5DR5H

Crystal structure of the sclerostin-neutralizing fab abd09097
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
224
structure length
224
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFTNYYMHWVRQAPGKGLEWVSTIAYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWFTDDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFLVPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation and Affinity Maturation of Neutralizing Anti-Sclerostin Antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords AbD09097 Fab heavy chain
total genus 49
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2015-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H01
4LIQL 1JN6B 1EO8H 2I5YH 4PB9L 1LK3H 1PJ9A 5GGSB 4G7VH 3DX9B 5FA3A 3QFDB 4HAGA 4L4TB 1HI6B 3L1OH 4X7TA 3W9DB 3SE4A 2Q87A 5GGRB 2VRAA 4RGNE 3WSQH 3QH3B 1RURH 5KVMC 1A4KA 1KJ2B 1A22B 1H3VA 5BOZG 1FVEB 4BUHA 4Y5XB 4L9LA 3HC3L 4YDKL 4L29B 4MA8L 5HYFA 4LSPH 5T5NG 3DARA 3OBAA 3WXVL 4M43H 5IK3A 3DMMD 5EBLB 1FVEA 4U6HB 1MIEH 1OARH 3MUGB 1BLNA 3VXSA 3N06B 4PJFB 4I3SL 1YEEH 3P77A 5GGRA 4PJDB 3PWPD 4NRZB 3WIFB 4W6XB 1RJYA 4ODWB 5F7UA 1JGVH 2XWJA 4JGMA 1DL7H 4K9EL 1G9NL 5E1HB 1RZ7L 3TJHC 3T0EE 2F19H 4G7YH 5T3ZH 3CLEL 1A7OH 4BFIB 1QFWI 1HHIB 4XVSL 1CIUA 4ZYKB 3V6OE 5I1CH 4P23D 1UB6B 3SEPA 3KR3H 5HYJD 2PYED 4FQJH 1BBJB 2VSDA 2QADB 3BQUC 3DUSA 2MTPA 5GZNC 4AJ0A 4R7DA 4FQIL 3QJHB 3H9SE 5M94B 3QHFH 5ESAA 2YD8A 4UTAH 5EA0H 2BSED 3VFTA 1JGLL 4PLJC 3FQUA 9CGTA 1BF8A 3TCXA 3FTGA 1H3GA 3MCLH 2LVCA 1GHFH 1SVZA 4OKVA 4U6YB 2XWTA 3ZE1E 3MBXH 4PJBF 5IB4B 1RVFL 3O0RL 1MEXL 4F80A 1X5LA 3VFGH 3T0BA 4YDLB 5FM5M 3RHWK 1RZIA 1LDPH 1S7XB 3GSNL 5E00A 3OHXB 4JRXD 3UCRA 4I0CC 5DXWA 1AGFA 2EDHA 2ATKA 4ZFOL 1KB9J 3Q3GB 4UNTA 1T0NB 3S8WA 2CIIB 4FQXC 4WFED 1I1YB 4M5ZH 3T0ED 3EO9L 4OLXH 3B2UC 3UBXB 3WFEH 4PRIB 3T1WA 1I1FA 2R69H 3RWCB 4F7MA 4X4YA 4F15C 3DGGA 5IJVA 2BY1A 5GS0C 4G3YL 3T08A 5C0AD 5CWSA 4PV8B 2EDKA 3F6LA 2A77H 3WCYA 1RY7B 2HAZA 1G1CA 1PX4A 1J0YA 4ZO8A 3V4VL 4JHWH 1P7QA 3CU1A 5IG7A 2AQ3A 3JWDC 4KUZL 3ARWA 5ILTL 5TFSH 3V4PH 1MPAH 1DLHB 1MCOL 3EYSL 1JNNL 1BGXL 4DN4L 1INQB 4G8GA 4RGND 1GZQB 3ZYIA 4NN7C 3SKOA 3IDXH 3LKPA 1XIWB 5C0RL 3OJVC 3MZGB 4HUUA 3GO1L 1Q0YL 4PG2C 3PF2A 4C83B 2HRPH 5E8PB 2X4RB 4BKLB 3QG6A 1G9MH 1FQ9C 4KI5E 1MNUL 1P5VA 4LSVH 4WENB 4U1JA 5D5MB 1MHPH 1TFHA 1ZKAA 3OZ9H 3EYVB 5KSBB 5BCAA 1SM3L 4KZDH 2WP3O 2VDML 4QXUL 5DD3L 3H3PL 4CJ1A 1BZ7B 3WD5L 2EEBA 4Z7WB 2KUTA 4JPWL 3O9WA 4AIXA 2Q6WA 3TT3L 2EDTA 1S9XB 2F74A 3NN8A 3D85B 4UQ2A 1KTRL 5EZIH 1MFEH 1UXSA 5FO7B 1WBYB 2JJTC 2PXYD 4H20H 5C0BE 4MJ6B 1DN2A 1WTGT 3DETD 3IJHA 1ZA6A 4MCYA 4OV5A 4OLVL 5JIIA 1W8NA 2DLIA 2FZ3B 4X6DE 4PJ8D 2LV4A 1LO2H 1AFVL 4HKXA 1YMMB 4YDJA 3O2WH 1O5DT 2P45B 1OAKL 2OJEA 4P3DB 1I3RA 3PDOB 3PQYD 4J23A 2NW3B 4KZDL 1HDMB 3LV3B 2I25N 1MVUB 3HFML 4P99A 5D7JC 2YXMA 4PJAF 3B9VA 4XP4L 3IT8D 5EIQA 4F37F 1NPUA 1MWAA 2NY4B 2YK1H 4F57L 4ZTPL 3U4EA 1QR1B 3S4SG 1G9ML 4PRPB 1LK2B 5I18H 1XZ0A 2EDFA 4KKNA 1QSFA 4JZNB 3U9PH 3FKUS 3MV9D 3K4DA 2XZCL 5E6IB 2SEBB 3SDAC 3F8UB 1XT5A 3BPNB 4WV1B 3LSOB 2E7LC 5FCSH 1DBJH 1YMMA 4YDJB 2PYFB 1DBBH 4OM1L 2APTA 2H32A 2L0DA 4X98A 4ZUUB 1PLGH 1DUYB 5MERB 1NCAL 4PY7A 1LEKB 4KDTA 1NDMA 3S97C 2YK1L 2F54D 1LEIA 5TDNA 2V9RA 5C0JB 3HRZB 4OCXL 1PZ5B 3NIFF 3V5KA 2UUDH 7FABH 3IJSB 3UYRH 4HSQA 3BE1L 3EYVA 2O5XL 2BSSB 5A3IC 4H88L 1D5ZA 4TVPD 3K4ZA 2FO1A 1WFUA 3E6FB 5E2UH 1O7VA 3G6JA 4C4KT 3F58H 3ILQC 1KJVB 2VXUL 2ZCLL 1R3HB 2W9EL 2B4CL 4FQ2L 5JXEA 2NX5D 1HIML 5B8CA 4GRMB 4CMHC 5E8PA 3HAEB 4M1CC 5CZVH 1YDPB 4NN7B 1NCAH 4YHLH 2EIEA 4HUUB 3AY4C 2BVOB 3OKKB 4JFDD 4DZBA 2X1QA 4MDJB 1OCWL 1BOGB 1WAAE 2HLAA 2IPUG 3WUWB 1T6VN 1JHKL 1E4KC 3RI5F 4TNWK 1BVLB 3EDDA 1C7SA 1BOYA 4UV7L 4FQXA 3LZFL 2FHCA 2QV2A 1OGAB 4JGJA 2QEJA 3DSFL 4OZFB 3HC0A 2X4SA 1U8LA 1QA9A 4W68A 1LO0H 4DWHA 4Y19D 3R8BB 5EOTB 4LVNB 5F6HJ 2ITCB 4LARL 1QEWB 1AHWB 3RVTD 5CWSB 5EBMB 3T0AA 2EDYA 1VPOH 3MLZH 1H15A 2NTFB 4P48A 5IJVB 4NO5B 5FYKE 1UB5B 4IOIA 4ZUWA 5JUEH 1B0GA 1KIUA 4H1LA 4N1EA 2B8OT 4EN3A 2OL3B 4R4ND 4RA0C 1QBBA 2DJUA 4IM8A 3S35H 1IC7L 2VL5A 1TVDA 5BOPA 1UJTA 5F7DB 1A7RL 2VDLL 1AQKH 1UKQA 1RU9L 1IFHL 4MHHI 3Q3GA 2VDKL 1MJJA 3ARDD 1XF4B 3R4DA 4LPXA 2LU7A 4QTHB 3MRLB 4P9HC 4WFHD 3DXAA 1ZT4A 1OY3B 4LSUL 2QSCH 2WSKA 2YHGA 3TYFB 5HPOA 5GS0D 4BELD 2C3XA 2VC2L 1EHLL 4PRNA 2R0ZH 4WV1C 2EXWC 3VWKA 3KYMA 3BP5B 4G6KH 1JZ3A 3QIWB 3O2DA 5AZ2L 5GS0H 1UC6A 3SHSA 1RU9H 3I6GB 4FG6D 4JFEE 1VCAA 4LEOB 2NY2B 2BFVL 4HWBH 1VB9A 2V2XA 3STLA 4K9EC 3ZL4H 4WI9A 2NY2C 3S36H 4HS8H 1GC1H 1BPVA 4PJ9C 1OAUL 4U6VL 5JHDE 5FYJU 2VWEE 3GI8L 1JMZA 3QCTL 5C6TL 4XPTH 2F15A 3LHPL 1HXMA 1ZMYA 1HHIA 2FNBA 5JA9A 5JW5B 3P9WB 2WANA 4NQEA 1AQKL 3VWJD 2P5WB 3V79C 2JB6A 3SCMB 2HTLC 4RRPG 1VSCA 3BT2L 2NZ9C 4P4KD 1WBZB 4NRZA 1HINH 2FWOA 1D9KC 5EORH 4IJ3B 2A1WH 4I0PA 4K7FA 3HPJA 5DJAA 1N8ZB 2NY6B 2OTUB 5CP7A 4BA8A 4HMDA 5F88A 3TFKC 1EEYB 3PL6A 2Q76A 5DEZA 5LCVL 3PXJA 1FFNA 2JB5H 3L5HA 2K9UA 4YFDB 4LOUD 3MYZA 2IEPA 4GXUM 4V1DA 4OZHF 4PJAB 3WBDA 3OPZL 4AL8H 4XCNA 5IESL 2VLJE 5GRZA 3VA2C 1B2WH 2VZTA 1IMHC 1Z3GL 4DEPC 5L0QB 3MRGB 5HDQH 4B0MM 3BP4B 5D9SB 2GSIA 2FR4A 1FGVL 2CD0A 2DWDA 3K4AA 1AGBA 4QXWA 3HG1D 5KSVB 4PGBB 4I0KA 2HTKC 1EHAA 4QHLB 3SKMB 3VFOA 4MA1C 5I17B 4HEPG 1N8ZA 2OTUA 3PWJA 3C60D 4Z78A 4NN6C 1U8IA 2DBLH 2EH7H 4UT7H 3IB4A 4M7ZB 3MLVH 4ZFZA 3KPLA 3QUZA 1ZLSL 4OCLC 3OKMB 2DQIL 3O8XA 1UCBH 5BW7A 1C5BL 2DQUH 4I77L 1GAFL 1Q9OB 1KF9B 3FQRB 4JPVL 3O6FB 5E6ID 3VWKC 1TZIB 4LVHC 4I4WB 1NGWB 1AC0A 3GSUA 1MFCH 2APBA 2GFBB 3HS0B 1NAMH 1I3UA 4PTTB 3FO1A 3CD4A 4A6YB 2CKBH 1ZA3B 3UJJH 2P48B 5CZKA 1TQBB 2DIJA 4XVJH 1KXTB 4L5FL 3QIUC 4F7TB 4ONFH 4UINH 1FLTX 3ECBB 2IMMA 4N5UA 2ZWLT 3PL6C 4CADB 1MCSA 5D7JA 4QXGL 3EO1A 3CXHJ 2XZAH 4ERSH 2I24N 1GCFA 1WWCA 1OGAD 1U3HC 3FMGH 4PR5B 5DO2C 1LD9B 4K3EL 2YPLA 4K23L 4ZPVB 3UJTL 4M7LT 1E6OL 3A6BL 4YHKH 5TE6L 3ULVE 4L8BB 4EDWL 4HUXA 2BK8A 5FUZL 1QSEA 3QCUH 1ZLWH 5JHLH 4HKBB 4K7PH 4YBLB 4HFUL 4N8PA 4WDIA 5ID1B 4UT9H 4GRWB 2NX5E 2AI0H 5GISL 2D7NA 4GKSB 4XPAL 5I1HH 5DD1L 4PRHB 4WU7A 4MNGB 4HGMA 3K1DA 5INDA 4L3AA 3LKRB 2V7NB 2W0KA 4NQCE 1JFQH 4KFZC 4ACPA 1GC1L 1FLRH 1H3XA 3AAZA 5F7DA 2D3VA 1PG7L 1QACA 4ETQB 2H6PA 2VL5B 5CJQH 1MY7A 3LRHA 1KGCD 2VJXA 4YO0A 5FUZH 5CBAB 5EU4B 2QQNL 3VFNA 3ARPA 4N0YH 3WLWD 1TZGL 4LLMA 1ZE3C 1INEL 2H41A 1PEZA 1JGUH 2HH0L 2I9TB 1ADQA 4R90L 3S36X 2VXUH 1D5XA 4IEFB 3QI9D 5KANI 4YPGB 1HSAA 1I8KB 1KCUL 3EHBD 3K74B 1V5JA 4WTXA 3TCLB 1MPAL 3MGTB 2W0LA 2J6EL 4JKKA 1MCWM 3DHMA 1OAZL 3J7HA 1M71A 1CF8L 1CDGA 1PSKL 1TLKA 5D72L 1UWGH 5A16A 1UJ3B 5DT1H 1A9BA 1NKRA 2GY7B 1BMGA 3V6ZB 4R0LC 5E6ZA 4OI8A 3CDCA 3O4OB 2EIZA 4MDIB 2F58H 3O4LD 5D7JD 4AMKH 3IGAB 4JM2F 5ETUA 5HGHA 1QNZL 2QBWA 5LXGH 2CQVA 4YZFF 1TNMA 1MCCA 3QPXH 4CMMB 3GJFH 4RWYH 5L2KB 1KCUH 1CXLA 1L4IA 1U8PB 3RI5K 5B8CB 1TVBA 4MVBC 5C07A 4PLKC 1A3LL 1KJVA 3IKCA 1JV5A 3N50A 5F9OH 3LQZA 1JVKA 1PKQB 4D0BA 4D8PA 1BM3H 5IKCA 2UWEB 2VXQL 4M1GL 2WM0A 4JQXA 1UGNA 1RULL 2AABL 5HDBE 4LHUA 4C56A 1ACYL 1F4XH 4YR6B 3MA7A 3T0XA 4UBDD 3CFDB 4Z7OE 1BD2A 3BOVA 5D6DC 1E28A 1XGQA 4HF5H 3FT3A 1QRNB 3RVWD 3VMNA 1ZHBB 2OP4L 3RPIB 2WIMA 2CK2A 2VZUA 3C6LA 2G5BB 4J6RL 1CCZA 1NL0H 1CK0L 1VGKA 3ARBA 2FO4A 4KKLC 1ITCA 3EYFA 4HIHB 3O11A 4N0CD 4HT1H 4NO3A 3DI3B 5HI3D 4OJFL 4ZFGH 4X83A 3QUKB 3VFSA 4NNYB 2ZUSA 1IGIH 1I8MB 3TIDA 1QTYT 1RJLA 1RZKL 1T21A 1X4XA 1MREL 1SJVA 4WTWA 2XYCA 4GLRI 4NNYA 4HPOH 1A0QH 3LEYL 1A4JB 5DD3H 4Z7QE 2P8MA 4P4KB 1QO3B 3F5WA 1CFBA 4RMSA 1G7HB 3S5LG 3TZVA 3BWAB 5EUOE 5K59E 3MFFA 2A6IB 4KHXL 5F8QC 2IQ9L 3IDMB 4BH7A 1VACB 4K7PY 1MVUA 5KW9H 2D03H 3QBTB 3W2DL 2HT2D 4HS6B 3MQIA 3QIUD 1H0DB 4Y4KD 2BNRA 4O00A 2R39A 4XNQA 1V7MH 5C07E 1CU4L 4HHAA 3LD8B 4QT5A 2EC8A 1SJHB 4JHZA 3UBXI 2X4TA 5FDWA 3VD7A 3Q6GH 3SN6N 1KXQE 1ZA6B 3PGFH 5I71C 1NBZA 5DJ0B 4P5TA 5E6IC 1G6RA 5IIEB 4G42A 2QHLA 3OAUH 3BEWA 1JV5B 2CRZA 4DVBB 2EO1A 3RIAK 2YN5A 1ZLSH 5HHOD 4PRDB 1RIHH 2HYMA 4CMMA 4X6EB 4HBCH 3ZE1F 3OJ2C 1XGTA 2ZUQB 3DRQA 2X05A 4NM4H 4WUUB 5ANMA 4MDIA 4LSTH 1ZHLB 3WDJA 1LEGB 4NHCL 4OM0L 3WJJA 2W0FA 1KB5A 3VGFA 4U1JB 3QEUB 1FRGL 5IWLA 5E9DD 3B8SA 4NUJA 5CP3A 3MXWL 5EZOL 5GS1B 2Z0BA 2DTMH 1JPTL 5FOJA 2AJUH 2A74A 4FQQA 2E9IA 4AM0B 3MRDA 1JZ7A 4LLWA 4W4NA 5EC2A 1U92A 4HC1A 2C26A 3LKSB 5D5ME 2VLRD 3D3VA 3FT2B 1VFBA 2MCG1 3P4OB 4G9FB 1M6OB 2IMNA 2ZNXA 3MRIA 4LASL 4QHNB 3G6DH 4G8FB 5LBSL 2BY0A 4F2MB 1XAUA 4Y19E 3QAZC 1CD8A 1A2YB 3G5ZA 5DZOA 3TO2B 3PGDB 4OZIF 1GYAA 2J4WL 4LRIA 1NGPH 1MEXH 1Q1JL 5JW4N 1VADA 2G2RB 4QRPA 2YD3A 1HKLH 4TUKL 2C1PA 4KUZH 4WVRA 1JK8B 3QQ3A 4KQ3H 4K8RH 3SDCC 3MREA 2LTQB 3RY4A 3RWJA 3CH8A 3QG7H 5INDB 5JW4M 3MCG1 5DJYA 5DGRA 2DD8L 2V7HA 2GTWB 4I2XA 2O61A 1U41A 4FP8H 3UBXA 1NAML 25C8L 1D3CA 2R8SL 5DF0A 2GI7A 3RUGA 3UJJL 5AWNH 5J1TC 4OGAC 5C8JB 4G6FB 3MRKB 5EU6E 5HDOA 2G5RA 3H42H 3SJVE 2WWKT 5MEQB 4HWNA 3ULUL 4KI1A 3OAZH 5C92A 4NQCD 2F53D 1BVKB 3DMMC 4A2LA 1JPGB 4YNYB 3ELAT 3LKNB 1XH3B 3FQTA 4KK8D 3FB5B 1KPUA 2Z31C 5ACMA 1NCDH 5JZ7C 5F72S 1HQRB 5F1SA 5H94B 5D7JB 4G6KL 4XMLH 5I8OL 1UCTA 5HGAB 4HIXL 4F9PA 4FQXD 1KCSL 4MNQB 2H1PL 3QUKA 4G3YH 4GJTB 1HN1A 1VDGA 1OLZA 3MBEA 2DQGL 3D9AL 4Z95L 5HVGB 4CW1B 4U6YA 4QF1A 1G7MA 3ARBB 2BHZA 3NVQA 3CMGA 4EI5A 1N5AB 3LN5B 3RPIA 2BHYA 2ZNWA 5E24E 4HXBL 3U46A 5I19H 1QRNE 5A1AA 1A7RH 3G6JF 4NSKB 1F4YH 3NCMA 3HI5H 3EOYG 2XZQL 5ESQA 15C8L 3GGWB 3OKOA 3S3PA 1QRND 2VQTA 3MODL 1JGDA 3GM0A 3L3OB 4YC2C 4WHCA 3RVWC 1T5WB 3WKML 1DBML 2WWMD 2DQJH 1P9MA 4YHYB 5BRZD 1NGYB 5HHXL 4YHYC 3ILPA 4RFNB 3VXME 2AABH 2E9WA 4HAFA 5I16A 4RFOH 5IGXH 5LGHH 2ICES 5HHME 4UIMB 3WNOA 2DQHL 5ADOH 5E8EB 1FL6B 2Y5EA 4GXVH 3KPRB 4LCCA 2Q20A 4PJFA 1A7OL 5FOBA 5F96H 3U79A 3EUUA 1BLNB 1K4DB 3I02B 1IAOA 4IJ3C 4LGSB 5C09B 1FIGH 2EE2A 5C6TH 3T77B 4I18A 4DGIL 3FQNB 3BKYH 3MV7E 3X12B 1MI5B 4PV9A 3CSGA 3QIUA 3WO4C 4BZ1L 4L4VD 2W91A 3QEQA 4YQXL 3C6SA 4GFTB 4NKOA 2B1HL 2DKSA 3TNNA 5HI3C 2VKXA 3S96B 1FE8L 5D1XB 1D5XB 3W0WD 2VDRL 4Y5VC 3PIQB 1MCDA 4HBQA 4JFQB 2ADIB 2CK0L 5I1IL 1JTPA 3RDTC 5SWSD 4EBQH 3FJTA 2H6PB 5ITBL 2ATPB 5I1GH 2Y07H 1MCFA 1S78C 1F4XL 3RTQD 2PW1A 4ZO7A 3OKYA 4PJXF 3CK0L 3O9WD 4OQTA 3FO2A 2V7NA 4NCC2 1CICC 1LO3H 4AEIH 1P9MC 2FH8A 1CL7L 4KTDL 3T2PA 4UIKH 5GPRA 1N0LA 5FYKU 2F9BT 3CMOL 4LCYA 2ZJSL 4O2CB 1KIRB 1IM9D 4ODUB 3UTSB 1W72L 1VKXB 2VAJA 4IRSB 5FKPA 4Z7OF 5LGKA 4OI9A 5DHYB 4KV5E 3HE6B 4PGEB 3OGCA 4R26H 3M45A 2MCPH 3BH8B 2P5EE 3DV4B 3BKJL 1UVQA 4ODVH 1NLDH 1HHGA 3H9HB 1PFCA 3EO1B 4JVWA 1WIUA 2X1WL 1Q9LA 1RV6X 3HPLA 5DMKA 4C55A 4FABL 4PJEB 1QPXA 1GGBL 2Z4QB 1U3JA 2GITA 4R2GC 1KNOB 4LPUA 5IHBA 4FQLH 3U7WH 3FO1B 1YNTA 4WWID 5I1KH 4FZ8H 3DROA 3O6KH 1J9CT 3DVGA 4XC3H 3VFUB 1NFIA 1NLBL 3VXPA 4NFDA 2KDGA 3FFCD 5T3ZE 2B1AL 3U9UA 4EDXB 5FFLA 4EN3B 3OQ3B 4OUUB 3RNKB 3UROR 4NO2B 1F4WH 1IM3A 4PJBE 3REWA 4UV7H 4IOIB 1A6ZA 4EQ2A 1MRCL 5H2BA 4LHJB 3GBLA 4ONHA 2WUCL 3RP1A 1ZGLA 3CUPA 2EDQA 1A6UL 4R97B 1ONQA 4Q6YA 3QI9A 3CVHH 3EYQC 4ELMB 2B20A 5I17A 4PG9B 3VFOB 3I3DA 4XBEH 5F6IC 2QQQA 4OFPA 3V5DB 3T0EA 2EDEA 4E0RA 4JPKH 5I1GL 3MLTB 1X5FA 4QYOA 1IGYB 3MRGA 4P2CG 2Y6SD 2F53B 3HC0B 1FPTH 3G5XB 5EZLB 4QXTB 4RMTA 1G7PA 4LSRH 2JIXB 4YUEH 2XTJB 4LPWA 2MMXA 4PG2A 4P57B 5B38B 3WFDH 3CFKB 4YDVA 1L7TL 3VGHA 3BPLC 2VDLH 1A9EA 5K9JH 2RHEA 4HGKC 2YRPA 4M8QA 4M93C 4PJHB 1FAKT 3EYOB 4Y7MA 4XC1H 3P11L 4DZ8A 3D69B 4UDUB 5HYIA 1J0HA 1NUGA 3HPJB 3GIVA 5EFIB 4PJBB 1N5YH 4F57H 3CCHA 1PZ5A 3HC4L 4M1CD 4MYWB 4WW1A 3KXFB 4RRPA 2ERJB 1OTUD 4HZLB 1OGTB 1WVZA 3MR9B 4KMTH 3RWDB 1HWHB 1XR8A 1VGEH 4ODTH 2FYYA 3DNKA 4JLRA 1FNAA 4OLEA 4RAUB 3UJIH 3O9WC 5ALBL 3DUUB 2J7LA 4PY7B 2PNDA 4J4PC 4PS4H 4GXUN 2PTTB 5B8CC 3EDKA 4M7ZC 2BVPA 1DBKL 3VXMB 1ZLUH 3FL7A 4NCDA 5M95B 4D3CL 1GZPB 4QRSB 4JO4H 3MJ6A 4H20L 5KSAC 4P5TC 5E6IA 4AEFA 2DM3A 2IAMD 1CFNA 3T8XA 5E0QA 3NA4A 4JDVA 3EBAA 5HI4D 1DUZB 1CE6A 3VFGL 2ZCLH 1DQLL 1FYTE 3VGAC 1ZS8B 4YGVB 3PWLA 2R4RL 1LO4L 2VDNH 5TPWH 2NY6D 5CD3A 5EU3B 4LLVB 4LPYA 2QLVB 1MQKH 4R2GD 2FCBA 4DAGL 3DO3A 3VGDA 3WS3B 1FBIL 5DMGC 3MACH 5J89A 3MXVH 5C0NC 3MRLA 1BM3L 1Q94B 2VAAA 1FGNL 1NLDL 1MCHA 4HCRH 4P5KA 5DJXA 5LAXA 1MJ8H 3UTQB 5DWUL 4O51B 3NZHH 3BPCB 3OJDA 1BQHA 1XMWA 2JTDA 3JWOL 4ONFL 5I1CL 1B0GB 3DBXB 2CLRB 1LO5B 5BZWB 1AIFA 3CFEB 3KPMB 4MJIB 4YEEA 1T7WA 1Y0LA 3ZYOA 1IM9B 3G6JE 5TH2A 2YKLH 3G5VB 4RFOL 5D1XD 5IGXL 4NDMA 3PDDA 3SO3B 4F7PB 4J12A 3IU4H 3OGOE 1IBGL 5J3HC 3UTTD 5EOTA 1IAKB 3LRSB 2B2XL 5GHWH 4BUGA 2GUOA 3BSZH 5I30H 1K6QL 3SDXB 2X89A 2WZPD 2AJYL 4OZFA 5C0BA 2YXFA 2PN5A 1PX3A 1DQDH 2VLJA 3FRPG 1JNLH 3RTQA 5IF0A 2BSRB 1GRWA 5A40E 3SQOH 4F15B 4NHUA 4OF7A 3SDXA 1A7NH 4YFLI 3CDGB 3E8UH 2VC2H 3ISWA 3EDFA 3TBWB 4YEFA 1OP3K 4H0IA 4F9PC 1R3HA 1MLCB 3VDCA 1N0XH 5BXFA 4JO3H 4Y2OA 4LCWA 2OYPA 5J1SC 3H3PH 5DDHB 4M9OA 4XRCB 3ARFC 2XFXA 3FZUD 4WWKB 4XWGL 5EO1A 3VWKD 3WUWG 3ZTJG 2DLGA 4L4VA 3O81A 3ZT5A 4D9QE 1MUJB 2BNQB 1WITA 2H26B 4MCZB 4JQIH 2XT1B 3QXAA 2WBJC 1LEIB 4OCNC 3L3GB 5TDPB 2EXWD 4TPRL 1NDMB 2X40A 3LEXB 1ITBB 2YR3A 3LDBB 1IGTB 5MERA 4MB5A 5F3HA 1ZLVK 3SDXF 3UTQA 3BQUD 3E2HB 1FRGH 3QQ4B 3BZFB 1MCNA 3BSZL 1K2DA 5GSRA 2EKSA 3ZKQD 1FG9C 2P7TB 2VABB 4PJGA 2YPKA 3ULUH 1NEZG 4MQXD 1RZIB 1CDHA 3VFMA 3B4NA 3GSQA 1NGXB 4ZQKB 4DOHE 2R56H 4IDJH 2JIXD 3MFGB 5CD3B 1AR1D 4DQOH 5BS0A 2GSGB 4GQPH 1JL8A 3BN3B 3PJSB 2FLBT 1WIOA 2G60H 2N7BA 3HZMB 2ICWB 3DURA 3O3EB 3P73B 4Y2DB 3L3HA 5DGQA 4U6VH 1IAMA 5B21A 2ENYA 1OTSD 2GSGA 4GO6B 5DQ9B 4CU7A 5F3BB 3HR5B 1TJGL 1T66D 2AJYH 1RZJL 4R7DB 2R0KH 4XPBL 1S9YA 2AXFA 1G0XA 4Z7UE 1E4JA 2APWA 2DL2A 1I7ZA 3JVGA 3TPKA 2HT3D 4HK3N 1LVEA 2AERT 3VE0B 1W0VB 1EVTC 2DLFL 2VLME 3KYNB 4GUPA 1KPRB 4LMQE 4BFIA 3JUYA 2Z91B 5F3HB 3IS0X 4NQEE 5FXCH 4ODXA 4MA3B 4OCRH 4D0DA 2V9QA 4RAUA 5DYOA 5ABDE 3ESVF 4JLRB 2IG2L 1Z3GH 5I0DA 1I7UB 4X6DB 2XWJB 4LLAA 5FB8B 4WW1B 5DJ6A 1WV7T 5BVPH 1RZ8A 3G6DL 5I71B 1NUFA 5KSBA 1MRFL 3LQAL 3CVHA 4XRCA 4S1SL 4KH2A 2RBLA 2HRLA 2EDLA 3H7BB 4HDIA 2FEEL 2VDOL 1YEIH 1BX2A 4HKJA 1ZGLM 4B53A 4JPIA 3CPLB 2BVEA 1UZ8B 2AKRB 4PJIB 1CL7I 4L9LC 5DK2B 4M61B 1GZQA 1ES0A 3WIIH 1UACL 2B2XH 5GHWL 1U8NA 3ZLQC 1IEAA 4NJAH 4U1KA 4P4RB 5JPNA 5K59F 1UWXH 3Q6GL 4AQOA 1NGQL 3DX9A 4KXZI 1DVFC 3BQUA 1L6XA 5FHAL 4Z9KB 1V3JA 2EZ0C 3ZSTA 4K3DL 4QRUA 5D7KD 2IBZY 4I48A 3RGVA 4RNRB 3P30H 4ZAKB 1U3HA 5TH2B 1QSFD 2BC4B 5ICZA 2NY6C 3PV7A 1MCPH 3AM8A 3IETA 4X4YB 3I2CL 3ZHKA 3WO4B 3RWCA 5I75C 2YWZA 4NHCH 1RK1B 3RVVC 3PWNA 4PS4L 1YEDB 2YRLA 3LEYH 2DJ4A 1FFPA 4FXKA 3UO1H 2DOCA 5L9DL 2HT2C 1P7KA 2OXGA 3QJFB 4D3CH 4LVNC 3DROB 1UFUA 1BIIB 3RGVD 1T0NA 3WE6B 3SDCB 3O3DA 3KLHC 2LVEA 5KSAA 2FD6H 3OHXA 2Y06L 3ARFD 5T1MB 3QHZH 2NXYB 4RGNB 3VRJB 5A2KH 3QDJB 1VFAB 1FN4A 5LQBL 3SOBL 5CBEA 1TZHB 4MD4A 4B7LA 1I8LA 4GSDL 4HIJB 2PR4L 4P9ML 3A0OA 3SKNB 1KIPB 4LPVA 1I9IL 5BVPL 1BIIA 2EEDA 3OR7B 5FF6B 2Y6SC 5KSUB 1G7IB 3QJFA 5TFSL 2GK2A 4Y4KA 5ILTH 4HFWA 3QUMA 2J6EA 5EO0A 3LEVL 4I1NB 5I0ZA 4LAJH 4TVSa 2XV6B 4DK6A 1KTDB 3QI9C 5GQBA 5DMIH 1UB6A 1YNKH 3N0PB 1DN0A 2ZZUT 5HYEA 3FN0H 3HMXA 1U95A 4F9LA 3DIFA 2PW1B 4G8GD 5ICZB 3F12B 2YD4A 3M8OH 2M26A 3VXNB 1NBVH 4WEBL 3DUUA 2WUCH 3BPOB 4KVNH 2IPTH 3RVUC 2FYYB 2GAZB 4N0CC 4EI6A 4NKQB 3BQUB 3OKDB 1MFNA 2DQDL 3V5HB 4HJ0D 1IEAB 3VW3H 2WINB 5D7IB 4O02H 4Q2ZB 3ARGB 1DSFL 2NW2A 3FONB 3P0VL 2FHBA 5GGVY 3CVIH 5C0AA 5DRWB 5D2NC 4X7SL 4M61A 3B5GA 3TT3H 2R0LL 4ZOCA 1JBJA 3D18B 1YJDC 4RZCA 1EK3A 3TYGL 3U0WL 3SDDA 3C5ZA 1NC4D 4HUMB 1JF1A 2HKHL 1A9EB 3CXDL 3WFHB 5BVJB 4HLZG 1M7DA 1EJOL 4XVTH 2A6KA 3SDDB 1D6VL 1DQJA 4BQ9A 1EAJA 4OCWH 5E2VH 2NMSA 5B39B 3BDYL 4G8EA 3RNQB 4JE4B 3NBNA 1M1SA 3CX5K 2JIXA 1L9NA 4PJ9A 2NY5C 4M4PA 3VJ6B 1MFAL 3GMQB 3KG5A 3BP6B 1HI6A 1MIML 3X3GL 1QFHA 2ZSVB 4PJXA 4X6DA 3MSPA 4GLRH 2LU4A 4L8SA 2GAZA 4K7PL 4PJGF 4ALAH 5I75B 4WUUD 3BIKA 5GISH 2X9YA 3FT4A 3O4LA 3UX9B 1HSBA 1UA6L 4PG9A 1T5WA 1KPRA 1GGIL 5C0DB 2B5IB 5IW1B 1W0VA 3BESR 1QSEE 1U8KA 1QLFB 4K3DH 2CDFB 1U3YA 1WQVT 4QRRB 2AXFB 1IM3B 3GKZA 4Y5VA 1QKZL 3FHQA 2W9DH 2ERJC 1JUFB 4XVJL 4AH2A 1T2XA 3GMOB 5I73B 3O6ML 4LCWD 2ADFL 2EXYD 2VISA 4KRNA 5HYJA 1MNUH 1WFOA 4QRTB 4JFXA 4K07A 3SKNA 1RUPH 4KPHH 1MFBL 4JKMA 5TF1L 3ROOB 1RUML 4KDTC 2X7LB 3VGEA 4XAWH 1FVCB 1MCOH 4Z77A 4YAQA 1NGXA 4ZQKA 1VFAA 2FX8L 1IQDB 1EAPA 1N26A 4QY8B 4TTDC 1FFQA 5KSAB 3NFNA 3RHWF 3NZ8A 5F7WC 3L3KB 1MJ7L 5C0BD 1U91B 1CFVH 4LOUC 3MRPB 4WEMB 4TOYH 3LOWA 4KV5F 2RJMA 1SEQH 2CO7B 4N9GA 1P7KB 4LRIC 4P2RB 4ZAKD 1TQBC 4XXDB 5FAAA 3GBNH 4QGTA 3NCCB 4M6NH 4M7KH 3PWVB 2OZ4H 5EC1B 1V3KA 1MVFA 3B2VL 3IETB 4NPYB 3JTSA 4NQCB 2YPLD 5IQ7H 2H1PH 5CSBA 4KK8C 2OS7A 1EHXA 1T7YA 5ESVA 1U3HB 2DMBA 4M9PA 2QHRH 3M1BB 1CFVL 3CIQA 4QRUB 2XPGB 1CGVA 1NEUA 4NO0A 5SWSB 4QHNA 3U4BH 5JUEL 4NP4H 1JNHB 3ARSA 3MGAA 4ZTOH 2ARJB 2Q7NA 4PB9H 5E1AB 5CEZD 2V9TA 3U1SL 4P0DA 2NY4C 4PJIA 2CR3A 3QEQB 5EC2B 5GRWA 3MRRA 1SQ2N 4IHOA 5DFVC 5DTFA 4DKEL 1S7UA 5JHDA 3MRDB 3N1GC 4ZODA 5DVMA 3T4AA 1YN7B 5L88L 2FATL 4JR9H 2X09A 5C3TA 2ZP0T 3T77A 2IBZX 1EX0A 5CEZH 4PP2B 5EUKB 5DI8B 1TVHA 5CJOL 4WU5A 1Y0LB 3QEHA 3LPGA 4NOFA 3GBNL 3IDGB 3UTPD 3HE6D 2X9WA 1KN4L 4XHJD 4L3CB 4ETYA 2HJLB 2QKIA 1J0KA 3K80A 3VGGA 3QUXA 5HGGS 5IM7B 5AZ2H 5SX4H 4G42B 1PD6A 4CU6A 1PW3A 4MWFB 3IDIB 3VWJB 5JXEC 4S2SA 5FYJL 4Z8FL 3GSVA 4FTVD 3R8QA 4E5XB 3BMVA 2C3VB 1Z5LB 2RFXB 5DRZB 5F8RC 3O0RH 1AH1A 4C58B 1ZHNA 5FHBH 3SE3C 1NUDA 3O3BA 4LGPB 4G9DA 2P49B 2W9EH 2Y72A 4FQ2H 4U7MA 1T4KB 2QJDA 5CZXD 3VXUB 3IRZA 4KMLB 3BWAA 3BUTA 4X7CC 4YJZL 1CR9L 1GIGH 1G7HA 4XB8A 1DLFL 4GAGL 4MQTB 3DYOA 5EU6D 1BAFH 5D70L 3DVNB 4W4OA 1K85A 1MHHA 1RJLB 4Z8FH 3DOSA 3CDFA 2HKHH 3FB5A 3OKNA 5IHZA 4NO3B 2ZKHL 4EZMA 4TRPL 4NZTL 2Q7YA 3O3AB 4KC3B 3QQ9C 1WZ1H 1KG0A 4PJ9D 4LARH 1TXKA 3QUYC 5D7IE 3U82B 4OM1H 5C8JA 4RSVA 4OI7A 2ITDB 1ZAGA 1QRNA 2R2EB 1A64A 1CDJA 4XHJC 3C60B 2JELL 4IS6A 2H26A 1SYSA 43C9A 2MQCA 1OLLA 5BJTA 3SDDD 1SY6L 3DMMB 1NBVL 1JK8A 4WEBH 4Q74A 5J0BA 3MRFA 3WS6A 4FABH 4Y88A 5DDHA 1PKQA 1S9WB 1KC5H 4LCWB 3WIHL 5BXFB 3LAFA 1ORSA 3LS4H 2O26U 4PRHE 1GGYA 3X17A 3PHOA 1TVBB 1CK0H 4XNMA 1VENA 5I9QC 4RISH 4ZO9A 1R24A 3MBED 5JXAH 4F2MA 2NNAB 4PBVC 2KL6A 5DURD 35C8H 3ARBC 4NOBA 4P57A 4WHTA 1R3JA 1C8PA 3BZ4A 2F5BL 1VFBB 4MXQC 3T4YB 2Y36L 1JZ6A 2G75A 4ELKB 1Q0XH 3TBVA 3GFUA 5C0BB 5IEHA 2F53A 4PRBA 3LH2L 3PP4H 4EN3D 1GGCH 4WW2C 5DWUH 3KPSB 2JK5A 4AM0A 2P1YA 4HK0A 3PV6B 4U1NB 5BV7H 1G9EA 4ELMA 3X3GH 1ONQB 1IM9A 4GBXC 1UEMA 3KPMA 3KPOA 2RIKA 4S0SD 3ARUA 4XCEB 4BQBA 1N3NB 3HCVA 5IB3B 5EDXA 1XGYL 5EU4A 1SJXA 4Y19A 2CLZA 2ZCHL 3QUYD 4YO0B 1M7IA 3AAZB 4Y4KC 3ARFA 4O9HH 3DV6A 5KSAD 4NT6B 1U58B 5DJXB 3HUJA 1JZ5A 3GJFB 5J13B 2EC9U 4XC1L 4C57C 1Q94A 2VAAB 4U7SA 1XF5A 2A9NH 2J12B 3BKYL 5J11C 1CFTA 4NNPH 3EJYC 4OIAA 2NX5A 4BM7A 3ZKXB 2GK0B 4D9RE 5T3XH 4WDIB 3IDMA 4BH7B 4PRID 5DUPH 3LZFH 3VFRA 4YGVA 4NRXB 1RIUL 3MFFB 1B4RA 2N4IA 2QQKH 5DA0B 2EDDA 3IFOB 3QULA 5E9DA 5DMGD 4UZGA 1QO3A 4JDVB 3BUYB 3RU8H 2BJML 3IXTB 1U3HD 5ADPH 3S37X 4Y4FA 4FFWD 3BKML 1G0DA 1L9MA 1AHWC 4XBEL 2Y7QA 5FYLL 3ECBA 4RGNC 4M6ML 4O2EB 1RI8A 1N59B 2EDRA 3L3IB 3QDGB 1N2RA 4JM4H 4UB0L 2NY3C 4JZOB 2YUXA 2BVPB 2MPAH 4X6CA 5HGDB 5I76A 5CHNB 1YY9C 3C6LB 5IR1B 1T20A 3GSUB 3MCLL 1D6EB 4P5TD 3ZHDA 1FCCA 4YDIL 3TBSB 5BV7L 1DQTA 1MAMH 5KVGL 5HHPB 2FGWL 3GRWH 4ZNCD 3EFDL 3TVMA 1F3JB 4IRSC 4QHKJ 5L8LB 1FNGA 2R4SL 4F37K 4HMEA 1HH9A 4I5BA 1H3PL 1PQZA 1J86A 4QXGH 1LE5B 3TPUB 1J1XL 3OXRA 5HYQB 3H9SD 4WNQA 4I3RL 3NFSH 4U1IA 3IJYA 1S7QA 4MLIA 1OM3L 2JELH 3D69A 5HJ3B 3QO0B 4YHIB 5ID0B 4HUNB 4PJHA 3QIUB 1AGBB 3PQYA 1WCBA 1LO3L 5INCB 2FR4B 2VSCA 3BGFB 5KVEL 3CFKA 4PJ8A 4POZC 1K4DA 2H8PA 5EU6B 3BISA 1W72H 4EEEA 3MLPA 1A9BB 3BO8B 4GQ9H 1C5BH 1QYGL 1UJ3A 3NFSL 5A3ID 4PTUA 3MLRL 35C8L 3WNKA 3JWDL 3MLTA 1RUAH 5TE4L 2VR4A 4PGDB 1GHFL 1BFVL 2G9HB 2OLDA 4JFED 4OZGE 5F88B 1TPXB 3S4SA 4HFUH 3QSKB 3P9LB 4OFDA 5EU7E 3LH2H 1QVOA 3AU1A 2AEQL 1TZGH 4K7FB 1R5WA 1W2KT 4PLKD 2MHAA 5T5FL 1TNNA 1PQZB 4LCUB 1WZ1L 4PRIE 2I60L 5HHQB 4LSSL 4QGYA 4POYA 3S34H 1KOAA 1EEUA 3U46B 3V7MA 4QRPD 3L3JA 1N5AA 3LN5A 1T20B 1HYSD 4OQTL 3KYAA 1T2QH 2E9BA 1TJIL 1CL7H 4EUPB 3MA9H 4UIKL 2GITB 5LGHL 3HE7D 1N2RB 3FRPA 4JFPA 4W70A 3MBEB 2R0KL 1LHZA 3J8F7 4L4TE 1QHPA 3MLWL 1Y6MR 1ZLUK 2VLRA 3D3VD 2YOCA 1QFOA 1OGAE 1Z9MA 2P24A 4GOSA 3BP5A 2BX5A 2R29H 5FGSA 4OCMC 4ZPVA 4ERSL 3VG9B 5JDSA 1RZ7H 3VFRB 2Z9TA 1J1OL 4JHWL 1E4WH 1KIRA 1IGML 2Z35B 5F7EH 3LHPH 5I73C 3RUGB 4TRPH 1X3DA 4HIIB 3OMZA 4RBPK 5CGYC 5F1NA 3NAAH 2NR6D 3NCJH 1FE8H 3L5XH 1CFTB 1ZT4B 2IANB 4I2XB 4NJAL 1OQOA 3MV8E 2XNAB 4R9HA 5ALCL 4M7LL 4BSVB 3CFIC 2C1PB 1XIWC 3D25B 4FQPA 4LSDA 2HFGL 5KBNC 3S36L 1S5HA 3FFDB 3OPZH 1Y6NR 3MLXH 2X89D 4M3JA 1GH7A 4LVHB 1AR1C 1WK0A 1A2YA 3GUTA 3MRHB 5FECB 4MXVE 1OWRM 3RIAF 2XRAL 5IFAH 1T04B 4F3FB 4JRYB 5GGVL 5D1XA 4WI6A 4NCC1 3MGOA 4JO3L 1EFXA 1QSED 2YBRA 3S4SB 1UKTA 1U92B 1A6PA 1IC5L 1AHWA 5EIVA 5D7LD 3AM8C 4QOKD 2F8XC 4PTUB 4KQ3L 4NUJB 5E8DL 3NMEA 1IAOB 2YZ1A 3QEUA 4JFFA 1B4JL 4ZO6A 5I19L 5JW3H 1FNSH 4UTAL 2OI9B 4MDJA 3DRQB 2XI9A 2HG5A 3B2VH 5CJOH 3HUJF 4F9LC 3SDXE 2ADFH 5KVFH 4MAUL 1KXVC 4I18C 2RB8A 1A7QH 3ILPB 3C8KA 5SV3A 2Q76B 4HWUA 1YEHL 1A6WH 5HJ3A 4JQIL 1U93B 1G6RB 3MXVL 3V6FA 3NIFE 4I0PB 4MQSB 3D39E 3DMMA 2Z93A 4TUOA 5ITFB 4HJJL 2HT4D 3BPNC 1KCRH 4LQFL 4AT6B 4QHMA 4C56D 3I6LD 1F3JA 3C60A 4IS6B 4Y4HC 2RGSA 4Y4HB 5DK0A 5DSCB 3QFJE 1D5IL 4L4JA 1LEKA 3TJEH 3EFFA 3NAAL 5IV2A 5IR1A 4NZRL 1HIMH 3QNYB 3T2OA 4X6CB 5HGDA 5HGBB 4HJGA 5DMYA 1DEDA 2WNGA 3ROLA 4ZUSB 2LE9A 2NY5L 1B3JA 2R0ZL 4V1DD 1MFAH 4YPJA 2YUZA 2V2XB 4FQCL 4OCYH 2JCCE 2DYPA 3QIBA 4KK5C 5TDOB 4H88H 1KPUB 2C7UB 3MLYL 1RIVH 3I6GA 5C09E 4R0LB 4YNYA 4M5YL 2FO4B 3U4AA 5JQ6H 3LKQA 4G5ZH 2ADGB 4XVTL 5I8EA 1MELA 3L5IA 3WFBL 4OAWA 5I1AB 1EFXD 4K2UL 4HUVA 1FP5A 3LCYA 3TA3A 1YECL 4POZD 4JM4L 1F13A 2JCCA 5I1LA 1JRHI 3BDXA 2ZSWA 1R6VA 2HA1A 5F71A 3U36B 1DSFH 3MA7B 3IAGC 3KS0H 2LABA 4XMPL 3QQ3B 1XF5B 4P59L 5D7SL 3ARRA 5F7FA 5GRXG 3ZMRA 3IJHB 4OV5B 3MXWH 4HKZB 1ACYH 3MRCA 2EE9A 1V7ML 3DV6B 2AJUL 3LQZB 2NXYD 3D85A 5FV2A 1M7IB 3ET9F 4JQXC 1UKSA 5L2KA 4PJIF 2AJSH 3HE7C 2RCSL 4NM8H 4K23H 4F7EA 1OAQL 4W6WB 2EIZB 1MRDL 4WFFE 4GG8B 3KPOB 4F58H 2ZCKL 3LB6C 2XQYK 3JWNC 4PPTA 2VE6A 1R3KB 5CMAA 4KHTH 5D5MA 4XH2A 3VXOB 5I30L 1WTLA 5TQ2L 5DK3A 5T1DL 1DBBL 4BKLA 1UA6H 3VDBA 4S1DC 4C83A 5JHDB 3T0WA 5TF0A 1U8LB 5GS1A 4LVOB 1C12A 3TCLA 5DJDB 4AIZB 1XIWA 4H0HB 5K93A 1FV1A 3FFCA 1OGAA 4CN1A 1IGFL 1HSAB 1P1ZB 2W0FB 2IAMC 4RAVA 4GRWH 2H9GB 3QHZL 3DXAD 3VRIA 3QQNA 5AYQA 1J11A 4TULL 2DBJA 2I9TA 1CE1H 4WUUA 5HD8D 4O02L 2W9DL 5ANME 5IQ7L 1I9EA 2A38A 2E6QA 4XMPH 1JPST 3T1FB 3EHBC 1KELH 1K5NA 2HH0H 2YA0A 4NQTA 1RUQH 5D93B 1FG2A 2CDEB 3M1BA 5MI0C 1MREH 4WI7A 5ESVB 1IGCH 1NMAH 4WW2B 4PGCA 1RPQA 5JW4Q 4XX1E 1N64L 1I1FB 4BFEA 1FH5L 1SYSB 2AW2A 5J57B 2VUOA 5MEPA 3K2UH 4GBXB 2JCCB 5I1LB 3C5ZD 1GPOL 5F1IB 1NANI 1C7TA 2WK2A 2W1NA 4XC3L 3OTTA 4NBZB 1P2CB 1YQVL 4DGIH 5JMRA 3GIZH 1GJIA 1NEZB 5DRXA 3WNPA 4X98B 4ZUUA 1OSPH 4ZNEA 3F5WB 2MJWA 4IIQA 2IJ0C 4WTZG 1IGFH 2MNUA 3O2VH 3UC0H 4WV1A 5DFTA 3FMGL 5F44A 1D9KB 1F02I 4YAQB 2ZG1A 3BP7B 1E6OH 3A6BH 4NGHH 4OV6F 2P5WE 5DC9B 4F7TA 2WBJB 3ZKXC 4LPCA 5TQ2H 4AZ8A 4JFXB 4JRYD 1ZA3A 1MJUH 5GGUA 4KRLB 2FX9H 3ALXA 4TSCL 3UPCA 3QDMA 4FQCH 1T2JA 1A3RL 2OM5A 3C5JB 3E2HC 1P7HL 1NDGA 3C08H 3QEQD 2VQUA 3CFBA 3FOMB 3O6FA 1AKJA 3H9SA 2VLKE 1Z5LA 4Y5VB 5B38G 1ULVA 5BW7C 4HKXB 1A14L 4HXBH 1WIPA 5DLML 2CKNA 1UENA 4RIRB 1CICD 3GK8H 4CVXA 2JJTA 3ZDZF 5IB2A 1U8IB 4JPWH 5KS9F 3PWJB 2IGFL 43CAB 3SKMA 1JI1A 4Y2DC 4NQED 4NUGL 3TV3L 1PGRB 2ZUXA 1DLFH 4GAGH 1RZKC 1JGLH 3BP4A 3O45B 3D0VA 1FFRA 3CNKA 5EWIH 5HGHB 2E9JA 3IGAA 3SE4C 1HK6A 1E4XH 3VJ6A 2IH3B 2DICA 4KRPB 3SE9L 4WU5B 3V6ZA 1TVHB 4XNXL 1G1YA 4BK5A 4JPVH 4XVSH 2A9MH 1BGXH 4DN4H 4UB0H 4JG1L 1SJEA 3VD9A 1PYWA 3HNSH 1ZLVH 4KI5F 5F97E 4RDQF 4H0GA 5JOEA 3CSPA 4JN2A 4Y5XA 5K9OB 4OFKA 2X42A 5A2IH 5SWQB 3RWIA 2ARJA 4ZXBC 4AEIL 1FCGA 1F6AA 3M8OL 4XPAH 1JTTA 2NY1C 3CSYA 3MV7A 4JFYA 4V2CB 4HMCA 1T04A 3R06A 1YEJH 5FA3B 4EQ3A 2A1WL 1RZFH 1QD0A 1EA9C 2EH8L 5IFJA 1AY1H 4ETQA 3L3DB 3VXNA 1CXFA 1LP9E 4WFEE 3FFDA 4AENA 3O8XC 2UV3A 1MLBB 1S7WA 2CK0H 3FFCE 4GMSL 3IU4L 5GIRB 4Z5RB 2RQ8A 3GHEL 1FZMA 3JTSB 4NQCA 3LKRA 2NY0B 2Y9RT 3MO1B 1G7JA 2ESVD 1TPXC 4N9OB 3V52L 4XXDA 4XPTL 3RVXC 2ZKHH 4QEGA 4LEOA 4KZEL 1UM5L 5C2UB 5FGBC 4FFVC 1G7IA 4EJ1C 3KYMB 4OGXL 2GKIA 3K0WA 4G9FE 5HVWA 1L6ZA 2VH5L 1WJ3A 2ZJSH 4YHLL 3L3KA 4OF5A 1N4XL 1KCKA 1J0JA 4KJPD 1S7XA 3D6GA 4YE4L 1AGCA 4P5MB 4X9BA 3M07A 2XWBA 3L7EA 5CBEB 2EICA 1HXYB 1FN4B 1HH6A 1KGCE 1FL3A 5DJZA 3JV6B 3DXAB 1T5XB 3K8KA 1JGVL 2C3HA 2B5IC 3ZT7A 4CBPA 3N1QC 1M7XA 2E7CA 2YA1A 1IBGH 1RHFA 5FHBL 4PTTA 1R3LA 4FQJL 4JFDA 5CKGA 4Q9QL 2XA3A 4M6NL 4M7KL 4JY5H 2EDJA 3NGBC 3RJQB 5C08B 3QUML 3ES6B 4EUPG 4FQ1H 1IE5A 3OKEB 1OAYL 1JUFA 5T3XE 3L3JB 4XPFL 4XCFL 5JXED 2DQGH 2Z8SA 2BSTB 2VTFA 3ARDC 1ACZA 3MA9L 4TOYL 3DUSB 2R15A 5DEFA 1G7JB 4X4XB 1XGRB 3HNSL 4CL7A 2XN9A 1U8KB 2YEZA 1CTNA 1ERNA 4N68A 3C6LC 3MLUH 2AEPL 4U1MB 5EBMA 3S35L 1PEWA 2CRMA 3B83A 5BS0D 2J8UB 2DQCH 1S9VA 3MRQA 3LMJH 1A1OA 1X5YA 5HI5D 1XF3A 4YX2H 1OARL 2DD8H 2JJSC 1Q9WA 5IUSA 4I3SH 4MXVF 1RZGA 4P4RA 3OF6A 1IGIL 2EDXA 3WLBA 3BO8A 2QL1A 4K71C 4LDEB 5T5NF 5I1EH 1FBIH 3IU3A 3EOAB 5DS8A 4G8EB 5EU6A 2A83B 1BVLA 4U3HA 1CGWA 3BGMB 1UZ8A 2AKRA 4G80A 1AE6L 4OF8A 1KCVL 4TSAL 2HFEB 2BNRD 4IMKC 4UV4L 4Y0GA 4GRMA 4Z7VF 3D39A 2FL5B 3D3VE 1IEBA 2NY1D 3AC0A 2DQEH 1EO8L 1L7TH 2NQCA 1X5ZA 3V8CA 4ENEC 1NC2B 2BFVH 4HWBL 4MMXC 5HTSA 1S7RB 3MV11 2BSSA 4LP5A 3QRFM 4Q2ZA 4FTVA 5HYQA 2H45A 3WKNA 3QCVH 3ZZ1A 2XA8L 4H25A 3IJSA 4IOFC 1HH9B 4I5BB 1CR9H 1GIGL 2FECI 4JDZA 4QO1A 1RMFL 2AV1A 2ZUWA 3QDGE 1FNGB 3AS1A 3O3UN 3OKDA 3IDJB 5GGSA 3C2AH 3TH3T 5TDNB 1YPZE 1H8NA 4Z0XA 5HHPA 5AEAA 1JN6A 4JO2H 4D0DB 3OZ9L 4NQEB 5CLWA 2X41A 4RFEA 5DEGB 43CAA 4YFEA 2ZG3A 4MNQE 5JW5A 2AEIT 4KMTL 3VFPB 5IB2B 5I76B 2OZ4L 4OLZL 2VLJD 3SGKC 3UJIL 3MROA 1DN0B 1I7TA 1MF2L 3PWPA 1AD0A 5GRUH 1N59A 3C6LD 3L3IA 3KAAA 4ZXBD 1E6JH 3SJVA 5C71A 1UZ6F 2KPNA 3EKCA 3VXSD 3IDXL 5KSBF 3QUMB 1NCCH 4JQVC 4NZDA 3EIFA 2OR7A 1N6UA 1I9JL 4I2XE 4LHUD 4DFHA 1JPTH 4PRPA 1NGZA 1FYTD 1YJDH 4KK6D 4NWUH 4XAWL 3U0TA 1KN4H 7FABL 1FO0L 2BNRE 5DUML 4OIIH 4W4OC 2DS4A 3GBMH 3H3BC 3B9AA 3WIHA 4R90H 5BRZB 3ZE2E 1TZHA 4MD4B 3WJLA 2NW3A 1EGJL 1I3RB 5E4IA 3BEVB 4WY7L 1P4LB 4LKXB 3C08L 5JPMA 3KWWA 3BKJH 4XX1G 5F7KC 4MCYB 3ARDB 1CLOH 1QFWL 3FQWB 4OCXH 4CJ0A 3U30B 3VD5A 2BY2A 2I9LB 4UQ2B 2OMBA 5E8NB 3IS1X 4UNVA 2V17L 2Q6WB 3L3GA 5GJTL 3DSFH 3AREC 3QXAB 5HY9A 5T5FH 3C9NA 4ZTPH 2XQYG 1F45A 2EDOA 2ILLA 2DQEL 2VXTH 3RPKA 4GSDH 1OB1B 3GMPA 4TNVF 3P4LA 1G9NC 4LSRL 3JBG7 3NCYP 1SY6H 2FJHA 2XACC 1U2CA 4M6OL 4LFHG 1BZ9A 3RDTD 3V6OA 1ES0B 2GJ6D 5C86A 3V8OA 3IFNL 3RTQB 2V2TA 4KROC 3RFZC 3C8DA 1LE9B 5CEZE 1QBAA 3WMSA 5EIIB 5T1KA 1BJ1J 4CVUA 1MRCH 3HAEA 4HKJB 3MTRA 4BSWA 1S5IH 3DGCR 3QWOB 1Q9KA 1T3FA 5HYJE 1OOAA 3U7YH 4F7PA 5JDJA 5KS9A 4OLVH 5DD0L 5FYKD 3Q6FA 4FQHB 1X5XA 5IVXE 4F7CB 3G6JB 1F3RB 1I9RL 1F2XK 3WFCL 4XH2B 4FFYL 4Z0BH 3VXSE 3FRUA 1JIBA 1R3KA 4PJFE 4ZFFA 1EEQA 3U7WL 2HVKB 1RZ8B 5FYKH 1WBXB 3B43A 5HY9B 2CLRA 5FB8A 4NQVB 2NXZD 32C2A 5K9KB 2OSLB 2RCSH 1GXEA 1QLRB 3L9RB 4OLWH 3H3KA 4Q0XL 1J12A 1CDIA 4KHXH 3LN4A 3AY4A 3QO1A 1I1YA 1JGEB 2XTLA 4TUJA 4YHZL 3SBWA 3KYNA 3HKFA 4FZEL 1I75A 4N0YL 3F65A 4J8RB 3EFDH 3HNVH 3NTCH 1I7ZB 3OKNB 1U36A 4AYFA 3BEVA 1QP1A 3TNMA 5I1JH 2P8LA 1MRFH 4KKAD 3NPSC 2Z8VC 4TTGA 3CX2A 2BJMH 3WHE0 1OVZA 3L95A 2X1OA 5DQ9A 5F3BA 5J7CC 3AS2A 1HHJA 4OAWB 4BQ8A 5I1AA 2P5EA 4R8WL 2BOBB 2VITB 3HZKB 1LK2A 1ZS8A 2ZUQC 1QPPA 1FJ1A 1NC4A 3BRFA 1EJ6A 1WISA 2DDQH 3RKDC 1DUZA 1LK3L 3DX6A 3HZMA 1CBVH 2VITA 1QFPA 3FQUB 5D6DA 3Q5YA 3WHXB 1JI2A 1L0QA 1T1XA 4FZEH 4YBQC 3L6FB 4GAJH 4K3HA 2CO6B 3HG1A 5AZEL 1HDMA 1KBGL 4ELMF 4MZ2A 4TNVK 4GT7A 1J87A 2P8LB 5F7LB 3RZCB 1BBJA 2F58L 5EULV 1A1NA 1UM6H 1YEKH 3ROLB 5GRVL 4H8WH 1OTUC 1X5KA 4B50A 4ZYKA 2VLMD 3VXMA 2DLTA 4HJGB 2ED8A 4OLYH 3QQ4A 5L2KE 4XPBH 5J6GA 2V2WB 2W65B 3QNYA 3ARZA 1IC4L 1WBYA 1MHEB 4WHYH 4I77H 1S9XA 4HULB 5TDPA 3BZEA 4YQXH 2VXVH 4Z7WA 1YQVH 1SY6A 32C2B 1MUJA 2BNQA 5AYUH 4D9LL 3KXFA 1RVFH 5TE7H 1RJYB 4WUUE 5CILL 3PL6D 2HVKA 2XXMB 4KTDH 1A47A 4G7YL 4QRRD 5EFIA 3V6FB 3JWOC 4BFBD 3VXSB 1H9VA 4GRLB 5F9JA 3W5NA 3BGAA 3EYOA 1MLCA 4MQ7B 1ZHKB 5HHOE 4E41D 2OK0L 1A6WL 1N7MH 2MQ3A 3MYJB 3QT2A 5SWSE 1KJMA 2ZUVA 1B2WL 3CDGA 1A7PH 1XCTA 3KR3L 4PJXE 4OGZA 4Y4HD 4O4YL 4DK3A 5EBWB 4P3CH 3HNTL 4P2YA 4ZFOA 3RL2B 2VDOH 2NY5H 1T1ZA 5DS8B 4NN6B 4G8GE 2F8OA 1AP2A 2VLJB 4MNGE 3QHFL 1RZGB 4HV8A 2CKBL 4JJ5A 4YWGL 4YXLL 5SWSA 1IGYA 4LLQB 1HYSC 1ZVYA 1IAKA 1A1OB 3CFCL 3QXUA 4V2BA 1YY8A 2C3GA 4P2RE 3G5VA 4ELME 4PV8A 1OB1A 3TM6A 1X5HA 3QI9B 5MP6H 4PJCB 3GSNH 3E8UL 3QISA 4H26A 3P0YL 4JCMA 4NPYA 4ONHB 5E5MA 5CJXA 1CLZH 2XN9B 2IG2H 4PRHD 1FZJB 3H0TB 4W81A 5GRYA 3UMTA 1T1YB 2UYLB 3BGFC 5EN2A 3JTTB 4JFZL 4QOKB 5MENE 5JHLL 2ZOKB 4K3JL 1KC5L 1FORH 3OKEA 3WNMA 3UTTB 1RZJH 4O51A 5IP4A 3OX8B 5J3HD 3DX7A 4DKFH 3ARDA 3HI6H 1I1AB 4X8JB 4PIRF 5JPMB 4WGVB 3NZ8B 2PYEE 2DQTL 4BSVA 5JMOC 2X10A 5I66A 1SYVA 1U8MB 4AL8L 3HUJE 2YD6A 5MEOB 2IANA 1FFOA 1FL3B 4KJYB 1FHGA 4LLYA 4MSWA 1CFSA 4NZUL 1RJZB 1FVCA 5BRZA 3VU2A 3PABA 4XWGH 1AGEA 2XKUA 5CILH 5J06A 5D1QD 3VFVA 2I07B 4A6YH 1IILE 1JHTB 2D7OA 2V5RA 4L8DA 4DKFL 4Y16A 4JDTH 2XKSA 2AXGB 2X44D 5EORL 3KGRA 3RUGE 1A7NL 2HT4C 3VXRB 2F5AL 4XI5D 5KTEH 1MJ8L 1P4BL 1C5DB 3TGXA 2VL4A 2C4XA 5EUOF 4KRMB 2JE8A 5LBSH 1I7TB 5FYJD 3OAYK 3FHAA 2HJFA 1FZMB 5CIPA 2F53E 4MNHA 3VH8B 3W82A 4M3KB 4X9FA 3IAPA 1P4IL 1JWMA 1EFQA 2R1XA 3IDUA 1DQQA 4ENED 2VDNL 4GRLC 1OTSC 2ADIA 4LU5L 3FZUC 1H3TA 3CXHK 4Q6IB 3DVIA 3MV7B 4JFYB 2IADB 2MHAB 1EV2E 5DJ8B 4LPTA 4OCRL 2VLKD 2VQ1B 3NCYS 1F6AB 4LQFH 3UYOD 4G7VL 4WWKD 5FM5O 4U6HA 2YMXH 2X70A 4XCCL 4XGZB 2EYTB 3QFJB 1KLUB 4YHMH 3U2SB 1RIUH 4NFBA 3V9FA 3FO0L 4Y5XC 4ZS6D 2AJZB 3NTCL 3LQAC 3HNVL 3DVFA 3FQNA 3VXUD 3D2UD 5CSZA 1T1WB 2NY4D 1YEFH 3D0LA 3ULVD 1DBKH 3VI3E 3D18A 1WLHA 4L8SC 1FVDA 1RUMH 3SGDI 5HPMA 4ZSOB 1PKOA 1A4KB 2BVQB 1JWUA 2WINA 5D7IA 2GJJA 2BP3A 3RBGA 3U0PB 4L4TA 3RZCD 1YMMD 1F8TH 3O45A 1OAXH 3AXLB 5C0FB 4B7IA 3X11B 4PY8I 1SBBA 2HJKA 4LRNH 1AI1L 4GW5A 4ZOBA 5J9PB 4CU8A 2WBKA 1I3GL 4CVXB 5E8OB 3MNZA 5IFHL 1BD2E 5CJBA 3G08A 5ESQB 3I84A 3BW9B 3SE9H 1J1XH 5IT2H 5EZIL 1T83C 3GSRA 4YUEL 3TBSA 4EDXA 1AKJB 3BVNB 3JUZA 1PLGL 1F6LL 3OWEA 1YQ2A 4JM2C 5KSUA 4C59B 1C5CH 1LO0L 3TV3H 1KFAL 3DX8B 1RK0B 2AS5M 2WBJA 5LJYH 5BS0E 3QDGA 2PXYA 1T5XA 3UYRL 4ZS7H 5DHVB 4CUCA 4EUPH 1QG3A 3UYPA 5HHOA 3P30L 4JAMB 1D9KA 2F54B 4XNYL 3WN5B 3QXTA 1JPSL 3GK8L 4JHAH 1LDSA 4RMWA 3LKNA 3BUYA 1RUKH 1F8TL 5CGMA 5F7EL 3W39A 3QULB 3WE6A 2Y25A 4X5XB 5DHYA 4DW2L 2FDBP 5FKPB 4X6FB 4KKCC 4OCSL 4ODUA 2AXHA 3GHEH 1S78D 3MUJA 5F1IA 1EMTL 4NC2B 3BJ91 2H3NB 1YEDA 2AQ1A 5FCUL 2FRGP 4Q9BA 4LF3B 3P4NA 5KVDH 4G6JH 2IPTL 1U2HA 3ZKSD 4JREB 1CG9A 4NGHL 4XHQA 1W0WB 4JREC 2AJSL 3BIBX 5GJSL 4X7FC 5D2NA 4NWTL 3BZDA 2DWEB 5FGRA 1JCKA 5DMIL 4CAGA 1I1AD 4P59H 5D7SH 1UJ3C 3GMLB 3QNXB 5DUMH 2P46B 4JFQA 4P2OA 1I3GH 1N3NA 5LGJA 3O41A 4UQ3A 4NWUL 1EMTH 5E99H 4C54A 2VLLA 1RMFH 4ZS7L 1EO7A 1FL5B 2OTWA 4RAVB 4GAFB 4OLUL 4JM2D 4OD2A 5SWQA 1W72B 5D7KE 1KEGH 3K2UL 1JWSB 1OT1A 4Z6AT 4NQXB 1E0OB 2PF6A 5DJDA 4AIZA 1EGJH 1RUKL 3CPLA 4U33A 3X12A 1SJEB 5D7LE 1ZV5A 1T22B 4ZDHA 1QSZA 2GIYA 5TE6H 2IAMA 1H8SA 4C4KO 5IEHB 1QZ1A 3HI1A 5IB5A 5CJQL 3SPVB 1FZKA 3QWRA 4QLRA 4CN6A 5JLZA 5D1ZA 3JVGC 4PGJA 1RIVL 1ZK9A 4LCCB 5E8EA 4UIMA 1ORQA 2HFTA 3ME0A 5CAYB 2Z8RA 5C9JB 3OKLA 4N0FB 4JRXA 3D0VB 2EECA 1F90L 1GGUA 4TNWF 3E6HB 1NUNB 4WEUD 5AUMA 4FA8A 2VH5H 3TN0C 5IMMB 2QQLL 3AFLA 1ORSB 2VNCA 3HLAB 3WD5H 1S9WA 3LKOA 5AWNL 3JV5A 2FECL 4UUJA 5GGRY 4J3UA 2VUYA 2E27L 3V2AR 3S5LB 1J1PH 4P9HL 2FX9L 1R3IL 4LRNL 3EDJA 5IMOA 2BRQA 1H0DA 2Z31B 3MBXL 1Y18A 1OHQA 1LO2L 4EOWH 5HSFA 2B0SH 3TH4T 1ZEAH 5FUOL 3F7VB 3IFNH 1YN6B 5F9WB 1GGCL 4EI5B 5JORA 4Z7VB 3CZFB 4RQQB 3X14B 5DA4A 4MXWL 4G6JL 5C0RH 2DN7A 1D7FA 2Q7YB 4HLZH 5FGCE 1RFDH 4N8VG 3B9KA 4X5WB 1AO7A 5TDOA 2UVFA 2F5BH 3VG0H 4MS8D 2DIBA 2DQJL 1T21B 3KYOB 4ODBD 4KY1L 1EERB 4WRLA 1E4XI 4WI2A 1X6LA 4S1SH 3QHTC 4X0KA 3O11B 2EKSB 5FYLD 3BD4A 1K2DB 4LDLB 1SEBB 4OZ4B 1ZVSA 4PREA 3OXSB 5KZCD 1II4E 2BNUB 3KPPB 3RAJH 2ESVB 1CDYA 4DN3L 1ZHBA 5DSCA 3FT3B 4NQUA 2Y07L 1P84K 1U8QB 2W07A 4AT6A 1UADC 3FN3A 3Q0HA 1FGVH 1HHKB 2IFFL 4JR9L 2Z93B 2L4OA 5HI5C 5ITFA 2VDQL 3TT1L 3C2AL 2JJVA 4M02A 1AI1H 5EO1B 3WDIA 4LHQB 2CLVA 5L9DH 4R4FL 1H3WM 1K5NB 5B3JF 3GHBH 5IVOA 4KUCD 4L3CA 4E9LA 1MCPL 1R5VB 4AG4L 3GB7B 4JG1H 1INDL 2DQIH 1MQ8A 2BSRA 5BQ7A 1DTUA 4N1HB 3VI4F 3L5XL 5MHSD 2OL3H 5EUKA 4JFFB 1FZKB 5CINH 5C0IA 2R2BB 4P23B 1FV1B 5EH1A 2V5YA 4M7JH 5IW3A 4JKPH 5A16B 3TBYB 3MRNA 3O8XD 1MHCA 3T4AB 1YUHB 4M5ZL 1I8IA 4IOFD 3EOTH 1RSFA 4H5SB 2NY7H 3NA9H 2YBRB 5T3XD 2A9ML 3MLWH 5HDQL 2IGFH 3EYUH 3NOIA 5C0CB 1K8DA 3TN0B 3GKWH 1R5VA 4DVRL 1OPGL 4PJEE 3MODH 4LLMB 5L6YH 1MAJA 3GUTB 5MEND 4R96A 1QBLH 1EH9A 1A5FH 1DBAH 4YDKH 2Q3AA 4KJPC 4N8VB 3DTXB 4XCFH 2X4OA 1IC7H 1WAAF 1VEMA 3D25A 3DI2B 4Y1AA 1C16A 1GPOH 3HZVB 5TQ0L 4J3OC 2YD9A 5F93C 3W0WA 5B3JE 4Q9QH 1A21A 3PQYE 4NC1C 2BNRB 2IFFH 5H8DA 5EOCH 4V1DE 3GSNB 1FC2D 2CUMA 5JQHC 3I75A 4HUVB 4N9GB 1XR9B 1FSKB 4JO4L 3TZVC 4IRZH 5I8EB 1JJUA 3LKQB 2YPLB 5T3XL 5F7MC 2P8MB 1BHGA 4P4KA 3W11D 2AGJH 1BBDH 4OSUL 2EH8H 3T8XB 2C7UA 4QY8A 1OF2A 1JHLL 5E94A 5MP6L 3A6CL 1WEJL 5CEYA 3L1OL 2O93L 3TIDB 4TULH 2ADJB 2X7LA 5C0EB 2Y5TA 3SE3A 2CGRL 1T6WA 5GGQH 3TWCL 3W81A 1T7ZA 3L5JA 4YBLC 4P46A 2FBJH 3B3IA 2PTUA 1ETZB 3G6AB 4UTBL 2KQNA 4PP1D 1NGWA 3HMXL 1I9RH 3UDWA 4HWEH 1TZIA 3E3QC 5K9QI 2E5EA 1IZKA 2DQHH 5GSVA 3HC3H 4DGVL 5F7HA 4QHMB 1KYOJ 4WUKH 3S5LA 4PJBA 1AY1L 3F62A 3KYKH 1LNUA 1MAML 1FDLL 4WFFD 4ZAKC 3MNZB 2YC1B 4PJ7B 5IW1A 4HWBA 2XG4A 4YXHH 2DM7A 4PY8J 3IRPX 3P9LA 4EI5D 3MJ7B 4EXKA 1AJ7L 5BZDB 4D9QD 5F9DC 2C5DC 1OP9A 2P43B 1RQ5A 2VMFA 1TJIH 3E6HA 3CC5A 1Q0XL 4XP5H 5I1DB 2UWEE 3PWPE 7CGTA 4PJIE 5GJTH 2QSVA 3C5ZC 3BAEH 4FHBD 3GMQA 1TCRA 4N0UE 4XTRD 4MS8C 1IAIL 2VDMH 1NLBH 3RBSA 3EJZC 3G04B 2X4QA 4HF5L 1CXHA 4FN0A 5JLZB 1K6QH 5T1LD 5HPMB 5B39A 1J05A 1JPFB 1IQWL 4X80L 5EZLA 5CGYD 4KTEH 1CD1A 2NTSP 4DGYL 2BVTA 1V3MA 4QYOB 1WICA 3THML 3ULUC 3IDYC 1WWBX 4YHIA 2E6JA 1V7NL 2NW2B 5C0AB 4GW1A 4DCQA 1RUAL 1FL5A 2OTWB 2W59A 1UXWB 4DGVH 2M1KA 4PRAA 1VFUA 1LE5A 3MV8D 1OAQH 3UTOA 5D6CB 2A73A 4R8WH 4X4ME 1DE4B 5TGBA 2JB6B 4EVNB 3CGTA 1D6EA 3MJ9A 1S5HB 3HC4H 4KKAC 4J7RA 4QHUB 5KW9L 3U9PL 2EYRB 1IGMH 4PJGE 5EWIL 3KPSE 1J5OL 1FYHB 4Z0BL 4MNGA 1KTDA 3BDYH 2HLFD 3BE1H 4OZIA 1DBJL 2IPUK 3OV6A 2Y7QB 5ECJE 4LLDA 1HHGB 4U1SB 5TPWL 4HC1L 4NQSB 1UVQB 2Z35A 3TEUA 5I1IH 1WC7A 1AJ7H 5CLTA 1A1MB 4X5XA 2P24B 2WWKO 1RUQL 4U49A 1F3DH 3WNNA 1F4WL 3UZVB 4HQQH 2FB4L 4HIJA 3T65B 3O6LH 3UAJC 3VD3A 2F54A 1IGJA 4JY6A 5CP3H 4CADA 4PB0H 1JYXA 4OZIB 1FNSL 3VRJA 1EIBA 5MEOA 4WI4A 3DETC 4QTHA 3FO2B 4OBRA 4Y4FC 3GSWB 4A6YA 3DX8A 3QZWG 5DD1H 3IKKA 3OX8A 4LP4A 4NT6A 5KJRH 3HS0A 5LVEA 1NANH 2UZYB 4TVPL 1DE4A 4YHPB 5TGBB 5ACLA 2OL3A 2DQTH 4CVZA 3B5TA 1ND0A 2AJXH 4ZUWB 2HRPL 5HHQA 5IJKC 1F11B 3QUZB 4TSBL 1KBGH 5E5MB 3EJYD 2Q8AL 1X7QA 5J6HB 3MLYH 1SMAA 5BO1H 4G43B 3SDAD 3TZVD 3X11A 4KU1A 4LBEA 5CFHA 3RKPA 5D1ZC 1NBQA 3WXWH 2KBGA 2BVUA 4ODVL 3TBVB 1U8NB 4JO1L 4MQXC 4ELKA 5FOBB 3FAWA 1HKFA 3G04A 3LS5H 2GCYA 5C6WH 1QQDB 4ORGA 3QPQC 1CZ8H 2C1OA 1UWEL 2PW2B 2YS4A 3D0LB 4YXKH 3ARBD 1R24B 4XNMB 3CFJB 3SGEH 1IL1A 1UM4L 3OAZK 1NGYA 4IMLB 2X70B 1EBAA 4GRLA 4MD0B 5DJAB 4JDTL 3DLQR 1BD2D 3TWCH 3ALWA 5D1QB 3TESA 3IXAB 1TETL 4OCYL 1WBZA 2Y1VA 2MPAL 5D1QC 5DJ6B 1FNLA 1JRHL 4Z7QF 1I7UA 1S7VA 1DP0A 2AEPH 5DYOB 4HJJH 2R1XB 1SM3H 5C07D 3G6AA 4ORZC 2XIDA 1NFDB 2V2WA 2W65A 3GJFK 4FS0A 1U9KA 4J3XA 4MNHB 3KJ4C 4Y5YA 4LHUG 4S1QH 2VR9A 4MAYD 2APFA 1B90A 1IARB 4O2EA 1GC1C 1YMHB 4LQ1A 2A2QT 2IPKB 2AXGA 4EDWH 1RFDL 3SCMD 1DQML 2ICWI 1DBMH 5C09D 4OIIL 2AEQH 4JG0H 4M6OH 2EH7L 1TJGH 3O2WL 1QR1A 1QBMH 2NZ9D 4P4KC 5IFAL 1LGVA 2WAHA 4M03A 2FJFA 2ICWA 3DURB 3O3EA 3P73A 1A6AA 2JJWA 1NMBH 4NRXA 5DR5L 1QLEL 2P5EB 5F9WC 3UTZA 2GK0A 1NMCB 2VERN 2C3VA 1CGUA 3GSQB 3EGSA 4YK4C 2OQJB 3M17A 2V7HB 2M8XA 5I66B 2D7TH 1UYWH 2P7TA 5F7YC 1F00I 2KZWA 4ZPTB 4X8JA 4NRYA 5I15L 3L5WB 4MB4A 1I85C 1VADB 1ZANL 2E7MA 3DTXA 2XRAH 3NCJL 3NIGE 5B4MC 1IGTA 5FKAA 2L7UA 3NN8B 3T3PF 3TP4A 2CXGA 5IBUB 4DQOL 4OZFG 4MJ5B 4H1LB 3JTTA 1WBXA 5IW6A 1MQKL 3UPRB 2BDNL 4JFHE 4D94A 1JMXA 1N7ML 1K8DB 2QSCL 3MRMB 5LWYL 5SWZA 3RIFK 1CXIA 1EHNA 1P4BH 2ENSA 4KQ4H 1OL0A 3UTSD 5E03A 3DHJA 1ZWIA 3FQXB 2D31B 5KS9B 4LSTL 2NY2D 4HK0B 5KOMC 4WFGE 1I8IB 5IBTL 3MV8B 2OR8A 5ERWA 3V4PL 3U30C 3IFLH 1MHCB 3KPSA 1KCRL 5GGTA 4LK4A 5CINL 4PRBB 2PYEA 1IFHH 2X4SB 4WWKC 2DF3A 2VDKH 3SDCD 4ONGH 2R2BA 2AI0L 4P23A 1T7VA 2AXJA 3C5SA 4IBLT 1LEGA 1ZHLA 2A6JA 5C7XL 1WCQA 2HLAB 4I3RH 3HI6L 1X5IA 1J8HD 1CVRA 2NNAA 1R5IB 2BVOA 4DZBB 4P3CL 1FGNH 1BZ9B 1NCNA 1K3IA 3ORJA 2D4DA 3HAEH 5JA8B 2FIKA 4DVBA 2D31A 2IF7A 5JZ7D 1UM6L 1YEKL 5C0ND 3MRFB 4K3JH 4MJIA 2VDPL 4ZNEE 5FDWB 3QUZD 4F7MB 4PLOB 3QFJD 3HA0A 1QBML 3C9NB 1U6AH 2HFGH 1NGPL 4HHAB 1LO5A 5BZWA 3I50H 5B4MD 3KPQB 4WW2F 4AG4H 2YD7A 3P0YH 4XWOC 3W9EA 3QUMH 5DRNB 4DW2H 2BVYA 3MNVA 1IJ9A 4NJ9L 2A6IA 3RVXD 4OZIE 3NZHL 5J6GB 4PJ5A 4UU9A 4YWGH 4NRYB 1O7SA 1F42A 5E7BA 3ZKMD 3S88L 1LWRA 4LLUB 2AK1H 5IHZB 1A1NB 3KVQA 3LRGA 1UWXK 1IQDA 3TT1H 3F58L 2FH6A 1IC5H 2MKWA 3HG1B 3QXDA 3U7AA 1RUPL 4LLVA 3HE6C 5EU3A 3ARXA 6FABH 4X5WA 3EYUL 4APQD 3EYFB 4HIHA 4OKVB 1NC4B 2VISB 5HYJB 3L7FB 1T4KA 1CU4H 1V05A 4Z7VA 4ZXBB 3GMOA 5KVEH 3INUL 3L95B 1S7TA 2NY1B 1TJHL 3MJ9H 3STZA 1EBPA 3SDAB 1CWVA 4I0PD 1KENH 2RFXA 2HWZH 4HJ0C 5T3ZL 4CRPA 4P3DA 3OAUL 2OJEB 2PO6C 3SJVB 1GZPA 1NMBL 2P47B 3IF1A 2LU3A 4LHUB 2NYYC 3UP1A 2CDFA 1FYTB 3BYYA 3MROB 3TA3C 4Y5YB 4MWFA 3VWJA 3PHSA 4MJ6A 4O5LL 4PJAE 4LCIH 1OAXL 5FO7A 4YC2B 4RFEB 5DEGA 5D2NE 1VPOL 3V7AG 4MXWH 4YHZH 2NY0C 3FO9A 1OD7A 2PETA 4Z0XB 3RWDA 4OJFH 1K4CB 4ZFGL 4M1GH 1EZVY 3R1GH 4N0FA 4ODWA 4R7NB 5GS1C 5FEBA 5ETUB 3IXAA 5C08E 4H25B 3IDGA 3PGCA 1PAMA 1S7RA 3GIVB 2NPLX 1QSVA 3WL9A 1NC2A 4KK5D 4MD0A 3SCMC 5DD5L 2OP4H 4FNLH 3SPVA 4FQHA 1HQ4B 4P2RD 3T3MF 3Q1SH 3QWOA 2A6KB 3D39B 4HUWB 4ZUVB 5JOFA 1YN7A 5J11B 3NPZB 4L29A 5A43C 4X7SH 1YNLL 2C1OB 4KROD 4KTEL 1JWSA 5E2TH 4L3ED 4OD2B 4RGOL 1R0AL 1U8JA 3FONA 1O0VA 3IU3B 1HNFA 1IRAY 3AB0B 3B9EA 4MB3A 1Q9WB 2YPVH 4WUKL 5DD5H 5CBAA 3GDBA 2XPGA 1J0ZA 4NZJA 4JRWA 5IWLC 1FC1A 2XTJE 1K3ZA 2FEDC 4KJQC 1ZGLB 1X7QB 2BZDA 5J6HA 5IVXA 3MOAL 2YSSA 3C87A 1JYWA 3BI9X 4RGOH 1A6ZB 4ISVA 1CQKA 4U31A 4GAYA 1JNNH 4MXQD 4OUUA 3NACH 3V0AC 4BH8B 5HD8C 4HFWB 4GQ9L 2EE3A 2D4FA 1NFIB 3VXPB 2CIIA 2I9LA 5IJKA 3Q1SL 4URTB 1AGDB 1TMCB 2XXCB 4PR5A 5JXAL 3ARTA 3P2TA 5F89A 1CGSL 3RRQA 1B88A 2Z4QA 3ZKND 8CGTA 4GS7C 2QQNH 3ALPA 3HPLB 5DMKB 1A6TA 3EOBA 5DJZB 3N9GH 12E8H 3X13A 3MNWA 1IGJB 4JY6B 1HZHH 3WIIL 2GJ6B 4P5MA 1FSKC 1A6TB 3EOBB 3FN0L 1Z0NA 5D70H 5IFHH 3QEQE 1UEYA 4Q9CA 1JYVA 4PGEA 4YBQD 3SDCA 1JGUL 4BYHA 5FCUH 3S3JA 2D9CA 4FMFA 5KN5B 3S7GA 3VFTB 1TQCC 4Y5YC 2HT3C 1FFPB 4FXKB 5E2TL 3ZKMC 1ZT7B 3WDHA 4X6BB 1HWGB 3O8XB 4QCIB 3ARGC 4XXCC 4ISVB 5SWZD 4DUXA 1EUTA 4S1DD 4RFNC 5I1JL 2HKFL 4QHUA 2R1WA 5GIRA 1OSZB 3QP3A 5FIEA 4XMKL 1HSBB 2ATPA 2DLHA 1UZ6E 2XICA 1IEHA 4EVNA 2DWDB 3AXLA 3ULVH 4OCWL 5E2VL 1N64H 4PLJD 4Y1AE 3IDJA 4PGZA 4PJ8C 2VXQH 1OD9A 4I0PC 1ZTXL 1DR9A 4U1KB 3CSYB 3EZJB 4YX2L 3P77B 4FTVB 4CN4A 4I3GA 4DCQB 2OR9L 1GOHA 3MV9A 4XI5C 3MUGA 1M05A 3TH2T 2B1HH 2XZZA 1YPZF 5ENWB 5HYSB 4E41E 3IVKB 4YHNB 3I6LE 1MI5A 4PV9B 4LDOB 4OGYH 4J4PA 4UINL 5BVJA 4ZUVA 1FO0H 5IHUL 3SE8H 3C5ZB 5ENWA 5HYSA 1EEYA 4HDIB 1HQ4A 2R56L 2XQBL 1JHLH 3T0VA 3QWQB 3MV9B 3VDAA 5AG8A 2QHRL 1E6JL 3CVHB 1MWAL 4IDJL 5AYUL 3ULUE 2IH3A 1LDPL 1TCRB 1QFWM 1TENA 1B6UA 3ARED 3SY0B 1T0MB 2CR6A 4OD1L 4XZUA 5I16B 5I1DA 2FEDD 4KJQD 4APQC 4EI6B 1RAMA 3JV0A 4G6MH 4KUCF 4WHYG 4XAKD 3O4OC 3U48A 4U3CA 2WQRA 4FTVE 4MNQD 5BZDA 2J8UA 4XPHL 3F12A 5BV7B 5EOCJ 1KN2H 5C2BH 2AJVL 4KGLA 3VH8A 2DQCL 3WXVH 4M43L 3GGWA 3OKOB 3WFEL 1BQUA 3REVB 4KI5D 3PNWB 3ZDYE 1XGRA 5L88H 1BFTA 3HNTH 3V0VA 1B4JH 1BZQK 15C8H 4OGXH 4X6BA 2UVEA 3U1SH 4X80H 1S3KH 4L8CA 4DVRH 5E5RB 4L8DB 4GRLD 2NCMA 3ES6A 3VG0L 3I9GL 4PD4J 1FNEA 5C08A 3L7FA 4XBGB 3QDMB 5JNYB 1MCQA 5JW4R 1DJSA 1AE6H 2WV3A 2I5YL 1HEZA 4NN5C 4POUB 3S37L 4XXCA 4U2YA 4P2QA 2XQBH 4MNQA 5GGVH 2CMRL 5ADOL 2J8UF 1KTLB 4K8RL 3MNWB 1MCWW 1CFSB 1HNGA 2NLJB 3QDJA 5FGBA 1P7QD 1SYVB 4YXHL 3PP3K 5HVHB 2VABA 3RWFB 1CT8B 5B3NA 3PG2A 5F89B 5HVHC 1BVKA 4UT6H 4JKPL 1P53A 1U3ZA 1OT2A 5E08L 4JRYE 4FFVD 3RWHB 4MMZC 1HZHL 4D9RD 4H1LH 3EJZD 1B6DA 4AK1A 3MLSL 3I75B 4XT1C 2DI7A 4BH8A 2QR0A 3TIEA 3KPQA 4S1QL 1BBDL 4OSUH 2UYLA 5EN2B 2GTWA 1WZMA 5F96L 5FK9B 3HZVA 4L4VB 2YSSB 5IVXB 1P6AB 4HD9A 4U6XB 1N6QH 4PJCA 1RHHB 4YK4B 1MLBA 4Z5RA 4K9EH 5I8CA 4AENB 3PGDA 1YEEL 5KAQG 5E08H 5LWYH 4IRJD 3G5ZB 4N5EC 3QNZA 3VXRD 3S9DB 1IZJA 3OB0H 1QA9B 3QUZC 3OL2A 1C1EL 4WO4D 2DQFA 1M6OA 4G9FA 4MA8H 2F54E 5GS0L 3RAJL 2H9GA 3VRIB 4PP1C 2CXKA 2XG5A 1Q8MA 2CJUH 3WUWA 2NY3D 4P2QE 1XCTB 4NZRH 5I15H 1YUHA 1N4XH 1NCUA 4J1UA 3I9GH 1BX2B 3Q2CA 5JOFB 1UYWL 3MRNB 3WSQL 1ZXQA 4JY4B 4UNUA 2DMCA 5F9JB 2C9AA 1NSNL 3RWGB 2VE6B