I;  2DEN B;  3TBL D;  3D32 A;  4IWQ A;  4KDL B;  4FUL A;  2M4N A;  2JVC A;  2C60 A;  1AAR A;  3HHM A;  5E6P A;  3VDZ A;  2O2V A;  1OQY A;  3B0A A;  2K1F A;  3RYT A;  2DYM A;  4B9K A;  2K25 A;  2MWS B;  3QWZ B;  1WGR A;  5D7G A;  3BIN A;  3VQI A;  1EUV B;  3U8Z A;  1I35 A;  2KX3 A;  2UWQ A;  2IZV B;  2GBK A;  4KV2 A;  4WWO A;  3EHV A;  4XZ4 A;  3K9P B;  3QAR A;  4JL9 A;  4HDQ A;  3O65 B;  2MBO A;  3A9J A;  4MGZ E;  3RUI B;  2LI5 A;  2M8S A;  1WJU A;  4ICU A;  4ANV A;  3Q3F A;  4LCD E;  3DBS A;  4MGI E;  2ZVO A;  5CTR C;  2FCQ A;  4BKG A;  2N1W A;  2V3S A;  2KD0 A;  1YX5 B;  4B6W A;  4FBJ B;  2IO0 B;  2FCN A;  3A4R A;  2RGF A;  4GDL B;  4HPL B;  4NQL B;  2PE6 B;  2KDB A;  5D6J B;  2KDI A;  4KDI C;  2BKR B;  4OVV A;  2WX0 A;  1V9J A;  4HWI B;  2HTH A;  3A4S C;  3VH4 B;  3U30 A;  4AUQ C;  1V81 A;  3HIZ A;  2BYF A;  3ML9 A;  3ZNH B;  5AEK B;  2ZPN A;  4TUU A;  3SHQ A;  3IBE A;  2L0T A;  1K8R B;  1E8Z A;  1SE9 A;  3WAM A;  3WAL A;  1RFA A;  4HVB A;  1R4M I;  1UEL A;  4FA6 A;  5D94 A;  2MBH A;  3L16 A;  3ZW3 A;  3WAO A;  3WA0 A;  1A5R A;  3T9L A;  4FHK A;  2K39 A;  3DVN V;  1R4N I;  4AP4 C;  3PHW B;  4ANW A;  2KMC A;  2M17 A;  4G11 A;  5FR6 A;  4EKU A;  1LQB A;  3MJW A;  2PEA A;  4F7Z A;  4F8C B;  3CF6 E;  1S3S G;  1WX7 A;  4WJO A;  1TGZ B;  2JPH A;  2D2Q A;  2EKE C;  2FIF A;  3PPA A;  4DDI D;  1KLV A;  4GDL A;  2MCN B;  5KHQ A;  1WZ3 A;  4W9H A;  4IUM B;  2GOW A;  2KN5 A;  1T0Y A;  1NI2 A;  2LVP A;  2LVO A;  3JW0 X;  2FNJ B;  4IM3 A;  3ZNG C;  2KK8 A;  2EMS A;  4KZC A;  1P1A A;  1RLF A;  2ZCB A;  3VUW A;  1MG8 A;  3NHE B;  1WXM A;  4ZRK A;  4BVU C;  4NAW A;  3HM3 A;  3TCA A;  5JHB A;  1OEY A;  4PYU A;  4GB9 A;  3UIP B;  3A1Q B;  3JVZ X;  3PRZ A;  4I6P A;  4F1S A;  1WGD A;  1WR6 E;  4P7I A;  3V61 A;  4HCP B;  1WMH B;  1GC7 A;  3ZLZ A;  2CHW A;  2LRU A;  3UF8 A;  3V62 A;  2G4S A;  2RSU A;  4NY0 A;  3KVF B;  4GXB A;  2FCS A;  3X23 A;  3UQA A;  4E71 A;  5LLI A;  3NS8 A;  5IA7 A;  3IHP C;  3DVG X;  2AL6 A;  2DYO A;  2L0F A;  1ZKH A;  4DWF A;  4FJY A;  4IWO A;  2M0X A;  1TBE A;  2J0M A;  3JYU A;  3U7D A;  1Q1O A;  1P9D U;  4AJW A;  3ZRF A;  2GBM A;  3MTN B;  4XC2 A;  3V6C B;  3ZKJ C;  2L05 A;  2CKH B;  3NZS A;  4G3X B;  3ENE A;  2NPT A;  4BKT A;  3QA8 A;  3M3J A;  2NVU I;  2JUO A;  2O2V B;  2D11 A;  4IW0 A;  3VUX A;  1SIF A;  3DCG A;  4A3P A;  1WM2 A;  4KSK C;  1OGW A;  3A1Q A;  2DHZ A;  1E8W A;  3RZW C;  2KFJ A;  2A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...