5DRKA

2.3 angstrom structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound to adp, amp and bicarbonate.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
89
Chain Sequence
b'IKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title 2.3 A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound to ADP, AMP and bicarbonate.
rcsb
source organism Thiomonas intermedia (strain k12)
molecule tags Metal binding protein
total genus 16
structure length 89
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5drkA00
2NS1B 1UMJA 4R25A 2E66A 2RD5C 1HWUA 1VHFA 2DCLA 3L7PA 4CNZA 5DRKA 3O8WA 4OZLA 3X3UA 3AHPA 2J9DE 2ZOMA 3NCRA 2CZ4A 1P1LA 2XULA 4CO4A 1O51A 2Z0GA 3AA9A 1GNKA 4C3KA 1XK8A 3T9ZA 2J9EA 1UFLA 4CNYA 4ZK7M 2XBPA 2XG8A 4C3LA 1NH7A 4RLEA 2XZWA 1H3DA 1V3RA 1Q1KA 1V9OA 2PIIA 2O66A 4USIA 5D4NA 2V5HG 4CO1A 1V6HA 4WK3A 3HLUA 5D4PA 3TA2A 2O67A 5D4LA 4CO5A 1J2VA 1O5JA 2NUUG 4WK1A 4YB6A 4YB5A 4OZJA 1OSCA 3TA0A 4D3HA 3NCPA 3OPKA 5L9NA 2JJ4D 3NCQA 2GW8A 1PILA 3CE8A 4AFFA 1UL3A 4RWWA 2NUHA 4IYQA 2EG2A 4USJC 2J9CA 3O5TB 4USHA 4RWXA 1UKUA 2GX8A 3AA8A 3LF0A 4D3GA 2EG1A 1KR4A 2GNKA 2J9DA 3M05A 4C3MA 4NYPA 1NH8A 2ZFHA 3AH6A 5D4OA 4Y6IA 2VD3A 1QY7A 4Y65A 4CO2A 1NZAA 3MHYA 3N5BA 5DS7A 4CO3A 3BZQA 1VFJA 4NYOA 4E98A 4CO0A 3DFEA 3GSDA 4OZNA 1V3SA 3TA1A 4YB7A 1NAQA 4RX6A
chains in the Genus database with same CATH superfamily
2VF3A 1ZH5A 1WOPA 2B9WA 2I1RA 1RT4B 2CQ1A 3MUVP 5LJ5Y 2H4YB 3IC1A 4WU3A 1HLWA 1NZ8A 1B7YB 3OFFA 4NRUA 4WFNQ 3N79A 4WFZA 2PN6A 4ZPCA 1UEKA 5LMUJ 1MMLA 2MZTA 4JV5J 1YI2S 3DRPB 3TWZA 1YJUA 1SJRA 5DM6Q 3GYGA 3T19A 1S6UA 4JI4J 2HAIA 1BGXT 2O67A 4LSLA 3RZAA 2UUAF 5C25A 1DQAA 4IH5A 4ERDA 3L9ZA 4NCBA 1FXRA 4M5HA 3A8EA 3SDEB 1VBXA 4XDDA 1CJVB 4KPCA 2DBBA 2NQPA 3KYLA 3OUYA 1HQEA 1XBWA 5KFTA 3OJUA 3KK1A 4QJVA 2ACYA 4R8UB 2LYVA 3K7RA 1PC4A 1T94A 3DU6A 5KFAA 4K2JA 2BW2A 2G2ZA 4CNZA 5HMZA 1UWBA 3KJVB 3ZTPA 2ZOMA 4BCAA 4IH7A 3TAPA 5AXKA 3T1HF 4IO9Q 2MZ1A 4ZCMA 2VQFJ 1JJHA 2QFIA 2DEIA 2XMJA 4WIIA 3C8YA 4GMKA 3DC2A 3GG1A 1UFKA 5H9FK 1TL5A 4DV6F 1KTVA 4EEYA 5IT4A 1Y0HA 3PW4A 3MZIA 4KGMA 2GQ2A 8ATCB 1R8PA 2W25A 5DQIA 4Q8FA 1NM2A 5HI7A 2GVZA 4DPTA 3NCPA 2ZZTA 4NMXA 1U6FA 3PZPA 2XSFA 5J1EB 1WEXA 3NS7B 2ZUGA 3Q89A 2K8GA 2G0JA 2VOPA 2G13A 2V4QA 3JYTB 4DJBA 1FK9B 2HQGA 1KONA 1VQKS 4KKOB 1VRUA 3EWGA 1ZAXA 2HBYB 5KT3A 2PI5A 3NNAA 2DD8S 2HMIA 2F63A 2OH2A 1RHRB 4P7VA 1TQLA 3SMZA 1G1XA 4A8WA 4OI6A 2K1RA 3EVOA 2MY7A 3BJYA 3KHHA 1JLAB 3BO4A 4DQQA 4A8QA 3GIJA 1YKWA 2AZ1A 2W9CA 2HWTA 4WK3A 2QV6A 2ZUAA 1A6LA 4N77A 3FJ2A 4YB6A 1HNWF 4B3MF 3MMCB 3M8PA 5L9XA 2KH9A 1JKHB 1IBCB 2CIMA 2UVWA 3SYZA 1VR6A 3M8QB 2ZNYA 4L3NA 4X4RA 2LQ9A 1KD1T 5J1NA 2HS4A 1KHWA 2YNHB 1UZDA 1XQIA 3GP9A 2J0XA 3RRHA 2MEWA 2YNFA 1TKDA 1RQ0A 3MMAA 2ZVIA 4JI2J 3CJTA 2R7TA 3BV8A 5HSPA 4ECQA 3M6WA 2QA2A 3I82A 1SIZA 2H5JB 3IR5B 5EX3A 3QO9A 4KHPJ 2DGOA 3KLEB 3UO0A 3BGLA 3MEKA 5BYRA 4WYLA 4PYDA 1VBKA 3CDWA 1U7LA 3T9ZA 4DX6A 4JI0J 3ZFVA 1UA1A 3WHIA 1S0VA 3E8OA 1YRUA 1DTTA 2Z4PA 4Q44A 3E51A 1VQYA 3FUYA 3MCNA 4PWDB 1ZYQA 4V1Ak 3HLUA 3PACA 3NNHA 4CO5A 4A8YA 4OZJA 3EDRB 5KG2A 4Q45A 2GHWA 4IG3B 1OO0B 2IM3A 1SV5B 2KVIA 2XB2D 3GMGA 4DG1B 4FF2A 2RAQA 1KLMA 2GJIA 1APSA 4B3RJ 3PJ9A 3G2XA 1PJ6A 1WF0A 3BKFA 1QDUB 2BW7A 3SZ2A 1UPPA 3NBPB 1K8AT 2VL1A 2AWZA 2R9LA 2F9DA 4NLQA 2XCAA 3CJRA 1U6BA 5CD4H 2BR0A 5K5MA 1YVFA 2HQIA 1ELOA 1F9EB 5KFHA 3OQ2A 5AE2A 4B9NA 5C7PA 4LT6A 4J9QA 2V69A 4B3SF 2BJ8A 2L9DA 1K9MT 2QIFA 4C0HA 1TVRB 4PCQA 3V4IA 2PI4A 5KFQA 3W9HA 3HKWA 2E9ZA 3WIUA 3DDKA 3HZEA 4PRFA 3NS5A 3TAMA 3EXCX 2P2CB 4P2XA 1FCAA 2MHEA 2VJVA 1CEZA 3OXGA 2DH8A 4QZVB 5A0YA 4RR5A 1FRXA 3JS9A 4OJGA 7FD1A 3I5CA 3ISND 3ZTSA 3RB3A 3U1LA 3EDQB 3ZZZA 2VUGA 2HBQB 2VG7B 4DR4F 1VI7A 3EMTA 3A4TA 1LFWA 4IFYA 4X2BA 4FYXB 2R8JA 5KT4A 1WJ9A 4RU9A 4FS1A 3CWJA 5B0FA 3H0PA 1EIYB 5DRKA 2QJ3A 3BH7B 1B0TA 4DPYA 2EK6A 1RWXB 3UD5A 5IV4A 2ZC4A 1U1MA 2LDYA 1RT7A 1KOHA 1ZETA 4JP8A 2F8EX 3FVYA 4O3PA 5KFRA 5F8NA 1U48A 5KFKA 3H5XA 1FF2A 4DL0C 4YR2A 5F8GA 4P2MA 1BD6A 2XMVA 5KTQA 2KTQA 2QT7A 1RE1B 3DM2B 1J2VA 2RDJA 2EBGA 4O44B 4DDFA 1T9YA 2E7VA 3THPA 1V5IB 3A13A 3LGNA 3FSXA 2A18A 2ZVSA 1C1BB 1LWFA 1NKBA 4JBCA 4E8UA 1IUJA 1Y00A 1VJQA 2V8PA 5FLXY 5K9FA 2MQOA 2JL9A 2ZOFA 5CD4A 3KWMA 2HEKA 3UR3C 2ZJQQ 5G4DA 2HKEA 2ACMA 2MKCA 2E9TA 1QD1A 3RBEA 4OQJA 2LA4A 2KT5A 4LFBJ 4GKJF 5IM0B 2QZ8A 1KVKA 2HAFA 1KRPA 1MROB 5J2MA 1FJEB 3LPEA 2OLWA 1YZ7A 2X7IA 1QAXA 4NEYA 2IVFB 5I42A 2CQPA 4EBEA 4LMZA 2QG9B 4GRSA 9ATCB 2OSQA 2PEBA 2XI2A 2AMCB 3CJKA 3CE8A 3CDEA 1B0VA 2CPZA 2DISA 3GONA 1S12A 5F0WA 4YY3J 4ZVHA 1WD6A 3OVBA 2QMWA 1BMQB 1UVIA 2KFZA 1NH8A 1YBAA 2NXEA 4B9TA 4OMFG 1Q7LB 1HBMB 4WE1A 5EWEA 2RE1A 1NSQA 3PY8A 1UW9A 4G1PA 3G8QA 3ISNC 5I3UB 3JSMA 2C2KB 2M5YA 4JI6F 5GADU 3P45B 3R7BB 1K47A 1Q82T 2V8DA 1ROFA 4P7TA 3VCDA 4WFAQ 2PD1A 5E3RA 3BGRA 3MM5A 2A6MA 1D3WA 4C3LA 1ZAVA 4U96A 2MGZB 5D3GA 1HWJA 4NXNF 3D5MA 3AY0A 3HHLD 5D78A 4K5SA 4C8OA 4XAKA 1VIXA 2L9NA 3RBXA 2LXFA 1I3OB 1TAUA 4QU7A 2FJDB 2C2MB 2UV8G 1JLBA 2B7BB 3ZZYA 2YWGA 3BDPA 1K1SA 4C11A 4MYTA 1WHXA 1L3SA 5LMNJ 2YY3A 3H90A 2GJ2A 4ZOSA 2HBZB 4JYAF 2HW3A 3GILA 2E5IA 2BVZA 1XIQA 4DBQA 4HLBA 2KVQE 1NKEA 3QJJA 1FFGB 4ED0A 2HNYA 2DGTA 2KU7A 2BKOA 2DCUB 2IRUA 4CO4A 3GE9A 5C24A 4MFBA 2ZH6A 3FCVA 2F8HA 3FRYA 4NLRA 4W98A 3QIPA 3Q23A 2QLXA 1RB0A 3DYAA 2EFNA 1N34J 1UFWA 2K3KA 3NGRA 2BEFA 2AJFE 1LFPA 2DRBA 3SSRA 4DHVA 2NZCA 4DV7J 3I5BA 1YBTA 3QT8A 3I9V9 4KAIA 5KFZA 4OHZA 2HZVA 4FBTA 1H38A 1LW2A 4CTAA 4B3TJ 2G0IA 3TP2A 4G1QB 2B5JA 2XS5A 4N47A 4L6V3 1BQNB 2EG2A 4PZVA 2BQRA 2GGPA 1O6XA 4OYZA 3LH2S 1RBOB 1SBRA 3CJ4A 3R5GA 3A3NB 2P5VA 2ZHOA 1R8BA 4QBUA 2RDIA 4ED4A 1I1GA 2KJWA 4DSJA 2CQHA 2MB0B 3QAUA 4LF9J 4X66J 2MPUA 3LQVA 3VF0B 4LBHA 4KFBA 4QIGA 3MAQA 2OPPB 1NEEA 2HVEA 1RAGB 5DJBA 2QMXA 3PW5A 1IM4A 3C2PA 2CZ4A 1GXLA 3W5ZA 4DV3F 2Y8YA 2NYIA 3UDEA 1SJFA 2PMWA 1IR1A 4O0IA 2XNQA 1ZZNA 2YWEA 1XEZA 5LL6d 2YQ1A 3JXOA 1WTBA 1S9GA 2C2RA 3WC2A 4X4NA 2E7WA 5GAHI 3CF5Q 2OPSA 4ZN3A 1Z4UA 2VODA 1Q8KA 1RZMA 3MAAA 2VC0A 4WKRA 1VQNS 3PRDA 2CA9A 1R0CB 4OHXA 2VOOA 2Q43A 1RBLA 2D1CA 5HLFB 3J7AN 4IYQA 3W8GA 2IM2A 5JMNA 4PEOA 2YKNA 1XR7A 2CWXA 3HVAA 3HJVA 2V2VA 2BX6A 1BY9A 2GIRA 3JQJA 5I4MA 2WSEC 2YNIB 4ID8A 4DOZA 2XMUA 4ECTA 4NEZA 1UMJA 2CJ9A 3G9CA 3SFUA 4UOCA 4J9LA 2OTLS 1SQGA 4HR2A 4ECZA 1HHQA 3ITHB 4ICLB 1GTEA 3JQKA 4KSEB 3W63A 3GFYA 1X9SA 4WP9A 2BRLA 1Q1KA 2EKNA 2JC0A 2J8SA 4DUZJ 2FVRA 2KYXA 4OX7A 1RWWB 4Y2CA 4OX9J 3D4JA 2R3VA 4IOCQ 4F4AA 2W1BA 4U6PA 2VV5A 1Q79A 3BH6B 3HJFA 5A8KA 3A8KA 2FLOA 3K0JA 2NZ4A 2GHVC 1OJ4A 2QLFB 4N8NA 1UWBB 1ZA2B 4I2PB 4DR6F 3G82A 2H5EA 2MQMA 4AQYF 4TU7A 1M5PC 1H74A 1VC0A 4RW6B 3KHGA 2Z56B 3AOBA 4MJKA 4PPZA 1WKJA 3SFGA 3IR6B 2ZH1A 2V2ZA 1PSDA 1OY6A 4DV0J 2HFOA 2GVZB 4JI1J 3MM7A 1ZZFA 2JWNA 1IKWA 1FWPA 4PG6A 4LFCF 1HARA 4GVBA 3ET6A 2APOA 2XYPB 2RJZA 1PGZA 3PW7A 4QPXA 1S97A 1NJXA 3OFHA 1N8RT 3MEDB 1H72C 5IQQA 4IDKB 4NA2A 2CXEA 4LSNA 1WDDA 1IKXA 1PBUA 4ZJLA 4C8LA 3KJNB 2RUSA 2YX1A 3MM8B 4MKAA 1MLAA 2J9DA 3V4MA 8AT1B 4CP5A 4MKYA 2KXFA 1OSDA 2HHHJ 2D41A 1HPZA 3CW2C 2H51B 3EX7B 5HANA 1C0TA 2P9EA 2RUGA 3QGGA 4I64A 3OHAA 4OZ5A 1VQLS 2LU1A 1U45A 2RNEA 1X4CA 4I7FA 1KQSR 3UD4P 2W9CB 3BM7A 1UVJA 2R7VA 3PEJA 1FRHA 2ZH5A 5C42B 3N0VA 4LR9A 5L1KA 2AJ1A 5E3AA 2GAHC 1SJ4P 1EX8A 2ZBCA 5KFVA 3QSIA 3OW2R 4OLPA 1HNXF 4GKKF 1UWAA 2UUAJ 2ZBIA 3NWRA 1A7GE 2B6AA 2N4CA 1JMTA 2YNFB 2LDIA 1RJJA 1S77D 1NK8A 4USJC 1S6QB 3W2WA 1FWKA 4USKA 4DQIA 4I2QA 5KG5A 1S57A 4GVLA 3QO9B 4BLGA 3POTA 3FBCA 4IG0A 4EMDA 1QTNB 1T3OA 2W4CA 3BSCA 2XSJA 3V81A 2ASYA 4NCGB 4Z2XA 3SQOP 4F0KA 2E66A 2N82B 1VHFA 2V2KA 4OL8A 1TL1A 4IUFA 4ED6A 3DOLA 5A76A 3J7YI 1S0OA 3CCTA 3VAFA 2Q6CA 3THVA 2EK1A 5L1LA 2RS8A 5DZ7A 2M2BA 2DNGA 1XTZA 2BANA 3TOQA 2R2RA 5FJ4A 3IMQJ 3W3SA 1P6TA 1RLCL 2PT0A 3RR7A 5DDOC 2NXNA 3MFIA 3GYXB 4A8SA 2DRAA 3V6DB 4USWA 1BE4A 1KLMB 3S6EA 5E2QA 1RI7A 2HRUA 5FDLB 2QL7B 3H25A 4RZRA 4NZ7A 3D67A 4TKTA 4ZVTB 4OYMA 1S1XA 3QWPA 3H8YA 4RUBA 1N54B 3M30B 2IMOA 2IM1A 3RRKA 1CJTA 4RW7A 4P52A 2UVVA 2DNQA 1CULA 1FI4A 3VZHA 3G6ES 5EUHA 3PIPQ 2YVSA 2J5AA 5J2QA 2HVIA 3V4IB 4K4VA 1G2EA 2KRRA 2CQCA 4L72B 5AXNA 4BBYA 3V6JA 2W2QP 3QJLA 3J80U 2HVZA 2ATCB 1H2UX 2HS0A 2VU5A 2QO3A 3HFKA 2M3DA 3PFEA 1KC8T 2HNDA 3CDBA 4BWJA 4CIOA 1S48A 2P6TA 5D4NA 2PMHA 4M5MA 5K8PA 2R4FA 2W9BA 1HNWJ 2VBWA 4B3MJ 4PWUA 1Y11A 4ZMMA 4E0DA 1OIAA 2XI3A 1KOOA 3Q83A 1X4EA 4RWWA 3TX8A 3GFHA 1ZM9A 1IBLF 2VICA 3OD2A 4H4OA 4KYZA 4GC6A 2CPIA 3V6HA 2DPJA 4FN5A 2QA4S 2JNJA 1YK9A 1U2RA 5A8WB 3PW2A 5KFLA 3BPSP 2CJAA 3TZZA 2NSBA 3AOCA 3BZQA 2VFRA 2FTRA 4EYHB 2UUBF 4ZP9A 3PR5B 1S79A 4B17A 2DCLA 4JV5F 2BACA 1S1WA 1T02A 3MEGA 3G87A 3B82A 3ETOA 4FKYA 1P1LA 3KUGA 2R8HA 3DNCA 3ISZA 3AJDA 2K2PA 3C3LA 1MNEA 2E1CA 4NLSA 3DOKA 2R7SA 3T41A 1WORA 4CLYA 1U24A 5CYQB 2L3MA 3GU0A 4KGKA 2LKZA 1R89A 5FD1A 1ULRA 3CJ5A 2G0CA 2R7XA 1LWFB 4LQ3A 4RNHA 2FJEB 3QATA 3H4BA 3CCSS 2MLYA 4USTA 4AXIA 3Q8YA 3NLCA 3CCWA 5E41A 2X3GA 3A3PB 4HDGA 2Y0SD 4ER8A 3FCWA 3NGKA 1X8DA 5GAEU 2XWYA 3KLIA 1N5YB 3MWBA 4DR3J 4J9NA 5EGYA 1WTFA 3BGOP 4LJMA 3M1VB 3MR7A 4A8OA 1K0VA 4MKBA 3LAKA 2EFGA 3VAIA 4LVNP 3AHPA 5J2MB 1HKAA 1VIOA 2AJ4A 2W7AA 3HD1A 3M32B 3KXDA 1FJGJ 3H5YA 4B3SJ 2H3EB 1UZHA 1TUWA 1NH7A 1FXDA 3BF4A 1TKXA 3CJKB 1FKAF 3M2UA 4EUVA 4CDIA 7AT1B 2D9OA 2IVMA 1R31A 1F9HA 4PUOA 2CQBA 4PKDB 1TK5A 5D4LA 3IBWA 2FC9A 4DV5F 3KK2B 2DR9A 3TJ9A 2C3PA 2MQPA 2MQ8A 3JTNA 4WE1B 4CH1A 2F4FA 4K4TA 2UU9J 5KFWA 1RU2A 1UKUA 3OTOF 4CQ1A 3N5FA 3QYYA 4DR5F 1RYSA 3LP0A 1SC3B 5HMWA 2YQ3A 4DR4J 4B3OA 4DLGA 2MQQA 2EWHA 1FT8A 4PABA 3TVKA 1HQ2A 2ZJPQ 3I0RA 2JFKA 1SKUB 3I96A 1OPIA 2QC3A 5E5NA 3DLGB 5HP1B 4PPDA 4BWMA 1FKOB 1N5QA 1QAIA 4ZVPB 1X4DA 5L1JA 1RT4A 3BSNA 3MFHA 1PJ7A 2CQ4A 1S1VB 3CB4A 2IM0A 1YGYA 3CVKA 1P27B 2K7JA 4LVOP 4ECWA 4C11B 4HHHA 3K5OA 2YKQA 4OV1A 5DO2A 1FD8A 1VQ4S 3T9NA 4IO1A 3NCQA 2VHGA 5KFEA 3SDEA 2ROPA 4F25A 3MUMP 3A3OB 1CJVA 2DH7A 2HQCA 3R27A 5C24B 4MFBB 3GJQB 4DL6A 3D1QA 4NPOA 5IXUA 3CIMA 1N5SA 2MKYA 2CFXA 4KHPF 4Y65A 1MSWD 3HDSA 5CABA 3MR2A 2XO6A 4R8UA 1RAIB 1U1QA 1RABB 2RF2B 2CVEA 1AFJA 3KJVA 2ROGA 3DRYA 5G0RA 2OMOA 2WAQD 1W25A 1HBOB 4GKJJ 3AODA 3TUZC 2GMJA 5H9FJ 3B8HA 2D3OR 2DGQA 1LW2B 4CTAB 2AJQA 3W65A 2I6WA 2O5DA 1F60B 1RKIA 3FBBA 4I0WA 4HL9A 2DITA 4ECVA 4AL7A 2YKMB 3QLHB 2N3LA 3Q22A 1REVB 1FFSB 1FJCA 1VC6A 4DMZA 3TQ1A 2DNLA 5F8MA 5DZ6A 3BQ1A 4KGVB 2P9GA 1EQ0A 1S9FA 4IQMA 4UUXA 4DFJA 4ED3A 4NRTA 1FXLA 1SKRA 1VISA 2ZITA 4NMLA 2KI2A 3NS6A 1FK9A 2BZ2A 1UVMA 1NK9A 5D4OA 2A6OA 2VA2A 2CWKA 3F41A 2GVDA 4KKOA 2FC8A 5HBMB 3HFZB 3CC7S 4AD6A 2O1PA 4M5NA 3E01A 5EX0A 4ZKAA 3HHNB 2M52A 2AGOA 1WACA 2QLWA 4JI6J 2IY5B 3AD8C 4F2SA 3VGUA 3L7UA 3KUEA 1VBZA 4DWIA 1FO1A 3PO5A 4HH0A 4K4UA 1JLAA 4K7QA 3MM6A 3MEEA 2VFTA 1G7CB 3CD6S 4NXNJ 3M9MB 5KFYA 2DHSA 2I0XA 2BJDA 1PIEA 2V6AA 1RADB 2OTJS 1WHWA 4EZ9A 4KY3A 4F36A 2XGPA 4FYDA 2IJNA 1WG4A 4NWBA 4WF9Q 4RBUA 3MMCA 4I1TA 1GH8A 2KZZA 1JKHA 1RTIB 4X4SA 4ED5A 2GS8A 3QRPA 3M8QA 4U7CA 2GC8A 3WDOA 3ZO7A 4RNFA 4D3GA 2XYHB 3KOAA 2FZGB 4JYAJ 2GAGC 1NPRA 2YNHA 1LXJA 4FF3A 5IT9U 3KDOA 5ADZA 2R2TA 1UAWA 2MKSA 3DLJA 4OI4A 4QOTA 3I31A 1PO6A 4DZDA 4UF4A 4USVA 4CWBA 3W60A 3DI6B 2UZAA 3BN7A 3I5AA 4TU8A 2ZWOA 3KLEA 3HKZD 1JJCB 2J7KA 4QR2A 4J90A 1HQUA 1GMVA 1U4BA 3V2UC 2MSTA 4WYWA 2KKHA 2FUG9 1EP4A 2P8IA 1HI8A 2HQFA 2CPYA 4PG5A 4PWDA 3RTVA 3TAQA 3PKMA 1WI8A 2UUTA 5ETKA 3IGVA 2MMYA 2PFFB 1YJ7A 2ZKTA 4JI7J 3G82B 4ZVUB 1KFDA 4IG3A 3WQPA 2ADBA 1SH0A 2LQJA 3DLKA 2RHQB 1SV5A 5ITHA 1R6VA 1S72S 3GFXA 2DNNA 3HCXA 3Q24A 3NXZA 3JQMA 3FSYA 3PX0A 1RUSA 1R8CA 4QYZJ 3GSDA 3NBPA 4UQTA 2JLEA 1XC9A 2ROEA 1HWUA 1F9FA 3MM7B 4J5OA 3T5KA 3HHEA 1IKWB 5J1PA 5HROB 2CYYA 4DV3J 4GVBB 3MCSA 2Z2MA 1NU4A 3J81j 4QCLA 4LF8F 3EVWA 1KN6A 1F2HA 4UTGA 4W4MA 3CJ2A 2KZMA 5GAGI 2V9WA 2FHMA 1OQ3A 1TVRA 1YJRA 4LSNB 4CH7A 1IKXB 2AQ4A 2NCKL 3HZGA 2M9KA 1DURA 2I5JA 4PG4A 3OTBA 3PHTA 1VLYA 6FDRA 4NLDA 5ETNA 1JK9B 1NK6A 3JAMU 1QAYA 4YP3A 1OSCA 3OR2A 2L9WA 4BS2A 1ZM2A 4OFZA 2HBRB 2X3DA 3UFCX 4KBIA 1C0TB 1V5VA 4LR8A 2D3UA 3B4MA 4ZP8A 1KR4A 2FB0A 3CXCR 1NUEA 1QAJA 2V9KA 2BA9A 2VG7A 1WELA 4C0OC 2CJKA 2XNRA 2YWWA 3D3BJ 2BE9B 1FDBA 2QFJA 4DXLA 1NSKL 1S6PA 2AEMA 2BM1A 3UN2A 4DF4A 1LW0A 5IQ6A 3MR6A 2E5JA 2DNOA 3FRZA 2AYEA 3PDNA 2AYGA 4I68A 4QWCA 4OZLA 5HVGA 3EZOA 2AT1B 3BO2A 4X4UA 5B0AA 3IWLA 4JOUA 1ZBTA 3MMBA 3QIDA 3W61A 4FVMA 3GWCA 3N4WA 3OR1B 2XZWA 3TEHB 1T7PA 2VDHA 3NRBA 2AIRB 3AXKA 1IBKJ 4USIA 1LV5A 3AT1B 3W2WB 4TLQA 1HBNA 3HSGA 2O3DA 4DSKA 3JSRA 4ILLA 3H5SA 3W2VB 2G2YA 1VGYA 3DM2A 4ELUA 4O44A 4WZMA 2FJBB 3ZTQA 1EKRA 2XSJB 2JX2A 4DX7A 3C46A 3I87A 5C5JA 1TL1B 2PE8A 4DR6J 1C1BA 1U1OA 4IRCA 1KS2A 1PYTA 4DSFA 2F3JA 2CG8A 2ZOGA 5KFFA 2OUGA 2OAUA 2DKOB 3VR1A 2BANB 2BYCA 4DR2J 1EQMA 2E5HA 1ZTWA 4FXVA 3MCOA 1LWCA 1HNVB 3PW0A 2DXDA 2IAJB 5H9EK 4KHMA 5JVGQ 2ZM6F 2GA7A 1OY9A 1VRTA 3BREA 4U8VA 4JV2A 1IJFB 3RAXA 5IM0A 4LF5F 1T9TA 4F3OA 3NGTA 1R0AB 2W4PA 1FDNA 5KT6A 1MROA 1Y4ZB 2J6TA 3TVZA 4LFCJ 1AFIA 1HD1A 2HHTA 3TRGA 3O44A 3T3FA 4D3HA 4ZLNA 1CJTB 4MMOA 3H2UB 3HVTA 2IRYA 2J9CA 2D74B 5DQGA 4ZJQA 1S7HA 3CULA 3R9LA 3NGDA 5J2QB 3GQCA 2FPHX 2LQ5A 2KFNA 3FEYB 3TEGA 3CCVS 4DV4J 2ZFHA 3CCUS 1SQEA 1NKCA 2M7SA 4A8FA 3U27A 3PCOB 2VH7A 2PO4A 2HRYA 1KFSA 1XMQF 3UCGA 2J8AA 1E6VB 4BDPA 3NGUA 2MLXA 5CH7B 3IRWP 1SXLA 4EBCA 2HNDB 1V3ZA 3WX4A 3SSQA 3OFGA 3GR1A 5ETMA 2E44A 2IRXA 1DARA 1D8YA 2F4VF 4K4XA 5DDPC 5DG9A 4L75A 4ZPVR 3WIVA 2ALZA 2MGZA 1JLCB 4WBFA 4H4OB 1U02A 2EFVA 2DNYA 1L5UA 4Y34A 3IM9A 3MD3A 2BRKA 4DUYJ 3MI7X 1ZPWX 1GTHA 3K8VA 3QFHA 3VAMA 1AUSL 3DDNA 5KT2A 4J9SA 1CC7A 1BWEA 4USHA 3OLBA 2CAJA 2W7PA 1BLUA 2FVCA 2Y1RI 4HVZA 2KXHA 1S1WB 3GIRA 3MEGB 4DI6A 4ZVRB 3SV3A 3JSYA 3ENWA 3L95X 3M8WA 1T0TV 1TL4A 1DAXA 5K14A 4RW4B 2C2EA 5LSOA 2R8IA 1WSVA 3M6XA 4UQGA 2X1FA 5KFMA 4GO7X 4F4ZA 1BQXA 2VBYA 2W9AA 4NXMF 1UFLA 1IBMF 3RBDA 3K58A 1LK7A 1N0VC 2AEJA 2HNZB 4NZ6A 3T6BA 2Y1LB 3BSOA 3DN9A 5THWA 4ZVQB 3ENQA 2KXNB 2RRAA 4CT9A 2GJFA 2N4DA 1M1KT 1EARA 2OI2A 4IH6A 1GXUA 1BQNA 4WTYA 4MK9A 3H4DA 3EGNA 4I69A 4RUAA 3VQSA 4DR7F 2XY5A 2XEXA 3TUIC 3LGHA 2V50A 2G1HA 5DS7A 2JVOA 3ILJA 2V8GA 5C2GA 3UR0A 1GXTA 3CUNA 2PA8D 3DLBA 4K5RA 2FZCB 1RGVA 4IR9A 1TKXB 2OPPA 2PSZA 2FQQB 4CM0A 2N3OA 3FEXB 2V34A 2WRMA 4PUOB 3Q8SB 4ES2A 4M5DA 2JDJA 4DL7A 2XG8A 4FXDA 3WX8A 5B08A 3U02A 2PDAA 4KRWA 4P2FA 2D69A 1H2VZ 1X4AA 2DGVA 4NASA 5IWAF 2K3IA 5HLFA 5F9NA 2KYZA 4L3KA 1P8GA 1IBLJ 1TK8A 2HFZA 4B08A 2W7OA 2ZJRQ 1XNQF 3P49B 3O1LA 2P6SA 3MECB 3NOCA 4Z7YA 4IFVA 2IFXA 3AJ1A 4CO3A 3OL6A 3FFIB 1TMJA 1KVIA 4OYAA 4CYUA 3LOUA 3AOAA 1IQZA 3M8RA 2YNIA 2UUBJ 4OZNA 2KT3A 2H48B 2WONA 3OTCA 1NSPA 1JXLA 1I5OB 2MZRA 1CQNA 5KFDA 3Q8VA 1AA1B 5HQ8A 3M2VA 2CVIA 3AJ2A 2GO8A 1RAJA 3KG1A 2DR7A 2KG1A 3ITHA 4ICLA 3DRXA 3TVYA 1GNKA 2KB2A 3N01A 1LXNA 4DL5A 4J9VA 4USUA 5GVQA 1JLFB 1VLOA 2NXCA 5M2UA 1S7IA 4ZVSB 4ES3A 5LXRA 2J7WA 1SQFA 1CJKB 3N28A 1B7FA 1H98A 3AD7C 3OTEA 4F3QA 1S5ZA 4DL2A 3UQSA 2JJ4D 4RW8B 2GW8A 1S49A 2QE5A 1GX5A 1RTHA 1UTAA 5CCMA 4CLFA 4YR0A 3RB4A 4UOHA 4NX9A 4FF4A 2CZ9A 4I2PA 3MR5A 5G0RB 1MW7A 2B4OA 1N88A 1WG1A 5D0EA 4QWDA 1CJUB 2Y1JA 2BE2A 2D9PA 4NE9C 4K4YA 2MKIA 6AT1B 4J37A 2DIVA 2YPZA 1O0PA 1RHMB 2ZHAA 3IWXA 2RQKA 4RW6A 2CJYB 1RISA 4HI2A 1UPMB 1X4FA 3G86A 3Q86A 3G96A 3UWTA 2XMTA 3J7Z5 2R7RA 3C6UB 3EM1A 2OD6A 1FRJA 1H3DA 2N7YA 1D1UA 2MKKA 4DV5J 5F8LA 4AT1B 4Q2MA 4I67A 3BO3A 4DV2F 3MEDA 2ZBRA 3S1TA 4IDKA 2IC3A 2GVDB 1R6YA 2FHJA 4ZHRA 4LBPA 2IYIA 2MYFA 4L76A 4YFUA 4A8XA 2CQIA 1B64A 3OTOJ 1QVGR 3E01B 1NDLA 4DR5J 1WC6A 1XN9A 2B56A 3MM8A 3BYPA 1BHNA 2DNMA 4A8KA 1K0TA 1EKSA 2R7WA 3HSJA 3FQKA 1AYEA 3PVXA 1XNRF 3BYRA 1RTDA 2ZHBA 4C6AA 4R25A 3MM6B 4EO8A 3FQLA 3MEEB 2MXYA 2Z58B 4ZP6A 3CC2S 4F50A 3RBZA 4C9DA 4M5LA 3MPDA 4LIWA 2OEMA 3J7A1 1Z1ZA 3PO4A 4HI1A 4OHWA 5C42A 1Y7PA 5KOXA 4KO0A 3D6MB 3OL9A 2R7UA 4C8NA 3SCIE 1T03B 1OY8A 4TY8B 3M2RA 5JUMA 3UPFA 2UP1A 4ZCIA 3K5MA 4X4PA 2FYXA 4QIEA 2EPIA 3R5BA 1S6QA 4YN3B 1NHVA 3LF0A 4UT4A 2GNKA 1M1GA 1S76D 4ZPDA 5ETPA 4P74A 1HQUB 1Q0NA 4E98A 4QW9A 3C19A 1QJHA 2YPYA 4NCGA 1QTMA 1EP4B 2QYCA 4AYBD 3C16A 4ECSA 3UI3A 1UJ4A 1CC8A 3HSZA 2AJ2A 2ZH7A 4HKQA 3RW7A 1FEHA 1U1NA 4F02A 2OFGX 2FJWA 4ZIVA 5DETA 3QJPA 1ICEB 4NLTA 3GJSB 2RHSB 3FMWA 3DLKB 2AKWB 3GIKA 3FGVA 4KT0C 1WOOA 3CJ3A 2FVPA 2IDEA 3V6DA 1WC5A 5KFNA 3LAMA 1NPPA 5FDLA 5H1SV 3J81U 3QGIA 3US5A 1DLOB 3EPIA 3U7JA 1N48A 4CLKA 1U0HA 4DR3F 3HM9A 2ZH9A 1JNRB 1PG5B 3M30A 2RU9A 3CJ0A 2KL8A 2EXUA 2D3ZA 3VAKA 4IQXA 4DS5A 2YWFA 4ANDA 4OI2A 2KM8C 4ES1A 3EICA 1LQ9A 1FJGF 1KNZA 2BMBA 3TA1A 2CQ2A 4PXBA 5D77A 1C1CB 2FDNA 2Z30B 1FJ7A 2OMLA 5IZHA 5D6GA 3ULHA 1ITPA 2I5JB 2H5IB 4GO5X 2NXUA 3CGIA 5EWFA 3MPUB 4A8MP 1TU0B 3HT3A 4DCPB 3G8TA 2HZCA 4IKAA 2UVUA 2CPDA 3OR2B 3CMAS 1SCJB 2GIFA 3M8ZA 2UXDF 5T41A 1QUVA 2VFSA 4MK7A 5LT5A 2AX1A 2EI5A 3RYLA 2UU9F 3MTJA 2ILYA 2HFVA 5E7OB 4C2MA 3HXMA 4OJ1A 4ED7A 4TN2A 3A8JA 1RXOB 4P71A 4KV8B 3D6HB 1JLEA 4JI3F 2E7XA 4ETXA 1S6PB 1YJWS 1N56A 1LW0B 3DGVA 3Q8UA 3DXBA 5A8WA 4OHYA 3G4SS 4LQ9A 4G1IA 1PYSB 3OTDA 4TU9A 4B9MA 4CO2A 3H2VE 4LRAA 3MMBB 1QM9A 2QLBB 1H7WA 3ZZ0A 4ZIWA 3DFEA 3DLLQ 2NS1B 5L46A 2HRTA 3EXYA 1X5SA 2JFDA 2ZD1A 4FKXA 4ZPAA 2BJ1A 1HBNB 3HO1A 1YJVA 1Y5LB 4DPOA 1D0EA 2F65A 3BN4A 2AYBA 2CDQA 1EJ7L 1FFWB 4WFYA 3C15A 2UXCF 1MU2A 2IHR1 3LALA 3P5TL 1CVJA 5CYQA 4YEAA 3GIIA 1TL3B 3A1YG 2RS2A 4ZPTR 4QIWD 3DXSX 1KQKA 2LLZA 3TA0A 2JEIA 5ETQA 4B9SA 4R5PB 2DO0A 4PYAA 7FDRA 4LF6F 2RQMA 2VA3A 3WC0A 3AA8A 3T5LA 1Y9OA 2V67A 1LWCB 1RT3B 1N32J 1IQTA 3G6VA 1DQ8A 1QY7A 4B02A 4X65F 1TV6B 1N5YA 1MWYA 4J91A 3RAQA 2MJNA 3UCZP 2PMZD 1VRTB 5LXYA 5EWGA 2LVWA 1L3UA 1XWLA 1LKZA 2RVJA 2IBKA 4L74A 3MGJA 3M1VA 1FE0A 2UXBF 3L7PA 3O3LA 4ILMA 5BJRA 4WP3A 3CD5A 3HULA 2Y8WA 1C4AA 4HT7A 1Y10A 5GAHU 4QW8A 4WXOA 5I3PA 4TQRA 1QVFR 3M32A 4Z7CA 1IKVA 3VALA 4LF8J 1FX4A 1Q5YA 3CJSA 2QN6B 1QLNA 4HTIA 3NWGA 2CJXB 4DUTA 5DGAA 1Q95G 2WVFA 4RLEA 1N4LA 3Q2TC 3HVTB 2Y3YA 2DIUA 4DS4A 4OV6A 4XTTA 4F0HA 3TJAA 1KLNA 3KK2A 3MR3A 2AP6A 2XCPA 1SC6A 5DG7A 4CLLA 1U47A 3TUJC 2JOQA 3W8PA 5BR8J 1M5VC 2B0GA 1B4SA 4CM2A 2UVRA 1VK8A 2OSRA 3IWNC 3GTYX 4M63A 1NPKA 2YKPA 3MPVA 2B8QA 4R0JA 1YIJS 3MF5A 1TR0A 1T9XA 1WC1A 2MY8A 3S8SA 3N5BA 2DR8A 3J7ZT 1Q8IA 1PC5A 4J9PA 5KT7A 3DLGA 5DM7Q 5HP1A 1QSSA 3DGPB 1D8ZA 1FKOA 1FA0A 1TUGB 2PGCA 3NOGA 2C2NA 3H2LA 1S1VA 1HWLA 1K44A 1R8AA 2HGLA 4M94A 3OHBA 3BGFA 3M6VA 3DMJA 2Q1LA 4CNYA 3J80Y 2QL5B 4ZP7A 3FDSA 2LFVA 1S59A 4TYAA 4QR0A 3QWUA 1LWEB 1NK7A 1HBUB 2A2DA 3CCQS 3FEZA 2H1YA 2XLJA 2FVQA 3C14B 3S01A 2CPHA 5K14B 5HK4A 3DLEB 2RILA 5HATA 2IJFA 2ZZMA 1DFDA 5JVHQ 1YRXA 4URSA 1Y5IB 4CLWA 1WOSA 1KBRA 2MSSA 2ZDPA 4EWTA 4UZCA 4FPRA 3BEGB 4WZQA 3UVJB 2RF2A 1JLQA 3EGWB 1H0HB 3VZIA 4C8KA 1CPZA 2ZM6J 4KJIA 2XS7A 5KFUA 1YZ6A 3NAHA 1HBOA 2XZDB 3NP5A 2HHVA 5KG1A 1URNA 4LF5J 2XLKA 5B09A 3TI0A 3IRXB 2ZZNA 4LUBA 2HURA 3IO1A 4JI7F 2DGUA 3W7BA 2R8GA 3IA0A 2HFNA 2J7UA 2VFVA 2PA3A 1W26A 1RA7A 3KUHA 2YKMA 2ZH3A 2JZ5A 3QLHA 4R0EA 1REVA 5B7WA 3FBEA 2WOMA 2K7KA 4V19X 5E3QA 3LP1B 2IYGA 4PAAA 1U1LA 4K50A 5ETOA 1I94F 2AJ0A 5F0UA 4M5GA 1QSYA 4ILRA 1RP5A 2QRRA 5HBMA 3U1NA 1XMQJ 1TKTA 2B3TB 4P2SA 4M5DB 1KEKA 1MMDA 2R7OA 3GLJA 2C2ZB 3NCRA 3CCZA 3VGSA 2HHSA 1RCOB 2F8MA 3TX0A 2J0WA 2F4VJ 4I4BA 2QTWA 5DLGA 4P75A 1Y5NB 1B0PA 1NJWA 2KO1A 1LK5A 2B9XA 1RHUB 3BQ0A 2HHUA 3KLGB 4F4XA 4DX8H 3PKYA 3K89A 4CH0S 3QZ8A 4LRBA 3UCUP 3B54A 4IFVB 3N6MA 2YQ0A 1RTIA 4CYUB 3VHQA 5ETVA 2CADA 1DHMA 4UZBA 2WONB 3QAEA 1CSJA 3MUTP 4A4JA 2Z8QA 3IS9A 3P96A 3M2VB 4PXEA 3JTPA 2RQCA 4B9UA 5MAOA 1SJQA 3J7YU 4DV1F 3FNNA 3RR8A 3DI6A 4PG7A 3E2EA 1U09A 4JUZA 3MURP 3PHEA 1IBKF 4WFBQ 2HIQA 5T7LA 3NEKA 3IBCB 1QSLA 1Z2ZA 4NXMJ 1WI6A 1IBMJ 1XMOF 2V4JB 2YNGA 2XY7A 4ED1A 1IR2A 1RTHB 3NL0A 3W1YC 3GCWP 2XGQA 5IS2A 2W2OP 1HNIB 5CZXA 4K59A 3CSKA 1CS4A 2BE2B 5A2QY 1HR0F 3HX9A 2MTLA 1YQHA 1EHWA 4Y3CA 4DR2F 1FNOA 4LF4F 5CYMB 1NXIA 4DR7J 1FESA 4DFKA 2XQCA 2KN4A 1SUQA 3P5BP 1N36F 1OPZA 2I9SA 2GHPA 3THTA 1ZM3A 2HHXA 3PRVA 4BC7A 2H65B 1UA0A 3R1HA 2HWHA 1WF2A 4ZITA 2YX4A 8RUCA 5AJ3F 1GX6A 1P9YA 2AF6A 4DLEA 5HROA 1M0SA 1U2CA 3B6BA 2VQEF 3PX6A 3MM9B 1Q86T 2V63A 4O3NA 5B0EA 4OI1A 2BBEA 4YS2A 2IC3B 4ZHRB 4MH8A 1IM6A 1NJYA 1NNDA 1TUVA 2H4WB 3LUYA 5KFSA 1V6HA 4L73A 2ZH4A 1SC4B 2HSEB 4DQPA 5DLFA 2XZTB 4FPIA 1RT6A 3H5UA 2V4RA 5IWAJ 3IP0A 4U7UD 4DV4F 4P73A 2OPRA 5KFPA 4ETZA 4NLXA 1ZS6A 5CA5A 4ECUA 4B9VA 1RTDB 1N6QA 2AU0A 1GMWD 1XNQJ 1RWNB 4YDXA 1GMUA 4OI0A 4TQSA 3R3TA 1HMVB 2GZOA 2ADCA 3K5LA 4TYBA 5E0OA 3OXFA 2WBRA 3VGVA 3UD3P 2CPFA 1IWAA 2W24A 3SCJE 5IV3A 2BKNA 1KWMA 1U8SA 2RKIB 3D0GE 1Q7YT 4RKUC 2X1AA 2ZEJA 1HWIA 3GYNA 4KO0B 3OFEA 2P9CA 2DJWA 1CBKA 3K8WA 4DUYF 4A48A 3M2RB 3SXLA 4S0MA 3KK3B 4DQRA 3OR1A 2RB7A 4NLUA 4X4OA 2VG5A 2A3JA 4X64F 3GCXP 1BUXA 4EK2A 3HT0A 3W2VA 2BJ3A 2VASA 1WEYA 4ZVGA 1XR5A 2EFQA 3ZZPA 1Q16B 2MZJA 4FXWA 2LMIA 4OHVA 3LW5C 2C22A 2KRBA 2YH0A 3OJSA 1FWLA 4QIVA 5AT1B 1TK0A 1AROP 2GFFA 3UDLA 2GO9A 3C16B 1VQOS 4Q8EA 2Y1IA 1EB0A 4ZLJA 4WPAA 3TUPA 5IT9Y 1Y3JA 1RU1A 2IIHA 1V3SA 4IRDA 5H9EJ 5K8MA 3HSDA 2E1AA 2RD5C 5F41A 2FJVA 5KFBA 5T14A 1HNVA 3DRSB 2OHDA 2IAJA 5KFGA 5B0DA 1TL7A 3I4HX 1FRIA 1GQEA 1O51A 1HHTP 4ZN1A 4CRJA 2CNKB 4Y0FA 2ZBPA 3D0HE 5L38A 3KLHB 2I38A 4DPXA 2BM0A 2YTCA 3NMRA 2BUNA 1R0AA 5AXLA 1SKWA 2CUYA 4IOAQ 1U0HB 3SSSA 1AT1B 3B78A 2VKZG 1MWZA 1WC0A 5CZVA 1GFWB 1RT5B 4DV2J 5ETLA 3I6PA 2Q79A 1N33F 4HEA9 2ZE2A 4TXSA 1FTCA 2ZC3A 1OMSA 1DZ5A 3CT9A 1HW9A 3AQPA 1TKZA 5C2CA 1WEZA 2OPQA 2VPZB 5SZTA 2DHHA 3M8SA 3D7SB 2Z2ZA 4OI3A 3M7VA 1R8HA 1KP6A 4O4RA 1T05B 4NYOA 1XNRJ 3CMES 1VQMS 4K0KF 4HT5A 1T8EA 2SXLA 2C3OA 1E6VA 1WHYA 2CNNB 1E6YB 3I56S 1MWQA 2LQBA 1M5HA 3CIZA 4RL1A 4K2XA 4MIWA 3BR9A 1YRTA 5KG7A 2M70A 1DTQB 1MMNA 2ZDOA 1JLEB 2M8DB 2LA6A 2Z57B 4CLUA 4QYZK 4Y2KA 2V5HG 1JLCA 4F04B 1WNEA 2JLFA 2CG4A 2JHEA 2HK3A 4QWBA 1JQGA 2HVHA 3JAMY 3D3CJ 3OPKA 1X31C 4CZCA 4MIBA 1RAAB 3BQ2A 2BE7D 2H54B 4GC7A 2J76E 1UETA 3BBBA 3FCHA 2ZD1B 1S0NA 2E9RX 2QGFB 2F9JA 1K73T 4O3SA 1WG5A 2HQDA 1KVJA 3DKDA 3FKBA 1BQMB 4YB7A 4RW4A 5F8IA 4ID5B 3NY0A 3C15B 2R7QA 1MU2B 1Q53A 3VAJA 3MPWA 4NLPA 2DH9A 1P1TA 3PJXA 2RIJA 4ECYA 1UVLA 5A6WA 1X4HA 4YMEA 2OFHX 1F5BA 4KH0B 2O66A 3NMAA 3MMJA 1AZSA 2HNZA 2UUCF 3NAIA 5I3QA 3K17A 4F4WA 4NLVA 1EETB 3TR5A 1PBAA 1H7XA 1RWOB 2V8HA 2F5GA 3RB0A 2CDRB 3AAWB 4LRCA 3HF5A 3RG6A 1RWPB 2QX0A 1PJ5A 5KFOA 3V6KA 1SL1A 3D6TB 2AW0A 1YJNS 4NYZA 4LSZB 3HVRA 3M9NB 1RSCA 2J0SD 1IKYB 4KB7A 3OSPA 1SVDA 1IKVB 1UW4A 2WSFC 3KKFA 2COLA 1M5SA 4F2RA 1N5VA 2VBZA 2FIUA 4YUDA 4ZLLA 5U47A 3QRQA 5LSRA 4G3IA 2J6SA 2Y0BB 5M2PA 3IAM9 2A1BA 3CCLS 2XBPA 3GV5B 1SJ1A 4URQU 2UXDJ 5A8RB 2AD9A 2QL9B 2L48A 5EDWA 3M4XA 5KFCA 2QA4G 5D0HA 2JC1A 1PYOB 3AFGA 2G1DA 3NG8A 1UEVA 4UUWA 3H98A 4AFFA 4JI3J 3M8YA 5KFJA 4F8RA 1J5OB 1HYSA 4LIRA 3HI9A 4JV0A 2WW4A 3A12A 2XC9A 1RT1B 1NDCA 4K8RA 3CO9A 3ELHA 3MECA 3OL7A 4H4MB 5D0GA 1S0MA 2RRBA 3MHYA 1YX2A 3FFIA 5CYJA 2X1GA 3DMJB 1T95A 4DQSA 3H7HB 1FDAA 4WP8A 5D8HB 3PTWA 2XHWA 2DNRA 1QE1A 2DNZA 5LJ3Y 2CZVC 4KGZB 2HVDA 1J5EF 3TW0A 3TARA 1U0SA 3W66A 3MPYA 4XIUA 3ADAC 5B0GA 2VDIA 4LF7J 4OYOA 2DXEA 1LNQA 2UXCJ 1JLFA 3BKTA 3PYFA 3RRGA 1S1TB 4IR1A 4NI2A 1UP1A 1CJKA 1HWKA 3UDVA 2CNLB 4YB5A 2CJQA 2HYIB 2VB6A 4LR7A 2DY1A 2DR5A 4FBUA 1SI9A 3CD0A 1T9WA 2QSFA 5DDRC 3D1HA 4RW8A 3VVTA 5LOQA 4LF6J 2IPOB 4PQUB 4Y2AA 4UW2A 4JI8J 1SH3A 5FIIA 1JLQB 3G6XA 2HHWA 4OYIA 1FRMA 3GV8B 1L3TA 2PC6A 4X65J 2V0NA 5HVHA 2XY6A 3ILLA 1CJUA 3VQTA 1KHVA 4OZ0A 3H20A 1KQGB 4KH1B 1RTJB 2UXBJ 2OJ3A 1YBUA 1W2BR 1RBAA 1SJ3P 3K5NA 5KFIA 5GAGU 1OYDA 1O8BA 3D66A 2AX0A 2ABYA 1FRKA 1T9UA 5DDQC 1IXKA 1VQ6S 3AA9A 4OX8A 2AGPA 3R2CJ 3C6UA 2WOMB 3R5AA 4HHUA 3G6YA 3SQGB 3EGZA 2GQCA 2VG6A 3RUBL 1R27B 1YG0A 1GAOA 2RQ4A 4WK1A 2VKRA 5F3ZA 4KTQA 5BXIA 3PYDA 3PFOA 1SB6A 5MLCV 4J7CA 1HW8A 5IOLA 1X9WA 4AL6A 4HH1A 2MZQA 1TKTB 3O5TB 1Q81T 5ETSA 3KJQB 2XO7A 4KR0B 1DJ0A 1RKJA 2EVZA 4XPEA 2G4BA 3G71S 3KG4A 2XS2A 2DB1A 3MD1A 3DHXA 2VPXB 1VK3A 3KNAA 1AB8A 2VJUA 3TZXA 4LRFA 3T1YF 4RU2A 1B99A 3UN5A 3P8BB 2CQGA 3M6UA 3LP2B 2YX7A 3R6LB 4C48A 2E5LF 2XULA 4P72A 3SBMA 1ZTTA 2XMKA 2FHJD 4C3KA 2EEYA 1RAOA 3EE3A 1GT8A 4RPFA 4O0NA 4I56A 2PIIA 3QBCA 3BBCA 1RTZA 1X5PA 1T11A 4QQBA 1A0OB 1BWVA 3BGUA 1HNZF 3KNGA 1MN9A 3PYGA 3IG1B 1T03A 3IS9B 2RH3A 3G8SA 2DYAA 2EBEA 4PXCA 4TY8A 3VV2B 2VFUA 2M88A 2LEPA 3KMQA 4J9UE 1NMEB 4NLOA 2HGNA 4M5KA 1S9EA 1RT2B 2BJ9A 3WBZA 4RW9B 2MDAA 5T7LB 3GJTB 3FZ2A 1C0UB 4DU7A 2LEAA 4YDDB 1FTRA 1REGX 5L1IA 3HHLC 1VC5A 2YNGB 1JLGA 3JTOA 3GPAA 1NBEB 4YHHJ 2POKA 4RBVA 2C1EB 1FX2A 5CHCB 1RWMB 2LCWA 4USMA 2WHOA 4DPWA 4M95A 4DPUA 1X5TA 4DSIA 5GADI 2KM8B 1CS4B 3CMQA 2DHXA 1DY3A 2ASLA 1FNXH 5CAAA 5DQHA 5GMDA 4CO1A 2CQ3A 4DF8A 2F7VA 3SI8A 3C6TA 1YWXA 4LSLB 3HK2A 2E1PA 5C25B 1N32F 4OJHA 1SUQB 1DLOA 3I4PA 3DLHA 1K1QA 1TAQA 4DFMA 3HHDA 1I94J 1KSPA 1GMWA 1BC6A 3OUYB 3MOJB 1HQEB 5HMXA 4QWAA 2E1RA 5J2NA 4ZVFA 3KK1B 1S4EA 2HZAA 1J27A 2OGUA 1F3VA 3FSIA 2HG4A 3QZ7A 4EO6A 4FDFA 3Q8QB 1C1CA 1GEHA 1NK4A 2DO4A 3DHWC 4HTJA 2DNPA 3ZZUA 4DCJB 1NK5A 2DHGA 2U2FA 2DR6A 1RT6B 1YSJA 5E33A 4ZK7M 1ZA1B 2DK2A 2OPRB 3H40A 3U1MA 1SH2A 3QFWA 5BR8F 1SL0A 2QEXS 1YDLA 2M8HA 2LECA 1N6QB 4ZDNA 3DRRA 3FK4A 1OQ6A 1N52B 4JI5F 5HAOA 3RU0A 4KQZA 3R7SB 1RCXB 4RJVA 3MCMA 2QLJB 4RUCA 9RUBA 1UL3A 2V68A 4BC9A 2DHAA 3LGMA 4KV8A 3HD2A 3CCJS 4LREA 4J9RA 1WC3A 5HVFA 2NR0A 4CI0B 3H59A 3IGNA 5F8JA 2X51A 2FZKB 2WB1D 3CCRS 2FLPA 1TFWA 3BS9A 1VRUB 4LFAF 4DR1F 4M8LA 1JWWA 1S6OA 3MOZA 4DV1J 2AGQA 1U25A 4ZLPA 2HMIB 4A47A 4ANCA 2CPEA 4FNHA 2DT9A 3VWSA 3OVSA 4OIXA 1DQ9A 4M1KA 2W8LA 4ED8A 4OZ2A 4Q2LA 4DFPA 5AXMA 3CPWR 3PV8A 2BOPA 2VG5B 4URGA 2OP5A 2K1RB 1R3NA 4KE5A 1TP7A 2YKAA 5KOWA 3GJRB 2J9EA 1XMOJ 4UOGA 4C7QA 2Q66A 2HQ3A 2OELA 4KHRA 4KPYA 4HHJA 3GG0A 4MIAA 1FEEA 1HHSA 1TL3A 4W92B 3W5XA 2DGWA 4X84A 4C4WA 3HPOA 4NOHA 1IN0A 1DRZA 3E3XA 3M8PB 1HR0J 3BR8A 4R5PA 4BHQA 3VAHA 2L08A 3IM8A 2WVDA 2R2UA 3R5JB 3T1AA 5M2RA 4LF2A 4LF4J 1ACMB 4PXDA 4O3OA 4F4YA 1HL6A 1X7VA 1RT3A 5CCLA 1U49A 5FLXU 1OYEA 1N36J 3MMAB 5HN0A 1TV6A 1TL7B 3AD9C 2WW8A 1VFJA 4U9RA 2C2DA 3PR4A 3DOMA 3FC9A 3L7OA 3ZZTA 3D0IE 5DG8A 2W2NP 1JJ2R 3O2IA 2B9YA 4CLPA 5HO4A 5AJ3J 4TLRA 1UEUA 2KHCA 2HLUA 3Q8PB 4ZPWR 2VQEJ 2AYMA 2ILZA 3S7RA 1S1UA 1U1PA 1DTTB 1WSRA 2JSXA 4EI2A 4AUKA 2ZE2B 3K2YA 3T1HJ 1FD2A 2XM3A 4C0BA 2BQUA 3CTRA 2IBOA 5F9LA 4F67A 4F7VA 1TKZB 4K4ZA 2OPQB 1JB0C 1FRLA 1LWXA 2DRDA 4PG8A 3J81Y 1LOUA 4N7TA 2AHOB 4DV6J 5EN1A 3Q2SC 1VDHA 2RSQA 4RO0A 2QMUB 3R2DJ 4WKYA 2KG0A 3L09A 3L3CA 2EKYA 2BDPA 3SEOA 4KC5A 1UJ5A 4DN0A 5F3TA 4C98A 2ZBQA 3D28A 3I55S 3GFZA 3DGPA 4DL4A 4AXJA 1VQ5S 1OS5A 1N0UA 4E2FB 5KAKA 2JEFA 4WFXA 3KG0A 4I6WA 3UN3A 4LRDA 3GSIA 3CNQP 3LWLA 3CDUA 1U1KA 1F5AA 1UJ6A 3ETMA 1NJZA 1FKPA 3I32A 2Q3PA 2CNOB 2FLLA 1LEOA 3P6YC 1XMBA 3V5RA 2HLTA 4X64J 2DTJA 2K06A 4OYWA 3TAMB 4O3QA 3W64A 3VTIA 4IRKA 4J9MA 1LWEA 3SIPB 2GMLA 2VC1A 4MYUA 5A0YB 1HBUA 4WIQA 3C14A 1X0PA 2VBXA 3DLEA 2FY8A 3F73A 1WUUA 4J9KA 2ZNZA 1M5KC 3M05A 2W2PP 2B4VA 2DVIA 3QGHA 5IC6B 1YJ9S 2WB4A 1RYRA 1AW0A 4IFYB 5BYSA 4EBDA 2OKQA 4X62F 2B7CB 2JVRA 4DZ6A 2A10A 2ZKUA 3UVJA 4ED2A 1PCAA 2DGSA 3CJQA 3QMQA 2J9DE 1AZSB 3CCES 4H4KC 4FYWB 4Y2MA 1HD0A 1DBDA 1RT7B 3PM9A 5LMUF 3BBFA 3IRXA 1G6BA 3R5CA 3LA0A 3T5JA 4JI4F 2E5GA 1XERA 3CO0P 2YXLA 4N56A 2W01A 1C2PA 2VZ9A 1H2TZ 1D9AA 3MDFA 5CXTA 2GV1A 1NJIT 2YKOA 1N33J 3IFEA 3KHLA 3IR7B 2DNHA 4OLOA 3LP1A 4LF1A 3NGSA 5KG6A 2B43A 1U1RA 2ASDA 3VAGA 1B70B 1H73A 3VVUA 1IJEB 4ZCKA 1IVZA 3ZXWA 3R8YA 2XMAA 4OYXA 2LU2A 4PQAA 2D3O1 4K0KJ 4O4GA 3Q0AA 1M1HA 2U1AA 3QT6A 4Q5VA 3OLAA 5AE1A 3HP6A 1NHKL 2HHPA 2IDLA 2AEFA 5IC4B 1FVSA 4UY85 5GMKa 1URRA 2NPFA 4FS2A 4EZ6A 4MTPA 2WVEA 4U95A 2XMWA 2VQFF 4HYKA 2V8VA 2Z2LA 4K4WA 2HIYA 3QPIA 4HACA 2O01C 1NDKA 1XR6A 3L4BC 2HPUA 1IR0A 1HYSB 5KG4A 2B8PA 3IN5A 1UVNA 5I42B 2XMMA 3KLGA 1B3TA 4ZCLA 3RJMB 4RNMA 2OEKA 1X60A 4ANEA 2YBVA 1Q4RA 2CQDA 3ILIA 1UCNA 3R5DA 4JV1A 4KIAA 4DSLA 3KLFA 4ZVOB 4DX5A 3HHLA 3LANA 1FHTA 1QE1B 2VPWB 1I6JA 5A6PA 2R2SA 3DU5A 3I0SA 1VOMA 4NLWA 1HI0P 3N6LA 5J2PA 3PNIA 1WKKA 2MKHA 2BOAA 3KJFB 1FERA 3JSMB 3O8WA 1U8WA 4EU0A 1T9VA 2OIHA 4U7UK 1D9FA 4NI2B 2EC0A 2E29A 4Q0BA 5B0CA 3BGRB 3MM5B 1CLFA 4LBIA 2GCFA 2AV5A 2V4JA 1VQ7S 5GMEA 5D3GB 3Q8RB 2UUCJ 4ITSA 2VPYB 1WF1A 2DNKA 4HDHA 2YWKA 5D4PA 2KDOA 4F3MA 4ZVEA 1HNIA 2LXIA 3BB5A 3KHRA 1JLBB 4Q7AA 3DRPA 3GZ7A 4WTOB 2NUHA 4N8OA 3PIOQ 1F1BB 1ZPVA 3ZC4A 2V2QA 4FYYB 2RU3A 1Q78A 5CYMA 4Y00A 4QIFA 2FHOB 1FNMA 5A2QU 4TVAB 3AH6A 3UNGC 2HNYB 4RNNA 4JI2F 4FP9A 1Y3KA 3ONQA 5K20B 2MJUA 3P4UB 5CQGA 2DY9A 5HMYA 2DXFA 4NZ0A 1NSAA 1NDPA 3SCLE 2VG6B 3QIPB 1TFYA 2N7CA 3DYAB 2Z0GA 4WWSA 1WKLA 2FLNA 4N76A 3MM9A 4JI0F 2IJRA 1A9NB 3GB0A 3QNWB 3F0NA 4OJ3A 5K8NA 3GV7B 1VJWA 3EUNA 3W9IA 2ALYB 2IVYA 1W7WA 2QYGA 2B5JB 3TO8A 1N5TA 4OZ3A 1RHQB 2IA6A 2WK4A 4WJBA 4QU6A 3RW6A 4MAKA 2GGPB 2R8KA 3I9ZA 2BABA 1YITS 5HL7Q 3AXMA 1NO8A 1ZAWA 3ILOA 2FVSA 2Y9HA 2F1FA 4B3RF 1IWGA 1G3OA 1HMVA 1F6TA 1ZOTA 2AZ3A 5J1EA 1FVQA 2UV8A 5L39A 4KFBB 3PXGa 2YWHA 4OX6A 3JYTA 5GAEI 2RKIA 4IOBA 1NCLA 1ZM4A 3W9JA 4P10A 5D0RA 4ZPBA 1AUDA 1J5EJ 4Y28C 1U2FA 2QSWA 3SV4A 2G9OA 1D9DA 1TZ0A 2MQNA 3W62A 2B4UA 3OVAA 4XO0A 5JJBA 2FHKA 3KDNA 1UVKA 1S9GB 3KK3A 4EYIB 2DPIA 1CG2A 2OPSB 4G6VB 1W2IA 3MAAB 4QWEA 2Z2YB 3TA2A 5ETRA 4ATNA 2FD2A 1S9EB 3ZTOA 2LXUA 2FJXA 5E3CA 1WWHA 1MG7A 3FMBA 2GX8A 1YLXA 4F26A 2YKNB 2ZH8A 3KTQA 1Q5VA 3TNVA 5JXSA 1JLGB 5RUBA 1JJ4A 2NLWA 1YTYA 2J6UA 1FE4A 4ZS6A 1Q8BA 2ASJA 2WCXA 2RT3A 2HGMA 4Z37A 2QA1A 3F44A 2CPJA 3DRSA 4RNOA 1F0XA 4OYPA 3TZWA 3C6TB 3HFVA 2LP4A 4MKVA 1VQ9S 1JXVA 3KLHA 3K59A 4F4KA 2BJEA 2C3UA 1S4FA 3HVWA 1RA6A 3VGTA 3GIMA 1TTHB 3UE2A 4K4SA 3WZ0A 1RT5A 2Q6BA 1S99A 1F2GA 5J2NB 1X9MA 1PILA 3X1LB 1Q8LA 3HHKA 4TY9A 1R7IA 4TNOA 5A8KB 3H42A 3N9UC 3O6QA 1XJWB 3KMSA 3TYTA 5ETTA 2B4PA 3CDAA 4RUHA 3CCMS 1WHVA 3UDCA 1T05A 2NPIA 5AE3A 3PEHA 3T1YJ 3QQCD 4DG1A 2HWIA 5KG3A 3D9BA 5LSLA 1E6YA 3OSNA 2XLIA 2E5LJ 1KQFB 3AB2B 1M5OC 2W2MP 3DRRB 4OZ1A 2CRLA 1JX4A 1SIWB 1RACB 3IBFB 2DEJA 4LFBF 2EFPA 1HA1A 1X0FA 5F8HA 5D15A 1DTQA 3ZTRA 4A46A 3W5YA 1V3RA 2H9ZA 2WVCA 1NB7A 5DGBA 2WBMA 4CLZA 4M5IA 1SL2A 1FDDA 5IFMA 4DN9A 3ET6B 2FJAB 3N6NA 1VQSA 4FNIA 1HNZJ 1VRQC 1SC1B 2GMHA 4X4VA 1VHIA 4ECRA 4NL5A 3K5PA 1JIHA 3OL8A 4OYBA 2CJBA 3PG9A 2XWXA 4NA3A 3EPGA 1Z2LA 3R1LA 1EZZB 1KDNA 3PYEA 2BJ7A 2X1BA 2CQ0A 3ICLA 4ALZA 4YY3F 2E1MC 1HIYA 3QT7A 4UY8T 3BPDA 1HPZB 1NB2A 1TMMA 4RBTA 2FGOA 1VMBA 4H4KA 2GQQA 1KKHA 1HFEL 2LQ8A 4FVCA 2CPXA 4QR1A 1BQMA 2HFSA 4ID5A 1D09B 4LF7F 4I7FB 2GIQA 4FZVA 2OO4A 5SUHA 2CKWA 2B51A 2D7SA 3HMJG 3P3DA 4Y2IA 4I6AA 3A8IA 2C28A 3ENAA 2KFYA 2WTFA 3UW1A 3OXLA 4JI8F 1EETA 1QUPA 3DCAA 2B6AB 1RHJB 1RHKB 1T3NA 5L9NA 2BQ3A 5E3PA 3DOMB 3IXQA 2VONA 2I8EA 5LMNF 3T5HA 5HJXA 3PX4A 3F56A 2NSCA 4I2QB 4CCHA 4I6YA 3BDEA 4QPTA 4DEZA 2JRSA 3ZZOA 1I51B 3PRBA 3POTB 2IMWP 4IG0B 2HK2A 1U26A 1S10A 1IKYA 3AQOA 4EFAC 3V81B 2XHCA 3DDIA 2A2CA 4EGLA 3TANA 3EGVA 1S1UB 1OWXA 3K57A 3DOLB 3D68A 2C3YA 1YJTA 6FD1A 2W8KA 5HJYA 4AQYJ 1PAUB 3B4DA 2L41A 1N34F 3RGIA 1XK8A 4AE5A 1SPBP 1RAHB 2MHNA 5BYQA 1RAEB 4J9OA 3JSBA 1NHUA 3CC4S 5A8RA 1R0BG 4ZJOA 4JB8B 4DV7F 4B9LA 4YOEA 2RDDA 3TQEA 2XYGB 1RDRA 4JI5J 3TZYA 3QT5A 1X5OA 4YR3A 4B3TF 2FGCA 4NLYA 3R97A 1S1XB 1J5OA 2FY1A 2MQLA 1MN7A 2WSCC 1C4CA 1RT1A 1NLKL 3JB9k 1JNZB 4C8YA 1VQPS 1WC4A 3LO3A 4NA1A 2WZ1A 4H4MA 4Y6IA 4PR6A 4LFAJ 4DR1J 4RW7B 1BXNA 1NZAA 4LF9F 4X66F 2HHQA 2M0GB 3D6FB 3OT9A 4WXWA 1CULB 3KFWX 4XDCA 1EAYC 5IT0A 2WVBA 1NAQA 4C8MA 5HQLA 1FKPB 4PWWA 5LM7E 4WU2A 3SCKE 1L3VA 4CT8A 3EYZA 1RK8A 1HBMA 1TELA 1RWVB 1PAEX 4QYRA 3EVMA 4MT1A 4N41A 2NXJA 2MZSA 5I3UA 4KGXB 1RLDA 4FF1A 1S1TA 4C8ZA 3LTOA 1F5CA 2RMLA 4XPCA 3GR0A 2W9BB 3C66A 2NUUG 2EW9A 2HFUA 4W90B 4YQWA 2RRNA 2PFDA 4Q43A 2BV3A 2R42A 3OV7A 2KT2A 1R43A 2JH3A 1KTQA 4O23A 4PQUA 1HNXJ 4V19J 3UNYA 4GKKJ 1X4GA 3R6GB 2C3MA 4X4TA 1RWUA 1VS3A 4P6QA 2YH1A 1G4CA 5KT5A 3NNCA 2BKPA 4YHHF 3IAS9 1NRKA 2UUWA 2NREA 3D54A 3AB4B 4ELVA 1RWKB 2A0FB 2ZWPA 5KG0A 4CO0A 1RTJA 3LPYA 2NYHA 4RX6A 3T6JA 4DU8A 1VBYA 4U67Q 1JXEA 1X4BA 4DCOB 4YB1P 1SKSA 2PEHA 3DOKB 3LWMA 1VYAA 3ZZRA 3SQGA 2C2OB 2F40A 3FZBA 3CD7A 4O3RA 1AXQA 2MKJA 4DUZF 3TJ8A 1P9QC 4G65A 4C97A 3QSYB 1VCTA 3D2WA 2DGXA 1O5JA 4UOFA 4OX9F 5EHHA 1H6KX 4CLTA 2IA0A 4M5JA 3QGPA 4P9SA 4ECXA 4ENOA 1M90T 2I2YA 4O4GB 4RWXA 3RB6A 3KLVA 4CLSA 4NLGA 1YHQS 3CEDA 2EG1A 1HI1A 4C3MA 4NYPA 2MLZA 3M9OB 5KFXA 3KLIB 2VD3A 4G1QA 2XTJP 4H54A 2V94A 2KHDA 1L3KA 2OEJA 3ENVA 1U6ZA 4HACB 1RAFB 3PJWA 3ZNJ1 2ZH2A 3X3UA 3LP2A 3EZ5A 2HS3A 3MXHP 4DSEA 3QRRA 2EFOA 3RAMA 4XK8C 2B9EA 4DV0F 2W4DA 5L8RC 4JI1F 2J0QD 4MK8A 4X4QA 3FBFA 4F0MA 5HQMA 1V9OA 3M2UB 2LEBA 3D1OA 4AL5A 3MTKA 3ZNUA 4DL3A 3KLFB 4FYVB 4ZA1A 4WCEQ 3HHLB 4NCAA 3IG1A 2C42A 3BSAA 5K8OA 2BXJA 2ERRA 3NKYA 3R7NB 1CQMA 2G2OA 3I0SB 1VQ8S 3BKUA 5J2PB 2VIHA 4N5SA 2ATLA 1GK8A 2JEJA 1WDTA 3LP0B 2EC2A 1PKUA 1F3FA 4B3OB 5B0BA 3OBIA 1RT2A 3MAHA 2KJVA 3I0RB 3CJ8A 2JEGA 4RW9A 2HHHF 2OD4A 1NK0A 2JLGA 4ELTA 3EZUA 4U8YA 1C0UA 4Q0BB 2M4MA 3EJMA 4X62J
chains in the Genus database with same CATH topology
4LJMA 3M1VB 3DLLQ 4A8OA 3Q8QB 2NS1B 1C1CA 1K0VA 4MKBA 1NK4A 3EXYA 2DO4A 3LAKA 2I1RA 2B9WA 2EFGA 3DHWC 1ZH5A 1RT4B 2CQ1A 3VAIA 1X5SA 2JFDA 2ZD1A 3AHPA 4HTJA 4LVNP 4ZPAA 5J2MB 5LJ5Y 3MUVP 1VIOA 2DNPA 3IC1A 2AJ4A 2W7AA 4WU3A 1HBNB 3HO1A 3OFFA 3ZZUA 1YJVA 1NK5A 3M32B 4NRUA 4WFNQ 1Y5LB 4DPOA 1D0EA 3N79A 3H5YA 2DHGA 2U2FA 4WFZA 2PN6A 4ZPCA 1RT6B 3BN4A 1YSJA 5E33A 4ZK7M 2AYBA 1MMLA 2MZTA 2DK2A 1NH7A 1YI2S 3DRPB 1FXDA 1YJUA 2CDQA 3BF4A 2OPRB 1TKXA 3H40A 4WFYA 3U1MA 1SH2A 1SL0A 5BR8F 2QEXS 3CJKB 1FKAF 1SJRA 5DM6Q 2M8HA 2UXCF 3T19A 2LECA 1MU2A 2IHR1 3M2UA 3LALA 3P5TL 4EUVA 1S6UA 1CVJA 2D9OA 5CYQA 4ZDNA 1N6QB 2IVMA 2HAIA 4YEAA 1R31A 1TL3B 3GIIA 3DRRA 3A1YG 4PUOA 1OQ6A 1N52B 2CQBA 2RS2A 1BGXT 4PKDB 4ZPTR 2O67A 4LSLA 5D4LA 1TK5A 3IBWA 2FC9A 4QIWD 3KK2B 4DV5F 2DR9A 4JI5F 3RZAA 3DXSX 1KQKA 2C3PA 2LLZA 3RU0A 5C25A 2UUAF 1DQAA 4IH5A 3TA0A 4ERDA 2JEIA 2MQPA 4KQZA 4NCBA 1FXRA 3A8EA 4RUCA 4B9SA 3JTNA 3SDEB 4WE1B 4R5PB 1UL3A 2DO0A 7FDRA 4BC9A 2DHAA 3LGMA 4KV8A 4CH1A 4LF6F 3CCJS 2RQMA 4J9RA 4K4TA 2VA3A 1VBXA 5KFWA 2NR0A 3WC0A 1UKUA 4CI0B 4XDDA 3AA8A 3OTOF 4CQ1A 3T5LA 1Y9OA 3N5FA 3QYYA 4DR5F 3H59A 1RYSA 3LP0A 1LWCB 1RT3B 5HMWA 3IGNA 1IQTA 2YQ3A 4B3OA 2DBBA 4DLGA 5F8JA 2X51A 2MQQA 2WB1D 3CCRS 2NQPA 2EWHA 1FT8A 2FLPA 3KYLA 3TVKA 3OUYA 1DQ8A 3G6VA 1QY7A 1HQEA 3BS9A 3I0RA 2ZJPQ 1VRUB 1XBWA 4B02A 4X65F 1TV6B 2JFKA 3I96A 4DR1F 4LFAF 4M8LA 1N5YA 1MWYA 1JWWA 1OPIA 5KFTA 1S6OA 3OJUA 3KK1A 3RAQA 3MOZA 2MJNA 3UCZP 2PMZD 4QJVA 2ACYA 4R8UB 1VRTB 2LYVA 5E5NA 1U25A 5LXYA 3K7RA 5EWGA 2AGQA 1PC4A 3DLGB 4ZLPA 5HP1B 1T94A 2HMIB 2LVWA 4A47A 1L3UA 1XWLA 1LKZA 3DU6A 5KFAA 2CPEA 4PPDA 4FNHA 4BWMA 2RVJA 2IBKA 1FKOB 3MGJA 2DT9A 3VWSA 3M1VA 1FE0A 3OVSA 2UXBF 4OIXA 1N5QA 2BW2A 1QAIA 3L7PA 1DQ9A 4M1KA 4CNZA 3O3LA 2W8LA 4ED8A 4Q2LA 4DFPA 5HMZA 5AXMA 1X4DA 5L1JA 1RT4A 1UWBA 4ILMA 3BSNA 5BJRA 3CPWR 3PV8A 3KJVB 2BOPA 2VG5B 4URGA 2ZOMA 3CD5A 3MFHA 2OP5A 4BCAA 4IH7A 1C4AA 4HT7A 3TAPA 5GAHU 2K1RB 4QW8A 1R3NA 5AXKA 2CQ4A 3T1HF 1S1VB 4KE5A 4IO9Q 4WXOA 5I3PA 4TQRA 2MZ1A 1QVFR 3M32A 1TP7A 1IKVA 3CB4A 4ZCMA 3VALA 2IM0A 1JJHA 1QLNA 4HTIA 3NWGA 1YGYA 2YKAA 5KOWA 2J9EA 2XMJA 3CVKA 1P27B 2K7JA 5DGAA 4C7QA 4LVOP 2Q66A 2HQ3A 4WIIA 4RLEA 1N4LA 3Q2TC 4KHRA 4ECWA 3C8YA 4GMKA 3DC2A 3GG1A 4KPYA 3HVTB 4HHJA 4C11B 2DIUA 1TL5A 4DV6F 3GG0A 4MIAA 4DS4A 1FEEA 1KTVA 1HHSA 1TL3A 5IT4A 1Y0HA 4EEYA 4W92B 3K5OA 3PW4A 3MZIA 4KGMA 2DGWA 2GQ2A 1R8PA 2W25A 4X84A 3HPOA 4NOHA 4C4WA 2YKQA 4OV1A 5DQIA 4Q8FA 1KLNA 3KK2A 1IN0A 1DRZA 3MR3A 5HI7A 2AP6A 2XCPA 1SC6A 5DG7A 3E3XA 5DO2A 1FD8A 3TUJC 3M8PB 1U47A 2JOQA 3T9NA 3NCPA 4IO1A 1VQ4S 3NCQA 1U6FA 3BR8A 1M5VC 2B0GA 5KFEA 3SDEA 3PZPA 4R5PA 4BHQA 3VAHA 2L08A 2XSFA 2UVRA 5J1EB 1WEXA 1VK8A 2ZUGA 2R2UA 2ROPA 4F25A 2OSRA 2K8GA 3MUMP 3T1AA 3IWNC 5M2RA 2DH7A 4M63A 2VOPA 2G13A 3R27A 4PXDA 4O3OA 5C24B 2V4QA 4F4YA 3JYTB 4MFBB 1HL6A 4DJBA 1X7VA 1RT3A 2YKPA 3MPVA 4DL6A 3D1QA 1FK9B 1KONA 4NPOA 4R0JA 1YIJS 5IXUA 3MF5A 1VQKS 5CCLA 1U49A 1TR0A 3CIMA 2ADBA 1N5SA 2CFXA 4KHPF 4Y65A 4KKOB 1MSWD 3MMAB 1VRUA 2MY8A 5HN0A 3S8SA 1TV6A 3N5BA 1ZAXA 2DR8A 3HDSA 2WW8A 3J7ZT 1VFJA 1Q8IA 4U9RA 3MR2A 2C2DA 1PC5A 5KT3A 4R8UA 4J9PA 3PR4A 3DOMA 5KT7A 3DLGA 1U1QA 5DM7Q 5HP1A 3L7OA 2PI5A 2DD8S 2HMIA 1QSSA 3ZZTA 3NNAA 3D0IE 5DG8A 1D8ZA 2RF2B 1FKOA 2CVEA 2OH2A 1JJ2R 4P7VA 3O2IA 2B9YA 1TQLA 1AFJA 5HO4A 1FA0A 4TLRA 3KJVA 2PGCA 1UEUA 2KHCA 2ROGA 3DRYA 5G0RA 3SMZA 1G1XA 2OMOA 2HLUA 2WAQD 4A8WA 1W25A 4OI6A 2K1RA 3Q8PB 3H2LA 1S1VA 1HWLA 4ZPWR 1R8AA 2AYMA 2MY7A 2HGLA 1HBOB 2ILZA 3S7RA 4M94A 3OHBA 3BGFA 3M6VA 2GMJA 5H9FJ 3B8HA 1S1UA 3DMJA 3TUZC 3BJYA 2D3OR 3KHHA 2Q1LA 1JLAB 4CNYA 3BO4A 2DGQA 1LW2B 4CTAB 3J80Y 1U1PA 2AJQA 4DQQA 4A8QA 1DTTB 2O5DA 1F60B 3GIJA 1RKIA 2JSXA 4I0WA 4HL9A 2DITA 4AUKA 2ZE2B 2W9CA 2HWTA 3K2YA 4ECVA 4ZP7A 4AL7A 4WK3A 1FD2A 3FDSA 2QV6A 4C0BA 2YKMB 2BQUA 3CTRA 3QLHB 2IBOA 2N3LA 4TYAA 1A6LA 4N77A 3FJ2A 4QR0A 5F9LA 3QWUA 4F67A 4YB6A 1LWEB 1TKZB 1REVB 3Q22A 1HNWF 4K4ZA 1VC6A 2OPQB 1JB0C 1FRLA 1NK7A 4B3MF 1FJCA 4DMZA 3MMCB 3M8PA 4PG8A 3TQ1A 1HBUB 5L9XA 2A2DA 2KH9A 1JKHB 2CIMA 2DNLA 3CCQS 3J81Y 3FEZA 1LOUA 2UVWA 5F8MA 2XLJA 3SYZA 3M8QB 5EN1A 3BQ1A 2FVQA 3Q2SC 3S01A 2ZNYA 2P9GA 2CPHA 1S9FA 4IQMA 5K14B 4UUXA 4DFJA 4L3NA 4ED3A 4X4RA 2LQ9A 3DLEB 4NRTA 2RILA 5J1NA 1KD1T 2RSQA 1FXLA 1SKRA 2IJFA 2ZITA 4NMLA 2ZZMA 2HS4A 1DFDA 5JVHQ 1YRXA 1KHWA 2KI2A 3NS6A 2YNHB 1FK9A 4URSA 4WKYA 2J0XA 2BZ2A 1UVMA 1Y5IB 2KG0A 1NK9A 3L09A 3L3CA 2EKYA 5D4OA 3RRHA 2VA2A 3F41A 2YNFA 1TKDA 2BDPA 1RQ0A 4KKOA 3MMAA 2FC8A 5HBMB 2MSSA 3SEOA 2ZDPA 4KC5A 4EWTA 1UJ5A 3CC7S 4DN0A 5F3TA 2R7TA 4C98A 4FPRA 2O1PA 3BEGB 3D28A 4WZQA 3I55S 3E01A 3GFZA 3DGPA 5EX0A 4ECQA 4DL4A 2RF2A 4AXJA 3M6WA 2QA2A 1JLQA 4ZKAA 3I82A 3HHNB 1SIZA 2M52A 2AGOA 1WACA 2QLWA 1VQ5S 3IR5B 1OS5A 3EGWB 1N0UA 4F2SA 5EX3A 3QO9A 2DGOA 3KLEB 5KAKA 2JEFA 1H0HB 3BGLA 4WFXA 3KG0A 3MEKA 4I6WA 3VZIA 4C8KA 1CPZA 5BYRA 3LWLA 1VBZA 4KJIA 3CDUA 2XS7A 5KFUA 1U1KA 4WYLA 3NAHA 4DWIA 1F5AA 1FO1A 1HBOA 3CDWA 3NP5A 2HHVA 5KG1A 1URNA 1U7LA 1UJ6A 5B09A 3TI0A 3T9ZA 2XLKA 3IRXB 3PO5A 4LUBA 2ZZNA 4HH0A 4K4UA 1JLAA 3ZFVA 1UA1A 1NJZA 1FKPA 3I32A 3IO1A 2Q3PA 4JI7F 2DGUA 3MM6A 1S0VA 2FLLA 3W7BA 3E8OA 3MEEA 2R8GA 1YRUA 1DTTA 3IA0A 2Z4PA 2HFNA 3E51A 4Q44A 1XMBA 3P6YC 3V5RA 2VFTA 1G7CB 2J7UA 3CD6S 2HLTA 1VQYA 2VFVA 2DTJA 3M9MB 4PWDB 2PA3A 5KFYA 2DHSA 2I0XA 1ZYQA 2BJDA 3HLUA 3PACA 1RA7A 3TAMB 1WHWA 2OTJS 2ZH3A 2YKMA 4EZ9A 3NNHA 2JZ5A 4O3QA 3QLHA 4CO5A 3VTIA 4R0EA 2XGPA 4IRKA 4FYDA 4J9MA 2IJNA 4A8YA 1LWEA 1WG4A 4NWBA 1REVA 2GMLA 4OZJA 5B7WA 2WOMA 4RBUA 4WF9Q 2K7KA 5KG2A 2VC1A 4V19X 4MYUA 3MMCA 5A0YB 4I1TA 4Q45A 2KZZA 1GH8A 2GHWA 4IG3B 1HBUA 1JKHA 1RTIB 5E3QA 4X4SA 1OO0B 2IM3A 2IYGA 3LP1B 1SV5B 1U1LA 2KVIA 4ED5A 3M8QA 4U7CA 2XB2D 3GMGA 2GC8A 1X0PA 3WDOA 4RNFA 4DG1B 2VBXA 4K50A 3DLEA 4FF2A 4D3GA 3KOAA 3F73A 1KLMA 4J9KA 2ZNZA 2GJIA 1M5KC 3M05A 1I94F 1APSA 2AJ0A 5F0UA 2B4VA 2DVIA 2YNHA 1LXJA 4FF3A 1QSYA 3QGHA 4ILRA 5ADZA 1YJ9S 2WB4A 1WF0A 2R2TA 1UAWA 2MKSA 3DLJA 4OI4A 4QOTA 1RYRA 1RP5A 2QRRA 1AW0A 3I31A 4IFYB 5HBMA 1PO6A 3U1NA 1TKTA 3SZ2A 2B3TB 4P2SA 4M5DB 5BYSA 4EBDA 2OKQA 3DI6B 3NBPB 2UZAA 1K8AT 4X62F 2B7CB 2JVRA 2VL1A 2AWZA 1KEKA 2A10A 2ZKUA 2R9LA 2F9DA 4ED2A 2DGSA 4NLQA 3BN7A 2XCAA 1MMDA 3I5AA 2R7OA 3QMQA 2J9DE 4TU8A 1U6BA 3KLEA 3HKZD 5CD4H 2BR0A 3NCRA 5K5MA 1YVFA 2HQIA 3CCES 1ELOA 3CCZA 4H4KC 2HHSA 5KFHA 3OQ2A 5AE2A 4B9NA 2F8MA 2J7KA 4LT6A 4QR2A 4Y2MA 1HQUA 1HD0A 4J9QA 1DBDA 2J0WA 1U4BA 3V2UC 2MSTA 4B3SF 1RT7B 4WYWA 3PM9A 4I4BA 2KKHA 5LMUF 2L9DA 1K9MT 2QIFA 3IRXA 2FUG9 1EP4A 4C0HA 1TVRB 5DLGA 1HI8A 4PCQA 1G6BA 1Y5NB 1B0PA 3R5CA 3V4IA 2PI4A 1NJWA 5KFQA 2KO1A 2CPYA 4PG5A 1LK5A 3HKWA 2E9ZA 4PWDA 3RTVA 3T5JA 3TAQA 4JI4F 2B9XA 3PKMA 2E5GA 3DDKA 1WI8A 3HZEA 2HHUA 3BQ0A 2UUTA 3KLGB 4PRFA 4F4XA 3NS5A 1XERA 3TAMA 3EXCX 4DX8H 1FCAA 3PKYA 4N56A 3IGVA 2MHEA 1C2PA 4CH0S 2MMYA 3QZ8A 2PFFB 2VZ9A 1CEZA 2ZKTA 1H2TZ 3OXGA 1D9AA 3UCUP 3MDFA 5CXTA 4IFVB 2GV1A 1NJIT 2DH8A 4QZVB 5A0YA 2YKOA 3N6MA 1KFDA 3IFEA 4IG3A 3KHLA 1FRXA 3IR7B 2DNHA 1SH0A 1RTIA 2LQJA 4OJGA 4OLOA 3DLKA 3LP1A 7FD1A 1SV5A 3I5CA 3ISND 5KG6A 2B43A 1U1RA 2ASDA 3VAGA 3RB3A 1IJEB 3U1LA 4ZCKA 1DHMA 5ITHA 2WONB 3ZZZA 3QAEA 2VUGA 1CSJA 3MUTP 4A4JA 1S72S 2Z8QA 3GFXA 3IS9A 2DNNA 2VG7B 3P96A 4DR4F 1VI7A 3M2VB 4PXEA 2LU2A 3JTPA 2RQCA 3Q24A 4B9UA 5MAOA 1SJQA 3J7YU 3FSYA 3PX0A 1LFWA 4PQAA 4IFYA 4DV1F 4X2BA 4O4GA 2R8JA 5KT4A 1R8CA 4QYZJ 3GSDA 3FNNA 4RU9A 3Q0AA 2U1AA 3RR8A 3DI6A 3NBPA 4PG7A 4UQTA 4FS1A 2JLEA 3CWJA 4Q5VA 3OLAA 5AE1A 1XC9A 3E2EA 5B0FA 1U09A 2ROEA 1HWUA 1F9FA 4JUZA 3HP6A 5DRKA 3MM7B 4J5OA 3MURP 3T5KA 3HHEA 1B0TA 1IKWB 2HHPA 3PHEA 2EK6A 5J1PA 1FVSA 5HROB 1IBKF 2CYYA 2HIQA 4WFBQ 4UY85 5GMKa 1URRA 5T7LA 3MCSA 2NPFA 2Z2MA 2ZC4A 1NU4A 4FS2A 1U1MA 4EZ6A 4MTPA 4QCLA 2LDYA 1QSLA 4LF8F 1Z2ZA 2XMWA 2VQFF 4HYKA 1WI6A 2V8VA 2Z2LA 1RT7A 4K4WA 1KN6A 1KOHA 3QPIA 1ZETA 2O01C 3CJ2A 2F8EX 5GAGI 1XMOF 3FVYA 4O3PA