5DR5H

Crystal structure of the sclerostin-neutralizing fab abd09097
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
224
structure length
224
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFTNYYMHWVRQAPGKGLEWVSTIAYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWFTDDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFLVPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AbD09097 Fab heavy chain
publication title Generation and Affinity Maturation of Neutralizing Anti-Sclerostin Antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2015-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H01
4FABH 1FSKC 4AYFA 1EUUA 1HCVA 3QA3A 1OLLA 1PSKH 3RZCB 1ERNA 1KNOA 3ZZ1A 4E41E 5DJDA 4N8VB 3BOVA 3C6LD 3I75B 4JG1L 5D1ZD 4P2CG 3MRBA 4BH8B 2EIZA 2C5DC 2YN5A 4L4JA 3RL1A 3UEZA 4U1JA 1IGCL 4Z76A 5L7XH 2AJXH 1A22B 2CUIA 4DUVA 1HILB 4GAGH 4GMTH 2C4FU 4TUKH 2D7QA 2B5IB 1YYLL 5EWIH 2VLMD 5B3JE 5AG9A 4WUUA 2BXZA 1IGTA 3T3PE 4MAUH 3D3VE 2AJUH 5T3XH 1LE9B 5BS0E 4YHLH 1YNKL 3OTTA 4H0HB 2FO4B 1R6VA 1RUKH 3ARYA 2FIKB 4YBQC 4IRJA 1N3NB 2J8UF 4JJ5A 1C5CL 2QQNH 1MFBL 3ARBA 1QG3A 3EOAA 3VGHA 1C5BL 4DGVL 4J4PA 4HC1L 1MJUL 4JFFB 2EO9A 5E2WH 3ZE2F 5C2BL 3D2UB 2VABA 2BJMH 4PJ5B 4ELMF 3UTTD 2C1OA 4L3ED 3L3DB 4P5TA 2RQ8A 4NOFA 4DCQB 1DQQB 3MYZA 4XCNA 2XRAH 3BZ4A 4WV1A 5BZDA 2JJVA 2DQTL 2R0KL 4AEIH 4S1DC 5JA9A 3BPLB 1EEZA 3QDJE 1D9KB 3AS3A 4P23A 4YHOL 5SV3A 2A2QT 2GSIA 4LSRL 1T7VA 3BO8B 3FCTA 4PJFA 1A6VL 1VCAA 5D2NB 5JOFB 1Z9LA 3U0PB 5DQ9A 5D7JA 5D2LE 1ZLWK 4NZRL 1N4XH 3MRMB 3RNQB 2EDTA 4MX7A 4MCZB 4EI6B 3W0WD 3HG1E 3MV9E 4UB0H 2BSSA 5B39A 3R8QA 3GNMH 1FNSL 2ZJSH 1AFVL 4LPUA 4JFDB 5IB4B 5T33L 2V7NA 5C08D 1O0VA 5F7EH 2RHEA 3NTCL 4L9LB 3VA6A 1CLYH 1BQHA 3MLSL 1YPZF 5EO9B 3CVHB 5IKCA 1NUNB 4JGMA 4PRIE 3VDBA 2IAMC 1BREA 2W60A 1TVHB 3LMJH 4OZGB 1GGIL 1M1SA 1QFWL 4XAWH 2HWZL 1U92B 3WFBL 4AQOA 4ZUUB 4KJPD 3S96B 5IROC 5IB1B 4Z6AT 1ED3B 2GJ6A 4LOUC 2CDGB 3OPZL 4WWKC 2MSPA 3DETD 2VDQH 2HTLC 2QSCL 4G6FB 3SKMB 3WBDA 3O6KH 5EU5A 1J8HB 3P0VH 4K94L 3QXDA 2QADB 4HF5H 4NHCL 3V79C 1ORSB 5CP7B 2GJZB 1LD9B 3RWFB 4HX1A 3NCMA 1RUAH 1A6UH 2DQHH 5T3XD 5JPMB 5IESH 1WBZA 2QR0A 2XKNB 4LCCC 1X5XA 3JWOH 3VW3H 1ZHKB 1UYWL 2V9RA 4X0KB 1B4JL 1JF1A 4FXKA 4JO1H 5DRZA 2J12B 5CHNB 4Z7VE 3MRHB 3I02A 2FEEI 4U1SB 1ZGLA 4L9DA 5I8EA 3T8XB 3MPCA 2AJZA 5IB2B 4XMLH 1M71A 1UCBH 3QIBD 2R23A 4EJ1C 1H0DA 3HKFA 3OXRA 2OZ4A 5DJCB 4ZO6A 3S37X 4Y7MA 2DQGH 4M43L 2ZPKL 1JNNL 5T5FH 5K9KA 5DD5H 3HRZB 4F9PA 3GIZH 4FQCL 3A6CL 2PTUA 3ULVL 2GCYA 3UTOA 3W5MA 3B8SA 2B20A 3VMOA 5E6ID 2WSKA 5LCVL 5K9JL 1G6RA 1RIVL 2FYYB 1KBGH 5F9JA 2F9BT 3GMMA 4P3CH 4PRDA 4Y5VA 1NCAH 1LK2A 2AV1B 3N50A 2J6EA 2YD5A 4ODWB 3SKNA 3ZTJG 4A6YH 1AXTH 2JIXA 4FFZL 4I77L 4X7EC 5T1DL 5BRZE 1ES0B 3RUGA 1DQLL 1GAFH 2W9DL 3MLWH 4F58L 3J7HA 1QFPA 4OBRA 3V0VB 3N1QC 4KVNL 4ZAKB 4LCWD 1CE1H 1HIMH 5INCB 4GAYB 1K8DB 4XBPB 3RWEB 2VQ1A 4OCMC 2EDOA 1CFBA 3BKCL 4E41B 5DK2B 5C0IB 1UA6L 1INQA 5IMLB 1TZHB 4GS7C 3UO1L 3Q2CA 5C7XH 3SE8L 1H3UA 1FRGL 3LKSA 1H3PH 1TTFA 1KPVA 5E9DD 1B6DA 5B3JF 5FO7B 4IRJD 3T3PF 3QO0A 4KUCD 3U2SA 2ZCHH 5EUOE 4LLAA 1BIIB 2VXVL 3TZVA 5DMIH 2J1KA 4J4PD 5MHSD 2YS4A 1MCWW 3HPJB 1G7JB 2OZ4H 1KJ2A 3ARSA 3O8XC 3CFDB 2OJEB 4WI3A 4YE4L 3BN3B 4LKXB 4HS6B 4LDLB 1VACB 4NRXA 4YEEA 1QVOB 3GI9L 2EH8H 1T0NB 1A7RL 2DQDH 1YZZA 4AIOA 1A21A 1RJLA 5D1QC 4Q97A 2KZ1B 1G6RH 1QR1B 8FABB 5FAAA 1R0AH 1IC4H 1A6PA 2NXYD 1SBSL 3PDGA 2J6EH 3WXWL 1MF2L 5BW7A 1HH9A 5ACMA 3BUTA 1V7NH 1YNLH 3OKDB 4Z78A 2FX7L 4OLZH 3MROB 1BAFL 4I3SL 1AE6L 3HE7A 2JJTA 5CEZL 5HYSG 3S88L 1U2HA 1BWMA 3T2OA 4F7MA 3ZKQD 4GXUM 5FV1L 1PD6A 1ZGLM 3NFSH 3HC4H 5D2LF 5HJ3B 3IU3A 5DO2C 4PGZA 1S7TB 2CDEB 3AU1B 4PD4J 1U8KB 1O7VA 5IW1A 2C3HA 2BMKA 3MV8E 3GSRA 1KEGH 4JFOA 5HXMA 5I75C 3PNWB 1X5JA 3RGHA 4RGNC 1H5BC 1PBYA 3HG1B 3IETA 3MV9B 5J11B 3ROOB 4UTAH 2CXKA 3GMQA 4HT1H 5HBBA 3AVEA 2P48B 3B43A 1J1OH 3UPRB 5FOBA 2DDQH 3QCTL 3P73B 1SVCP 4LLQB 5FUZH 2FJHB 3A67L 4HWNA 4X9HA 5CZVH 4D9QD 5LGJB 3QUZB 1GOFA 4P57B 2VLRE 3WIHL 5TH2A 1W0WA 1F2QA 4PJXA 4OZFG 1KJ2H 1FZMA 4UAOC 3H9SE 1YN7A 1IGJA 4X6CF 1AXSA 4HH8A 3V5HA 3K81A 3KYOB 1JHLH 1MJJB 5CJQH 1FSKB 3CDGB 4M7LT 1MPAL 1T1WB 4M48L 2DAVA 5JHDE 2J4WH 1OTUC 5D6DA 3L5JA 4U1NA 1A6AB 1XGUA 2YUXA 3BGFC 3P4LA 4LIQH 1LQSR 1LE5B 4NQXA 1G1CA 2AS5M 2LVEA 3G5VA 4FQIL 5I1JL 1HZHH 2IBBA 4L4TA 3QFJA 4XCYB 3PDOB 2P8MA 1NBZB 1HQRA 1FFRA 3DVFA 4HGWB 1T0PB 1UVQA 4K3HA 1J05A 4EZMA 5IIEB 1AGEA 4JVWA 4LMQE 4XZUA 4RQQB 2ZUTA 4Z7NE 3NAAL 1NBQA 1JPST 1KGCD 4M8VA 1H15B 2XPGA 5HI5D 3MLPA 4ZS6D 3TA3A 1FQ9C 2Z93B 4Z7VB 4KHTH 2VDOL 4OZIE 5GGQL 2XWJB 4WTWA 3B9AA 3DVNB 1CD8A 4D0DA 4X8JB 1VEPA 4U1HA 2ADGB 5SV4A 4YGVA 3LQZA 3M1BB 3VGDA 2P8LB 3B83A 4LEOB 3FN0H 1MCNA 1SVZA 1T7ZA 2NX5B 2X4UA 4IJ3C 3DOSA 4JG0H 1W0YT 3BH9A 2JCCE 1IQDA 5JUEL 4KKCC 5E8PA 4XBEL 3ARQA 2YPLD 1BHGA 1UH4A 1ZK9A 2V17L 3DMMC 4X5WB 1P7QD 2YKLH 3HB3C 4PJ8C 1WZ1L 1XZ0A 1LO4L 5E24E 4OAWB 5B22A 3AREA 4P46D 1EAJA 5CZXD 4UQ3B 4F3FA 1MI5E 5KAQF 1A1NA 4UDTB 3MACL 1Y18B 1BJ8A 4K8RL 4LF3B 1Y6NR 5HHME 3B3IA 4NKDA 4E5XA 4P4RA 2AVGA 3DUSA 1B88A 2UWEF 4G8GD 1VPOH 3CC5B 4RGNE 4PD4K 3GK8L 5I1GL 3WLBA 4I5BB 1J12A 5DHVH 2HFFB 2NY5L 1FL3B 4DW2H 1G7IA 5JNYA 4XP1H 5F8RC 2EYRA 4HUWB 4JRXB 4F7EB 1HQ4B 1FZJA 5AZ2H 4JM2D 3UJTL 1NFDF 4CN1A 1NGZB 2PYED 5EUOF 5EBWA 2P7TB 1F58H 1FE8L 3WD5L 2IAMB 7FABH 4ODHH 2IF7A 4P4KA 3GMOB 5FYKU 4HBQA 4MNHA 1DZBA 4GOSA 5F3BA 3TT3L 1KCSH 5C0AD 4Z7OE 5GGRY 2YPKA 2IFFH 4IS6A 1TENA 1ZVSA 4KXZI 5J6GA 3RWCA 4HWZB 1BJMA 2E27H 4DGIH 3BP7B 3L3IA 4XVSL 4KKAD 1YECH 2K7PA 3KLAA 2BVOA 5ANME 4X7TB 35C8L 2BCKA 5K9OA 3KWWB 4KV5E 2VDLL 4TVPD 5T1LB 5B8CC 1CT8A 1QRNE 2IH1A 4MAYC 1VKXA 2YPVL 4I8DA 1L6ZA 4BZ1H 3FFDB 2GYSA 4Q9RL 1MLBA 4F9LC 1CXHA 4BZ2H 3MV7D 4ZUTB 5HYFA 2W9LA 4D3CH 3HNSL 3ZE1E 3OZ9L 3WSQL 3MRLB 3CH1B 4YFLI 5IHLB 5B4MC 3IFPA 1UWEL 5DQDL 4PJ9B 3RNKA 2D7NA 2DS4A 4N0YH 1W8OA 3KPNB 2BSRA 2O61B 4HLJA 4RBPH 4WI8A 1Q9LB 1FVDA 4YQXH 1MVFA 4I48A 3B5GA 1R3IL 5D71L 5F1NB 4IM8A 1RURL 4GRWH 2VXTL 2MQ3A 4LASL 4NO0B 5ISZB 1MRCL 1XCQB 3QH3B 1KCLA 2VIRB 4N8VA 3T1WA 1RHHB 1QFHA 4RMQA 4AK1A 4WFGE 5EC1A 4PJDE 4NUJB 1FNHA 4O00A 4OLYL 3UPAA 4NZUL 4F7TB 5J13C 1CGSL 3FQXB 1PJ9A 1V3MA 3VFMA 4OD2A 4P5MA 1T1ZB 1TCRA 1AQDB 2BNQD 5FM4A 3RVWD 4BH8A 2OXHA 1CZ8H 4PJFF 2NTFB 3VWKC 3G6JA 5FCSH 4H1LB 4Q0XH 3T0DA 5CGMA 1OTSC 3H9SB 5KVFL 3T08A 3VFVA 5J1SC 3TV3H 1EXUA 2ZCKH 4PRBB 4H20L 3FHAA 4K55A 1DVFD 1KLGA 1P5UA 2OM5A 1A7PH 1A9BB 5ITBH 5JHDB 1LE9A 2ORBL 5ERWA 2I25N 2DLHA 4GS7B 4OLWH 4U6VH 5C0CE 4JFHD 3RHWK 5C9KA 4ZFOL 4OFVA 2FIKA 5KVDH 1V3JA 4HUVA 4Z7NF 3VXSD 4Z7UE 5H37H 2HTKD 1EA9C 2FB4L 5JIHA 3WJJA 5HHOE 1U41A 1WFOA 4BZYA 3B2VL 3D2UA 1UWXH 2FWOB 2DLFL 1WGOA 3T2PA 4KRPD 5DRXB 3CSPA 1RJCA 2BX5A 3O8XB 2AQ1A 1DQQA 5BMFH 2IBZX 4P2QA 3V4PH 1SJXA 2ESVA 3PWPE 3FO0H 4U6YA 5F44A 5AZEL 1U9KA 3TPUB 4OZIB 1G7LB 3GHEL 1CD0A 4NHUB 2ED9A 3LD8B 3VXRD 4H8WL 3HS0B 1D9KA 2HT4C 5F7LB 3U7YH 1G9NH 1QSZA 1S9YB 3BO8A 3EFDH 1A7QH 2PO6C 4Y4FC 2JK5B 4GW1B 4QHMA 4KPHL 3GI8H 3VXUE 3U0PA 4O58H 2JCCB 3MRMA 2W0FB 3RNQA 2A83B 5ECJE 3L3KA 5FK9B 3SO5A 5KVGL 1NAKH 4EI6A 5I30H 4ISVA 5C07D 3BSZL 1KXQE 3GM8A 3QQ4A 3FAWA 4TQEH 1S3KL 4IDJL 4JFDA 2H2SC 4B7LA 2FECL 4PJ7E 4KJQC 1NMAL 3R1GL 5CBEB 4R4FL 4JO2L 2VQTA 4NIKB 1LO5B 2LAGB 2J8HA 4WI9A 5GGUA 3CVHA 1MI5B 4K9EH 1EHLH 4PY8J 1IKFH 5HHMB 3V4VL 4C56D 5BV7C 5FUCC 2IWGA 1TVHA 1DQJA 2AERT 3ARDC 1FFPA 5ESQB 3C87A 1U92A 1N2RB 4RGNB 4KXZH 5JMOC 4ZUUA 3G08B 1K6QH 3P9MB 5IB1A 1Z5LA 4L8DB 5JLZA 1ED3A 1DBBH 3QCUL 3GJFK 2CDGA 2VLLB 3CMOH 5CSBA 2F54A 2Q8AL 3N06B 4PGBB 5CD3A 4M7LH 4O4YH 5CP7A 1HOCA 1LD9A 3RWFA 1MCOL 1OARH 5DK0B 1ZHNB 3RUGF 2DYPD 2A73B 3TNNB 3IDXL 1K4CA 5JPMA 5IGXL 2CRYA 2XKNA 4DN4H 3QXAA 4YHIB 2HJFB 5DJXA 4KZDH 4C54A 5CHNA 1OAQH 1EO5A 3U6RB 3MRHA 5ILTL 1QO3B 3BGFB 1IL1A 5KOVC 2ZSWB 4GBXC 1JGUH 1HINH 1SJEB 1WAAA 3TCLA 2D7PA 5IB2A 3LV3A 2XZQH 1FO0L 1JPSH 2H8PA 5DJCA 1C08B 5ANMB 3D87B 3W39B 1GIGL 5C1MB 3SDDC 5SWZE 2EDEA 5SWSB 4TTGA 4Y19E 2WBWB 1G9MH 3WO3B 1MIEH 3HRZA 1IGIL 1QRNB 3NIFE 1UM4H 3BPCA 5M7QA 2WUBL 3I9GL 3UAJD 4ALAL 4DKDC 5F88B 4L29B 3FFCE 1IARB 2C1PB 3C5SA 2QSTA 2FYYA 4XNMB 3HRPA 4MQ7A 4HW6A 1X5AA 3CVHH 4GG8B 4TRPH 2EDDA 4ETQA 3H2WA 3G5YA 2AV1A 2VJXA 3VFRA 4ODWA 3RZCD 2YRPA 5D1XB 2HMIC 2YSSB 1FH5H 5CJ8A 1A9EB 4IJ3B 4OV6F 3BP5B 1T3FB 4NJAL 4WTXA 1RHFA 5D7LD 1EGJA 4U05A 3SEPA 2Z31A 4ZAKA 2FCBA 3K2UH 4FQXC 4XXCA 2BC4B 3EUUA 2ZCLH 1UB5B 3VXME 2XNAA 5IVXB 4PLKC 1KEML 5JIKA 3A0OA 1QBAA 3RWEA 1K4DB 3L1OL 5DK2A 1M6OB 5C0IA 4F2MB 4YPJA 5ETUB 5IMLA 1TZHA 2CJUH 3DRTB 4FG6C 4HGMA 4L8SB 4PJDB 3QHTC 4G3YL 1R5VA 4MD0A 3R8BB 5GGTA 5JW3L 5FUCE 3FQNB 4HIJB 2DJ4A 3U36A 1P1ZB 3BN9C 2MCPH 1S8DB 1BIIA 4RAUA 4K07A 3OX8B 2HFGH 3MGOB 3VCLB 2WINB 3WHXA 4JFFD 1G7JA 4ENEC 4PJ5D 2P42B 2R56H 5DTFB 4LKXA 3QG7L 1C5DB 2EEAA 1OT2A 1VACA 3MODH 4G6ML 5LXGL 1CD9B 4XPAL 1T0NA 3RKDC 1AGFB 3GRWA 5C0CB 3G5XB 4KRMB 4M3JA 5FA4A 3OKEA 1PZUB 3NABH 4PJXF 3MBED 8FABA 1D9KD 4G42B 5SX4I 2X1QA 2G2RB 3U9PH 3T04D 1A6ZA 5HHOB 1LDSA 2H6PB 3QNZB 1KIQB 5IOPB 4XWOC 1RIUH 1DBML 2GSGB 3ZHLA 4PFEA 2APFA 1JGDB 3MROA 4NQEA 2Y23A 5HHQB 3P9LA 1WWAX 1IC7H 2Z91B 1MEXH 3LKRA 3EJYC 4ODBD 2CKBA 4KMQA 3FRPA 1FC1A 4XPBH 5C0DB 2DD8H 4MJ4A 2VXSL 5HJ3A 3LKNA 4NO2B 3S9DB 1S7TA 1J0ZA 1U8KA 1WCBA 5B8CB 1ZHBA 2UYLA 1A7OL 3BIKB 4QTIL 3VXUB 3P11L 15C8H 4Y5XC 3T0ED 1J86A 3O0RH 3VRLE 4Y4KB 4PJ7F 4J23A 3RWDB 1IAOA 2PW2A 1WV7T 3WDHA 5DGQA 2EDXA 5FCUH 3ESUF 3UPRA 2V7HB 3DURB 4PJAE 3HNTH 3P73A 2FJHA 3KXFD 3R4DA 4G6FD 3EFFB 1QACA 5LGJA 2DB8A 1YQVH 5FYKE 1J8HD 3E6HB 5ICXB 1X9QA 2QADD 3MJ9A 2QHRL 5I66B 5JOEA 1MWAL 3KYOA 1MJJA 2YBRB 4TSAH 3CDGA 5GGRB 5KBNC 5ADPL 1T1WA 4ZOAA 1TLKA 3WKNA 4K71C 4J1UA 1S7VB 3ESVF 2OXGA 1LE5A 3B9KA 3BWUC 6FABH 1J1PH 5CWSB 4XCYA 3PDOA 5J13B 1NBZA 1QYGH 1UXSB 4HGWA 4J6RH 1EBAA 2HKHH 3DBXB 4G7VH 3UJJL 3MA9H 5F7HA 3VWKB 5ACLA 5IIEA 3QB7C 4ZFZA 5EULV 3MGTB 3SQOL 1DTUA 3ULSA 4NFCA 3C2AH 1MCHA 4Z7WF 1H15A 1IMHC 4I0CC 5EU6E 5HPOA 5ICYB 2Z93A 3HMXA 2A74B 5FM5O 4KDWA 2XWJA 3DVNA 3ARFD 5IJKC 4X8JA 2R8SL 3TPKA 2ADGA 3MXVH 5CMAB 1OVZA 5IF0B 4DQOL 3NIFF 1JPTH 1F00I 4LEOA 3K1KC 1TJIL 2NX5A 5GHWL 4Y19B 3KPLB 1I7TB 2E8YA 3EYQD 2W59A 4U7SA 3SOBL 4OGZA 3ALXA 3FAXA 4XHQA 1NGWA 1GGBL 2FGWL 3CLFL 3C5ZD 4X5WA 4PBWD 5JW4R 3QWQB 1FIEA 1E6OL 3BP4B 1WF5A 3QCVL 2A9NL 4OCLC 5E03A 4XCFL 4KFZC 2JB5H 4OAWA 3H42L 2H3NB 1S9KC 5HI4C 1FL6A 4FQLH 4E41D 5IQ7H 3MNZB 3OHXB 3L7FB 4X6EB 3PHQA 2PO6B 2A9MH 4Y4FB 4XP5L 4JZJC 3Q5OA 3L5WB 3WFEH 3ZTNH 1H8NA 1RU9H 3WN5C 4Y2DD 2FBOJ 4F37K 4ZFGL 4ORGA 5GS2H 3CC5A 3U0WL 4N5EC 2B7DT 2L7JA 3SDAB 5FEBA 4WW2B 4I5BA 3VXMB 2HFFA 2CIIA 1Q9OB 2GFBA 4GSDL 4LSTH 3D3VD 4HUWA 1DLFL 1Q1JH 4KMTH 4JRXA 4NWUH 1HQ4A 2BRRH 3FOLB 4ONHB 4OM0L 4F7EA 5BS0D 3R06A 1NGZA 4AT6A 2P7TA 1T2QH 2IAMA 2DTSA 3QZWG 5BV7B 5E8DL 3GMOA 3HMXH 3ARDB 2O5XL 1AQKH 4TN9A 3V6OA 3I6KB 5ESAA 4NM8H 5HYIA 3BGMB 4LLWB 5F3HB 1NGYB 3DI3B 2YMXL 4N0CD 2DLEA 4HWZA 4MDJA 4TNVF 5KG9B 2XWBB 4F80A 3BP7A 3QISA 3KPOB 1L9MA 3B5HA 1S9WA 1R5IA 1DFBL 3BEVB 1QFUH 4HXAH 5C6WH 4KU1A 3KWWA 4DTGH 5E0QA 3AUVA 4JPWH 1T2XA 5T1LA 2Y5TB 5DLML 2FH8A 4MXVE 5C0RH 3FQTB 1IC5L 1NBVH 2DM4A 3G6JF 3QDJD 2VDMH 4XXDA 3QEHA 4MXQC 5EZOH 4IOIB 3FFDA 2W0LA 3BVNB 3CXDL 2R4RL 4Z18A 1OAYL 1IRAY 1DSFL 3D0LA 1Z3GH 3RY5A 4JPVL 4ZUTA 4GBXB 1LP9E 5H94A 3HG1D 2AJ3B 3GSQA 3MRLA 3MV9D 4WJ5B 1GH7A 5CCKH 2IGFH 3PIQA 4WY7L 1AC6A 4PJ9A 1AKJB 2X4QA 3HTLX 1XCTB 3KPNA 4X5LA 3SGJA 1HHKA 3DV4A 1OAZH 2CQVA 4DGYL 4HS3A 3THML 3QUZD 4WI6A 1JNHB 4NO3A 4UINL 2VC2H 1Q9LA 3NOIA 4GFTB 3VXQA 3NCBB 1BD2E 2R2HA 1YYMH 2X44D 1F4WL 1I4FB 5F1NA 3VGBA 4PRID 4UT9L 4JR9H 1NLDL 4NO0A 5ISZA 1DQDH 1TJGH 1XCQA 5GSVB 3QH3A 4PGJA 3VFTB 2VIRA 1FVEB 1RHHA 4ONFL 1AP2B 4G6AC 4HMDA 1PX4A 4PJAB 4NUJA 3RP1A 3FOMB 5GS2D 4F7TA 3KG5A 4PRNB 1Y6KR 1KN2H 1U8HB 3V9FA 3EBAA 3N0PB 4JKKA 4DVRH 4H1LA 2ZG2A 3H9SA 1U95A 3ROLA 4FQXB 2RCSH 2UZXB 2CGRL 3KPSA 1TJHL 4OFIA 3CSGA 3S34L 3FO9A 3S35X 1A9BA 3F65A 4YLQT 2NZ9C 4OB5H 5E7FA 3GSUA 3NMEA 1OF2B 4M7JL 4Z95H 4LSVH 2W38A 3T0VA 1PYWB 1EEYB 4G7YL 3BD4A 5GQBA 3VD4A 2BK8A 2LU4A 2V2XB 4YBQD 2FWOA 1J1XH 1C7TA 5DRXA 2EDBA 4S1SH 1A4KA 1RUML 5EU6B 3KPRB 3VRIB 4OCRL 3FT3B 3T3MF 3Q5TA 2CUMA 3TPUA 2CLRB 4LCIL 2PUQT 2BHUA 4JAMA 2JTDA 2EYSB 1RAMA 3R0NA 2ZUQC 3TLRA 3HS0A 4S1DD 2K9UA 3REVB 3F7YA 5M94B 1S9YA 5HYJB 1FNEA 1J5OL 1INDH 5BRZD 3CFEB 3PE9A 2A83A 5FK9A 5J06A 3INUH 1KJMA 3P4MB 3I84A 3F12B 4P5KA 3DO7A 2J5LC 1KUMA 1RULL 4QYOA 2H2PC 1P6FA 2J88H 2W0PA 4U4BA 3CH8A 2KPNA 3UBXG 3V5KB 4DWHA 1I8KA 1WAAF 4BFGA 1RZFL 4H1LH 3HC0B 4R8WH 2X70B 4JHZA 4XNUL 1JGEB 3NIDF 2L7UA 5GRJL 4ZD3L 2XZCH 3IF1A 1MI5A 1CFNB 1P6AB 1SEQL 4LSQL 3LQAC 1OAXL 2OYPA 1QLFB 2IAMD 3AMLA 5ENWB 2AXGB 4OJFH 3VDAA 3KYKH 5I17A 2ZOLB 3P9MA 3FB8B 4OZ4B 3IU4L 1JFQL 2I60L 2VLLA 3EYUH 2Q7NA 4J3VA 3SY0B 3L9RA 1QEWB 4FTVA 4LOUD 4WWKD 2HTLD 3O45A 1JJUA 4POUB 3UTSE 1IM9B 3PWUB 5A2IH 2W65B 2GHWB 3V4UH 4H26A 1ZHNA 3Q48A 2H26B 3LDBC 1UM6H 3GGWA 1FYTE 3TNNA 2E7LC 3AGVA 2E7HA 5T1LD 4ODTL 1G7PB 4XWGL 1LO2L 4ESKA 2M8XA 3BQUC 4S2SB 1TZIB 2AK4E 4QF1A 5J3HC 1JBJA 4HFUL 3U6RA 1VFMA 1QO3A 3K4ZA 3SE3C 1A3LH 2A6IB 2ZSWA 5E08H 2LU7A 3LVEA 1SEBA 4XCCH 5SX5K 2XQBL 2HJLA 5D8JH 4EIZC 3WO4B 3W39A 5KJRL 2OJZL 5HDBF 4DAGL 5GRUH 4N1HB 5SWSA 1FGNH 2YD6A 2X4PB 1BFVL 1ZLVK 1DBJL 1KULA 4AEFA 2O5YH 3ULUF 3BESR 3WLWC 4X99B 3LN4A 4AIZB 1F8TH 4XNYH 3MV8D 1NCDL 4NQVA 2C1PA 4JLRB 2ARJQ 1AR1C 1JPGB 3BZFB 1N6UA 1J87A 4ZPTB 5IBTH 4GG8A 1NC2A 3ETBF 1Z9MA 1LP9B 4EDXB 1YEHH 1Z0MA 4MXWL 1K3IA 5D1XA 1MFCL 3Q6GH 4JFZL 1T2JA 3R0MA 1GGYA 1QHPA 4P2RE 1A9EA 3GZKA 5DVNA 1XF3A 2PCPB 4MNQE 2VLRD 4HWUA 4HG4J 1YMMA 4LRNL 2JJSC 3H9SD 5IVXA 3LSOA 3PWNA 3BE1H 5K59F 5JOPE 4KQ4H 2FR4A 1CIDA 3ELAT 3DO3A 1BVKB 1M6OA 3LPWA 3C8KB 4F2MA 3RQ3A 5JHDD 4OF7A 3DRTA 4L8SA 3CSBA 4PLJC 1HSBB 1LGVA 4JZJB 3FQNA 1N7ML 4QNPF 5KSUB 4FZEL 4HIJA 1P1ZA 3WN5B 5KANG 2G9HA 3MOBH 4FN0A 2FO1A 3TYGL 3E0GA 5FYLE 3NFPB 2W0KA 3OX8A 3VCLA 2PF6A 3MGOA 1KENH 2HVKA 3D9AH 3OR7B 1QSEB 3U79A 1ADQL 1RJZB 5DTFA 3O8XD 3D69B 4GKSB 1YEFH 5IB3A 3IXTB 5C0NC 1T4KB 3OAUL 4YHPB 4KAQL 2ZG3A 3G5XA 4KK6C 2PXYC 2R0WH 3RY6A 1BGXH 4LVEA 4D9RE 5FUOL 4TSBH 4HKBA 5D5MA 4HIHB 32C2B 4LAQL 5D1QD 1LO3L 3NCJL 4P3DA 5FOJA 4G42A 1GGCL 3OG4B 3QI9C 2FDBP 5HHOA 3CK0H 3QNZA 5LWYL 5IOPA 1FZKA 2IFGA 1X4YA 5F9DC 1E4KA 1EO7A 1X5LA 2GSGA 2XYCA 3MGAA 4KK5C 3C60C 3FO1B 3LB6C 3MBXL 3MRCB 4RFNB 4EN3B 5C0DA 5DDHB 1UH2A 3DVGB 4NO2A 3RZWA 2C3GA 2NMSA 3E8UL 2DBLH 2F5AL 4Q2ZB 3HUJB 3F5WB 5DO2D 3QZWA 1I85C 1MI5D 1U8IB 3BIKA 1C12B 1U3HC 3O2DA 3PWVB 3QDGE 4EOWH 3EGSB 5HHMD 4XVTL 4Y4KA 4JKPH 4NN5C 3RWDA 2BDNH 5I1DB 2G75A 4EDWH 4ZTPH 4LGSB 4RGND 4DFIA 4X6FB 4PJEA 43C9A 3DURA 1Y0LB 1AI1H 2Y36H 3ES6B 5IK3B 5HDQL 1A5FH 1G7HB 2AJXL 5L7XL 4GAGL 5DEGB 4YJZL 3QUYC 5KTEL 5DD3H 1MCJA 4I18C 2XTJB 1C8PA 1OP3K 5EWIL 1QLEH 3QHZH 2HH0H 2YC1B 2AJUL 4LSSH 5IHUH 5HPMB 2FBJL 5T3XL 5DR5H 5C70A 2YBRA 1U2CA 3DIFA 2D7TH 4EVNB 5JZ7C 1S7VA 2VAJA 4HG4K 2AEWA 1FFNB 1OTUD 1KN4H 5HHNB 4YO0B 2NY2C 1RQ5A 5CWSA 1WCQA 1KB5B 3S97C 3LN9A 4HXBL 1UXSA 2Q8BH 5B38B 4OLEA 1M05B 3UTSB 4MD4A 2BJML 3DBXA 2DQCL 1U8OB 1P4LB 2E9WA 1G1YA 1QHOA 2EXWC 2VZ3A 5CINL 3MLZL 2P1YA 2UUDK 4UQ2A 5CJXC 3KGRA 2X5PA 2PTTB 4QOKE 4N8PA 5LBSH 4OT1L 1CICC 2AK4B 1QRND 3P4OB 2A74A 5CS7A 3ULVC 4HQQL 2VQUA 2CKNA 1F90L 1T66C 5A16B 2NY0B 4PRHB 5A2FA 4P2OB 4WHYG 1N26A 5CMAA 5FGSA 1N4XL 3OGCA 2I9TB 5EB9A 1K9TA 3M8OH 3X3GH 1BQLH 1FL5A 4UB0L 1MQ8A 4HIXH 4PP2A 3KPLA 4PG2A 2EDKA 4EUPG 2ZJSL 1TITA 3OB8A 2DI9A 1TFHA 4G9FA 1HHGB 2EIBA 5F7EL 4KKCD 3TH2T 4S1QH 1CLYL 5DRWA 2APXA 3DMMD 3V0WH 1IGYB 1FFOB 3O3EB 2CLZB 4PJ8D 2X9XA 3VD9A 2ZUQB 1NGQH 2YD3A 3OF6A 4HK3N 1CE6B 3LMJL 3BH8A 4OUOA 4X6DE 3L7FA 5EORL 2GT9B 2PO6A 5L8LB 4WFGD 3FO2B 4GQ9L 4P2RB 3TT1L 1OM3H 1MHCB 3BDYH 1N6VA 5SWQB 2D7MA 1ZEAH 3O6KL 1MHEA 3SDAA 2MQ0A 4NNYA 4OCXL 4RX4A 4WW2A 2BY2A 2B4CH 4CDGC 3MNWA 5K9QI 2J5LB 5FM8A 2P24A 3G6DH 5ELIA 1Q9OA 4LSDA 2B1AL 1KG0B 1SMOA 4X6BA 1RUAL 1NGPL 1Q72H 1A6UL 1PG7H 3EOTL 3FOLA 5KSAD 2NY1C 3L3OB 3JWOL 3VW3L 4OF6A 1X3DA 4HLZG 4HHAA 4JO1L 5F9WC 1JVKA 5C0CD 3T4AA 2BRQA 2WNGA 2FL5A 3O6MH 3ARDA 4WO4A 5DMGC 3SGKC 3VGAC 5BQ7B 3QDME 2HP4A 3EYFB 4RAVA 3UJIH 2B0SH 4O9HL 3AY4C 1EK3A 3JWDL 3KNBB 1MJ8H 5DJZA 3BGMA 4LLWA 5F3HA 1UCBL 2RB8A 5HHOD 4KKNA 4TPRH 5E94A 4CGTA 4B53A 5KG9A 1JTTA 2XWBA 1CXLA 4HJJH 4JM4L 1EFXB 4GAJH 4CVXB 2AK1H 3KPOA 2DQGL 1I9EA 3LIZL 5C0FA 4KY1L 4UOW1 1M7DB 3BEVA 4XP6H 3PABB 3PWPD 3GIZL 4DEPC 4X98B 2Y5TA 3LDBB 4ZUWB 2X4TA 2OQJB 3FMGL 3RAJH 4LPXA 4LLVB 1FCCA 3BQUB 4KDVA 4P3CL 3IDUA 1MCEA 4IHOB 2ED7A 4MAYD 5D6CB 2VXUH 3VXUD 4WI5A 2X42A 1PKQA 3ULVE 5EU7C 2EKSA 3ECBB 3BT2H 2YZ1A 1QD0A 1FP5A 4HDIB 2AJ3A 5CUSL 4YHKH 1JIBA 3TN0A 4KTDL 1AKJA 4X4MA 1GHFH 4FZ8H 5B4MD 1CE1L 4N9GB 4YDJA 1I3RB 4CKVX 1JNHA 1HWGB 5JPNB 5J7CC 4JQXC 3QDGB 5D72H 1I4FA 2VMFA 5GPRA 3CZFB 4XB7A 5GSVA 5IMMA 2ZUXA 2VDRH 3FQWB 5KW9H 1R3HB 3VFSA 3ARWA 3MX0A 5BV7H 2MJWA 1AP2A 1L7IL 4R4ND 4RWYH 3FOMA 3MO1B 5CFHA 1LEGB 2AI0H 4PRNA 3D48R 3VD5A 4OQ1A 1U8HA 4MSWA 3PGFH 2X89D 4CMMA 4QHKI 3EO0B 2OZ4L 4J3UA 4FQXA 3VWKD 1KT2B 2XZAL 3BPOC 1UG9A 5GS0L 1OTSD 2DQUL 1N5YH 1DBAH 4CVUA 2EH7L 4FQJL 4HJ0C 4CADA 1YEKH 3CJJA 5DZOA 4R0LA 4AQ1B 5CIPB 4G9DB 4LPVA 1G6RL 4MZ3A 4NUGH 5TFSH 4Z0BH 1UWGH 1OF2A 1NC4B 2BERA 4ZG1A 1PYWA 3REWB 1TCMA 2J6EL 3IRPX 1BM3H 1U42A 3K3QA 5SWZD 2YWYA 3VXPB 4Y19D 5GGVY 4QOKB 5AEAA 5C8JB 5EU6A 4V1DA 3NFSL 3KPRA 5LGHH 4R90H 3RI5F 3FT3A 2R2EB 3TBSA 3FFCD 5GGSY 5MEPB 3JSSA 5IQ9A 4OQTH 1ZT4B 2LTQC 2PXYB 3L95B 5KSBE 3TBVA 5CEZE 1GZPB 4K3JL 3REVA 4JZOB 3UYOD 3PHSA 3VXOB 1FPTH 3OF6D 4B41A 4F33A 5HYJA 1EUTA 5IW6B 4QHLB 5ALCH 3RWIB 3MOAH 3QEGH 2PO6D 2ILLA 1VGKB 1ZA6B 3OKKB 2UY7A 4Y4FD 3CFEA 4BUGA 5MENE 2GJJA 4UTAL 4K8RC 1UJ3C 2D0FA 4HT1L 3X14B 5EU7E 1J1OL 2DDQL 3HI6H 4BH7B 4LEXH 1W72B 3C60B 3WDJA 1UM5H 2PR4L 3MRKB 1I75A 3IDIB 2E6PA 3VXMD 1KJ2L 2H2SD 4IOFC 3OKYA 3H3KA 3D0VB 4KJQD 4E42A 2NY5C 4OTXL 4OD3L 4X6DB 3VI3E 4DK6A 1JHLL 5CJQL 3NGBC 3JV4B 2FEEL 1QNZH 2J4WL 1QLFA 3QFDB 3S6CA 3PP4H 4LIQL 5ENWA 2AXGA 1I9RH 4NN5B 1ACYH 3RVUC 1AGCA 3ARDD 3QBTB 3DRQA 2Y06L 1HZHL 1OP5K 3FB8A 3VXNB 4HULB 1UENA 2AJVH 3CUPB 3SY0A 1QEWA 3MLUH 1XIWA 1Q0XH 4KZEH 1IILE 2ITDB 1I7UA 1T89A 2ARJB 3PWUA 3QUYB 4HWBA 1CF8H 2BY0A 1U8QB 4I18B 5EU3B 5FYJU 3SKOB 1F4XH 4FFYL 4MA1C 2MOVA 1YEEL 3E1F1 4KHTL 2PETA 3PGCB 2IEPA 1UZ6E 4P99A 4S2SA 1TZIA 1PZ5A 3QDMB 4ODUB 4QTHB 3UTZB 1JHKH 4P3WA 1OW0A 2I07B 5IVXF 1X6NA 3MRQA 2R2BB 1PY4A 2A6IA 4X8XA 2EDRA 3JVGA 1IEAB 1CDYA 2NY2B 5I71C 4GBXD 4CMHC 1RFDH 1JHTA 1JGVH 1MCPH 3BRFA 3BD3A 4U33A 4PRAB 2A77H 1AKJD 1RZGB 2X4PA 4OLVH 3SDDD 2YKLL 2Z92B 2H45A 3Q6FB 3N9GH 4AIZA 3N1MC 3MXWH 1CICB 3VWJC 2OI9B 4EEEA 4M62H 5F7MC 3CFKB 1GC1C 3BZFA 4ZPTA 4O51B 5MP6H 1UJTA 1OSPH 4EDXA 4YFDB 4JB9L 4GW4B 1F6AB 4QGTA 5CLTA 3OR6B 1VGEH 3OXSB 4ZQKB 5TE7H 1VPOL 1WC7B 1VFBB 4M61B 1I3VA 4X80H 5D5MF 1NDGA 2PCPA 5FYKD 4JO4H 1DDHB 4DW2L 3I85A 5GIRA 3U83A 4OSUH 4FQXD 2OTWA 3KYNB 4U6XA 1BVKA 5EOTB 3SJVA 3Q3GB 4N1CA 4NWTH 4PLKD 4QO1A 1F58L 4RA3A 5INDB 1KCVH 1L6XA 4BFBD 1D6VL 1OCWH 1WSST 5DJ2A 4UTBH 3PP3H 2OK0L 4YC2B 1JZ2A 4CAGA 1HSBA 1KCSL 4UIMB 2NY7L 4FG6D 1BBDL 3SBWC 1MHHB 2X9WA 5A3IC 4S1RL 3VI4E 5E5RB 2IFFL 5EC2B 1HXYB 4GW5B 3RFZC 2ZKHH 1FLRL 3T2QA 1F3JB 3BN9D 1XGTB 4MJ2A 4D9LL 2E27L 3NFPA 4DGIL 2WV3A 1U93B 4HWEH 1YECL 3EYOB 3OR7A 1WUNT 3SHSA 4FA8A 1QSEA 1A7NH 4G6KH 4ENED 3BRDA 4PJEF 3D69A 4NZTH 2DLIA 5EU6D 2P5WA 4GMSL 4M7ZB 4MD5B 4NNPH 2P43B 1JK8B 2NY1B 4NCDA 4YHPA 3U7AA 4PJBA 1B3JA 3MLTB 4MJ6B 5F9WB 3RKDD 1OD7A 4BZ1L 2BVQB 2GY5A 1MREL 3QIWC 3BKMH 4PJHA 4H8WC 1EAPB 2CIKA 1P4IL 1NCWH 4R2GC 1FDLL 3AC0A 1NPUA 2CMRH 3GSXA 4XWOD 4WUKH 2A6JB 3M07A 3MYJB 4N0YL 3W11C 1JRHI 3FO1A 1CK0L 1RVFH 4MYWB 2W07A 1XH3B 1T83C 4EN3A 3EJYD 2K7QA 3N85L 5IFJB 3PUCA 5DQJB 3DVGA 1ROWA 1XGPB 4LNRA 5KSBB 3ARGC 4YQXL 5B3NA 2MMXA 5I19H 4X4XB 3HUJA 3F5WA 4GT7A 2WAHA 4IBLT 4YPGB 1O5DT 1C12A 3PWVA 5JR1L 3OQ3B 1JZ6A 2PYFB 3BDXA 3D85A 2M2DA 2P8PA 3SDXB 1M7XA 4MZ2A 5I1DA 2VAAB 3D39A 5F7UA 3QG6A 4X6FA 3DX9B 4QXTB 4NQUA 1Y0LA 1S7RA 3IFOB 4Q0XL 2IG2H 3LEVH 4I0PC 5DEGA 1LK3L 2IQ9H 1QBMH 1UACH 4U2YA 4C83B 2YC1A 1PG7W 1IM9D 1C1EH 1MOEA 3MR9B 1A7PL 5ITBL 4R4BB 3LRGA 1YNTA 3QJFB 3W0WB 1ZLUH 2AEPL 4NCC1 4U6VL 2BNRE 1CGYA 4XC1H 2QKIB 5C08B 5HYEA 5HHNA 1ND0B 4YO0A 3JWNC 4OKVB 4G80B 4YHMH 2UZIL 9CGTA 5JDSB 3BAEH 3MLYL 1EZVX 1KB5A 1U3YA 3CFIC 1RJYA 5F1OB 1M05A 3QPQC 1T7XA 3IXAB 1UZ6F 1U8OA 3JV6B 5BVJA 5IM7B 4U1KB 1D7FA 3KJ4B 1H3VA 3V4PL 3BPOB 1NMCC 2DJSA 2PTTA 5DYOB 1KV3A 1JN6B 3U7WH 2RJMA 1Q9KA 1WLHA 4WW2F 4L5FH 1ONQA 1JTPA 1D5XB 3EJZC 2AKRB 3U7YL 2CLVA 2P44B 1G9NL 3NPSC 1F02I 4N0UB 1A7QL 4PRHA 1NKRA 4P2OA 5FGBC 1MQKH 4O58L 3X13B 2I9TA 2VXQH 5I30L 5IEHB 4DKAA 2HN7B 3WHE0 4LDEB 4ONGH 2IALB 1T5WB 1MWAA 4RFOL 1QSFE 3QRGL 1Z9SA 2DL2A 3KAAA 1BD2D 1CFTA 1S9VB 2RFXB 4MQTB 1XGQB 4RBPK 1FFOA 1I8LA 4Y4HC 2CLZA 2EYTB 1ZLSH 4K9EL 4TYUA 3QIBB 4LGPB 1CE6A 1MFNA 2DQEL 4UU9A 1KTDB 2E9IA 5HI4D 4NQDE 2GT9A 3FO2A 3SO3C 4P2RA 5AAMA 3UBXB 3QAZC 1MHCA 3QUXC 5FDWB 3MJ8B 4D0BB 1DBBL 3WYRA 2ATPB 4LCUB 5D7SH 1MNUH 3OGOE 4YZFF 5H2BA 1ZTXH 3CMOL 1JUFB 2WM0A 1KB5H 4N5ED 4YXHH 3OWEA 4O4YL 3TO4A 3ALPA 1KELH 1KG0A 4OCSH 1OARL 4MA8H 2CK0L 1JWSA 2Z9TA 3Q5YA 4PJIA 1AR2A 3VI4F 4DN4L 3L3OA 5E8EB 3QPXH 1KYOJ 3NGBB 2E5EA 2VZTA 1OAQL 2B39A 5BQ7A 3EYFA 4NO5B 4LCWB 3MJ7B 3LS4H 3BPNB 1JGUL 4IRZL 4PRPE 1G6VK 1TMCB 3CLEH 5IHZA 1SY6A 4PREB 1JRHH 1KTKE 5L9DH 5GXBB 1CLOH 3DX6B 4Q9BA 1EFXA 5FHBH 5GGSB 1VB9A 3RVXC 8CGTA 3GJEB 1IM3B 1G9ML 1MIEL 1M7DA 2BFVH 5E5MB 3IDJB 1A02N 4BFIA 12E8L 3RBGA 5I18H 5ID1B 4JKWA 4YDVB 5EA0H 1V5JA 1A3RH 5D7IA 3MRGA 3VXTA 2E7LA 4MA1B 2B2XH 3P30H 4PGEA 1KPRB 2DL9A 3BQUA 4NKOB 1WWBX 3CVHL 4TRPL 1OPGL 1FNAA 5D6CA 4MXQD 2C3WA 1UGNA 3SE3A 3ECBA 3FTGB 1XR8B 4K2UL 4R3SA 1FH5L 4XBGB 4HDIA 2COQA 4R26L 1ZWIB 4JVUA 4CMHB 1BFOA 2HT2C 4W6YB 4LSUH 2C7UB 1LILA 1JYNA 4LLUB 1CXFA 1MJ7H 4N9GA 3H8NA 4R9HA 1EMTH 2ZCLL 4MMXC 3RU8L 1WBYB 2GIYA 3FZUC 3WFDH 1KC5H 4UMGA 2FLBT 3MFFA 1HN1A 5JPNA 1S78C 3AS2A 1WFUA 2NXYB 4O5LH 3V6FA 3VWJB 1I1CA 4POYA 1K85A 4WI4A 2C9AA 4FQQB 1S7QA 1ZE3C 1GGUA 3FRUB 2CJUL 3O6LL 3FQWA 2DOCA 5D96C 5TE4H 1KJVB 2ADFH 3O6FC 5FF6A 5C0BE 1I1AC 3LQAH 4JFYB 3MREB 4AG4H 5FYJE 1J88A 1LEGA 4G6AD 5L8JB 4ZYKA 4U1MB 2VKXA 1DUYA 3GJFB 1SY6H 3D6GA 3GEWB 3DLQR 4V2CB 4OGXH 3UTSD 2XN9E 1CLZH 4LHJB 2VL5A 1KT2A 1GYAA 2W9EH 4WDIA 4KDTC 1UC6A 1FYTD 1PX3A 3HLAB 1J0HA 1ULVA 2BNUB 1VHPA 2VWEC 3GSOA 2AK4D 3MUGB 5CIPA 3WE6B 4G9DA 4CL7A 5DT1H 2R0LH 4PV8B 2NZ9D 3EO1A 3U9PL 3NACH 3ARRA 2VDPH 3T1FA 4LQ1A 3TJEH 5CJ5A 3REWA 4YAQB 5I1KL 3Q0HA 4NM4H 1RIUL 5DXWA 3K46A 2VE6A 5L6YH 1MRDH 5JW4Q 5E56A 3IJHB 5KSVB 3HZVA 1IC7L 2C3VB 1KYOK 1PVHA 1ZLWH 2IANE 1EERB 4MLSA 4OZHB 4Q6YA 1EGJL 4JFEE 3EYSH 4XPBL 2DD8L 4LP5A 2VR9A 3B6SB 3K7UA 5MEPA 3L5HA 1ZT4A 4MA7H 3DXAE 4YWGL 4Q6IC 1D5BB 3BW9B 3S4SB 2PXYA 3U4BH 4GLRI 4TNWK 15C8L 4AZ8A 2EDNA 4NCC2 1BQSA 3VXOA 3LRSA 5F7DB 3TNMB 3C08H 3RX5A 3U30B 5I2IB 5IFAL 3KYMB 4QHLA 3D25B 1VGKA 3OKKA 4KHXL 1V7MH 5GGTL 4P2RD 1A4JA 4CU7A 5FCUL 5BOPA 3ILPB 4R2GB 3IS1X 1QSFB 1F3DH 3GMNA 3HNTL 3FQUA 4JO3H 4MNQD 4BH7A 1W72A 3ZDZF 4Z9KB 3V7AG 2BVPA 3IDIA 5A2JH 4JG1H 4W6WB 2H2PD 5LJYH 5JOPD 4M5YH 3PGDA 1I3GH 3ARGB 3HCVB 4FXLA 3LY6A 1MCBA 1IGCH 4TSAL 1NUFA 1MRFL 3GRWL 5CGYC 1RUPH 3QFDA 5CIPH 5DD0H 3S3SA 4ZTOL 2H32B 2EZ0C 1J1PL 3KPMB 4PJGE 1P7QB 3VXNA 2QQKH 4RSVA 1BBJB 5FYLD 1YNKH 4ORZC 4J6RL 3JTTB 1NUDA 1EBPA 4FQHA 4EI5C 1MHPL 1TNNA 2ITDA 5I8CB 4OLUL 2ARJA 2BHZA 1EFXD 4I0PB 4MS8C 1C5CH 4GG6E 1MFBH 1SMAA 1U8QA 2CKBL 5EU3A 5C3LD 3SKOA 4DGVH 4LLDA 4HC1H 4XMKL 1I3UA 3G04B 2N4IA 4G8GB 4R6UA 4D9RD 5BO1H 3MRRB 3UTZA 4W4OC 3QNYB 4ZXBC 3BQUD 2I07A 4LSPL 2VWEE 2XWTB 3MXVL 4ZSOE 5J3HD 4YR6B 2R2BA 4IMLA 1SYVA 1F6LL 4OCWL 5B39G 1IEAA 4BK5A 1ZSDB 4YHOH 4R97B 4LVHB 4JFQB 4XPTH 4LSRH 1A6VH 3DVIA 4PRAA 4AY0A 4FMKA 1BQHG 5ID0A 3H0TB 1HYSC 4NZRH 3B2UC 4Y5YB 2EE2A 3QEQA 1W72H 1NMCB 3H9HB 4UT7L 3MNVB 3FB5A 2JB5L 4WEMB 4WU7A 2I24N 3KJ6L 5C0AB 3MJ9L 3MRDB 3WLWD 1AFVH 1TVDA 3QDGD 4FQLL 4O51A 1F4HA 3NPSB 5IBUB 1AR1D 2A9ML 3NTCH 3ZE0F 4PLNC 2MWCA 4NSKB 1II4E 2XTLA 3WFEL 4GW4A 1F6AA 1T03H 3UXFA 3OR6A 4J8RB 2Q87A 3OXSA 4PJBF 1WC7A 1AY1H 3D18A 3PL6C 4M61A 5JQ6H 1BOGB 2KL6A 4G8FB 4PPTA 5J89A 5DFTA 1QFWH 1SM3L 5GISL 4LKCB 4PJHF 5J1AB 2HWZH 3WFBH 3KS0J 5HGHB 1CGUA 4WNQB 1JGLL 3ARTA 4M8QB 1Q38A 3CPLA 4LSTL 3QWOA 3SDCA 1B2WH 1Q1JL 3OPZH 1NAMB 3KYNA 2QSCH 1ZT7B 4HK0B 5EOTA 4IEFB 4Y4HB 3Q3GA 1DP0A 4FMFA 5F93C 4F8TA 4XNZC 2WP3O 1H9VA 1T2QL 4JZNB 4HUNB 5C0BB 4NHCH 1U8JB 4D8PB 4DZ8B 3SCMC 3HMXL 1HEZB 3X12B 1AQKL 1B90A 4NM8L 1VDGA 4HBCH 5CP3A 1MHHA 3QUXB 3WCYA 4PLJD 1AHWA 1WWCA 1NC4D 4YIQA 5EC2A 4GW5A 1XGTA 4NC2B 5IV2B 5F6IB 1YMHA 1HCFX 4QXGH 5MI0C 4HXAL 5FFLA 4QOKD 5EBLA 1WFNA 4JPWL 5IWLA 1P7KB 4GLRH 4NGHL 4MD5A 5C0RL 2XA3A 1B0RB 5EZOL 4FFVC 4MCYB 4XCEB 3MLTA 4MJ6A 5C0ND 2BNQB 2JB6B 2ZPKH 1JNNH 1CN4A 2BVQA 5HY9B 1DUZB 4KK6D 2PXYD 3TIDB 3ULVH 5DHXB 4L1DA 2KZWA 5A2KH 1EAPA 4PJCA 4AM0B 5LCVH 1DL7H 5K9JH 2DM7A 3QI9D 1RIVH 1T5XB 5L88L 2IANB 4XGZA 5CCKL 3IYLW 2CPCA 3OBAA 1IAKB 5LAXA 3O9WC 3QNXB 2A6JA 3MYJA 4JQVA 4M93C 1FFQA 4KK5D 4APQD 4ELME 3C60D 3LB6D 4I77H 5T1DH 3WKML 4TOYH 1YEGH 5IFJA 1TZGH 4MVBC 2VC2L 3DXAB 5DQJA 3PQYE 5KSBA 5DHYB 1YYML 4RMTA 2ZNWA 4TUJB 4X4XA 2NR6C 1N59A 4KVNH 4YPGA 5IJVB 1TJGL 4Z0XB 2PYFA 3EYQC 2X4SA 3UTTA 1JYXA 3ZYOA 2G5BB 1BOYA 3SDXA 5HSFA 1U3HD 4S11A 4PGCB 4Q58C 1VFAB 1WIUA 3LHPL 4LLYB 3C5ZC 1N5AA 2VAAA 1DLHB 4GH7B 1UA6H 3OKMB 2OL3B 4YHYC 3DX9A 1KN2L 4QXTA 5CP3H 1OLZA 3UO1H 3EDJA 2YUWA 4DVRL 2V9TA 3SE8H 2DMCA 1AD0B 4RZCB 4AEEA 1U3JA 2RCSL 3DUHA 2FX9H 1I9IL 2DQJH 3QUYD 4X4ZA 3MR9A 3LS5H 5FIEA 3GMPB 4LLMB 5LQBH 4OB5L 1YPZE 3O4LE 3W0WA 2VZUA 4YE4H 1MVUA 4K7PL 3O4OC 3GSWA 3QDMD 3F7VB 4PJGB 5D96B 4Z95L 3O6FB 5C08A 1I1AB 1L0YA 5JZ7D 1JPFA 1ND0A 1A7RH 2VYRE 2PNDA 4LARH 4GRLC 3VD7A 2NY2D 4GG6B 1J1XL 1PKOA 3S36L 1X5IA 3JV6A 4C56B 5IM7A 3DX7B 4U1KA 3PG2A 3C9NB 1NUGA 1CQKA 5DYOA 1MCRA 2EXWD 1JN6A 3MUJA 4UT6L 1D5XA 3FONA 1IEBB 1U8PB 1CICD 4PS4H 2AKRA 5CEZH 2ICWB 2GQHA 4U2ZA 2VLJE 3CX2A 3JBG7 4N0UA 5C0GB 5CBAB 3ULVD 3VE0B 2I9LA 3DV6B 4PJIF 3WEXB 1INDL 1F4YH 5MERA 2EC8A 1WTLA 3VFUB 5CEYA 1MY5A 2G5RA 2X1OA 3MUHL 2Y9RT 2HN7A 2DLTA 2IALA 4W81A 1CTNA 3V6ZB 2YRLA 2J88L 1A2YB 3NFNB 5C92A 4YH6A 2DN7A 1PEZA 1NCBL 4R8WL 4PIRF 2R9HC 4E0RB 1H3XA 1S9VA 1MAMH 3OG6B 5DK3A 4HUUB 3A67H 3GBMH 4HFWA 5DJAB 5EIQA 5EO1B 4Q6IB 3QIBA 1BPVA 4NFBA 2AJSL 3WIHH 4XNXH 4HZAA 1PY9A 4WW1B 1HDMB 5D7IF 3IT8D 1MY7A 1S7WB 3FB7B 1U58A 3CZJA 1WISA 2BZDA 1T6VN 5T3ZL 5FDWA 3MJ8A 1XF2B 1I8IA 4D0BA 5IR1B 4UOJA 1NEZB 3EYUL 4LCUA 3SDYL 1EV2E 1LO0L 1OGTB 4M48H 3NZ8A 4BSWB 3WNKA 1JUFA 4HMEA 5B21A 3RWJB 2GTZB 4M1GH 3GMLB 4JN2A 1P84J 3VMNA 2HLAA 4FQIH 3QIUC 2VR5A 5MEOB 2XY1A 4NN7C 4OFPA 4P59L 1BFTA 4XPHH 4HCRA 2NY1D 3OKLA 3MOQA 5E1HB 5D7LB 5C09E 1FNGB 1NSNH 3EDDA 4M4PA 1A3LL 4LCWA 3MJ7A 1CLCA 3LH2L 1XF4B 4KWUA 5DMGD 5E1AB 3V8OA 2AJYL 1ZS8A 1I9JH 2M1KA 4OLXL 3DHMA 5GGQH 2O5ZH 4TULH 3DX6A 3KR3H 3IJSB 1S5HB 5LKNA 4EI5B 4QT5B 2XI9A 1FGNL 3IAQA 3RWHB 1IM3A 5HHXL 5E5MA 3IDJA 2O5YL 3MLVL 2WW8A 1KJ3H 5ID1A 1F8TL 1HHIA 3RDTC 4QEGA 5E9DA 1U3ZA 1NDMB 4AENB 2QL1A 5CEZD 4NKOA 5IBTL 5HD8C 5AD0B 4ZXBB 3NIGF 1WZ1H 1MLCB 3RWGB 5HGAB 4LHUB 4Z77B 5MEND 2J8UB 3Q6GL 4XBGA 3QULB 1EPFA 1ZWIA 3MCLH 4UZGA 1LEKB 3LEXA 4K8RH 2C7UA 3ABZA 4LU5H 5EG6C 3HPLB 3ISWA 1S9XA 4KQ3L 1WBYA 3MBEB 1KIPB 4UDUB 3BE1L 3GK8H 1ORQA 4MJIE 3SPVA 2X1XR 3VWJA 3AROA 2V5RA 2NY5H 2CXGA 3RKPA 3PV6B 3CU1A 3STLA 4P2YA 4XX1G 4HCRH 5LGKA 2BOBA 3HMWH 4JFYA 3IDGB 3MREA 3BIAX 3MOBL 5L2KE 1EJ6A 3PL6B 1FE8H 1F11A 2R1WB 5GGVH 3MRFB 4U1MA 1SQ2N 3D9AL 4WHDA 2XACC 3T0EB 4MNGA 1SYSB 3IVKB 3HLAA 4O2EA 3DYOA 4A6YA 1YEFL 1YPZB 3O4LB 1X44A 5EH1A 4LVOC 4CJ0A 5M95B 5H37G 4J3SA 1BGXL 3MUGA 4JFXA 4HJ0D 4TSBL 4X6CE 4UILH 35C8H 3SCMB 3KXFB 4MDIB 2FSEB 5C0EB 2VDLH 2HLFC 1P84K 3T4YA 4GQPH 3CK0L 2CH8A 5DJ8A 3S7GA 1MFEL 1P5VA 3V52H 3BKJH 2AAVA 1TVBB 2YPVH 3QQNA 1TQBC 2IPKB 5DD6B 3MRJB 4WTZA 3IJHA 5KSVA 2V2TB 2A6DB 4Q9RH 4AMKH 5HDLA 3QXTA 2YOCA 1UADC 4OZHA 3VA2C 1KOAA 4HJGB 2OR8A 2X9YA 3WSQH 3QEUA 3I50L 3VRJA 3PWLB 2DBLL 4B50A 2NLJB 5DQDH 3KPQB 4N8VG 2VH5H 2DICA 3MRPB 3S4SA 1KPUB 4EOWL 4ZPVB 5DEZA 4RMRA 1X4ZA 3U4EB 4LBEB 1GC1H 2Y07H 3KYMA 4JKPL 2BDNL 3D25A 2E9JA 1E4XI 2LVCA 4WFHE 4EDWL 4ZTPL 43CAB 1R3IH 3ILQC 4M9PA 4N90E 4Z7QF 5D71H 5BXFB 1FNFA 1R5WB 5I6XC 4BKLA 3ILPA 1RZ7H 4LASH 1MRCH 1CTOA 5T1KD 5HYQA 4K8RD 1JF6A 3O9WB 1DE4B 3QXUA 3WJLA 4ZS7L 3RI5K 3MLXH 4J7RA 4NQCE 1CS6A 3ARBC 3ARFB 3GJFH 4H0GA 3ME0A 4NZUH 2HH0L 1CGSH 2WIIB 4LSSL 5IHUL 1WIOA 3O3AB 1IAII 4OFDA 1WEJH 4KKLC 4IOFD 4R96A 4P5TC 4M5ZH 1PG7X 4BQ8A 1YY8B 1AGBA 3WIFB 1OGAE 5I76A 2DF3A 2ZUVA 2RBLA 4ZFFA 4F7PA 5ABDE 4NT6B 2MKLC 2H32A 2YPLA 1KN4L 4H20H 4HGKC 3VFWB 3KPMA 1MIML 3C5ZB 4QY8A 1P7QA 5ITFB 3RVUD 3EJJX 1BBJA 4U1GC 4YHYB 2Q8BL 4L8BB 4P23C 3OJDB 4WI7A 1G7MA 3JTTA 2UWEE 3H6JA 3JWDC 4P46A 3UYPA 3EZ8A 5I8CA 3DWTA 1BWWA 4Q7DA 4JFPA 5JXEC 4X7SL 4RMWA 5LBSL 1Q9WA 2NNAB 1FZOB 3B2VH 3G04A 4HKXB 4Y2DB 4XC3H 4G8GA 2AABL 5C09B 4CN4A 5CJBA 4PTTB 3QNYA 2XXCB 1NFDE 3LAFA 3O4OB 5GSRB 2BVTA 3O2DL 4YR6A 3C6SB 2GK0B 1KIUA 2YD9A 2FEDC 4H8WH 3X3GL 3D3VB 5TGBB 3RX8A 4JY6B 4GRLB 4JHAL 4JM2A 5BS0B 4JFQA 4AH2B 3BHBB 2PYEA 4U49A 1I7RB 2IH3A 3H7LA 3S3PA 2F58H 4KPHH 3WFHA 2R4SH 4DUXA 4Y5YA 2OTUA 4S1QL 2NY6C 3HZMA 4HEME 3H9HA 2ATKA 1OHQA 3V0WL 3BSZH 2P5EE 3DROA 5C0AA 4KRNA 3MRDA 1S3KH 3MA7A 1JV5B 3ZLQC 3VWJD 1YDPA 5EUKB 2Q7YB 1IFHH 3L3GB 3S37L 1MCIA 3HAEB 5IMOB 1OM3L 1B9ZA 2FHFA 1JI2A 4POZC 3BDYL 3EHBC 2NW2B 4J8RA 4PYGA 4U1IA 4DVBB 4WUUE 1CIUA 2H32H 3V4VH 5JXAL 5CILL 4G8FA 3V7AE 4LRIC 1AJ7H 1KLUB 4NN6B 2B4CL 1A1MB 4LKCA 3QDJB 4NDMA 5HGHA 4WGWB 3G6DL 3CVIL 4JQIL 4WNQA 4AL8H 2IQAA 5BJTB 4MJIB 4PJCF 4JDZB 4M8QA 3U46B 1I7ZB 4HSQA 4YEFA 2ENSA 4M6MH 5D2LB 1NAMA 1Q72L 3MV7A 1ZT7A 4HK0A 4X5XB 5C0JA 3JUZA 1E28B 5GS0C 4NQSB 3LKPA 1E4WL 3VFNB 5C0BA 4QCIA 4F9PC 1U8JA 5KS9A 2BNRD 4D8PA 3O6ML 1C7SA 2E7BA 3X12A 1T1YA 5L2KB 4Q9QH 4YUEH 2IADB 4JPIB 3GM0A 2Z8RA 3IB4A 3MMEA 1CR9L 3ZL4L 3WS6A 1CGVA 2NZIA 3IDXH 4BYHA 5IGXH 1IE5A 2X2YA 4S0TD 4TPRL 5T1MA 5J56B 5HGDB 5A3ID 2EO1A 4PRIB 4GAJL 3KPPB 3WFCH 1RUQL 2AK1L 3TBYB 5IV2A 5ILTH 3ZYIA 2HKFH 5DMKA 4PJFE 3QIUB 1IKNC 3V5DA 1P7KA 4X6CB 3RAJL 4ODXA 4IIQA 3ZKXC 4NN7B 1ITCA 4XCEA 4MCYA 2BNQA 1DUZA 1E4XH 5I1CH 5DHVA 4AJ0A 1DN2A 1IGIH 2VXUL 3TVMC 3WFZA 3TIDA 4GO6B 2WUBH 1AD9B 5ADOH 3BT2L 3H7BA 4WVRA 3QIWD 2ICWI 1T5XA 1J7VR 4UIKL 4NZJA 1MSPA 2ICEB 1DVFA 1NEUA 1IAKA 3TP4A 3QNXA 4R2GD 4OCNC 1QSFD 4TVPH 4TUOB 2NYYC 1GHFL 2O26U 4FZ8L 1ZT1A 5EIIA 3JTSA 4GKZA 4K7FB 1TETH 1IAIH 3W11D 2JELH 2JJWA 3TZVC 5F96L 4HK3J 5D72L 3VXSA 4TUJA 4E9LA 4YBLC 4J2XA 2GJ6E 3ARGD 1NAMH 5CEXB 1T20B 1G0YR 2YD8A 2FIRT 2Z4QB 5EFIB 3WXVL 4QRRE 2VDRL 1IZKA 4NQDD 3WS3A 4ZODA 4YXLH 3LOWA 1CD1B 3VH8B 4NYLB 3UTQB 1VFAA 2WWMC 3BUYB 3X3FH 4LLYA 2WQ8A 3L1OH 5FYJH 5GRZA 5TJWK 3BZEB 1FVCB 1DLHA 5KOMC 1KCRH 2OL3A 4XVJH 3BKYH 2J2ZA 4F7CA 1HHHB 4PUBH 4XAKE 1MELA 1OSZA 5DGRA 2LU3A 1UXWA 2NXZC 5C6TL 5I8OH 3VXRA 3OSKA 4I2XE 1AD0A 3KLHC 3AB0C 2OR9L 1QQDB 3CDFA 5E99H 5F71A 4I0PD 4RDQG 5BW7C 4GRMB 4JHBA 1DBAL 1YEKL 1U6AH 4FXGA 1NLBL 5BRZB 3ZMRA 4N8CL 3GMPA 4G43B 3HE7C 2JJTC 4LLMA 2B1HH 5C07A 1IAIM 3NZHL 3P40A 3BI9X 4WEBH 5A43C 5JW5A 2QSVA 3F7VA 1IC1A 3SE4C 2ERJC 4PRPD 5EOCH 5LXGH 1LVEA 2UWEB 4KGJA 2Y6SC 4NKMA 2VZVA 1H3WM 3DYMA 5KSAC 3FRPG 3FJTA 4GG6A 1IGML 3VGEA 1Y6MR 1DBKL 4C56A 3OJ2C 3QPQD 1GVIA 1AO7E 3RPIB 1OQOA 1C16B 1DBMH 5TE6H 4GUPA 1S7XB 4LPYA 3P9WB 3HI1A 4LVOB 4OQTL 5DSCB 1NFDB 5EUOB 4ZUVA 3RUGE 1QKZH 5BOZG 2ICWA 4NRZB 1NGXA 3EJZD 5C0GA 5CBAA 3VE0A 4WWKB 5JDJA 4G6JH 4MMZC 1S5IL 1GZQB 2ED8A 3K80A 1FNEB 3WEXA 4WFEE 1OAUL 2CD0A 3VFUA 2DYPA 4QTIH 1TQBB 2VOTA 1U36A 4M6NH 5EN2B 1SHMA 5D6DC 3G9VA 2OL3H 5DJDB 2FD6H 1KTLB 3QUKB 3V6ZA 3U4AA 3NFNA 1QPXA 1PAMA 2P5EB 4LCCB 4P49A 1NKOA 4E0RA 4U7KA 3MRBB 3AM8A 2FJFB 2EIZB 4YDIL 3RJQB 3RL1B 4HUUA 4U1JB 4Z76B 1TIUA 1RZKL 4Y4HD 2HRLA 1K2DB 4NJ9L 5C0BD 2Y7QB 5F7KC 1I9RL 2OBGA 1HDMA 3TA3C 1S7WA 1H3TA 5FYJD 3FB7A 4Z8FH 1XF2A 2IPUK 3W9DB 5J9PA 5IR1A 2VO5A 3K8KA 2AJVL 3QUXD 4M1DH 5ADPH 1OGTA 1FAIL 2FHBA 3MLUL 3MV8B 4BSWA 1YEDB 2ZNXA 3RWJA 2XN9D 4X83A 5GRYA 4JJ5B 1CF8L 3ARBB 3W81A 4HS8H 3RZCA 4R4NC 5MEOA 3VFOB 2VABB 3I75A 3I6LE 3N1PC 3BISA 1GSMA 5FHAL 3SQOH 5D7LA 3UZVB 1FNGA 2VLRB 3I2CL 3BGAA 3ARZA 4LQFL 2P4AB 5E1AA 3T0XA 2WMPA 3AREC 1HILA 1EO8L 4U1GB 1RFDL 1JGVL 5DVMA 1MCPL 4OF3A 3FCTB 3ZDYF 4PJFB 2IAND 3IJSA 1S5HA 2R8SH 4QT5A 4JFED 3RWHA 1P9MA 4PB9H 4DQOH 4FNLL 4MX7B 3RVXD 2FO4A 3MXWL 3IRZA 3DXAD 3QUMB 1NDMA 4QHKJ 4Q9CA 5EPMB 1N3NA 3SOBH 3UZQA 5JW4N 5MP6L 5FGCE 3QQ9C 1YEJL 4W4OA 2FGWH 4JFFA 3RWGA 3QCVH 4PJ5A 5HGAA 2VZOA 2J8UA 4XCFH 1VGEL 5IKCB 3L3DA 3F8UB 4PJXE 5TE7L 5I1IL 4DCQA 3TWCL 1JMZA 1XFPA 3QULA 4YDKL 2ICES 3RRQA 2W60B 4X80L 2NPLX 4K23L 3OL2A 4U6TA 1G9EA 2HT2D 3HPLA 3JUYA 3RIAF 2OX5A 1PLGL 3MBEA 5D1QB 1KIPA 1AGDB 2NY6B 4ZFGH 2GJ6B 3U0WH 1BLNB 2QJDA 4HWBL 3FZUD 5D2NA 5JOFA 4L4TE 4QRRB 4NWTL 1QRKA 3QFJE 1S78D 5GJTH 3PV6A 4MCZA 2E9BA 1OCWL 1ZV5A 4UTBL 4HX1B 4Y2OA 1WZLA 1CDJA 4DZBB 4OF5A 5IB4A 3O6FD 1I1AD 2HRPL 4I2XB 4FXKB 2AV7B 2D2OA 2F74B 4OM1L 4L9LA 5CKGA 4HEPG 1F6FB 5DI8B 2Q3AA 2WUCH 4ONOA 4HWEL 5EO9A 2HT3C 3EKCA 4ZNEA 3T0EA 1M71B 3LPGA 4NZTL 3IVKA 3W82A 4OZGA 5E2UH 1YPZA 5I75B 4NNPL 4YBHA 1H5BB 3GSNB 4XMPH 3B8YA 2YHGA 3S96A 2BVEA 4QRPE 4IMKC 3KXFA 3BKML 5C0EA 2GCYB 3SKMA 3BEWB 5E7BA 5GS1C 1OT1A 4CN6A 1J8HA 1G9NC 3HR5B 3LPFA 4FFWC 1IC5H 1PEWA 2QQLL 1ORSA 3X17A 3B9VA 3D1MC 2GJZA 1T1XB 2CMRL 5E2VH 2H1PH 2IPKA 5I8KH 2V2TA 4YDLC 4UAOB 1AO7B 1OAYH 3SKNB 1RVFL 4YX2L 1EHNA 5TDOB 5I9QC 1ZHKA 1YC8A 2DQFB 2JIXB 1D5IH 4HJGA 4X0KA 4U3XA 3HHRB 4NC1C 3S5LB 3W2DL 2XXMB 5C2UB 3PWLA 2NLJA 4XP4H 1FLTX 3KPQA 4U1SA 7CGTA 1JNLH 3MRPA 3ZKXB 5DMYA 2I5YL 4Z7WE 4RFEB 5E8OB 3T8XA 3U4EA 3THMH 1JCKA 3WUWB 5AWNL 2B5IC 2D03H 3TVMB 4HIIB 4K9EC 2D4DA 1F4WH 3KPTA 4UT9H 3TBTB 1R5WA 4H1LG 1NLDH 1INQB 1YUHB 3HI5H 2WQRA 1DE4A 2IG2L 5DUMH 4ONFH 4CW1B 4NC0B 3LKSB 4C58B 1KPVB 2IQ9L 3ARFA 4YGAB 1UACL 4N1EA 2WIIA 3WJJC 3H3PL 4JM2F 3O3AA 5JTWA 5FV2A 4QXUL 4YBLB 5H8DA 1N6QL 2M26A 4JJHA 1ES0A 1PQZB 3RX7A 1N8ZB 4JHWL 2YZ8A 4XC1L 3PP3K 5CGYD 3S34H 2BXYA 3V0VA 1QFOA 3VFWA 3C5ZA 5ITFA 3B5TA 3BAEL 3DJ9A 5INCA 3DMMB 2EZ0D 1BVLB 4GAYA 2N7AA 4ZNCD 1K8DA 4XBPA 4PJ8B 2XFXB 5JW4M 4E41A 3AB0B 4EI5D 2OCFD 3BFOA 2HVJB 4MS8D 2HJKB 1FZOA 4L5FL 2L4OA 3RA7L 4Y2DA 5C09A 1ZLVH 5FO7A 4F7MB 1RUMH 4NBYB 2WLZA 1IT9L 5GSRA 3IU3B 2ERJB 3PDDA 3C6SA 4ZXBD 5GZNC 2GK0A 1IBGH 1U8NB 1I1RA 1J0KA 3HFML 3HPJA 3BD5A 2VXQL 1PW3A 3CFDA 3GSRB 2OJEA 4LHUD 4JFOB 4KTYA 3D3VA 2V5MA 1D5MB 4M1CC 4ONGL 2BY1A 5KS9F 4HS6A 1T22B 5BS0A 5KSAB 4AH2A 3VG0H 2WWKT 1I7RA 1QVOA 2H41A 3IETB 5TQ0H 3QWRD 1Q0YL 2AEQL 2F8OA 1G0XA 1J5OH 1GXEA 1XGYL 1KB9J 1YEIH 4QXWA 1YJDL 4W70A 3PQYD 3GMQB 1HYSD 3ALWA 3B2UD 1QR1A 4FP8L 4Z7UB 5FGCB 5IVZB 5FOBB 5DFWH 1KCKA 2XA8L 1ZLSL 3T0BA 1JV5A 1RULH 4NC1E 3P2TA 3MRNB 4XPFL 5F97E 3GKZA 1EIBA 4UI2A 4XP9L 3G6JE 5TH2B 1W0WB 3L3GA 4PJXB 4CJ1A 5I74C 3OKDA 3HAEA 4XNUH 5DC4B 4NFDA 2FATH 1YN7B 1IGJB 3TJHC 5J0BA 3IDNB 2NW2A 4DVBA 3PWPB 3V5HB 5F7FA 2X09A 3PWJB 4X9GA 2E6QA 1SEQH 2LQRA 5D7SL 1MNUL 3V7MA 4OFYD 1KLUA 1MUJB 3PL6D 1KB5L 3KHQA 3QDJA 2CDEA 1XGUB 1BJ1H 3AU1A 4YXHL 3QQ3B 1CXEA 3QT2A 2YK1H 4NQXB 4JDZA 1L7TL 4OCSL 3U46A 4MAYB 4L4TB 5JIPA 1NCCH 3VU2A 3QFJB 2AEIT 3IU4H 5D2LA 3FB6B 2I60H 3PNWA 4MHHG 4X5XA 1UVQB 4LVNC 3QPXL 3O4LD 3HG1A 3G9AB 1E28A 2VZ1A 3MV9A 2VDKH 4NQSA 3QRFM 1AGEB 2AP2A 2OP4L 3ROOA 1NMBH 5L2KA 3IS0X 4OCYL 4PJ7B 2IADA 5LG1A 3LS4L 3SCMD 4LLQA 4P2QE 3GUTB 3QUZA 2ESVE 3CLEL 4ODTH 1LO2H 1FORL 4P57A 5JHLH 1FGVL 3SKJH 1JRHL 3O3BB 2E8ZA 1QR4A 4X9IA 1M7IB 4PRIA 3KPPA 4HFUH 4TSCH 3LQZB 4OGAC 5KVEL 2GTWB 5I18L 2X4UB 1HWHB 1A3RL 3PXJA 4HV8B 3O3UN 4QRPB 1ZOXA 1A6AA 2B2XL 3MUZ1 2Z31C 3SKUD 4ZAKC 2EE9A 3LKOB 4DAGH 3EW3B 2VLJD 1IEHA 4XXCC 3HC3H 1BFVH 2QLVB 1UQSB 1BFSA 3GKWH 4FFVD 4JFDE 1AD9A 4ZMAT 1GOHA 2R1YB 1R3JB 1A14H 1NCDH 3HAEH 1P53A 5DD1H 1BEYH 2FX8H 4RQQA 2ICEA 4HAFA 2X7LB 2UY6A 5C9JB 3B3IB 4NKDB 1MJ7L 4E5XB 3MSPA 1WBXB 3RIFF 1EMTL 3O9WD 4Z7VA 4K7FA 1WVZA 3DUUB 3WFDL 3ULUC 4X7CC 2GUOB 5KZCB 4Z7WB 4O5LL 2WWKO 4GRWF 4MVBD 3T3ME 2IPTH 1T20A 1OWWA 3M1BA 2P8LA 5EFIA 1OP3H 4RWHA 1SJVA 2NR6D 3QR2A 5SWZB 1G7IB 2ADFL 4LRNH 2F54E 3RTQC 2V2WB 4LFHD 1CD1A 3VH8A 3NCCB 4NYLA 2C4FT 4AG4L 1KB9K 1D3CA 2XKSA 3MV01 4N68A 2FHCA 3PJSB 4IDLA 5EBMB 3FFCB 5EBGA 1HHHA 2V5YA 2Q76B 2R0ZH 1SY6L 4LPWA 5F3BB 1K8IB 1N7MH 3QYCA 5L8KB 4FZEH 1N0XL 1J0IA 3DSFL 3DSNA 4UQ3A 4IS6B 1ZVSB 4K3EH 4P9HL 1MFDH 4GRMA 3TYGH 3RWCB 4UDTA 1Y18A 1WAAE 4LF3A 4YNYB 2W1NA 5BRZA 1EDQA 3L3IB 2UUDH 3NIDE 2R0LL 5DEFB 2BVOB 5CJOL 5C09D 2JJUA 4BSVB 4W4NA 2ID5A 2VDPL 3TJEL 1CT8B 3L7EB 4NM4L 1FL3A 5L6YL 5FUOH 4XPGL 4JPKH 1WJ3A 4OIBA 1MLBB 4NBZB 4LAQH 2WZPD 4GRLD 1GGCH 4QKXB 5LVEA 3EYSL 5H35B 1CWVA 2HFEB 5LWYH 4ZOEA 3G6AB 1C16A 5F70A 4C59B 1CXIA 5E70A 3IFPB 4WU5B 3RNKB 4TTDC 1JYWA 3OV6A 1F3DJ 5EUOA 1RV6X 4HIEB 2BSRB 3MBXH 4NRZA 5IROA 4RGMC 25C8H 2ARWA 4WWKA 5FKPB 5GS1B 4YK4C 4DN3L 1V7ML 2F5AH 3ET9F 4X7TA 1B0WA 5EN2A 4JO3L 4LMQI 4XVTH 2VNCA 4YDLB 1KTLA 3QUKA 3B9KC 5EC1B 3VDCA 2P5EA 4LCCA 5I9QB 4M5YL 5HDBE 4MJID 2EE3A 3VFMB 4OD2B 4P5MB 1I3GL 1TCRB 2FJFA 2R9HD 2AQ3A 2VKWA 3G6JB 5HDQH 3ULUE 2C4XA 4H88L 3DX8B 1FCGA 1K2DA 3VFVB 5KTEH 1RUPL 3CH1A 3OJVC 5DD0L 1EXUB 2Y7QA 4OGYH 1ODAA 1KLGB 5L2KD 3H3BC 2FBJH 3SDDB 2QQKL 5ERWB 3W9DA 1UB6B 2O61A 2GK2A 3MV8A 1YEDA 4Y16C 4RISH 3IFNL 4HUVB 1JYVA 3GO1L 2PKDA 1A47A 5CZKA 4HXBH 2FZ3B 4JDTL 3VFOA 1JWUB 3QIUD 2DQCH 5BO1L 1OAKL 5K59E 2VUYA 1F13A 4NQEE 5CINH 4P2QB 3MLZH 3FQXA 3NBNA 3DGGB 2ESVB 4U6YB 4BQ6A 1T1ZA 1AQDA 4YFLF 2VLRA 2NTFA 4OT1H 4CVZB 4Z5RB 1IGFL 5TQ2L 5I0DA 3SN6N 4UV4H 4KJWC 1A8JH 1EH9A 4RCAA 2EECA 4QNPE 4HQQH 4XPTL 5FB8B 4PRBA 4V2BA 1F90H 4QHMB 2Z8SA 5AUMB 5JHDA 4K7PY 5FA3B 3L3KB 5JXEA 1W72L 1WZMA 4ISVB 4N0RA 2J8OA 3QQ4B 4TNWF 3QUMA 2CR3A 4OIIL 5EPMA 3RDTD 1N64H 4OKDA 1JZ3A 1P4BL 2VDNH 3UMTA 4MHHI 3BMVA 5HD8D 4B5EA 4OZGF 4WFHD 4N90D 5GGUB 1T03L 4N0FB 4UOW0 2BVUA 4M6OH 1AY1L 3O8XA 2R69H 5JQ6L 4P9ML 1DQJB 1QBBA 5F9OL 4GXUN 1FFPB 5EORH 4OZIA 5D9SB 3V6OC 1G7LA 4NQCD 1CDBA 4GQ9H 3TT1H 4NHUA 4LL9A 5D1QA 1Z5LB 5JLZB 1AGDA 1B2WL 3KYAA 1W2KT 1BLNA 5DWUL 2JK5A 3P0GB 2IPUG 4QRRA 4OCXH 4GW1A 5HYSB 2F54B 2G60L 2J7LA 4MQSB 1OGAD 2JCCA 3C2SA 3ZO0A 2W0FA 5CD3B 2B1AH 3RBSA 1HOCB 2E7MA 4U3HA 5I16B 3N1FC 5I74B 1NGPH 4HBCL 4JGJA 5E00B 3EOTH 1K4CB 4DZBA 3QXAB 5KVMC 5DJ6B 5FM5M 4JN1L 5DJXB 4I2XA 5CBEA 2AV7A 2F74A 3TCXA 4LRIA 5DI8A 1LO5A 1LDPH 4QXGL 1IL1B 2I27N 3IFLL 1A6WL 2DQIH 2UZYB 4ODVH 4O9HH 1R3LB 3TCLB 4G5ZL 4P48A 1LNUB 5I1EH 3JWDH 3LV3B 1HKLL 4Y5XB 3JV5A 1ZXQA 2H8PB 5ESQA 1BQUA 4PJ9C 1N2RA 4JM4H 4M7KL 1H5BA 3GSNA 4LVNB 2NX5E 3SGJC 3LIZH 3G08A 4FQ1L 3QUMH 4LDOB 4OZFB 4KY1H 2CRZA 4L8DA 4ZO8A 3BPCB 4LNVA 3BEWA 5HHVL 3GSVB 3C5SB 3FMGH 3HR5A 1DL7L 2HLFD 4PGBA 4MQ7B 3QO1B 1T1XA 5DK0A 3S35L 4ETQB 2WK2A 3G5YB 1XF1A 1AO7A 1S7UB 2A73A 2FH6A 3VFRB 1X5FA 2N7BA 5TDOA 2DQFA 4YHIA 4TOYL 1YEGL 2APTA 1TZGL 2HJFA 3LEYL 1CGTA 3S5LA 5IT2H 2P5ED 5CUSH 1IKNA 4K71B 3OAZH 5JIIA 4KTDH 2Z31B 4RFEA 1SJEA 5E8OA 1CFQB 5EDXA 5K9QG 1CFVH 4JANB 3WUWA 1KFAL 2XNAB 1RMFH 3TVMA 4HIIA 5C6PB 1C08A 5ANMA 1V05A 4L4VE 5IBLC 4WUUD 3TBTA 2BVYA 3BX7C 1YUHA 4OV5B 4JRXE 3ILQD 1QRNA 4X7DC 3VD3A 3K2MC 1R5VB 4MD0B 2ZOKB 1IVLA 3NA4A 3MRIB 5F88A 4L29A 4CW1A 1OP5H 4FQ2L 1UKQA 1L7IH 4XNMA 3U36B 5GRVL 2FX9L 1DQTA 2DQJL 3V6OE 3ARBD 4W6XB 5I73C 1L4IA 4RAUB 3Q1SL 1AH1A 3LS5L 5D7KE 5GJSH 3WHXB 5LQBL 2YSSA 4MQXC 4XT1C 1DEEB 4KKLD 4P5TD 4RDQF 3GSNH 1PQZA 2XZAH 4YHNB 3I6GB 1N8ZA 5GS0H 3BP5A 3RTQB 1T3FA 2DQUH 4HPYH 1CVSC 2EH7H 2FNBA 3LD8C 4FQJH 4YHZL 1BD2B 5J57B 4PV9B 2BC4A 4LARL 1UB5A 4PG9B 5FA4B 3DMMA 3VFGH 1BVLA 3OKEB 2H9GB 4PJ8A 3CFBB 4P23D 2XFXA 1K4DA 1A6ZB 3O11B 5D7JD 5ETUA 3GHBH 2HVJA 4O2CB 3EZJB 4PJDA 5JXED 2HJKA 4NQEB 3P9LB 3LKRB 2CKBB 4PS4L 4KTEH 5TPWL 2R1XB 1JI1A 5GRXG 1S8DA 3QHFH 3LKNB 3SE4A 4F15C 2F8VA 1F4YL 1U8NA 1WCBB 2WINA 1ZHBB 2UYLB 2D0HA 1D5MA 1RZJL 4K3JH 2FEDD 1T22A 5KSAA 1C5DA 5ISZE 1IAOB 2PW2B 1AGFA 1YY9C 5JORB 5C0CA 2EE6A 1OY3B 1MAML 1G7QB 4Z7UA 3GFUA 5IVZA 2NY6D 4NKIH 2GJ6D 2G2RA 3GBML 3MRNA 3OB0H 4QRRD 2H6PA 1KIQA 2PR4H 1W0VB 4YXKH 4RGMB 4KK8C 4XNXL 3SGDI 3TEUA 1JGDA 2BSTB 5HHQA 2A6KB 3IDNA 4OTXH 2Z91A 4OD3H 4YK4B 4APQC 3KPSE 3PWPA 3PWJA 4POZD 4WCYL 2CK2A 3EHBD 4XAKD 1MUJA 4J1UB 4ELKB 4M1GL 4R7DB 4FABL 5B8CA 3QQ3A 3B9KB 3F7QA 2DKSA 2Y06H 1X5HA 4MAYA 4ZDHB 5EU4B 5T3ZE 3VXUA 2HFTA 2QQQA 4K3DH 1PSKL 5D70H 3FB6A 5GRVK 3CCHB 3V0AC 1UKSA 2VISB 4F9LA 4XPHL 4Y1AE 4ZFZB 4Z7VF 4OFKA 3ULSB 4WHTB 5GS0D 1NSNL 2V7HA 4JY5H 4PJ7A 2SEBB 4FFYH 3EFFA 3GUTA 1I9JL 1YEEH 4GMTL 1VFOA 4QRTB 4TUKL 3O3BA 1CU4H 3E6HA 5ICXA 1ZHLB 2O5ZL 4TULL 3KR3L 5C3TA 1M7IA 4K94C 4MAUL 4Y16B 5CD5C 2NY4C 5D1XC 5I66A 4RA0C 2GTWA 3OMZA 4YHLL 2KH2B 1AO7D 4ERSH 5GGRA 1KJ3L