5DR5H

Crystal structure of the sclerostin-neutralizing fab abd09097
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
224
structure length
224
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFTNYYMHWVRQAPGKGLEWVSTIAYDGSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARWFTDDIWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEFLVPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AbD09097 Fab heavy chain
publication title Generation and Affinity Maturation of Neutralizing Anti-Sclerostin Antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2015-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dr5H01
1ACYH 4L8DB 3BGFC 1FIGL 4M1DL 4RIRA 1D9KB 4HKBB 5ACMA 3CFBB 3MRLA 2WBJB 5IMOA 1DE4A 1FL5A 3RIAF 3LAFA 1MLBA 1LNUB 3S3PA 3ZE2E 4G9DB 4K94C 5JIKA 3PNWA 3VWKC 3S8WA 3CK0H 4AIZA 3VJ6B 1MEXL 1QFWI 5K9OA 4Z7QF 1CU4L 3QULA 2B1AL 5J6HB 2XZQH 4XBEH 2NY4C 3TBVB 4ZD3H 3SDXA 3VXTB 1E4WL 4TNWF 1JGUH 1CFNA 2BVQB 1DBKL 1JMZA 4PJ9D 3LRHA 1MFDL 4QO1A 4RZCB 4XMLH 4OGYL 4BFBD 1ZHNA 4S1QH 5L6YH 4RWHA 3LN9A 4XNUH 3ZE1E 4YFLF 3H8NA 1UWXH 4P9HC 5IESL 2AERT 3U7YL 4I77H 3OKNA 4HQQH 1KJ2H 4JCLA 1T1XB 2GT9B 3ALWA 2KDGA 3O3EB 4XVJH 3REVA 1I9IH 5LAXB 4DJMA 1FPTL 2IADA 1FE8L 1VADB 1NL0H 2NTFA 2WIIB 3HZKB 1B88A 4YXLL 1YMMB 2CRIA 2IBZX 1QA9A 1CICA 1RFDH 1NSNL 2WQRA 2ZKHH 3VGAC 1S5HB 2WLYA 3O3BA 1TETL 3EKCA 2CR3A 5JIIA 3LKQA 1U41A 3KYOB 5GGUA 3PE9A 3INUL 5JO5A 2W65A 3F7RA 1MREH 3TC9A 1JF1B 1KC5L 1JK8B 3HE7A 4XCEB 1V5JA 3QH3A 4P59H 2BSSA 3BZ4A 5IR1B 4U6XA 1MAJA 3T4AA 3TIEA 4LSVH 1TQCC 4YHOL 4GG6E 2A6KB 1F97A 2DQJH 4WI9A 2F53A 8CGTA 2FEDC 5LCVL 4IOFD 5C92A 4YIQA 1YN7B 3IVKA 5C0AD 1CT8B 1TCRA 1YECH 4GRMA 2WUBH 4NCC2 1BQLH 2X4RA 1EFXA 4LSTH 3RIFF 4AIOA 1N5AA 2EO9A 1BVKB 4LLQA 4BKLB 2GY7B 2I07A 3H3BC 4NCC1 4U6HA 4AEEA 5I0DA 4Y4FD 3GMLB 4AMKL 4WU7B 3QHTC 4JPIA 5JMRA 3PL6B 1PZ5A 4LKCB 1AKJD 5KSAB 4P46A 3LKOA 3GSNA 3KJ4C 3AMLA 1MQ8A 1X4XA 4JJHA 2I9TB 5CJOH 4QRUA 1S7QA 3FMGL 4RBPK 1T0NB 3QUZD 1U6AH 1AP2A 1YEKH 4MAUH 1E4XH 4JFXA 1FSKC 3VWJA 1DEEA 3D69B 5DUMH 5LBSL 2Z31D 1FNSL 5DGQA 5TQ0L 5HGBA 1K3ZA 3U83A 5D4QA 3R06A 3S36X 3PWNA 5C0GA 4EN3D 5FOBB 2AJXL 3GSRA 4WUUD 4KKCD 4K8RD 4WEBH 1KG0A 4WFFE 2EDTA 2KQMA 1QBBA 3BKCH 4M02A 3HPLA 3I02B 4QCIB 1I3GH 2GTWB 3BE1H 3CVIH 3DROB 3VD4A 1FLRL 3QJFB 3LMJL 4OSUH 3F62A 4KVNH 4YZFE 25C8L 2YPKB 3GM8A 2RFXA 3RVWD 1U8HA 1Q38A 2HT2D 3OF6D 3H9YA 2VLKE 2XG5A 1YEFH 2R1WA 4P4KD 4JY5L 3LSOA 3Q3GA 4UB0H 1XZ0A 5KOVC 1AO7D 4ZTPH 2HH0H 4GAJL 2C1OA 1NC2A 2GUOB 1T2XA 4ELMB 2MOVA 2BHUA 3SDCB 2NPLX 1M7XA 4KTYA 5IW1A 4PV9A 4PP2B 5FV1L 4XMPH 2CD0A 3GK8L 3H9ZA 4L4TE 3KJ6H 1KGCD 1FYTB 2CK2A 4Q97A 1Z9OA 3D85B 4LCYA 4LQFH 4MMXC 4L3CB 1NGZA 5DO2D 1T4KA 4Z7QE 2BC4B 3TF7C 4TOYL 4F7CB 1XF2A 5JLZB 2IH1B 2DN7A 5DUPL 3FRUB 2DJ4A 4Z18A 1WEJH 4UTAL 2GSIA 1QFWH 2J2ZA 4X7SL 2Z93B 3I75A 4HWZA 3RZCC 4G8GE 1C12B 4MNQB 3RWJA 3QB7C 1ZLSL 5EU6D 1DDHB 1KCVH 3PGFH 3GNML 1LD9A 3G04A 1UJ3C 1ZXQA 3C5SB 1NAML 1W0WA 4XPTL 4X6FB 1UZ6F 3KPQB 1S7TB 4K71B 3QNZB 4KJQD 3GKWH 5IOPB 3P2TA 3RHWF 2N7AA 4XPHL 4XP4H 3KPOA 2AEIT 3O9WD 4FMFA 3UEZA 5MEND 5JZ7C 3WNMA 4RNRA 1QO3A 2EH8L 2D0FA 4XCCL 1L7TL 2YHGA 2JLLA 2PW1B 4Y4KB 1G7LB 1WBYA 1ORSB 7FABL 1FZMB 4UQ3A 4PJ9A 4ZDHA 3NBNA 2VWEC 4ONHA 2Q6WA 3Q0HA 4IRSC 2HFFA 4JDTH 1XIWD 2FX9L 3VXRB 1NKOA 1CVSC 3UYPA 4MCYA 5BS0E 5I73C 5E8PB 4ZFZA 1A7QL 4JY6A 1XGQB 4QF1A 2FX7H 3VXSD 5C08E 1F6AB 5DWUH 3QZWG 5MERA 2GK0A 3I6GA 5JOEA 1AGEB 5C0CE 3E6FB 3BX7C 4KVCH 2V5RA 3DUUA 4OZGA 1GAFL 4AM0B 4WRLA 2NY4D 4OB5L 1JWSB 5I71C 3O4OC 1YMHB 3BN3B 4FS0A 5DJDB 5EWIH 4N0FA 1P9MC 2EXWD 3EFFA 2ZUQB 3H9HA 5MEQB 4OZFH 4LCIH 3VCLB 1VFBB 1NGPL 2C7UB 1ZAGA 3QUKA 1GHFH 1KXTB 4XI5D 5E2UH 4GKZA 3GSQA 5DD5H 3QIUC 1DCLA 3HS0B 5HYJE 1DQMH 5D7JC 1OD9A 5CINH 2AW2A 2EH7H 4G6AD 1BBDL 1PX3A 1YPZE 5DLMH 4XC3H 5C07D 5C0AA 1OP5H 3VG9B 4MA8L 2CO6B 1A3QA 3KYMA 3SKNB 2IC2A 3BKYL 3S9DB 3GJFA 3OPZH 1QUNA 1CDUA 1IEBA 4MJ6A 5EDXA 1DVFC 3EYOB 3UO1L 4L8BB 15C8H 4Y4FA 1OTTC 3EOAB 4UNUA 2WBWB 3L95A 3G5YB 1AKJA 2G2RB 4ZODA 5J56B 5FHBH 1JYNA 4Z6AT 3U9UB 5DZNA 5A2JH 1UYWL 4TQEL 2XICA 2QADD 1T21A 5IHBA 1LP9A 3QUZA 3OXRA 3V6ZB 3RDTB 4MJ2A 1S3KH 1SM3H 5D72H 4C4KO 1BECA 4R4BA 2Z31A 3B2VL 3FN3A 3C6SB 4HHAB 1SJXA 2Y6SC 5HHPA 3DYOA 1AQKL 4AEHL 1DBJH 1AR1D 1N7MH 1ACYL 4EN3A 1L6XA 2NXYD 2AABH 2VUOA 3PHOB 4W4NA 4WUUA 3WEXB 5EFIA 1EH9A 3RTQC 1LMKA 2HJKB 4P57A 4YHKH 4RRPG 1ZHKA 4Y16B 4C54A 4ISVB 4PJ8C 5I2IB 4HZLB 2CRZA 3KDMA 1G7PB 3CK0L 3NCEB 5DMKA 3BQUD 2X70A 3VFTB 2XZQL 2NW3A 3CVHH 3G6JF 3X13A 2FB4H 4KTDH 4PP1C 3C60B 3OF6A 4NHUB 3DVNA 3O3AA 3SCMC 4I3RH 4L9LA 5ISZB 4P4KA 3GEWB 2VQ1B 1VFOA 1JGUL 1NMAH 1X5LA 5DK0B 4AENA 3MV01 1NGXA 1AO7A 1KSRA 1ZA6A 3VXPB 4OZIF 1Q9KA 4YBHA 4NQVA 4XMLL 3RKDC 4RA0C 4S1QL 5L6YL 4G80A 4XNUL 4HV8A 3C5JA 1UZ6E 4I77L 1RZ8B 5CP3H 1A6TA 3BPLB 1KJ2L 4HQQL 1XF4B 3U0PB 5I1DB 4Q7DA 4YHLH 3QBTB 4XVJL 1I9IL 3GSWB 4YO0A 5KVDH 5HHME 5CIPH 1NKRA 3OKEA 1NL0L 2XFXB 1IM3B 2EC9T 2A6JA 4YHNA 2GFBA 2CMRH 2V5YA 5HVHC 1RFDL 4XBGB 2P8PB 5EU6A 3EIFA 2EECA 2ZKHL 2Q76B 4NNYA 4KUCD 3KPTA 5I1EH 2W9LA 3MUGB 1I1CA 2M26A 2CDGB 3VXNB 3TEUA 5I9QB 1MREL 5J11B 2Y4SA 4R8WL 1FHGA 3HI6H 1DTUA 4P59L 3DPBA 5GS0C 2VLKB 2VSCA 5ETUB 3W81A 4LSVL 3EGSA 3HTLX 3GJEB 3NN8A 2DQJL 3EOTH 5E2WH 2DKUA 4PRBA 5JIPA 3O9WA 2X4QB 4Y8DC 1HSBB 3UROR 5MENA 3V4UL 1KCSH 3RGVB 3ZDYF 3S88H 1PZUB 1WFNA 4JG1H 5IHLB 2JJWA 1HI6A 4I2XA 2WUBL 5F21B 4ZUWB 1BQLL 2X4OA 3ULVD 3O45B 5C2UB 1XIWA 3EYVB 3A6CH 5F72S 2GITB 5IJKC 3MGOB 5K93A 5C0JA 3WSQH 1E4KA 2EDEA 1KIRA 1MRDH 5DVKA 2VZ3A 2WBKA 1R5VA 3VXSA 4QRPD 5C1MB 1C1EH 1FZOB 2R56H 4NFBA 1XF3B 5I17B 1F4YH 5L2KE 5FEBA 5IIEB 3C08H 3BKMH 5CJOL 4WHYH 3BKJH 4UV7H 4JFEE 2QL1A 4NHCL 1CR9H 1YEKL 4MAUL 1E4XL 3P9MB 4HDIB 5DUML 3V6OA 5C3LD 1Z9SA 1XR9B 3RVVC 2D0GA 2YD7A 5EZLA 2XQYK 4HIJB 1U8JA 4PB9H 3MLYH 1FNHA 4ZFFA 3BRFA 3QO0A 1AGCB 4OFIA 3KNBB 4FXLA 4BM7A 4PS4H 5E6YA 5HHXL 3BKCL 5FM8A 3VFVA 5GS1C 1II4E 1MVFA 1EX0A 3MNZA 3G5ZB 4U1MA 2J1KA 3BE1L 3CVIL 5C07A 4APQC 1ZGLP 4FTVE 4QY8B 4LFHD 3ZTNH 4OSUL 4KVNL 5F7FA 5F96L 4U4BA 1BZQK 4JFYB 5C08B 3MNWA 2ZUYA 1U58B 1YEFL 1Q0XL 4UB0L 4F80A 2I24N 4NO0B 1PQZB 4JFHE 1X5HA 2DKMA 1CCZA 3V52H 2EIZB 3H0TB 1TLKA 1IQWL 1KJMA 4ONGH 3EHBD 4P3WA 4XMPL 2NY2D 3ECBA 2VXSH 4MCZB 4XZUB 1B6DA 3KJ6L 5EU5A 5JOPE 4HC1A 4YC2C 1H3TA 1OP3K 4DK3A 1S5IH 3MRPA 4I0PB 3GRWA 1BQUA 2FZ3B 4JLRB 1L0YA 3O2WH 4WTWA 4G6FB 1WEJL 5DSCA 1QFWL 1JE6A 3LV3B 4MDJA 3T0ED 3ZKND 3BSZH 3WKMH 3RWGA 1BM3H 1HOCB 4OZIE 3PGFL 1CI5A 1BZ9B 2C3VA 3T8XB 3ZKXB 1QOKA 3P0YL 4M1CD 3H3PL 2Z35A 1NFDF 4K94H 2XA8H 4XAKD 5SWQA 2A9MH 1BVZA 2FJFB 3IDJB 5CD5D 3GKWL 2JB5H 1OP9A 3BQUA 2X1QA 5DQDH 2V5SA 4XP4L 2A74A 2X42A 5EBWA 5F7UA 4FP8H 5CWSB 3E3QC 1I8KA 3QDJE 4M93C 3ZDXE 1B0GA 4HXAL 3O8XD 1B9ZA 2XTJD 1IC1A 3TBYB 2VTFA 5J0BA 1PAMA 3ARDB 4G8FA 5KZCB 5CJXC 3CFDA 1MCNA 2HRPH 4JDTL 5E8OA 3QCTH 4S1SH 4PD4K 4P9HH 4PLNC 2AXFA 5DRZA 3QDGE 4NT6A 1BVLA 5FO8A 5CIPB 3PQYE 5GZOD 4M8QB 5DJAB 1ZT1B 2FX7L 1F58L 5DWUL 4P5KB 3K4ZA 5C0RH 1C16B 3VFUA 2GCYA 2BJMH 2ADGB 4HS3B 3FB7B 4I3SH 5FDWB 3ZDYE 3FCTA 1S7SB 2UYLA 5DUBB 5IROA 4PP1D 4MQXC 5I1IH 2HKHH 1XGRB 4JDZA 5EWIL 2NZIA 4NZUH 5FCUH 4J3XA 5DXWA 5F7WC 4M7JH 2AXGB 4LCIL 3GB7A 4R2GB 4PJFF 2VZOA 4YWGL 1GHFL 3LRGA 5E2UL 1C8PA 5DD5L 5JIHA 3MMEB 1DQML 5CINL 5D7LE 2P8LA 2EH7L 4YX2H 4QT5A 4HFWB 5CGTA 1OB1B 3F6IA 3MRKB 5DLML 3TGXA 3UX9B 1I75A 1CFSA 2WUCL 1R5IA 4B50A 3ARVA 3P11L 5E0QA 4JANA 1RHFA 3OPZL 5T33H 1DL7H 3RUGA 15C8L 4J6RH 1YNTA 5I74B 3WIHA 3MGAA 5IMMB 4JM2C 5FHAL 1UH4A 4QRPA 2XWJA 3BGAA 3W11C 4HKJA 1D5BA 5TDOA 5BOZG 4X5XB 1P4LA 3O6FC 4XNMB 1KTKE 3BP5A 1U8OA 5DT1H 2C3WA 2X10A 3D5OF 1QHOA 4DQOH 2AJ3A 3L3HA 4U0RB 5BVJA 2FWOA 1AHWB 2DAVA 1WJ3A 4FG6D 5EC1B 3LB6C 3KLSA 3X14B 4TRPH 3FN0H 5I6XC 1DBJL 2UUDK 1N7ML 4Z77A 4H1LG 4IRSA 3TVMD 4P23C 4LHUD 4YR6B 1KIUA 3ESUF 3L7FB 1H15A 2CIKB 1Q9WB 4LCUB 4YHKL 5FGSA 2H3NB 4OD1H 2OP4H 3IDUA 2UZYB 4JRYE 4U3XA 3OAYH 3S4SB 3N1MC 4AT6A 1XH3B 4ZOBA 1CDJA 3OGOE 5FYKH 3AROA 4X0KB 3MCG1 1C5CH 3P0VH 2YZ1A 1VPOH 2FB4L 1BFSA 4KTDL 4X9GA 1TJIH 4XXCA 3IJYA 2NY7H 4I3RL 5EUOA 5GZND 1HQRB 1NMAL 3V6FB 1SY6H 2BK8A 5EUKB 5L2KB 3OG6B 4OM1H 2YPLD 3MV11 4JFEB 4NKDA 3K74B 1A6ZB 1S7VB 5EORH 1NFDE 4BH7B 2CUHA 4QOKD 1N5YH 1P53A 1ND0B 5DHYB 3ARGC 1K5NB 2LVCA 4GW4B 4YHLL 3BVNB 2R23B 1XR8A 2F74A 4WV1B 3CZFA 5KVDL 1AD9A 1ZT4A 1WIOA 2L7JA 4Z95H 2VE6A 3FRPG 5CKGA 5CP7A 5F71A 3AC0A 2XKNA 4CN4A 2NY0B 3T0EA 2CMRL 4UU9A 3O2DA 4NSKA 3IS1X 3WL9A 2WWKT 4UT9H 2IQAA 2Z8RA 3JV4A 4FTVB 1AIFA 5KN5B 2ENYA 2PYFA 5I1EL 4RMWA 4PJBF 1U8NB 1TZHB 4ZUTA 3STLA 2AGJH 2YBRB 3UBXG 4NQCE 2YEZB 1T20A 5D1ZD 4EIZC 1HH9A 5ITFA 1FO0H 3MRCA 3HI6L 4LLDA 2EXYC 5BMFL 4WNQA 3RX8A 4K3EH 2V17H 2RAMA 1JV5A 1NFIA 4PR5A 3QUXD 4GAFB 3EOTL 5E2WL 12E8H 4TVSa 3WJJC 5GGVL 3ZL4H 1AGFA 1TVBA 3T65B 4MYWB 1KCSL 3S88L 1INQB 4DVRH 4PJ5E 4C56B 1I1FA 3VFPB 3O8XA 3GSOB 3ZHKA 4HWEL 4D0CB 2OMNA 3MA9H 4Y5YA 1S78C 5C0FB 3U4AA 2BHZA 5GRWA 4GBXC 1Z3GH 2AV1B 2OTWB 2V2XB 4Z7WA 2BNUB 3G6JB 3WSQL 1IMHC 1LGVA 1LWRA 4X98B 5M95B 3IDGB 4NRZB 1OD7A 3K8MA 3FFCE 4AL8H 4AQOA 3RL1A 4X5LA 2YKLH 4F7TB 4PJFE 2FHFA 4HWBH 1C1EL 1NGWA 4D9LH 4EUPG 2R56L 3RY5A 1JNLH 3ROLA 4HLZG 1CFQA 1E28A 4OZIB 2VABB 4L8CA 1IGFH 3BKML 4EIGB 5AZ2H 3BKJL 1OSZB 43C9A 5J9PA 4UV7L 1QLRB 2P5WE 2G60H 3G5VA 4NO5A 4U1LB 5IEKB 5GSVB 3OR7B 1OF2A 2GSGB 1A1NB 3C8KA 5SWZD 4KMQA 1LVEA 4DFHA 2DS4A 4NJ9H 5I8KH 3AMKA 3DRTA 3IDMA 1A4KA 1S7UB 2CPCA 3WFDH 4FQ2H 3MRNA 1P5UA 4MXWH 1UCBH 4PB9L 2AKRA 4S1DD 3QDJB 1N64H 1CS6A 2DKSA 1KXVC 5I1KH 1G6RH 4HEME 4PS4L 4KH2A 3PP4H 3OR6B 4FABH 2AQ3A 2O5ZH 1CDIA 2AJYH 3B3IA 3MOAH 3NIDE 4QRTB 2CKNA 2NR6D 1S9WA 1CF8H 1R3IH 4JHZA 3RPIA 3BISA 2W0KA 4PREA 1WTGT 2A38A 3IRZA 2VL5B 4RAVB 5H2BA 3VRJA 1LHZA 3NACL 3AU1B 4MQXD 3RJQB 2CJUH 1XGTB 4CVUA 1FFQA 4W70A 1IGJB 4N1CA 1MCJA 2XT1B 2CXKA 4OCWH 2P42B 4HLJA 5BV7H 3HC0B 3SE4A 4KY1H 5DJCB 4FFYL 3V52L 1H3PL 4JPKH 3DGGB 4KJWC 1XGYH 4ONGL 1RUKH 4PGDA 5JPNB 3WO4B 4LDLB 3MBEB 2VXSL 5HHOD 1KPVA 5E7FA 5BJTB 4JKWA 5IB4A 3GMPB 3UBXB 1S5IL 4Q74A 1IGTB 3U82B 4ESKA 3AFLA 4HSQA 1NEZG 2B8OT 4GT7A 3UPAA 4DCQB 4PTUB 2N4IA 1W2KT 1JYVA 2DM7A 3I50H 4EI6A 1NEUA 3O11A 3GMQB 3EOBA 1NGYA 3OKMA 3AREC 3TVMA 5HSFA 4LHUA 3RWFB 1QD0A 3UTZA 3BSZL 4FOMA 5T3ZH 1BM3L 1UKSA 1MJ8H 5F8RC 3DO7B 1C08A 1JWUA 1I9JL 5JPMB 5B38G 4ODVH 1URLA 4K94L 4CUCA 2GEEA 3MROA 5EBLA 3W39A 1SJHB 3F7VB 5EBMB 2A9ML 5D7IA 4E41D 2JB5L 4R0LC 4Q6IB 3IJSA 4X7TB 5DQDL 3N1PC 3OXSA 3OZ9H 4FP8L 4JY4A 3T0VA 3FB5B 3NZ8A 3WFHA 2YD9A 3CX5K 3P73A 2R0ZH 4F3FB 3ULUF 2I26N 3U1SH 5FGCE 1I3RA 4X99B 2C1PB 2ZZUT 4XNYL 3RY6C 1UVQA 5FA3A 4HIXH 1W72A 2YPLA 2ESVD 3KPSE 3BW9A 3ZT5A 4P23D 2HRPL 4PJBE 3QCTL 4S1SL 4PRPD 1JGEB 4XNXH 2IH3B 4QOKA 3SGKC 5F7DA 5KSUB 2YUVA 1HHKB 4O4YH 4O2CB 2BOBB 1ADQA 1SJEB 4N8VA 1H0DB 1FZJB 1AXIB 2A6IA 4EBQH 1JPFB 4X4MA 5GS1A 1A8JH 1NLBH 2BNQD 4MNHA 3U30C 2EYTB 3CFCL 4Z8FH 5C0RL 1W8OA 4RCAA 3FT3B 4PFEA 2BJML 4LPXA 5IBTH 4KRPC 4I3SL 4R7DA 4HIIB 4JN2A 1A4JB 1ZGLA 4GG8B 1OAKH 1FFOB 1QFUH 4JJ5A 5I1IL 2HKHL 1FO0B 4YDJA 4BQ6A 1PKQA 3U36B 4JFDD 2NCMA 4NZUL 1IAKA 4X8JB 3SDAD 3BD3A 4HZAA 5EC2A 3WN5B 4X6DB 4BQCA 4QRSA 5D1ZA 5A16A 4M7JL 4RFOL 5AZEH 5FGBA 4DUXA 5B3JF 1BD2E 3W9DB 5ADPH 4L4VB 3QUXA 2OK0L 4GOSA 3VFNB 2L7UA 1D5ZA 4ZXBD 5F89A 3VXOA 4OLWH 1QKZL 3DX8A 1T22B 4YX2L 4TVPE 1HN1A 1WCBB 4X7DC 3DRQA 2ZOKB 3D18B 1M6OA 4Q2ZB 1RSFA 2ZUUA 4I13B 4MQ7A 4NFDA 4OIIH 4CNIB 5C0NC 5T33L 3G6AA 5T3XE 1DL7L 4XGZB 4JO4L 5FKPB 3IB4A 4BQ9A 4J6RL 3PDDA 5LXGH 2FR4B 3MRBA 1ZSDA 3WS3B 1NBVH 3KLAA 3ARZA 3B8SA 4F7MA 4MA1B 2NY1B 1TZIB 5B38B 2MSPA 4Y5XC 4PRID 4DQOL 5A43C 3LH2L 5A1AA 2XIDA 5KVFH 1IM9B 3MLSH 3QIWC 3PWLA 4NWUH 1U8KB 3QEHA 4MXVF 5SWZA 3FQTB 1SYVA 3MLZH 2WMPA 2D7OA 2Y36H 2Y7QB 4OJFL 4ELKB 1G6RB 3LD8C 4H8WH 4NUJA 2DIBA 5CEYA 5HJ3A 3KYNA 4NKOA 5D2LA 4DFIA 3WDHA 4RGND 5SX4I 3BFOA 4PJ5B 3VD9A 4XXDA 1FGVL 1WBZB 2Q7YB 1QFWM 4OD1L 3OWEA 2OP4L 4HUNB 2H2SD 3OTTA 5T1LB 4P9MH 1OAZH 4PTTA 2XXMB 5ESAB 4R7NA 1DP0A 3QXDA 4HGWB 4L4JA 3I2CH 1B4JH 1C5CL 3SGDI 3KXFB 3OAUH 4AZ8A 2BVOA 1G0YR 1T1WA 3FFCB 5BV7B 5E94B 1X9QA 1TJIL 2DF3A 2HMIC 4ALAH 2X4UA 1EEYA 2NY7L 3S5LA 1SY6L 1I9RH 4RFNB 5H35B 4OM1L 4X7FC 3CC5A 3BPCB 3SJVB 2IBZY 5I66B 4A2LA 3IJHA 5EORL 5IHZB 4PJIA 2AK1H 5HHOA 1N5YL 2BZDA 4M8VA 5KG9B 3DMMB 1M05A 3A0OA 1PEWA 1BAFH 3KYKL 4MQTB 5DF0A 3D2UD 3O6LH 5EZJA 3S3SA 2H32B 2PYED 4M6NH 1NDGB 4DKAA 2EDWA 1IBGH 3QISA 2F53E 2H45A 5F6IC 2MQ3A 5F97E 4Z95L 4Y2OA 1TQBC 5F88B 2DLTA 1T5XB 2VDOH 3V7AE 3ULUE 3CCHB 4YDVA 3UTTE 3BP6A 4O51B 2NLJA 2P47B 4UT9L 3RQ3A 4NC1C 2ITDA 2M2DA 3RVXC 3LZFH 5FO7B 4E5XB 5BRZE 1FO0L 3KAAA 4E41A 1BQHA 1OP3H 4LSUH 1JZ5A 4K3EL 4OUUB 1K8DA 1OWRM 3SO5A 3NA4A 4PJCA 1I1AB 1X5FA 5AEAA 2XNAA 3L6FA 2KUTA 3ZL4L 2OQJB 3MA7A 1FN4A 1U91B 3RKPA 4DVRL 4GS7B 4I8DA 5HD8C 1MFEL 3MA9L 4M00A 1A1MA 2X9WA 2ESVA 5SV3A 1U8MB 4LGPB 3AB0B 4P23A 5IB2B 3F12A 3ZKQD 2CLRB 4PRPA 3WUWA 1Z3GL 5CKAA 4NQSA 4EKXA 3IAPA 2IPTH 2V7NA 1D5XA 3CUPB 2YD6A 4AIXA 5B3JE 3VGEA 3IDNA 2K9UA 4PGEA 4MNGA 2YKLL 1N0XH 1NQBA 2BNQA 4HWBL 2R4RH 4D9LL 2QJDA 1JNLL 3J7HA 2NXZC 3L5WA 1E27B 1KN4H 5E95B 3WMSA 4Y5VA 1OM3H 1LP9F 4FFVD 4G43B 1R5WA 3PG2A 3CU1A 1XCQA 3QFDB 1WZMA 2G60L 1HE7A 2FL5A 3NFPB 4CJ0A 5F9JA 1I85C 3CFJB 2XWBA 4NJ9L 4JFDA 4GRWF 4KKAC 4N8CH 3SDAA 3C2AH 4MD0B 1S7XB 4G8IA 1CWVA 5EOCH 3WFDL 4FQ2L 4DAGH 1H3GA 1UCBL 4TULH 1RY7B 3SO3C 5IFAH 1YY8B 3GSNH 5FGCB 1D5MA 2FJGB 3NCJL 5I1KL 4UOW0 1G6RL 1DQQA 3ARGA 2K3TA 4KI5C 3PP4L 5D2NC 4ZXBA 4HIEB 4FABL 3EDKA 5F7HA 2AJYL 1FFPA 3MOAL 5C3TA 4JAMA 4HS6A 1XMWA 1TJHH 1R3IL 3P4MA 4N9OB 1FBIL 1RJZB 3B4NA 4MXVE 3MJGX 3DLQR 1DLHB 2QQKH 4BJLA 2Z8SA 1LO0H 2CJUL 4G9FE 4HK3J 4G42A 5TH2B 4OCWL 5ACZA 1BQSA 2DICA 2Y25A 4PYHA 5BV7L 3HE6C 2JJSA 3PWPD 4KY1L 3C6LD 3ALXA 5IB5A 3RWDA 4KJPD 2BY2A 4JPKL 5D9SB 1YEDB 3KHOA 1XGYL 4D0BB 4YQXL 3WFCH 1RUKL 4JE4B 4AEIL 3OKOB 2XZCH 1BWWA 1E4JA 4PRIA 3QFJB 1YNKH 5SX4H 2JK5A 4QWWC 5E6IC 4ZUUB 1DZBA 1REIA 3M17B 1HYRC 4RQQB 2OZ4A 3PF2A 1A7BA 3LKSB 3V7AG 3CDCA 5ABDE 3AAZB 3MXVH 5D1XD 2GAZB 4PGBA 5T3ZL 2X4TA 3OKYA 4AH2A 1MJ8L 2F58H 2EE9A 4FQCL 4QHLA 4PGCB 2EYSB 1NMBL 4O2FA 4JQIH 3X12B 1KIQB 4KDTA 1NDMA 3WNPA 3MRMA 1DLFL 3B9KB 1BJ8A 4KGJA 4OF0A 3FKUS 4X80H 1IEHA 4PGZA 4GXVH 4RIRB 2Y07H 3U0TA 4W68A 4EZMA 3MUZ1 2DL9A 3MRLB 4N0CC 1HINH 5IMOB 1DE4B 7CGTA 3OZ9L 1FL5B 1AE6H 4ZFOA 1Q9LA 1I8LA 3RVUD 2R0ZL 1KB5H 2R2HA 1MLBB 3U1SL 3V0VA 2GI7A 1MHEA 1P1ZA 1PY9A 1Y0LA 3PNWB 4B7LA 4HIXL 4AIZB 2NZ9D 5L9DH 5K9OB 3QULB 5HI3C 2AQ2A 4S1RH 2X9XA 4CADB 1RZFH 4GW5A 1YN6A 1J1OH 3TT1H 3SDXB 4O4YL 3T0BA 5F6HJ 3D2UA 4EBQL 2D3VA 3RWCA 1CFNB 1NLBL 2PYEA 4CU6A 3RU8H 2XY1A 1A6VH 3MUY1 4Z8FL 1IAIH 1KF9B 4PG9A 1Z5LA 1ZHNB 5IBTL 3HC3H 1K8IA 1S8DA 3RZWA 4D2NA 3DSFH 3ARFC 1OAKL 1QFUL 3OKNB 2HFGL 3ARBD 3QUYD 1PLGH 2DLEA 1QBLH 3REVB 4MX7A 2IADB 5BZWA 5AZEL 2NTFB 3FQXA 1FV1A 3TNMA 4OLYH 1OTSC 4LPWA 5ADPL 1QA9B 1CICB 2Z4QA 4ZAKC 1KXQE 3FB6B 3QXAA 3JWOC 1OGTA 5I8CA 1T0PB 1NCDH 4MSWA 4MDIA 1F45A 3O3BB 4OLWL 3QIBD 2DQIL 3LKQB 5GGUB 5I75C 3HG1D 4RGMB 1IZJA 1B2WH 5JO5B 2W65B 3T77A 1UG9A 4BH8A 1LP9E 5DK3A 3HE7B 3QH3B 4WI7A 4LU5H 2BSSB 3BZ4B 2X4SA 4U6XB 3BIKA 5DA0B 2EDQA 2GHWB 3D9AH 4OIIL 3T4AB 3TIEB 5E03A 2EZ0C 4GRWE 1EEQA 2HTKC 4F9PA 3UDWC 2ZUVA 4TTDC 4U1NA 3V7MA 1J0JA 2F53B 5LXGL 3QXTA 3F7PC 2W9DH 3QWOA 1I7ZA 1F11A 4YIQB 3IVKB 2XV6B 4LCCA 4ODUA 1U8IA 3L3KA 1TCRB 1NBVL 5C9KA 4GRMB 3P30H 1MHHA 2X4RB 1EFXB 2RR3A 1ZWIA 2IANE 1N5AB 4LLQB 1JPGA 3UTOA 2I07B 4J4PD 4U6HB 1SMOA 3PXJA 3MR9A 4XNQA 4HS8L 2NX5D 5GGVY 5KVFL 4IMLA 3MLSL 3V4VH 4NWUL 2IPUK 1EHAA 1IKNA 1HZHH 4JPIB 4W6WB 3MLZL 1PZ5B 2HWZH 3LKOB 3GSNB 2W1NA 2Y36L 5INCA 2OXHA 4H8WL 3VMNA 2R2BA 4JVWA 3E2HB 2ZUTA 1S7QB 3MLRH 4OTXH 1AP2B 3EJJX 5HXMA 4JFXB 1DEEB 2SEBA 4WFFD 4P9ML 1OAZL 1RK1A 5HGBB 3R06B 1M7DA 3I2CL 1CK0H 4YAQA 3PWNB 5C0GB 1B4JL 5C6TH 2OJEA 2DWDA 1K4DA 2EC9U 1KG0B 4BFEA 4MAYC 3QP3A 4ALAL 2VLRE 5F3BA 1TFHA 3HPLB 1I9RL 1UXWA 4U31A 4K8RH 1CXIA 1Q94A 3PWPA 3C6LA 2Q7NA 1BEYH 1OARH 2NY6B 5KOMC 1FORH 2RFXB 2RJMA 1U8HB 2AK1L 4DUVA 4P2RD 1BAFL 5MEPA 2VQUA 2R1WB 4L4TD 4QGTA 3O6LL 3LSOB 3Q3GB 5B8CA 1XZ0B 5I1CH 4M6NL 4JQVC 3IU4H 3OKDA 5KS9A 4Z7UA 1Y6MR 4F15C 2C1OB 1NC2B 5MENE 1A7PL 5IW1B 5F9WB 3NMEA 4PV9B 1MLCA 3U9PH 4I2XE 5D1XA 2NYYC 5BVPL 1ZK9A 4KUCF 5KW9H 4POZC 3LVEA 4LCYB 3SE8L 3ARTA 1NGZB 4G8GD 1T4KB 3FQWB 1WZLA 4X4YA 3LZFL 4MVBD 4MS8D 1XF2B 3C8HA 1I1RA 2GSIB 4LSUL 3VXSE 1T83A 3I75B 4HWZB 1I9EA 4CN6A 3LKPA 5DMJB 3RWJB 3ZYZA 1PGRB 4UOW1 5FK9A 1LD9B 3G04B 5IB1A 5SX5K 3HAEH 1W0WB 5GRXG 3HNSH 1VDGA 4FRWA 3OJDA 3ULVF 3BHBA 3FB8A 1ZLVH 3V6OE 4CDGC 4ACPA 1PG7W 4D3CH 1IZKA 3B9EA 3KPOB 2IPTL 3DVFA 4RNRB 1RAMA 4U1IA 3SN6N 3N0PB 4S0TD 5BS0D 1N0XL 5C09E 1WBYB 2R4RL 4UQ3B 4PJ9B 4WDIA 5GSRA 4ONHB 2Q6WB 2G5BA 1KN4L 1B90A 2HFFB 1JI2A 1J0KA 2X41A 2JCCE 5C0CD 4MCYB 4BUHA 2DYPD 3BUYA 5GGRY 4ZFZB 2IWGA 1I7RA 4JY6B 3ARBA 2BNRE 1FP5A 5DI8A 4XWGL 3QUYA 4N8CL 1AXTH 5MERB 2GK0B 3I6GB 3C2AL 4Z7VA 4JQXC 5E2VH 2W9EH 4XCFH 3KPMA 4KGLA 5EOCL 2ICWJ 4DAGL 3QWQB 3S37X 4TULL 2VIRA 3DUUB 4LSPH 4OZGB 5DJ2A 5IFAL 4M4PA 4NNPH 2VDNH 3GSNL 4JPVH 2IG2H 5C6WH 2FH8A 1RZGB 1A47A 3GGWA 4GG6A 1U2HA 3QIBA 4N0FB 2V9RA 1K2DA 4JFQA 1LO3H 4WY7L 3EFFB 3HG1A 3H9HB 1J10A 4QYOB 5HVFB 5HYJD 1YYLH 3MOQA 3BMWA 1TJHL 1WVZA 4NKMB 3SDDC 3QUKB 2X05A 3BJLA 3DARA 3ARFD 4GKZB 3GSQB 4ZMAT 5JHDD 2CK0H 1CFTA 5EUOF 1LO0L 4KROD 2GW5A 1UXSA 4Z7NF 2WK2A 2YRLA 5C0AB 2F54D 5J13B 3LCYA 3KPLB 3KYMB 4KRLB 4LLAA 2H8PA 3WYRA 2OR9H 3F7YA 3ARUA 3WFCL 3GJFB 1VGEH 3QZWA 1IEBB 4PLJD 3VFMA 4MJ6B 1G7QA 4J4PA 2XZCL 4FQLH 1YNKL 4Y4FB 2NX5A 3DHMA 3T09A 4JZNA 3L95B 1NUGA 1AKJB 3ARSA 1MJJA 2F8VA 3WDJA 2APFA 5IEHA 4JKMA 3MXVL 2EZ0D 3D25A 1OVZA 1AC0A 1KTDA 1T21B 1LP9B 4NJAH 3QUZB 3OXRB 5LVEA 4GAYA 4JQIL 1PG7H 1FNLA 4R4BB 2Z31B 3V0WH 1H8NA 1WWWX 2WWMD 1IRAY 5FOJA 2Y5EA 3OJ2C 5HHPB 5H8DA 4ZQKA 2YD8A 5I8EA 4EN3B 3DETC 4GXVL 5IB3A 2Y07L 3L3IA 3SQBA 5EIQA 3ARWA 4WUUB 5FYKE 5EFIB 1HINL 5F9DC 3MYJA 1I1YA 1AE6L 4FQXC 4OQTH 4P57B 1ZHKB 2MQ0A 4ZOAA 4CBPA 4Q9QH 3QA3A 1I85A 3FOLA 3UJTH 3HNVH 3T0DA 2P4AB 2DWEA 2Z92A 4J1UA 5DMKB 4L29A 5L9DL 4Z7WF 3EYSH 3PV6A 1CDGA 2NW3B 5L88H 2FDBP 2DQDH 3EDEA 3X13B 1RZFL 3QQ9D 3TT1L 1HXYA 3DVNB 3O3AB 4P2RA 4ZOCA 2J4WH 5J3HD 4L9LB 4L4TA 4P4KB 1JZ7A 2YXFA 2BY3A 3RU8L 4AENB 1NGXB 1AO7B 1ZA6B 5DC4B 1A6VL 3X3GH 1Q9KB 1IAIL 4NQVB 1SBSH 4BZ2H 3WLWC 3HLAA 3QHFH 4P2QD 3HC3L 1U2CA 4G80B 4O58H 5HHMD 3GIZH 3WFEH 4HV8B 3C5JB 5DJXB 4M4RA 3UXFA 1T7VA 1A6TB 4WFGE 1IGMH 1OTUC 1A5FL 4G8GA 4TUOA 5IVXF 1PLGL 3VDBA 1QBLL 4XC1H 4YO0B 3K81A 2PTTA 3OB8A 4RRPA 3OKEB 5E5MA 2A6JB 4OLYL 2GFBB 4YHNB 4QRPE 3FT2A 5EU6B 2AJZA 1NCDL 3QEQD 4NNYB 1R3JA 1QSFD 2AJSH 3GSXA 2B5IB 4P2OC 1B2WL 2B4CC 2XN9E 4XTRD 4ZS6C 1G0XA 1WT5C 4KDVA 5DD0H 2P24A 1BMGA 4LU5L 4M3KB 2VO5A 1MFBH 3QSKB 1I7TA 3WXWH 1R6VA 3D9AL 2NYYD 3EGSB 3NN8B 5B39A 2VWEE 1KBGH 5DVNA 4POZD 1BFVH 3O9WB 1UCTA 5MENB 2W9DL 3CSPA 2E8ZA 5BS0A 5IVZA 3UTQA 1HI6B 4J8RA 2VAAA 4I2XB 1MCHA 3N50A 4KZEH 1XIWB 5AG9A 1KYOJ 1KCUH 3KS0J 1JYWA 1F5WA 5C0CA 4JFZH 2VKXA 2DYPA 5C0JB 1CE6A 1D9KC 3VXME 1N0LA 2CLVA 1KIRB 3V4VL 4NQXA 2WBJC 1HZHL 5IP4A 1R5VB 4YEEA 2HWZL 3VXSB 3HRZA 3S97C 3WFZA 2J8OA 2R0KH 3BEVA 4XWOC 5EUOE 2RHEA 4X9HA 1YZZA 4XHQA 3O2VL 4Z7NE 3MLRL 4OTXL 3NFNA 3STBA 5LWYH 2NY4B 1CG9A 4PJAF 4GH7B 2FD6L 5JR1H 2VH5H 5D7IF 4P48A 4ZOEA 5HYJA 1ETZA 1T6WA 2EDNA 1CK0L 5EZLB 2XKUA 1UEMA 5C6TL 1U8JB 1YPZA 4ZFFB 2P46B 1NFKA 3QO0B 4OAWA 3MLPA 3ARFA 5DMIH 5L0QB 5JHDA 2G5RA 4PRNA 1X6LA 2DQFA 2GKIA 4LMQI 4PB0H 4DOHE 3VFVB 4JDVA 3STZA 3KPRD 3MNZB 1KJVA 4U1MB 4K8RL 5C07B 1X44A 2F54A 1BEYL 3QDME 1OARL 4J7RA 3WS6C 5I1GH 5DQJA 3PDOA 5CZXD 4JFHD 4F9LA 1FORL 3AY4C 5IG7A 3EJZD 3MNWB 1ZEAL 4IS6B 4PGJA 3VGAB 3Q6GH 4NN7B 5JOPD 1QR4A 4GQ9H 1IL1A 3IU4L 2MCG1 1CL7I 1EPFA 3QHZH 1Y6NR 2GY5A 3LKRA 4IM8A 5B4MC 3ECBB 1RIVH 3U9PL 5EU5B 3VI4F 4PRHD 2QADB 5KW9L 3MRPB 2JKXA 2LU3A 1CLYH 4NC0B 5DHVH 1WUNT 1S9YA 4Z7WE 1DFBH 3O81A 3A6BH 4JHAL 1MCBA 2C3HA 3I9GL 5DSCB 4PG2A 4XPBH 4IHOA 3VH8A 3B2UC 3SKMA 4MDJB 3F5WA 1F4XH 2NXYB 4RMVA 4UNTA 4XH2A 4ODSH 3RWGB 1S7RA 2C3VB 2WLZA 2Z35B 3DVGA 4W4OA 3HNSL 4QRRE 2A0LD 1A9BA 2BVTA 5SWQB 1F2QA 1A6AA 2VLJE 3IU3A 3PL6C 2F5AH 2BDNH 4NPYA 5KSAC 5E56A 4KK8D 3BQUB 5IVXE 3QG7H 2X4PA 4D3CL 2A74B 5EBWB 4AY0A 5DR5H 1F6FB 2CSPA 1I8KB 2VUYA 3QDGD 3IF1A 3P9WB 4LVEA 5ACLA 2EEDA 1B0GB 3KLHC 3D48R 2CXGA 3PQYD 4M5ZH 3G08A 4G8FB 4V2BA 3CFDB 4XAWH 3O4LD 5BXFA 1MFCH 4P2QA 5E8OB 3ZE0E 2PO6D 2AXFB 5DRZB 1NLDH 1I8IA 4LFHG 4NT6B 1BVLB 1PYWA 2QSTA 1CBVH 5FO8B 1GRWA 1WITA 2BMKA 3IFOA 5HI5C 1FGNH 2DRUA 1EBAA 1A7RL 4Y19D 5CEXA 1AXTL 3JWDH 1NBQA 1X5IA 3DUHA 2WP3O 5E2VL 5EO1A 2W9EL 4XCFL 3VFUB 2GCYB 3DXAE 5D2LF 4LSPL 4NNPL 3RL2A 1VCAA 2VDNL 4JPVL 2IG2L 2UYLB 1HCVA 4NKQB 5LG1A 2GJ6E 2VZVA 3QEQA 1QSFA 2IF7A 2YMXH 3MV8D 4JDZB 4PJDF 2YOCA 4JQVA 4HUKB 1LO3L 3MJ9H 2PTVA 1JZ2A 1KB9J 3H9SE 1V7NH 5D7LD 4M61A 4H88H 3WLWD 3GB7B 1V3MA 3SDCC 4Y8AA 3TBTA 3TT3H 1M4KA 2CK0L 2FECI 1S9XA 3JVGA 3VFWA 3M8OH 5K33A 2P8LB 1T1ZA 4QT5B 4XB7A 5L7XH 4H26A 2FHCA 3EO1A 1KTRL 3UCRA 1CFSB 2HRLA 4GSDH 1R5IB 4PJAE 4JANB 2OR9L 4HBCL 2BY0A 4PJIF 4R96A 3OSKA 1VGEL 1V05A 5C2BH 5C71A 1J5OH 5D7IE 4TNVK 2EE6A 4FQLL 1IEAA 1UWXK 3RUGB 4K3GA 3RWHA 1AI1H 1YNTB 3V4PH 3L3JA 5ID0B 5CJ8A 3IDXH 4QRPB 3SOBH 3WJLA 2XWJB 4MB5A 4ZS6D 4HKJB 1D5BB 1MY5A 5TDOB 4QTHA 5J1TC 1P4LB 4M7LH 1YQ2A 3BP5B 1U8OB 1CGSH 4K71C 2BHYA 3BT2H 2AJ3B 3L3HB 4NJAL 3ZYOA 3MRDA 5BVJB 2FWOB 3BESR 4K23L 1PG7L 1QRND 4QOKE 1KULA 3HI5H 3D3VD 3SGEH 4Y4KC 4X4ME 4JRYD 2YA2A 3SQOL 4Z77B 3MPCA 4PJCF 3HMXA 1WZ1L 4LVNB 3TCLA 4I9WE 2HLFC 1A21A 1H15B 3ILQD 4OI8A 2OR8A 2PW2B 1YUHA 4OQTL 2Y06H 4Q9QL 3KWWA 5GGRA 3KPRA 3EYFA 4AT6B 1KPRA 3UJTL 1CL7H 3HNVL 3VI4E 1J0IA 1PKQE 2IAMD 4YHMH 4QTIH 3BWAA 2XQBH 3EYSL 1J11A 4ZUSB 5L88L 4WHDA 2DQDL 4M9PA 3U7WH 1IT9H 4Y0GA 2VKWA 3IJYB 5I19H 1NH6A 2J4WL 4ZG1A 5HDOA 3U7AA 2FSEA 5EUOB 4HGMA 3EOYG 5DMGC 1QTYT 1B0RA 3X3GL 4Z0BH 2ZJSH 4NKDB 1JGLL 1KEMH 4BZ2L 3NIGE 3QHFL 4O58L 1P69B 3GIZL 3WFEL 5A3IC 2NY2B 1YEIH 2V2TA 3NTCL 1W72H 4PRHA 2BCKA 1FAKT 1IGML 4H1LA 4U1SA 2UZIH 2VXUH 1XR8B 2F74B 4XC1L 1RZKH 1XGUA 1AD9B 1ZT4B 3X11A 1T5WA 5CSGA 2VE6B 2XA3A 4AQ1B 3VG9C 4AYFA 2IBBA 4NQCD 2XKNB 1H5BC 3T0EB 2E9BA 5F44A 1AQDA 4UU9B 4NSKB 4OM0H 3WL9B 3PWUA 2IQAB 3JV4B 2J88H 1AIFB 2AJSL 2PYFB 32C2A 3V5DA 4TN9A 5F9AC 2AV7A 4ZUTB 1QVOA 3ZT7A 2YS4A 3NGBB 1T20B 1HH9B 5DTFA 5ITFB 3E3QE 4LLDB 3MRCB 4M3JA 5DD0L 3HCVA 5SWZE 4WNQB 5IQ7H 4POUB 1JV5B 3OKKA 1MFBL 1NFIB 4PR5B 3WXWL 1DN0B 5D6DC 4QLRA 4LEOB 5JW4R 2E3VA 1KBGL 1MPAH 1BFVL 4F37F 1AGFB 1I4FA 1TVBB 4LSSL 3QDGA 4M62L 3RDTC 2PN5A 5J06A 5BOPA 1I1FB 5HYIA 3O8XB 3SDYH 3PQYA 2XTJB 4BZYA 5FO9A 4Y5YB 4LCWE 3O4LA 2YC1A 5SX5H 4KZEL 4PJDE 2PO6A 4NRYA 4JFZL 4Z7WB 4X9BA 3ULVL 4ZPTA 1TCMA 3G9AB 2OL3H 3T0WA 3RL1B 3RI5F 2P5WD 4Y19A 4HK3N 4LGRB 4Y16C 3VDAA 1NGWB 4LAQL 5GGTH 4K7FA 2R0KL 3ROLB 2ATPA 1CFQB 2IMMA 1E28B 4ETQA 2E9WA 4L8CB 5C0IA 43C9B 2E6PA 1CGWA 5J9PB 1G7IB 3QPXH 3D0VA 3G5VB 4NO5B 3JTSA 3T2NH 4BSWB 4WO4D 3RWIA 1OF2B 4PJIE 3MV8A 2NY3D 5HHOE 3C60C 5JR1L 2VH5L 3DRTB 1KOAA 2JJTA 3IDMB 1A4KB 4YHZH 4N8VG 4IRJD 5D7LA 3SGJC 1NAKH 4HUXA 2LAAA 3MRNB 4LLWA 2AKRB 2FBJH 1GC1H 2YK1L 5DMIL 1ZOXA 1IC5L 1F02I 5EPMA 3CLEH 4OZHF 4PB0L 4OCXL 1M1SA 3BPLC 3NVQA 3B3IB 5EIVA 1FIGH 4M1DH 5TF0A 1S9WB 3HZYA 4MJIE 5I1GL 3RPIB 1T7YA 4PREB 2XQYG 4DN4L 4EUPA 3RIAK 5H2BB 3VRJB 1E6OH 3CPLA 4LPTA 1OGAE 3Q6GL 1UZ8A 3AM8A 2KQNA 4IJ3B 4PJCE 4GQ9L 4OD2B 5HDBE 5B21A 4HK0A 4IOSD 1GGCH 3QHZL 3EDJA 4MHHI 2ICWA 4LVHB 2QSCH 5I9QC 3MLUH 5J11C 4K7PL 4PGDB 3MLXH 4TUJA 4RX4D 4Z76A 1RIVL 4O00A 4TNWK 1KPVB 1F6LL 5IB4B 1DBKH 1CLYL 2FGWH 3LPFA 3FONB 4PRPE 1QRNA 5E7BA 1DFBL 3A6BL 2QV2A 4EI6B 3RGVC 3D3VA 5KTEH 2A2QT 4U05A 3O11B 1QSEE 3OMZA 3EOBB 1NGYB 3OKMB 4JRYA 4XPBL 1CXHA 3TVMB 4NRXB 4OCYH 4LHUB 1HYSC 1F4XL 1OAQH 3UTZB 1RHHA 3V95A 5HGGS 5I1LB 4FQPA 3DIFB 4GXUM 1JWUB 2AK4E 2P7TA 3C9NA 3FFDA 5IBUG 5DK2A 4YXLH 1VA9A 3MROB 3W39B 4OFVA 4QHUA 2F5AL 1OCWH 5D7IB 2IAMA 1NSNH 3LS4H 3IJSB 5CUSL 4Y2DD 3KPSD 1DUYA 2ICES 3OXSB 3TZVD 1QQDA 1PSKH 1LEIA 4I18A 4JY4B 4XP1L 2ED7A 3NZ8B 3WFHB 4DEPB 2E7LA 3P73B 1NFDA 4RDQF 1KC5H 1OL0A 1I3RB 3DX7A 3PIQA 2R1XA 1UVQB 5FA3B 5FYLE 1W72B 2YPLB 3MUHL 3BW9B 3DX9A 4WUKL 1NEZA 4FFZL 4XAWL 1JBJA 4DGVH 1MFCL 3GI8L 4W6YB 5D7KE 3RY4A 5CEZH 1NLDL 5EH1A 4QOKB 5LCVH 5F7DB 1CBVL 3VRLF 2W92A 1UM5H 4N8VB 3NZHH 2A6IB 1RU9H 5T5NF 1FGNL 5GS1B 3L3DA 5BZDA 5ADOH 1UKQA 1NUNB 3RIFK 2EKSA 2VZUA 3JWDL 4MNHB 4N0RA 1J18A 1LQSR 1NBYA 2PXYD 3FJTA 5ILTH 4Q9RH 2VN4A 2D7MA 2J5LB 4NQCA 4R7DB 2Q1EA 4JN2B 2WINA 1ZGLB 4JJ5B 5DURD 1BD2D 1NAMA 3ET9F 5EBGA 4YDJB 2YMXL 1PKQB 4NM4L 5GS2H 5JXEC 1L6ZA 1IAKB 1HWGB 3MJ9L 2B4CH 5EC2B 1V7NL 5A16B 4QRSB 4OGAD 5D1ZB 4TVPD 1TVHA 3S7GA 3TA3D 5E8NA 2CGRH 2EO1A 4GW1A 4PBVC 3QUXB 3TT3L 1D5ZB 5F89B 3VXOB 1QZ1A 3LIZH 5HPMA 3M8OL 3K3QA 5T3XD 4X6EA 4I0PC 5H37G 5DMYA 3DRQB 2D2OA 4GSDL 1M6OB 1T66C 2Q3ZA 1T3FA 3WLBA 4PJFA 5A2KH 5J6GA 4MQ7B 5C2BL 3ILPA 1J5OL 1BQHG 3G6AB 1L4IA 3IS0X 1AI1L 4DGYH 3V4PL 4NBXB 5KS9F 3MRBB 4Z7UF 1ZSDB 3ZKXC 1X4YA 3IDXL 2P5WA 3KPNA 3SOBL 3KLAB 2HTLC 1EMTH 4F7MB 2E9IA 4WW2A 4OZHE 4M7LL 2YUXA 1CGSL 4FZ8H 4OT1H 3SE9H 2J7LA 3BT2L 2NY5H 4KUZH 4OLVH 1H3WM 5TGBA 3PWLB 1NCWH 4WO4A 3QEHB 3WUWG 2CKBA 5SWZB 1SYVB 3HI5L 4FQQB 4JB9H 3UTSE 3D69A 5KAQF 4IRJA 1JF6A 5ALCH 4UILH 4NUJB 1O7VA 4D8PA 1A1OA 5CEYB 3ARDC 2NNAA 3KYNB 3B43A 2OZ4H 4NKOB 5D2LB 5HJ3B 2FIKA 4XXDB 2Y06L 2J8UF 3EJYD 3IRPX 4OCLC 3ZTJG 1A9EB 4PTTB 5E8EB 3BH8A 3VMPA 1FVCA 2R69H 1CL7L 4R7NB 1J88A 4X7SH 4HUWA 3QXDB 2OX5A 5FCSH 2MFNA 2BVOB 1R3HA 2XQBL 5I0ZA 4QHKJ 3U7WL 2DQEH 1LO4H 2YPKA 4QHNA 5I19L 5D6CA 2X4UB 1EEYB 3S5LB 1EHNA 3DUSA 3HKFA 2D7QA 5FIEA 1O5DT 3CC5B 4Z0BL 3CZJA 4CVZA 1KEML 3IJHB 1MFNA 3D0LA 1YA5A 5IWLC 4RX4A 4PJIB 1YEIL 2UWEA 4OZ4A 2LAGB 4U7MA 3G5XA 1M05B 1W72L 4XCCH 1L7TH 3ULUD 3UTTD 7FABH 3MLWH 1RUPH 3JTTA 5EZJB 4F7PA 2UZIL 4Z7VF 3TN0D 2VXUL 5CGMA 1RZKL 4XNZB 1EGJA 3LKNA 3WNKA 2FX9H 1ADQL 4X6CE 4Y89A 3JV5A 4UUJA 2IH1A 3MZTA 4YDVB 3BP6B 5BRZD 5FF6A 3TV3H 1TDQA 3B9AA 1FYHB 4KKBD 4OM0L 2NLJB 2ATKB 2P8MA 4MXQD 3OGCA 2ITDB 4RMSA 1NJ9A 3MNVA 1G9NL 3MQIA 4JZJA 1VEOA 2DMBA 4E41B 1BQHB 4X6FA 1T6VN 3QNXA 4Y88A 5IQ7L 1D7FA 3KPQA 3VXUE 1K8DB 3DYPA 4PJCB 4R4NC 4Y2DA 3KPSA 4CU7A 1MPAL 2OS7A 4L3EE 2XNAB 3TZVA 3GMRB 3L6FB 5ESQB 4PJBA 1QHPA 2BP3A 3MA7B 1FN4B 3HFMH 4JKKA 3LEXA 4U0RC 4ORZC 1AHWC 1VGKA 1J12A 4KK6C 1A1MB 2ZSWA 2ESVB 2ID5A 2W0PA 4P23B 3S35H 3F12B 3LDBB 4PRPB 1KJ2A 1T1YA 3WUWB 4NQSB 2Z91A 2V7NB 1N2RA 3SBWC 1QR1A 3NCMA 1D5XB 4LARH 3IDNB 4PGEB 4MNGB 5I76A 2BNQB 3BKYH 2MJWA 5GGTL 3IKKA 5E99H 4PY8J 2PXYA 3L5WB 3C5ZD 3CSYA 1FAIL 1PVHA 4MD4A 4XVUC 4Y5VB 1R5WB 3QPXL 1XCQB 3SKJH 1BD2A 3T2NL 3WE6A 4H0HB 43CAA 4BFGA 5F9JB 3TFKD 2XWBB 4JFDB 3Q5OA 3SDAB 1NMCB 5D1QD 4EI5D 4YHZL 4G8IB 4Z78A 4TQEH 1JFQH 4LNVA 1NAKL 4LF3A 4Z7UE 2FBJL 3TJHC 3TA3A 1GC1L 3CJJA 4LKXA 4V1DE 4CMHB 1D5MB 1DQQB 4ZXBB 5SWSD 3CLEL 2OSLA 5J8OA 1FFPB 4JAMB 4G9FD 4HS6B 3BZFB 2I5YH 2DMCA 3P4MB 4WV1C 5IM7A 2HT3D 5KBNC 2E9JA 4WU5A 1BOGA 2X7LA 2RIKA 4XVSL 1H5BA 4KI5F 1E6OL 3GM0A 3C8DA 5K59F 2NY0C 1KCRL 5E9DE 4G42B 4NKIH 5JXED 5ACZB 3RP1A 1T2QH 3SY0A 1GGCL 1EVTC 5IB5B 3RWDB 1M7IA 1Z9LA 5E08H 2QSCL 2J8UE 3MLUL 3TNNB 1IC4L 3MLXL 4PRIB 2YD3A 4N5EC 2FGWL 2JK5B 2OR7A 5F3HA 1AD0A 1JNHB 4ORGA 5C7XH 1YC7A 3SE3C 4QKXB 1F90L 2BRRH 5KTEL 2R9HD 4RDQG 5DHXB 2GYSA 4OCYL 1OAQL 2VLLA 1P7KA 4PGBB 2X4TB 4J2XA 1T89C 4AH2B 4RGNB 1F3JA 1CXKA 4QHLB 1FVEA 3WEXA 4O2FB 4HPYH 4MA3A 4XMKH 1NDMB 1A6UH 3MRMB 1DBBH 1OCWL 4PJEE 2XXCB 5T5NG 4N0UE 3LS4L 3U0TB 4Z7VE 2ZP0T 3LOWA 3P4NA 4PUBH 3VDCA 3GSVA 1HKLH 4NBZB 1PSKL 3QNYA 4QEGA 2NMSA 3ESVF 4ZFOB 2YD4A 1Q9LB 2H2PD 5F70A 1L0QA 1RPQA 2R2HB 4R8WH 3VRIA 3V0VB 1YQVH 1MHEB 1P1ZB 1Y0LB 4FXGA 5ISZA 5L2JA 5E2TH 4XHJC 4DGVL 3HG1E 2XRAH 5DEFB 3ZMRA 5KZCD 4C57C 3BEWA 5CEZL 3VFSB 3V4UH 4GW5B 5KSBE 1YN6B 1UM5L 3MREB 1QLEH 2CLZB 2OYPA 4YFLI 3NZHL 3UTTA 3HPJA 1RU9L 3D2UB 3RWCB 5ADOL 2PYEB 3QG6A 5FDYA 3TN0A 2VZSA 1BHGA 5I1DA 1QNZH 4NC1E 4PG9B 1Z5LB 4GJTB 5ILTL 4Q9RL 5IMLA 1K8IB 3L5HA 1S8DB 5BRZA 4C83A 1CYGA 3HN3A 5BW7C 4OFYD 4UI2A 5IK3A 4QXUL 3QO1A 4MX7B 3K2MC 1OAXH 2EDKA 2B4CL 3OAYK 2NX5E 5DJ8A 5BZWB 1YPZF 3FQXB 2OCFD 5D5ME 2CDGA 1FV1B 3K0WA 3TNMB 4NCDA 2FNBA 4NHCH 4OUOA 2Z4QB 2CGRL 3QXAB 1OGTB 4BFIA 5I8CB 4HUVA 4LIQE 4MSWB 3WO4C 3MBEC 1CGTA 1MNUH 4PJHE 4Y4HD 3BAEH 3LIZL 3BP4A 5M94B 3U4EA 3T77B 3W9EA 1MY7A 3AS2A 5J1AA 4BH8B 1UC6A 3GSUB 5MP6H 1MUJA 4R26H 1JZ4A 3QQ4A 4KK5D 5LGJA 3E8UH 4P49A 2X4SB 1B6UA 3BIKB 1AGBA 5HHXH 1A7OL 2EE2A 5KAQG 2IAND 1MIMH 4U1NB 1JHLH 5TFSH 4DGYL 3QWOB 1I7ZB 1F11B 5FB8A 1OT1A 5JW3H 2GIYA 4LCCB 4ODUB 1U8IB 2DQCL 3L3KB 1DBAL 2ARJA 3AUVA 3RAJH 4GKSA 4QHMA 5F96H 1EMTL 1ZWIB 1ES0A 4B53A 2Y72A 3C5ZA 1JPGB 3DHJA 4FZ8L 4OT1L 3SE9L 2NY5L 1Q0XH 3MR9B 4KUZL 4OLVL 4Q6IC 5TPWL 4IMLB 1NCCL 4WHTA 1NCWL 5AYUH 4LP4A 4ZNCD 2HKFH 3OAZK 1IQWH 4OZFA 3F7QA 4JB9L 3HUJE 4KI5E 4P2RE 5D1QA 5INCB 1OQOA 4EI5A 1UB5A 1WK0A 5K59E 1KJ3H 1QG3A 2R2BB 5ALCL 3ZO0A 4UILL 3QEGH 1J9CT 4R4FH 2OZ4L 4EOWH 3MJ6A 3O41A 4TTGA 5SWSA 2SEBB 4OCRH 2DQHH 3QPQC 1RK1B 4RFEA 3U79A 5A40E 2R69L 4J3SA 3TH3T 2QBWA 2VLRD 4G9FA 1M7DB 5TE7H 3W0WE 4YAQB 3O3UN 3QXUA 1MRCH 4IIQA 4U1GB 8FABA 2IEPA 2OJEB 3RVTD 2DWDB 1K4DB 3P0YH 3UPRA 3X3FH 4FFWC 1J8HE 3H3PH 2DQEL 1LO4L 3S36H 5DJZA 1HDMA 4K55A 5F3BB 1U3HD 1D6VL 5JXEA 1LDSA 1Q94B 3PWPB 3C6LB 4ZFOL 3UAJD 4NZRH 1FLTX 3WN5C 5F1IA 5CLWA 1BP3B 1MH5A 3TO4D 3GBLA 3H0TA 1J1XH 4HXAH 5MEPB 5B8CB 3MLWL 1RUPL 5IBLC 3OKDB 4M6AA 5KS9B 1MSPA 5HI4C 2VXTH 4GKNA 2QHRH 4JRXD 1JHTA 2LTQB 4X6BA 1P2CA 2NTSP 5D1XB 4L9DA 4UINH 3TV3L 4CVWA 1F58H 1HK6A 3B83A 3VWKD 2JIXD 1WLHA 4OLUH 4X4YB 2BX5A 4RMUA 2ERJB 1KLGA 3KYAA 4UDTA 2B39A 3CVHA 4K7PY 4R90H 4JFPA 1O7SA 2CR6A 3LKPB 4MA1C 4R3SA 2VMFA 5FK9B 3P4OA 2RCSH 4LOUC 5AAMA 5IB1B 1CVRA 4NC2B 4KZDH 1OW0A 3HFML 6FABH 4Y7MA 1VHPA 3OJDB 4G8EA 3U46A 4LRIC 3BHBB 3TO2A 3FB8B 4YWGH 4S11A 5C09D 3Q1SL 3S35L 5CP3A 2DM3A 3BPNB 1ITCA 2EKJA 2HA1A 5E70A 3IFNH 3OL2A 3MZGB 3I3BA 2B20A 5I30L 3OB0K 1BZ7A 4U1IB 4LARL 1CQYA 5E00A 2WUCH 1LO2H 2XOTA 3IDYC 3P11H 5JHDE 3UYOD 5DJAA 4WDIB 4XT1C 5E99L 2BNRD 5GSRB 2AJUH 3MYZA 5TE6H 3ARRA 2AEQL 3CFKA 2F54E 3BXNA 5C0BE 3HZVA 2WIMA 3RA7H 4U7KA 4EVNA 3SKJL 3BUYB 3I3EA 3LN4A 4YPGA 3QYCA 4OFYA 5FHAH 3TYFA 4AG4H 5BV7C 3ARBB 1IGIH 5DI8B 3QUYB 4Z7VB 5F6HI 5ENWA 3KPMB 1JFQL 4RFNC 1Z9MA 2VIRB 5DJ2B 4BK5A 2X2YA 5IWLA 5F8QC 2FEDD 3LN5A 1U42A 4WEUD 2HFTA 1F4AA 3GGWB 4Y4HA 1YEHH 4GG6B 3DMMC 3QIBB 1PW3A 3BWUC 1K2DB 4JFQB 3MMEA 4HMCA 3HG1B 3VD7A 1MVUA 1LE9A 1KYOK 5DRNA 5DJ6A 2I5YL 4NYLA 1MAKA 4HFWA 4OF5A 1X5YA 3UYRL 3ZHLA 4I1NB 1EIBA 3RPKA 5HY9A 1CFTB 1PX4A 3ZYJA 2EDLA 2IANA 3NCYS 1UXSB 4NKIL 1HXMA 1X7QA 3BN9C 2ZNXA 1T2QL 1P7QD 5FYJE 3T0AA 3Q48A 2H8PB 5E08L 3F7YB 4DW2H 3QZWB 3VD5A 3JV6A 4RWYH 4S10A 3VFMB 1G7QB 4BZ1H 2NX5B 4JEGB 3TYGH 1T0MA 3CXHJ 1I1AC 4K07A 4JZNB 5B39G 3BMVA 5ERWA 2O61A 5C7XL 3OV6A 2YUZA 4R97B 1SYSA 1MJJB 2BRRL 1EUTA 4OBSA 4GS7C 4HT1H 5IEHB 3D25B 5D7SH 1KLUA 1KTDB 4UIKH 3AB0C 2AXJA 4P2QE 3SBWA 4GAYB 1BFOA 2VL4A 4HPYL 5FYKD 4N0YL 4OCNC 4XMKL 4GMSH 5F9OH 3ZDXF 1A6UL 4HUMB 1DBBL 2QQLL 2VLRA 4ZQKB 2DI8A 4HWUA 5I8EB 5IB3B 3L3IB 1UFUA 2P49B 4FA8A 4PUBL 3ROOA 1HKLL 3AVEA 3MYJB 1BJ1J 1I1YB 4U1JA 3PWVA 2IQ9H 3QA3B 3FHAA 1CN4A 4I48A 2FLRT 4BYHA 1A0QL 1U3HA 1YQVL 3FOLB 5BMFH 3MV7D 3QEQE 2DWEB 1QSFE 4P0DA 1Q9OA 2Z92B 3FO9A 4J1UB 4M9OA 4L29B 1N26A 5E2TL 2O93L 2XRAL 3MACH 5GGVH 3PV6B 5JA9A 3TO4A 2W07A 4NO2A 2DI9A 5IKCA 3D39E 5HPOA 1QLEL 3N06B 1HXYB 1R0AL 4P2RB 4ENEC 3VA2C 3FZUC 1J05A 3G6DH 4L4TB 4HWEH 5EO0A 4LQ1A 4WFGD 4XVTH 1QNZL 3RZCD 2CQVA 4JRXA 3HLAB 4HJGB 5GGSA 3S34H 4HX1A 1C5BH 3PHQA 4LAJH 4NDMA 4G8GB 3VWKA 1SJVA 2JIXA 4TUOB 2GJJA 1OAXL 4M7KH 3BDXA 2PTTB 4N90D 5EOQH 4W6XB 4KKLC 5E5MB 1NUDA 2XN9D 1UQSA 4FMKA 4CVXA 2NW2A 5JZ7D 3MSPA 1OPGL 2VXQH 1MHCA 1LK3L 2AJZB 2BY1A 2X09A 1MNUL 1R3JB 3BAEL 3GSXB 1SEQH 4IRSD 4H8WC 2AJVH 5MP6L 1U8LA 4R26L 2C26A 1QBMH 2P24B 3E8UL 4CGTA 1I7TB 5C09A 5I1JH 4FQHA 3VH8G 1KPUA 1MIML 1JHLL 5TFSL 2J3SA 4WFHD 4NN6B 3UBXI 1HCFX 2JCCA 3ORJA 4Z0XA 5JW3L 5BS0B 3NPZB 5IVZB 3VXMD 4J8RB 3RAJL 2VAAB 4YBQC 4BK4A 5K9JH 3MRHA 2BNRA 3CH8A 3VGFA 2VDKH 3KPRE 3NACH 5FYKU 4UDUA 5DC9B 3B9KC 3A6OA 5C0CB 3BUTA 1A3LH 2DYPB 1CE6B 3EBAA 5HGAB 2CLVB 5IGXH 5JHLH 4NQXB 5AYUL 3VGDA 4K9EL 1VERA 4FFYH 1IM9D 1H3PH 4PLKC 2HKFL 3HRZB 1NCUA 5EU7C 3BEVB 1RUQH 2P48B 1JPTH 1KJ3L 5BO1H 1EVUA 4JHBA 3QEGL 3D1MC 3QIUD 5K9KA 4R4FL 3GMMA 5D7JD 3NFNB 4EOWL 3BOVA 1CG9B 3MX0A 1MRFH 4UZGA 4WTXA 1TZGL 2IPUG 2E6QA 4OCRL 3E0GA 4B0MM 1HQ4A 2DQHL 1GPOL 4PRHE 4KI1A 1U36A 1MCEA 5HYJB 1ETZB 1WISA 5TE7L 4X4XA 1MRCL 1DVFD 2R1YA 4U1KA 1UB6A 1YPZB 4WTZG 5CCKH 4NO3A 1I9JH 3X3FL 1OTTD 5JW5B 3QDMD 4OAWB 4YGVA 1GZQB 4HCRA 3ARFB 1C7SA 5JHDB 3S36L 4PRNB 2DQFB 4KROB 3HMXH 4JDVB 3STZB 3MCLH 5E6ZA 1KJVB 2F54B 2HVJA 2HVKA 1P7QA 3MRRA 1ZHBA 4NZRL 5DQJB 1GGYA 4NM8H 2HLAA 5JPNA 1J1XL 5CBAA 1FJ1A 1CICC 3DX6A 4XNYH 1WZKA 4M43L 1MQKL 2Y6SD 1IL1B 2VXTL 2I27N 1X3DA 3LKRB 5DJYA 2VLME 2QHRL 4RGMC 5HHQA 2GJZA 1PJ9A 3HE7C 3RTQD 5IJVA 1EERB 5GRVL 4UINL 4PJ8D 1RULH 3O4LE 1I7UA 3QRGH 4LHQB 3CFCH 1S9YB 3CLFH 3BN9D 4OLUL 2DLGA 3QXVA 3R4DA 3QJHA 3TPUA 1OT2A 4QRRD 1UGNA 4IHOB 3VH8B 4R90L 4Y19E 5EBMA 2APXA 3SKMB 5IV2A 5J1SC 2VLJD 3F5WB 3SCMD 4XH2B 1RZIA 1S7RB 4NUGH 1OHQA 2W0FA 2RCSL 2N7BA 1SY6A 2V9TA 3TBSA 3ZHDA 3DVGB 4KZDL 1A7NH 4RFOH 3RKDD 2HT4C 2OXGA 5KSVA 1A9BB 6FABL 4QNPF 3MV7A 4KHTH 1A6AB 3IU3B 4ZSOE 3MV8E 4NPYB 3WFBH 1EAPA 4YJZL 2OK0H 1QSVA 2GTZA 3DBXB 4KK9C 2X4PB 3MOBL 2FBOJ 2RGSA 4MZ2A 5B22A 1QKZH 3JUYA 3T3MF 5JOFB 2R29H 1UH3A 2VDPL 2YWYA 3IFNL 3E2HC 1J0YA 2BERA 3IF1B 3NIFE 1MAML 1ZE3C 1LO2L 4YK4C 1IVLA 4WW2F 4P3DA 3G08B 4U1HA 4WIQA 3RZCA 2DBLH 2AJUL 5TE6L 3ZLQC 5BXFB 4JO4H 5DZLA 3L3OA 5HHMB 3VU2A 5HYFA 2V5TA 1I8IB 1UJ3A 1AQKH 5FGRA 5CD3A 3RA7L 1PYWB 3DXAD 3GMNA 4Y1AE 1YYML 1TPXC 2BSTA 2BMKB 3IFOB 1QRKA 4AG4L 1CIDA 1FCGA 1IGIL 4F7EA 1G7HA 3WCYA 5CEXB 1FO0A 2GJ6D 5GS0D 3C2SA 5EO1B 4HJ0C 1JL8A 3NIDF 1BIIA 3LH2H 3H9SD 3KLDA 1HH6A 2XN9A 3C09C 3RL2B 1INDH 2NY6C 1A02N 3UC0H 5F7KC 3ULSA 3QEQB 2CUIA 3UPCA 1QSFB 5T1KD 3ZKMC 1KV3A 1YEHL 4OJFH 4CKVX 1CXLA 4HWNA 4KWUA 4M61B 4UQ2A 1HIMH 1QRNE 1ZMYA 3GUTA 2ZCLL 1FGVH 1OY3B 3D3VE 5F9WC 2Q87A 3QQNA 3TBTB 1S9XB 5ANME 1H3XA 5EZOH 4HWBA 1T1ZB 4BQBA 5DFTA 4JZOA 4GMTH 1XAUA 3CGTA 4H26B 5BCAA 3EO1B 3VXMA 3FTGA 2YXMA 2AEWA 2UWEF 4DW2L 4R96B 1GCFA 4LSDA 4RWYL 5ELIA 2EDHA 3N1FC 4BZ1L 1IEAB 1P9MA 2E8YA 3RWHB 3TYGL 2M1KA 3L3JB 2EDDA 1T7XA 4EUPH 3RVVD 1TITA 1IM9A 4HLZH 4QTHB 3NABH 3ETBF 5EB9A 1ZT7A 4HT1L 4M7LT 3QIUA 3E1F1 3KYKH 5D7SL 5D7JA 4UIKL 3VFOA 2IBGA 3MRDB 4I9WD 5E24E 4APQD 2XY2A 4GMSL 5F9OL 1VFAA 3W82A 3RNQA 1DVFA 3IETA 4PJ9C 2D4FA 3TCLB 3QDMA 3OAZH 4OI7A 1YUHB 4F8QA 1CGVA 2IQ9L 4B7IA 5IMKA 5C0EA 5GGRB 5CMAA 5DZOA 3KPRB 3EYFB 1KPRB 3HNTH 2ICCA 2EDBA 4EQ2A 4PPTA 3BWAB 3MACL 2YD2A 1JZ6A 4HAGA 5HVWA 1TJGH 3K2UL 1MCKA 2CUMA 2FSEB 2X4NA 3G6DL 3RNKA 1MFEH 3GJFK 1J86A 4XVTL 1B0RB 2XKSA 3MCKA 1BLNA 1WC7A 4MJ4A 4GUPA 4M1GL 2V2TB 3RTQA 3S34L 1C5BL 1JIBA 1ZA3A 4QNPE 4BSVA 4PRHB 4PJ8A 2BCKB 4H1LB 4U1SB 2B0SH 5EOTA 4M7KL 1XGUB 3X11B 3ABZA 1U95B 5EOQL 1T5WB 2H26A 4IOFC 3T3ME 1KTLA 4QRRA 4L3AA 5FO7A 1QYGH 4JO3H 5CS7A 5J13C 2VISA 2HYMA 2VLJA 3ZSSA 1AQDB 3SCMA 3FO1A 2VXQL 3PWUB 1ZLWH 5IVXA 32C2B 5GRUH 3V5DB 1FFNA 2AV7B 4Y4FC 1QVOB 1SEQL 2AJVL 2APBA 1P7HL 2MKWA 5DTFB 4J3TA 1QBML 1YEJH 3HCVB 1DUZA 3N1GC 3NCJH 3OKKB 5I1JL 2VXVL 5IW6A 4YNYA 1G9MH 4LCWD 3SPVA 1ITBB 1PFCA 4YBLB 1I4FB 2ED8A 3QDGB 1RJLA 5EU3A 3QUZC 1F8TH 1ZKAA 1FBIH 3PQYB 1U3YA 5FO9B 5K9JL 2C4FU 4F2MA 2DL2A 4UOJA 2Z31C 5CJBA 2VDKL 5EO9A 3O4LB 2YC1B 1GOHA 5E4EB 2PO6B 4NRYB 1CD9B 4EN3C 1A3LL 3DXAA 4OKDA 5IGXL 4ZPTB 5JHLL 4KKCC 4K8RC 3QFDA 1FDLL 4ODHH 3BZEA 1BFTA 1JF5A 4Y19B 2GJ6A 4YQXH 4K7FB 1RUQL 2ATPB 4ONFL 4AEIH 1JPTL 5ICYA 4ETQB 5BO1L 4DVBB 4X9IA 3H9SA 3OB0H 5C0IB 4YH6A 3D0VB 4H5SB 4WI2A 1JHKH 1MRFL 3JTSB 5DRWA 2HT2C 2A9NH 3MV8B 2UWEE 3PHSA 5T1KA 1CD0A 3M1BA 3BGMA 4LSQH 3EZJB 1MELA 2X44D 2H32H 4L9LC 1VEMA 1KENH 4P4KC 1FYTE 5D7LB 4HUXB 4LLWB 2CKBH 5EIIA 1W0VA 3I6LD 5IJKA 1ZLVK 4FQCH 5CCKL 2H41A 3WO3B 1MCLA 4MJID 1NMBH 4PJAA 1JTTA 4H20H 4TSCH 4IOIA 4JM2D 3T1FA 2YSSA 3IGAA 1ZVSA 5EPMB 1DANT 1F3DJ 3W11D 3HMXL 2W91A 3H7BA 4S2SB 3MCLL 1QSZA 1DLFH 2X1XR 4CU8A 3O6FD 2BXZA 1OGAD 5DO2C 3EO0A 4MNQE 1WFOA 4KTEH 2BFVL 1RZJL 4EUPB 3QWRD 5ESVA 1YEDA 1IE5A 4NM8L 3B9DA 4D0BA 3CPLB 4D94A 3LB6D 3VXQA 3KS0H 1UZ8B 1NBZA 1P84J 3I6KA 1MCDA 4HK0B 2QQNL 3RBSA 2EIBA 2ICWB 5ALBL 2B5IC 5IVNA 3GZKA 3MV9D 4Z76B 5EZIH 2CDFA 4KJQC 5ECJE 2XPGA 1QSED 1RULL 4XBPA 3QRGL 3VE0A 4APQA 2ZCKH 3GHBH 3O9WC 3CLFL 1QRNB 4H25A 5T1MA 2IFFL 2AK4D 1YJDC 3D3VB 4U6TA 1KIQA 3FO2A 3Q6FA 4JRYB 1RK0A 2HFGH 2EC8A 1RHHB 1EGJH 3NH7L 1CIUA 3MFFA 4NUGL 1XIWC 3K7UA 1NC4B 2QLVB 2P7TB 3C9NB 5I1AA 3FFDB 5DK2B 3HA0A 1A7NL 5K9QI 2X1OA 1E4KC 5LQBH 4KHTL 4YDLB 4QHUB 5HGDA 1MCPH 2IAMB 4HUUA 3WFBL 3ARGD 4FXKA 3K8KA 3GBNH 4Q0XL 5FYLD 1DUYB 2MQCA 2DQIH 1QQDB 4WCYH 1UENA 3TIDA 1LEIB 1X4ZA 4I18B 2R29L 5D7KD 2WANA 1HILA 4CADA 1BJMA 1NFDB 4DKDC 5I16A 4PBWD 3DX7B 1TENA 3PIQB 1BWMA 1CDHA 4QXTA 2R1XB 2MTPA 3IXTA 5IT2H 3MRJA 4G5ZH 2EXWC 3DX9B 3V6OC 2DBLL 2FJHA 1NEZB 4JHWH 1GVIA 3SKUD 1ZV5A 5LJYH 3CNKA 3L3GA 2ICEA 4OF7A 5HDQH 3L3DB 4XI5C 5BZDB 5L0QC 2EXYD 2EKSB 3TBWA 5F7YC 5TDNA 2R2CA 1NBYB 2BXYA 5GQBA 1K3IA 4G6AC 1G1YA 2BOCA 2HJLA 4HS8H 4NQCB 4HF5L 4KDWA 1INDL 4LLUB 2WINB 4OCMC 4URTB 3REWA 3UC0L 1NAMB 3V6BR 2CDEA 3FB6A 1HEZA 2FO4B 1XCTA 1MF2H 1S78D 1FCCA 1GH7A 5GXBB 5CJXA 1BBJA 4NN7C 1CE1H 4NGHH 1HIML 4GBXD 4OV5A 3WIFA 2B7DT 1TVHB 3NFSH 1MHPH 1SHMA 1CTNA 3OKLA 3HI1A 1B0WA 3KPPA 5E8NB 4GW1B 4HG4J 4HXBL 4QGYA 5DA4A 2VDQL 4LCWA 3HZMA 3IFPA 5D96B 1DR9A 1NANI 4PJDA 4TVPH 5HPMB 5KANG 1HNFA 4X5WA 5EZOL 3RBGA 2VZTA 2QADC 1Y6KR 4X6EB 4GMTL 4EJ1C 1A22B 1WWCA 4P5TC 1T3FB 3UTPD 3WLBB 4PJFB 5T3XH 3ILPB 4YHYB 1AR1C 3NPSB 2JB6A 5ICZA 1FNFA 2NXYC 2V7HB 5JNYA 4RAUA 5EA0H 4M7ZB 3IAGC 5ID1A 2P5WB 3KPNB 4WI4A 1YEEH 2JTDA 3TCXA 4XCYA 4WW2B 3QUMA 3WHE0 3NABL 5J4MA 3UTSD 5ISZE 4P5MA 1R24A 3BQUC 3GBMH 1LO5A 4NQDD 5TGBB 5HYQA 4WO4B 4U2ZA 2VITA 4D0DA 2CKBB 1RJYA 2NY3B 4FQIH 3L5IA 3OBAA 4WWKB 1A7PH 5D71H 3MBXH 3DV4A 4LVOB 3MRFA 4IRJB 5BVPH 2F19L 5DFWH 2I9LA 3DV6A 2R2EA 4D8PB 3MLTB 1A1OB 2NNAB 3SE8H 4MJIA 2FIKB 1EEUA 4JM2A 1JCKA 1IAII 3BH8B 3MJ8A 4KJWD 1FVCB 3O6FA 3E6HA 4HUWB 1OGAA 2Y9RT 5HYEA 3HNTL 3BYTA 2VR9A 3QCUH 1K6QH 1R3HB 2PF6A 3QWRA 4WW1A 1FL6A 3OJVC 1CLOH 4UT6L 4QHNB 1TJGL 5D6CB 1MCSA 2AI0H 5IROC 2AXHA 3DUSB 4M48H 2MCPH 4U3CA 5DEGA 5DRXB 3ARED 4N1HB 1ZS8B 4CVZB 1RUAH 1TTUA 3D0LB 3MV9A 1Z0MA 2UWEB 4OZ4B 3T08A 3G5XB 3RX7A 4D9QE 2J6EA 4GLRI 4LLVA 4BUGA 1QSEA 1WSST 4EQ3A 2B0SL 3JTTB 4F7PB 2FGZA 4LNRA 4GQPH 2VZ1A 5CSZB 3LKNB 4U3HA 1AXSA 5DD3H 2AK4A 1FRGH 3FQWA 4DKFH 3ULUH 4TYUA 4PV8A 1QYGL 4JO3L 5EULV 4UUJB 4JFOA 4Z5RA 3C87A 5FF6B 4FQJL 1ZTXH 4NOFA 3ULVC 1KEGH 1KB5A 4XWGH 3VXUD 2P8MB 4RA3A 1IJ9A 3OGCB 5GRUL 1X5JA 1NJ9B 1UH2A 3MNVB 4L3ED 2DLIA 4JZJB 4ZO7A 3HHRB 4HGKC 1YEJL 3QNXB 2C5DC 2KH2B 5JQ6H 4EXPX 2YRPA 3KPSB 4Y2DB 1G9ML 2E27H 3NCYP 2BSRA 3TZVB 3BDBA 3BP7A 4WY7H 3WUZA 2GQHA 4PJBB 3LQAH 2A1WH 3V5KB 5HTSA 1F8TL 3ARXA 3LEXB 4KRPD 3RWEA 5SWSE 1VGKB 2ZSWB 3BD4A 4LSRH 2VAJA 1D5IH 1KJ2B 1T1YB 4KQ3H 3VG0H 1G7MA 2Z91B 1L0XA 4LVNC 1N2RB 4O2EA 3TJEL 1QR1B 1YNLH 3FAXA 4YDIL 4ODHL 4BQ8A 1FIEA 5I76B 2D03H 1IQDA 1C5DA 1BIHA 4OD3H 2PXYB 2R8SH 3CSYB 4MD4B 3WJJA 4MMZC 4I3GA 4NQED 1J1PL 1FNGA 2QR0A 5DURB 1BD2B 1JHKL 2F8OA 5T5FH 3WE6B 2A9NL 1NANH 4V1DD 43CAB 1K4CB 4LSQL 4XXCC 1RZGA 2A6DA 4HKZA 4Z78B 3QR2A 1KENL 3FQUA 1DQDH 3ELAT 5C0ND 4LF3B 4GBXA 2CKBL 4QYOA 5I15H 1U93A 2R0WH 3TA3B 4LKXB 4ZYKA 4NKMA 3T1WA 2PTUA 2H6PA 3EHBC 4FNLH 4H20L 4TSCL 3PGDA 2NY2C 3QQ3A 2QHLA 3QEUA 1L9MA 2QKIA 2OSLB 4LLYA 2OBGA 5KJRH 3QDAA 4GRLC 5E9DD 4KTEL 5C6PB 1WV7T 3ZSTA 5IM7B 4WU5B 1BOGB 2X7LB 3KPLA 1H5BB 3QIWD 2PR4H 1TNMA 1JI1A 4OZHA 1OQXA 3T0EC 3ZKNC 1ED3A 3OX8A 1GGIH 4O5LH 3SY0B 3CFEA 4M1CC 1MI5D 1M7IB 3IDIA 2VNCA 3NGBC 4G7YH 2DQUL 3UTSA 5EZIL 5CD5C 4NQDA 4FN0A 2VR4A 3R0MA 5F3HB 4BA8A 2ZCKL 3GHBL 1AD0B 4OFKA 4ORGB 1LEKA 2JJUA 4L1DA 3GMOA 1FNEA 4P5TD 3QT2A 3O8XC 2XTJC 3O3DA 4Y5YC 2HMID 5MHSE 2VLLB 1A5FH 1EGJL 1P7KB 1DQLH 5IQ9A 3U6RA 1F3JB 1U8QA 3PUCA 1FVEB 4ZUVA 3PGCA 1GGBH 3JWDC 4MA3B 2OI9B 5LQBL 5GZOC 1Z0NA 1MCPL 1HHJA 1IARB 1IGCH 5HYSA 4OZFG 3CDGA 4MB3A 3GBNL 4UNVA 4NOBA 3P4NB 1WAAF 4WCYL 3GSVB 1LE5A 2D7PA 3QNYB 4GLRH 4LLMA 2JCCF 1SEBA 4LDOB 5TF1H 4XBEL 3L5JA 3VRIB 4ZD3L 5MI0B 1INEH 5IT2L 1ERNA 3AREA 4FXGB 4G5ZL 4NQTA 5C8JA 5L2JB 4JHWL 4JFFD 3LQZA 5AAWA 3BEWB 4L5FH 3QCVH 5AWNH 1F4WH 3RVXD 4X6CA 5TJWK 4JN1H 3BRGC 3CD4A 4NNXA 3DTXA 3HPJB 4QHKI 3UTTB 5HDQL 5DJXA 1JGDA 2Y5TA 3HR6A 3QG6B 4LRNH 3TN0B 2CO7B 1P4BH 2HG5A 4P3CH 4R0LA 3EDFA 3WHE1 5CAYB 1CZ8H 5IMLB 1KFAH 1MJUH 5ITBH 5BRZB 4EDWH 4C83B 3GJFH 5GPRA 3HAEA 4P46B 1V3KA 3VXUA 5IK3B 3RY6A 5HD8D 3QO1B 1MF2L 1UT9A 4L3EA 2I60H