5DRKA

2.3 angstrom structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound to adp, amp and bicarbonate.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
89
Chain Sequence
IKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title 2.3 A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound to ADP, AMP and bicarbonate.
rcsb
source organism Thiomonas intermedia (strain k12)
molecule tags Metal binding protein
total genus 16
structure length 89
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5drkA00
1H3DA 3GSDA 4OZNA 2XG8A 3HLUA 3O8WA 2CZ4A 3LF0A 4CNZA 4YB5A 1NZAA 2E66A 5D4PA 2O67A 1NH8A 4Y6IA 2J9DE 1KR4A 2EG1A 2ZFHA 2RD5C 1HWUA 1V9OA 2J9DA 4YB7A 4C3KA 3AA8A 5DS7A 1VFJA 1O5JA 2GW8A 4CO0A 3AH6A 1GNKA 4RLEA 4CO5A 3M05A 2DCLA 4YB6A 2NUHA 3NCPA 2JJ4D 1UL3A 3X3UA 2GNKA 3N5BA 4WK1A 1UFLA 3L7PA 2PIIA 5DRKA 2J9EA 2O66A 3TA2A 4RWXA 5D4OA 1P1LA 2VD3A 3BZQA 2V5HG 1UMJA 1XK8A 4WK3A 3TA0A 4CO1A 3AA9A 1V6HA 4E98A 3NCQA 4USJC 4CO2A 1UKUA 2J9CA 3DFEA 4R25A 4USHA 2NS1B 3T9ZA 1Q1KA 4CO4A 4C3LA 4OZLA 2EG2A 1OSCA 4AFFA 4D3GA 3MHYA 4IYQA 3CE8A 1O51A 1NAQA 2Z0GA 4D3HA 2XBPA 1NH7A 2XULA 3OPKA 4USIA 1V3SA 1V3RA 1PILA 4C3MA 1QY7A 5D4LA 2NUUG 4NYOA 4RX6A 4Y65A 1VHFA 4OZJA 4RWWA 1J2VA 2ZOMA 2GX8A 3TA1A 3NCRA 3O5TB 5L9NA 4CNYA 2XZWA 4NYPA 5D4NA 4CO3A 3AHPA 4ZK7M
chains in the Genus database with same CATH superfamily
5KG7A 4L76A 4TU8A 1FFWB 4FF1A 2CPIA 2B5JB 2VASA 5I42B 4KKOB 2HHQA 3HVRA 3M2VA 2MLYA 2RKIB 1HYSB 4I2PB 1R0AA 1LW2A 2E5GA 4J37A 2EFGA 4ZP7A 3NXZA 4WTOB 2JEGA 3NCPA 4W98A 4LBHA 2EK6A 3C6UA 5CXTA 2IIHA 5LMUJ 1N33F 2J7WA 1H0HB 1Y5LB 4F04B 1UW9A 3OR1A 1FTCA 1Q8BA 1VRQC 1KQSR 2O1PA 4K4XA 4WF9Q 3VZIA 3T19A 1FK9B 2RDJA 1QE1B 5KFRA 3KLFB 5LOQA 4N5SA 3CCES 5IQ6A 2F65A 4NZ0A 1T9UA 5KFJA 3C46A 1LFWA 1UVJA 3IS9A 3FK4A 3O5TB 3PO5A 4LF8J 3PVXA 3ZZTA 5IT9Y 2DIUA 1IBMF 3E01B 3BGUA 4J9LA 4FBUA 4Q44A 1SC4B 4U6PA 2QZ8A 2QMUB 1RB0A 3UN5A 2I0XA 2QA2A 2OI2A 3GLJA 3BSOA 2ZBRA 2GIFA 4RNHA 4F4ZA 4QIFA 2N3OA 4F3OA 5LM7E 4NPOA 4XPEA 4OYMA 4DR4F 3BO4A 3PFEA 4OI6A 2R9LA 1RU2A 1RCOB 2J6SA 3OW2R 2HVZA 2IC3A 2FTRA 4ZOSA 2ZKTA 4Y2AA 3NS7B 3N5BA 2YX4A 1S1WB 3MM5B 3OT9A 3MWBA 2LQBA 5F0WA 5CYMA 1NJWA 3HMJG 1RHJB 1UJ4A 2DXEA 3R6LB 4RW8B 3RW7A 2WRMA 2OPRB 3LW5C 4ZPWR 1C4CA 2NS1B 4P2FA 4MAKA 1Q1KA 3IBCB 3SMZA 1LQ9A 5F8IA 4O3RA 5T41A 1N88A 4NLVA 3MEDA 2HHTA 3ENVA 2Y3YA 4W92B 1KQFB 3NS6A 3UD3P 4KFBB 2E5HA 4IQXA 1J2VA 2OJ3A 3GR1A 3Q2SC 2ZBCA 1VRTB 5ETRA 3HSGA 2XZWA 1LW0A 2K7JA 3PRBA 1KLMB 2MSTA 3HI9A 2PO4A 3RRGA 3NGDA 4DFKA 3QIPA 4CH0S 3D9BA 1RCXB 1S4FA 3FBFA 5EN1A 4CLKA 5DS7A 3I0SA 3TW0A 1RT4A 2RMLA 1SUQB 2FHOB 3QFHA 1QAIA 1SQGA 1J5OA 4KC5A 5J2QB 1NM2A 3DKDA 2M5YA 2L48A 2ZDOA 4F4XA 2ZM6J 1RADB 5DLFA 2FC9A 2ZH6A 3R3TA 4ELUA 4UQTA 1VOMA 1U6FA 1FCAA 2ZHOA 1IKWB 1V3SA 2DPIA 1FKPA 1S9EB 2ATLA 3NG8A 3JS9A 1QDUB 4CYUA 4CT8A 3WHIA 4ED6A 1TAQA 2FLOA 1DHMA 4XDDA 1ITPA 5KG4A 4DV4F 3KMSA 4JYAJ 4ZPAA 2ERRA 3L7UA 1D09B 1D9AA 1I5OB 4NX9A 2FHMA 2RIJA 3M2VB 3TVKA 1AYEA 1R0AB 1LW2B 2GW8A 3AH6A 3UNGC 5B0BA 1FFSB 4JV5J 3EXYA 7FD1A 3RR7A 3SCIE 4K5RA 1ZPVA 3FZBA 3C6UB 2LCWA 2D3OR 3OR1B 3ENQA 4CLLA 4KGMA 4CP5A 2POKA 3CCZA 2XMMA 1PCAA 3T9ZA 2VF3A 2CQ4A 4MIAA 3IWXA 2Z2ZA 1SPBP 2EG2A 5HJYA 2HGMA 3M8WA 4M5NA 1HI8A 2AJ2A 1SV5A 3PNIA 3IS9B 4XPCA 3HCXA 5HATA 4QQBA 2GMLA 3J7AN 1DY3A 2QFIA 1KRPA 5HSPA 3PJXA 1YBTA 4ZIVA 3R7NB 2KFYA 1Q5YA 4XTTA 1MWZA 4ZP9A 1WKLA 3G6VA 1N5TA 2VBYA 3JSYA 5D0EA 4USTA 1KC8T 2Q6CA 3D6MB 4K4YA 2HFVA 4OYXA 2R7TA 2IC3B 1N6QB 4IRKA 1B7YB 4IG0A 2HHVA 4IRCA 2UXBF 2AZ1A 1X4FA 3TQEA 2DR8A 4K0KJ 3PW4A 3GIIA 2F8HA 1VQLS 5CYMB 3OTBA 1KQGB 2GMHA 2VU5A 2WONA 2B9XA 2PA3A 1YJTA 2HGLA 1OY6A 3CJQA 2MKHA 1BUXA 2G4BA 1RTHA 5E3RA 2ZZTA 1AB8A 3LAKA 2DGXA 2BJ1A 1D0EA 3R6GB 1FRMA 2RT3A 2YKOA 4OI3A 2XHCA 3MEDB 1FJCA 2HRTA 2YKPA 2BJ3A 4W4MA 4ALZA 3WX8A 2CQBA 3DHXA 2ZVSA 3GIRA 5D3GA 5AXNA 2AYEA 3H8YA 3NNHA 4CO3A 4C0HA 3TJAA 2V0NA 1VR6A 1T8EA 2MQLA 2MHNA 2HKEA 1RTIA 3QIPB 4DR1F 2ZZMA 1H6KX 1HW8A 3MEEA 5J2PA 2J7KA 1ZTTA 1RT4B 4DR6F 2NLWA 4YR2A 3G6ES 3UD4P 2DHXA 1RE1B 4TQRA 1N0VC 1WC3A 4RJVA 4CTAA 3H5UA 3OLBA 3VQTA 1J5OB 4CIOA 3RB6A 4WK3A 2IBKA 3ZO7A 2IMOA 1R27B 3P4UB 1F0XA 3I6PA 5KG1A 2ZUAA 1QVGR 4K2XA 4E2FB 3C16A 2UP1A 2YKNA 4AFFA 2MZ1A 3H20A 1CPZA 2KDOA 3KXDA 5JUMA 1FKPB 1HBMA 5ETQA 3EGNA 4CYUB 3IMQJ 3CC2S 1K44A 3J80U 2DNHA 3JQMA 4YUDA 3CCQS 1J27A 3ISZA 2WOMA 4LQ3A 3CDEA 4X65J 5C7PA 2CPDA 2R7XA 1IN0A 2J9DA 1G2EA 3R5BA 2DIVA 1RTJA 4J9MA 4QWBA 4P2SA 3CO0P 2BOPA 3D0HE 5KFKA 3MURP 3BDEA 2DJWA 1VISA 2KHCA 2P2CB 4DUZF 1T3OA 1U7LA 4B3TF 4KHPF 1RJJA 1HBNA 4IFVA 1NHUA 1XQIA 4BWJA 1KVKA 2BEFA 1O6XA 3BQ0A 1NH7A 4IH5A 1SV5B 3LP2A 4ZCLA 4YR3A 5A6PA 4A8SA 5KFOA 3MF5A 4GKJF 1TTHB 1RT6A 4M5LA 1UFWA 3DXSX 5D4NA 2IJRA 2HQCA 1S4EA 2UUAJ 3MMBA 2F8MA 3EZ5A 2NXUA 2YH1A 2DY9A 1F9HA 3TYTA 4N7TA 2ZD1A 4EMDA 6AT1B 3LUYA 1TKTA 1JLCA 2CQ2A 3AJDA 1AW0A 4IG0B 2XEXA 3K5NA 2HFSA 4YB1P 5DQHA 4JP8A 2J0SD 2HMIA 3BS9A 1G3OA 2AJQA 1DQ8A 4WKYA 2IAJB 2WONB 2WB4A 4LF9F 1WSRA 2PFFB 2Z56B 4USHA 1RTHB 4C3LA 1RAHB 1JMTA 2RS8A 2DH9A 2C3YA 1XR6A 2MHEA 3OVAA 3TANA 1C1BB 1IM6A 1ZM4A 1Q7YT 2CQGA 2D9PA 1LNQA 1I94J 2L9DA 5D3GB 4I6WA 2APOA 2XG8A 2ASYA 3NAHA 3I32A 3H5SA 2F7VA 4MIBA 3FQLA 3I87A 2AMCB 1RWKB 4L74A 1DLOA 2YWEA 3W62A 4FF2A 3MM7A 4K7QA 1VS3A 3AA8A 1BQMB 3MEEB 5J2PB 2OAUA 3K2YA 1PAUB 3UPFA 2VFSA 4W90B 4CTAB 2ACYA 4RW6B 2F9JA 3GILA 2RJZA 4ECXA 1AROP 3JXOA 3M32A 4Z2XA 4P2MA 2NZ4A 4CO4A 1ZZFA 4C4WA 1K1SA 2UXCJ 2YKNB 4A8XA 4JI1J 2FLNA 4P10A 1TK5A 5I3QA 2XULA 1HBMB 4ZLJA 1P1TA 1U45A 4OV6A 1BQNA 1KDNA 3MMAB 4P72A 2X1BA 2FVRA 3OTCA 2V67A 1X4CA 2XMUA 1T05A 1FNXH 2WOMB 3N5FA 2JFKA 3HFVA 1RHUB 4O3QA 1WDTA 3PCOB 1XNQJ 1RTJB 2W7PA 3CJ3A 3G6XA 3CD7A 4A8OA 4DR7J 4MJKA 6FDRA 2HLUA 5LMNJ 1X0PA 2B9WA 1UWBA 5KT4A 1IJEB 3F0NA 4NXNF 4YMEA 2GQQA 2CUYA 1NK0A 2CQHA 2V2QA 3AY0A 1EZZB 1H7XA 4NMLA 4O4GA 3QPIA 2XY6A 3R5CA 4M5HA 1FKOA 2G2ZA 2P9EA 1YK9A 1FDDA 2PDAA 1E6YA 3JTPA 4C8KA 1BE4A 3SQOP 4OIXA 3LP2B 5A2QU 4DX6A 3WIUA 1UVMA 2WW4A 2RU3A 1RT6B 2AD9A 4NRUA 3CXCR 3AB2B 1OY8A 3GSDA 3MMBB 4IOCQ 4BBYA 3FSXA 2VQEJ 8RUCA 2QLBB 1X5SA 4NASA 4USWA 4NLSA 4ZCMA 3CCRS 5KT2A 1MN7A 1HNXF 3PYGA 3J7Z5 2IMWP 2HHXA 2E5LJ 1KOOA 2GZOA 1JLCB 2EC0A 1UAWA 2PC6A 2DXDA 2RHSB 3KJFB 1X4DA 5D4OA 2MKJA 4RUCA 5ETNA 5B7WA 1EB0A 2HMIB 3BGLA 2E9TA 3TRGA 3QYYA 2MKCA 4WFBQ 2VFVA 1S97A 3FMWA 2JZ5A 2LU2A 1URNA 4IYQA 5HP1A 1U8SA 1RWPB 3SBMA 4NLUA 4OX9F 2BE7D 2Q3PA 4P7VA 4CM0A 1PILA 3B78A 3TEHB 3GTYX 4FXDA 5E41A 1VQOS 3MXHP 2C2OB 2XZTB 2FJEB 5HL7Q 2DXFA 1NO8A 5L39A 1S9GA 2OSQA 2PT0A 2RVJA 4ZK7M 4HR2A 2GAHC 4XIUA 4X62F 4O3PA 1WHYA 1YDLA 1FHTA 1HHSA 1DLOB 4DPOA 4J9RA 2Z8QA 1RSCA 3MM7B 2LDYA 1R8AA 4NLPA 2YY3A 2Q66A 5CHCB 3UCUP 4WK1A 1HWLA 4JI6F 1R8CA 3H42A 4MTPA 4GMKA 2V4QA 3MPDA 2V5HG 3GZ7A 1XK8A 2B4VA 4IOAQ 4OX6A 5GAGI 2OIHA 2OH2A 2FUG9 1S77D 1MN9A 4TY8A 1OSCA 1T0TV 5E3CA 2ALZA 2WCXA 2GJFA 1BLUA 3R5JB 2B4OA 3I4PA 1BQNB 2VFUA 3SDEA 4ZLPA 2RDIA 4O23A 3TAPA 4ZN3A 2JWNA 1RUSA 1FWLA 3HHLC 3SCLE 1JXVA 1PYOB 1T05B 1WKJA 1K0VA 1H3DA 3OFFA 4UT4A 4B3SF 4K5SA 3QT8A 4IH7A 1WC5A 4ED4A 4L3NA 3TVZA 4CLFA 3J80Y 4YR0A 3IXQA 3D3BJ 3I4HX 3M8QA 4MT1A 1NSAA 1MWYA 4DR2F 4Q45A 4QYZJ 1RZMA 2C2ZB 2CVIA 3HF5A 3VCDA 1OSDA 2KM8C 4A8KA 1R31A 1SI9A 1CVJA 3M30A 2OP5A 3HKWA 3KMQA 2HS4A 1L3SA 3M7VA 4EZ9A 5B0CA 4YN3B 4FXWA 5IM0A 2WB1D 3UFCX 4CO1A 4PG4A 4HTJA 2EVZA 4O4GB 1NJXA 2HVEA 1U4BA 4LVOP 1FKOB 3MFIA 2CRLA 3HX9A 4KR0B 4ZJLA 5DDOC 1YIJS 3MUMP 1E6YB 2XNRA 1S49A 2EW9A 3UDCA 2G1HA 2G9OA 4QW8A 4F26A 4ANDA 4OYZA 2Y8WA 2KT3A 1VRUA 1ICEB 4F50A 1N5YA 3TX0A 2FJAB 4ZVRB 3T5KA 2DGTA 3HFKA 4LFCF 3HZGA 2VICA 3MGJA 1LWFA 4KBIA 2FJDB 1FERA 4JI3F 3GV8B 2IVFB 4U8YA 4RO0A 4NLOA 3PG9A 3T41A 1OY9A 3PIOQ 1WOOA 3UE2A 3HVAA 2DNNA 1P6TA 2M2BA 4AQYJ 1WEYA 2CJYB 4QR2A 4OHVA 2FZGB 2R7RA 4DV1J 3MEGB 1IQZA 3MOZA 5L46A 3IWNC 3CGIA 4LMZA 4LQ9A 2HQ3A 2EK1A 1VHIA 1L3TA 2AGPA 3ULHA 5HP1B 1TUGB 2C2KB 3RYLA 4RX6A 3PFOA 1SC1B 2QLWA 4RNNA 4B9UA 2CZVC 1RYRA 1XMOF 3MPWA 2CNOB 4WFXA 4LFAF 1S9GB 2GQCA 1X5TA 3K89A 2KXNB 1T9YA 3LPYA 4BS2A 3R27A 5KT7A 3O1LA 3RUBL 2H5JB 3M8SA 2VBXA 1PKUA 3NGRA 1C0TA 1Z1ZA 4FXVA 5LL6d 2Q43A 4I69A 4HHUA 2J9EA 1T02A 4JI0F 3LWMA 3ZZ0A 3ET6A 3C3LA 1MMLA 1HWKA 2B7CB 2X51A 2XLIA 1HKAA 2D41A 3M8RA 3Q8PB 4G65A 3NMRA 2IM2A 2J76E 1TK8A 1CJVA 3OL6A 2E1MC 2WZ1A 3UDLA 2E1CA 1YQHA 4CQ1A 1GXTA 3N6MA 3E8OA 1RAAB 3OHAA 4ANCA 4RWWA 4X4UA 4M5IA 3SSSA 2RHQB 3Q23A 5HN0A 2DO0A 1RABB 3H40A 2F40A 1YBAA 4ZPDA 4WFYA 1HNWJ 1H73A 3D54A 2CJBA 4QYRA 3H5XA 3NLCA 3M8QB 1FJ7A 4QBUA 5IOLA 4OJGA 3DLHA 3NRBA 2HAFA 4DV0J 4N77A 4IRDA 1GX5A 1MLAA 1VQ4S 4YB6A 3QGIA 3M30B 3VGVA 4ITSA 2HHHJ 4ZVPB 4OQJA 3L7PA 2PIIA 3L3CA 5IM0B 3KHGA 1FA0A 5BXIA 3F41A 4PXEA 3EVWA 2LEPA 1VQ6S 3JTOA 2VG5A 3PM9A 5KFCA 1KQKA 5KFGA 4JB8B 2DNKA 1VI7A 1UTAA 4ZVOB 2X1FA 3CJRA 1JXEA 5H9EK 3M2RA 2MSSA 3OPKA 5LJ3Y 4KPCA 3TI0A 4LBIA 3MR3A 2DHHA 2B43A 2WAQD 2R7WA 1EHWA 2UVWA 1XNRF 4OYWA 3HHEA 5SZTA 3AHPA 4Y2IA 3R9LA 1SJRA 2IBOA 2KO1A 4YY3J 1VRUB 5L1JA 1N5YB 3IAM9 1B0PA 3CDWA 3OXLA 2R8JA 1BXNA 3FSYA 4ZP8A 2E7VA 1LWFB 2BJ9A 1Q4RA 4GKKJ 4QR0A 4XDCA 1N0UA 4Z7YA 4CO0A 2XWYA 5H9FJ 4ZIWA 5JXSA 4TLQA 2HQGA 3NY0A 2Q6BA 3UDVA 3BGFA 1FX2A 5GAEU 4F3QA 2QYGA 4J9VA 2ZH4A 1JLFA 4TYAA 5B09A 3PO4A 2KXHA 4NA2A 2QN6B 1C1CB 1S1VA 4IR9A 4WXOA 3LANA 4AL5A 4USJC 2ZJPQ 2BOAA 2KVIA 1F9FA 1Y10A 5HMYA 1WHXA 5JVHQ 4F25A 4LF6F 2XBPA 4AYBD 2HIYA 4BCAA 4MKBA 4M1KA 3GYGA 2RAQA 5AT1B 4B9SA 1P27B 3KDNA 3M8PB 2VHGA 3VVTA 4DR3F 4EZ6A 1RU1A 2PD1A 2DGSA 4NCGA 5HMWA 4ID8A 1PO6A 1RHRB 3GJSB 2QA4G 1PIEA 1RISA 3CMAS 1V3ZA 1X0FA 3BB5A 3DOKA 1R3NA 4X64F 2HIQA 2CJAA 1HBOA 3ISND 2CIMA 4KT0C 1S48A 1C0TB 2E44A 3Q8QB 2XGPA 2JL9A 4OJ1A 2O3DA 2W9BA 4LRCA 3H2UB 4UUWA 3ET6B 5ITHA 2DHGA 2XSJA 3OTOJ 3CJ5A 3DOMA 2J8SA 2W8KA 3S8SA 1RXOB 3OBIA 2VPZB 1IBKJ 3JSRA 2MZJA 4FKYA 1QAJA 1V5IB 3R2CJ 1CJVB 1S57A 2ZBIA 3CJ8A 3D0IE 1GT8A 3DM2A 1TL3A 3OFGA 3OJSA 3FRZA 3D1HA 2HSEB 2HVDA 3FDSA 3IAS9 3LWLA 5HMXA 3BO2A 2E5IA 2W4DA 4HDHA 4ECSA 1K8AT 4J9SA 5GVQA 5LMUF 3QNWB 2KG0A 3KHHA 4FS2A 1U8WA 1XWLA 3CCSS 2AX1A 1EKRA 2YPZA 3VR1A 3M8YA 4JI8J 3J81j 2Q1LA 3NGKA 4F8RA 5D0RA 1IQTA 4GC6A 4LUBA 3RB3A 5E3AA 3GJRB 1GMWA 1YG0A 2YWKA 3CO9A 3CCUS 4LF8F 3PXGa 3Q89A 3KLEA 1IKVA 1T95A 2IVYA 1QUVA 2CJKA 4DPUA 3PEHA 1DQ9A 3M2RB 1GAOA 3V4MA 2QJ3A 3KJQB 5EX3A 4B3MJ 4JV2A 4J9NA 8ATCB 1VQNS 4H4KA 1KFDA 4H54A 5M2UA 4KHMA 2E9ZA 1L3UA 3W61A 1GMUA 2AW0A 2B51A 2BZ2A 3SCKE 1BY9A 3KNGA 2G2YA 4RW9A 2IRYA 4L73A 2B9YA 1O0PA 3S1TA 1HD0A 1KTVA 1XMBA 2AYMA 3ILLA 1SXLA 4ZHRA 1DZ5A 3Q86A 1JLFB 1KP6A 5F0UA 5DGBA 1FRJA 4LBPA 1RKIA 1S1VB 3EGVA 5KOWA 2YWWA 1U2FA 1HNZJ 4FYVB 3BSNA 2RNEA 4OZLA 3M1VA 1YRXA 3B4DA 3GSIA 1ZM2A 2BVZA 3VVUA 2Y0SD 4BWMA 3H0PA 4CDIA 4ECYA 1BC6A 2UUTA 1JJCB 1A0OB 4NYOA 1UJ6A 5AXKA 1RAEB 3DNCA 3EMTA 1IR1A 2H5IB 2JVOA 1GXLA 2ROEA 4U9RA 3HD2A 5KFQA 4NCGB 3HPOA 3MEKA 4DX7A 4ED7A 1Q86T 3DI6A 2ZM6F 3AXMA 5L1IA 2HZAA 4YEAA 5IC6B 1U47A 2YWFA 4C8ZA 1HBOB 4CLPA 4OI0A 2WBMA 2V50A 4L6V3 2W9BB 3TP2A 1WD6A 2FC8A 1WHVA 4DL2A 2ZC4A 1XMQJ 2M9KA 4ED3A 1HIYA 4IR1A 2OD6A 3PW2A 1TKDA 3CDAA 4UOFA 5K5MA 1SKRA 2UUBJ 4JYAF 1CSJA 2OTJS 4K4SA 3KUEA 5KFNA 4KB7A 3PDNA 4D3GA 2Z0GA 5K8PA 3L7OA 3HDSA 4JOUA 1DAXA 4KRWA 4URGA 2E5JA 3O2IA 5KOXA 1U24A 4M63A 3DM2B 1TL3B 3RBDA 4ZVEA 1RWMB 3DU6A 4JV5F 1A6LA 3CTRA 4PEOA 3FCHA 5IZHA 3IM8A 4IOBA 1LXNA 4DV5F 2H5EA 1SBRA 4ECTA 4BDPA 3IGNA 4KO0A 1R43A 5D0GA 1RBAA 3CD0A 2BACA 3H59A 2OEMA 2HHPA 5LT5A 4UTGA 3WIVA 3BSAA 4FPRA 4C8MA 2J6TA 5ETVA 2HVIA 4UOCA 3BKFA 4X4QA 5IT9U 2WVDA 3C2PA 2IDEA 1TQLA 3CCLS 3KLEB 1IKVB 2MPUA 2XI3A 1UFKA 3DFEA 4Y0FA 3NBPA 1FRIA 2KKHA 1SL2A 2H3EB 2VFTA 1LWCA 1OYEA 2HURA 3PHTA 2C2NA 2G13A 2RE1A 2MKIA 3AD8C 1UVNA 2P5VA 5F8NA 4XK8C 3OSPA 2CPJA 3P5TL 2LXFA 1DBDA 2CWXA 3UWTA 3ZZOA 4A8WA 2KT2A 1U1QA 1OPIA 3T5HA 3JB9k 4K0KF 1TUVA 4OZ5A 1ZYQA 2VZ9A 4PZVA 4ZVGA 5DG9A 2ZHAA 3TAQA 2K3IA 1YHQS 2N7YA 4RW9B 5EWEA 2IHR1 1RWUA 2V69A 2R8GA 5KFWA 2LEBA 1N8RT 3VAFA 2OKQA 2GV1A 4PQAA 2MQPA 4ZHRB 2GMJA 2MJNA 1NXIA 3W2WA 2E1RA 3WBZA 4KAIA 4NCBA 4GVBA 1VQPS 3E2EA 1R8PA 2UUWA 4J90A 1IR0A 1W7WA 3PW7A 3M1VB 3ZZYA 1DARA 2DNPA 4ID5A 4ECRA 4MYUA 4EO8A 2R4FA 5ETTA 1Q0NA 3IG1A 2YNIA 1A9NB 5CYJA 4WFAQ 4OZ3A 2RF2A 2YKMA 4FF3A 3LF0A 4J5OA 5EHHA 2KFNA 3RBEA 4O3SA 2QE5A 5LXYA 3DI6B 2XCAA 2P6SA 2ZE2A 3HHLA 4WP9A 4Q0BA 2OELA 2NUHA 4DQPA 2ATCB 2BJDA 2R42A 3LH2S 2LMIA 2MLXA 2MQNA 1A7GE 3EXCX 2AIRB 1GFWB 2PEHA 5G4DA 2AYBA 2I8EA 2ALYB 3H2VE 4ZJQA 2BXJA 4YQWA 1S76D 2EBGA 4DQIA 4DV3J 2C2MB 2DITA 4C8OA 4ZPCA 2HNYA 2JEJA 4X65F 4A8QA 2X3DA 3VAJA 2WHOA 4B3OA 1LOUA 1DFDA 2BKOA 2RUSA 2DNLA 4A47A 1PSDA 2ZEJA 5L8RC 1KHVA 2V8GA 5HROA 5KFUA 3CJ2A 3K17A 1SJ1A 1EETA 1N36J 4JI7J 5KFTA 2UXBJ 1HD1A 3O6QA 4JI5J 2GAGC 2DH8A 4KO0B 3ETMA 1U0HA 3DLKA 4K4VA 5IV4A 2DTJA 1TL1A 4MMOA 4U95A 1X4AA 3R1LA 3D6HB 4C6AA 3AD9C 4U96A 4ES2A 1NDPA 2YQ3A 2HW3A 2AP6A 2U1AA 4M5GA 4YDXA 4ZVUB 4PAAA 2CPZA 1Q8KA 4F4WA 4PRFA 1SJQA 1T11A 2KJWA 1VLYA 3C15A 2UUAF 4B3RJ 3NBPB 4DXLA 1L3KA 5HAOA 3AQOA 3S6EA 3OV7A 1LWCB 3CIMA 1HW9A 1S0OA 2H51B 4PXCA 4K4TA 2DNZA 3KDOA 3CULA 3W3SA 5K9FA 1WI6A 3G4SS 1CJUA 2PE8A 2DGOA 2WVBA 1RP5A 5HBMA 4H4OB 4EI2A 5BJRA 5K8OA 3LALA 2IPOB 2CPEA 1NZAA 2DD8S 2CQDA 2ZH1A 2J9DE 1JK9B 4A48A 1DJ0A 5M2RA 3T3FA 3GWCA 1FXLA 5LSLA 3M4XA 1GNKA 3TAMA 3PX0A 2B0GA 2EXUA 1R6VA 3A8EA 4P75A 2X7IA 1QVFR 2VD3A 2VODA 1BGXT 3R7SB 2XGQA 1I94F 4FN5A 3W2WB 3TJ8A 1AUDA 2ZZNA 3W66A 4GVBB 1RHQB 1TMJA 4F0HA 4FKXA 5F8MA 2WVFA 2MZQA 5F8HA 3TARA 1S1XA 1N5QA 3EZOA 2HHWA 4TQSA 3RB4A 2V9WA 1WSVA 2EEYA 4NRTA 1URRA 5EDWA 4PWDA 2I38A 4ID5B 3CCJS 3HM9A 2PMWA 2ZOFA 1S6OA 1RQ0A 2HFOA 2FY8A 2LECA 3IG1B 2YNIB 4UOHA 2GO8A 1WOSA 2ASDA 2N4CA 1CBKA 4DL5A 1WI8A 2RF2B 2YKMB 1JWWA 2NCKL 1T94A 4NMXA 2HVHA 3X1LB 3D2WA 4EYHB 4CLSA 2W4PA 2QEXS 2ZE2B 2DCUB 2NREA 1GMVA 3HHLB 4ZMMA 5E2QA 2YBVA 2UXCF 4JI1F 4Q0BB 3T1HJ 2MZSA 2OFGX 3PW5A 3PJ9A 4PWWA 4ETXA 1HMVA 4PUOB 5DM6Q 3CT9A 1S7HA 3OVSA 3AA9A 1VCTA 3VGTA 4RR5A 2KM8B 2Z58B 1IR2A 2R7SA 1NB2A 2NXEA 1S79A 4X4PA 3FZ2A 2GVZA 2CNLB 5BYSA 3IR5B 4DZ6A 1JNZB 3SQGA 3GR0A 4B3OB 5G0RA 4DCJB 3C8YA 1U02A 5L1LA 4ZCIA 5LSRA 1XNQF 2K3KA 3KG4A 2KN4A 2FB0A 1ZAWA 2XC9A 4EYIB 5HROB 2M8DB 1FRLA 5U47A 3ELHA 2XWXA 5LMNF 5A8RA 3VAGA 3QT7A 1EETB 4KY3A 1RYSA 2YNFA 2DYAA 2OPQA 1R89A 1BMQB 3GPAA 4JV0A 2D3ZA 3AD7C 4HLBA 1S0MA 1U0HB 4ED2A 3DLKB 4F67A 3ZTRA 4QCLA 1TL1B 2I1RA 3THTA 4EBCA 1U1NA 2ZH2A 2M70A 4LREA 2HGNA 3MM8A 5GMDA 2ZWOA 4M8LA 2D3UA 3O44A 4ED0A 1YX2A 4XAKA 3GG0A 2V63A 3N01A 1L3VA 1D3WA 1KN6A 2VQEF 4NI2A 3K5PA 1YRTA 1IVZA 2H48B 4V19J 2CADA 3PEJA 4B9LA 2GX8A 1SL0A 3CCVS 3N79A 1CJUB 4MK9A 2W9AA 1T03A 2W2QP 1RAFB 4QZVB 1U48A 2QC3A 1SKUB 3O8WA 2FGCA 1C0UA 1CQMA 1WF1A 1VYAA 3D6FB 2OEKA 4K4WA 2F3JA 1PG5B 5FDLB 2RRBA 4QU7A 4B02A 3I9V9 4LF2A 2AQ4A 3TAMB 1W26A 2RQKA 5KG0A 2UV8G 2D3O1 2K06A 1I51B 3CW2C 4RL1A 3OVBA 5KG3A 1JLGB 3LGMA 4GRSA 4ZVTB 3P49B 4IH6A 3ZZPA 3W2VA 4R8UA 3OXFA 4ZDNA 1S1XB 3QRRA 4O0IA 4WFNQ 2CWKA 4JV1A 2IM3A 3QBCA 4QWEA 3CB4A 2CPYA 2ZH3A 4LFBJ 4OJHA 3WZ0A 3CDUA 4PWDB 3G71S 4OHXA 3EGZA 3CCMS 4HYKA 4J7CA 2AGOA 3RJMB 1QTNB 4DQSA 3BR9A 1NRKA 4C2MA 4PQUB 3PW0A 2V8DA 1VQ5S 2NZCA 3QSYB 2VIHA 1YLXA 2XNQA 5GMEA 3GE9A 2ILZA 2JLGA 1E6VA 3R97A 2Y0BB 1XN9A 5IC4B 3OL8A 3WC2A 3JQKA 4F7VA 2KYZA 4NCAA 1IXKA 2E9RX 5KFAA 3KTQA 1FO1A 3GV5B 3OHBA 3HSJA 4G3IA 3A3OB 2GVZB 5EX0A 1ZA1B 1UA0A 1NK6A 3H90A 2V34A 4Y3CA 2DNQA 2K8GA 1WORA 4LRAA 3W1YC 1UCNA 1IKYA 4Y65A 5KFDA 5J1EA 1OJ4A 2QA1A 3US5A 4L75A 2IA6A 3NCRA 4ZITA 4CNYA 4MK8A 2C3UA 2Y1IA 3RW6A 3Q8VA 3Q83A 3ETOA 5A8RB 2HS3A 3V6HA 4TU7A 2R7VA 2YNFB 2OPQB 1Y5NB 4DFMA 2C2RA 2M4MA 3TVYA 5CD4H 1MMDA 1RGVA 1OYDA 2FDNA 3OXGA 3M9OB 1RT3A 2C28A 1IWGA 2GS8A 1YJUA 4OHWA 2BANA 4OX9J 2BABA 3LGHA 2VPXB 2W9CA 3T1YJ 3D1QA 1JNRB 1PAEX 3D6TB 3MM8B 3QFWA 1VGYA 4KSEB 5AE2A 2IFXA 1W2IA 4LIRA 1FJGF 2ZDPA 3QJJA 1C2PA 5B0FA 3QZ8A 2FJXA 1OPZA 1O51A 1PJ5A 4NI2B 2VPYB 3BDPA 1Z4UA 3GCXP 4C11A 2KTQA 5AJ3J 1CC7A 5CD4A 2VOPA 3L4BC 4R0EA 3MPYA 4NLTA 3FNNA 5J2NA 1H2UX 4C0BA 2L41A 2DVIA 4USUA 3QGGA 4AQYF 1T03B 1HHQA 1TMMA 3DRYA 4JI6J 4K2JA 5E5NA 5KFZA 3EZUA 1KTQA 1C0UB 2NXJA 2WBRA 3TZXA 1Y5IB 4HI2A 1GK8A 5CZVA 2FHJD 3RAQA 2F4FA 2SXLA 3KLHA 4N8NA 3M6UA 4I2QA 4NOHA 1EX8A 5DDQC 4F0KA 1XBWA 4X4VA 2HPUA 1TL4A 2NR0A 1SL1A 4OYPA 4Q43A 3VAHA 1HA1A 4P52A 1M5VC 4I6AA 4DPYA 3W2VB 1VIOA 3OD2A 2A1BA 3IN5A 4LF7F 1NSPA 4R8UB 3TZYA 4DR5J 2NPIA 8AT1B 2M0GB 5F41A 4B3SJ 1P8GA 4YP3A 2W2MP 1LW0B 3MECA 2HYIB 1T9WA 4RBVA 1HQ2A 2CYYA 1BWVA 1DTTA 2AV5A 3VHQA 2RQMA 4QPTA 4ECVA 2PI5A 3Q24A 2KHDA 2HRUA 4P7TA 4EU0A 4Q8FA 3BPDA 3I0SB 3BV8A 2AF6A 4GVLA 3BPSP 3BKTA 2W2OP 1ZH5A 1CJTA 1FRXA 2XMKA 1KLNA 3CWJA 2XB2D 2V8HA 1VQKS 1E6VB 5A8KA 3OJUA 3G6YA 4AL7A 1YSJA 3G2XA 4QIVA 3ZZZA 2H65B 4WCEQ 2C1EB 2AJFE 3D28A 5B0DA 1D9FA 5GAEI 1RHKB 3ZXWA 4QIEA 4HDGA 3TEGA 2ZHBA 4CO2A 1KS2A 3TX8A 2PSZA 3UVJA 1YWXA 4M94A 1HNWF 2FZCB 4NLQA 1HFEL 2W7OA 1V3RA 3UN2A 3OL9A 2GIRA 1IKYB 1YZ6A 5MLCV 5J1EB 4DV0F 1JJ4A 1SJ4P 4RUBA 3B8HA 3G8QA 2HHHF 3BQ2A 1KBRA 5KFHA 4OZNA 1ZM9A 4LF5J 2VPWB 1Y11A 3GFZA 2E66A 4YB5A 1RAOA 1MSWD 2HNDA 4MFBA 2R3VA 3GYNA 3VTIA 3MMCA 2KRBA 4AL6A 1TELA 4WWSA 1XJWB 3KG0A 3KLGA 1RT3B 3DN9A 5DDPC 3TO8A 4UQGA 3R8YA 3R2DJ 5FLXU 1PC5A 3HZEA 1X4HA 2W9CB 4M5DA 1Q16B 1Y00A 3P96A 2AYGA 4DQRA 2JNJA 3MAQA 1S0NA 4X66F 2EFPA 4FYXB 2EBEA 2QLJB 5C2GA 4YY3F 1XR5A 2FVSA 1YJVA 1NAQA 2DGVA 4L72B 2A2DA 2QIFA 2XY5A 3MM9A 5FJ4A 4GKKF 1S59A 2GQ2A 1WG4A 4QU6A 4OHYA 1HWJA 2HQIA 1ZTWA 1Y4ZB 5J2NB 1B99A 1LK7A 3QRPA 2VQFF 2QLXA 1FI4A 2V9KA 1SB6A 1RAGB 2YNHA 1Y0HA 3WDOA 2A18A 3I31A 5KFYA 1RA7A 2BDPA 3IFEA 4LVNP 1S0VA 2QA4S 4Y6IA 4PR6A 1FKAF 1KVIA 2XYHB 1Q79A 4N8OA 2R2TA 4I2QB 3JSMA 2UUCJ 3IP0A 1GTEA 5D0HA 2GVDA 2DBBA 4BHQA 4H4KC 3TA2A 4UZCA 4KKOA 2NSBA 2NYHA 3W7BA 4HH1A 2ADBA 4CH7A 4DUYJ 3DOLA 2K2PA 1K73T 4LF4J 3TWZA 2XO6A 1X31C 3HSDA 2IM0A 1LV5A 4OL8A 3HJVA 4A8FA 5F3ZA 3MECB 1BD6A 1XEZA 4PG7A 1DTTB 2N4DA 2DRBA 3QZ7A 1RTIB 1VQ8S 1FK9A 5JMNA 4J9OA 2PFDA 3RG6A 1U26A 2YX1A 4I4BA 4KQZA 1TP7A 3DDNA 2KFZA 2BE2A 1XERA 4PXBA 2X1GA 4NXMJ 1CJTB 3K8WA 5RUBA 5DG8A 1WELA 3OTOF 5DQIA 1U6BA 4MKVA 3CJTA 3ONQA 3POTA 3E01A 5A8KB 2B8PA 2E1PA 1IBKF 3AJ2A 1VQ7S 1PGZA 2CKWA 2MGZA 1K9MT 2MKSA 4ECQA 1HR0J 3GV7B 3C16B 1LFPA 3W9HA 4JI4J 5T7LA 3FSIA 4PXDA 1F3FA 3KOAA 1RAIB 4USVA 3TZWA 1I6JA 1HI0P 3IGVA 1XNRJ 4P6QA 3JAMY 2KRRA 2LFVA 4A8MP 4CLYA 2ZVIA 3I96A 2GJIA 3UVJB 2HS0A 2DEIA 1T9XA 4UF4A 1H7WA 3GG1A 4DV7J 3D3CJ 3VV2B 1CQNA 4F3MA 3DU5A 3V2UC 4OHZA 3NAIA 4JI8F 3VAKA 4HACA 1X4BA 2R8IA 2XMJA 2Q79A 2P9GA 5IWAJ 3M9MB 1VK3A 1F2GA 1ZAXA 4WIQA 4OZ2A 5IT4A 2HWTA 2HNDB 2HWHA 3QATA 4MFBB 3FBCA 2JFDA 4I1TA 2B8QA 2ZNYA 3MMCB 3SV3A 2V6AA 3G96A 2ZNZA 1GX6A 4LT6A 1HBNB 3KLGB 3CCTA 4IFVB 1U1LA 3W5YA 2VC0A 2JSXA 2V2KA 3K57A 3Q8YA 1UPPA 1G1XA 3BYRA 2DHSA 3OL7A 4M5DB 2HQFA 5IQQA 3KUGA 2EC2A 4PKDB 2AJ0A 3K8VA 4X4OA 3ISNC 1K1QA 4DR3J 2I2YA 5HLFA 3QQCD 1WG5A 4DV6F 2KT5A 1J5EJ 1I3OB 2DH7A 3CE8A 1U2CA 1HNIA 4MK7A 1ZM3A 3MM9B 4P73A 1X7VA 2GIQA 1TFYA 4X64J 3DXBA 2ZD1B 3MCOA 1TKTB 1IBLJ 2UXDJ 1ROFA 1RWXB 1F5AA 2YNHB 2C22A 2F63A 3H98A 1Z2LA 1YJRA 3Q2TC 5ETSA 1X4GA 4CNZA 2QL5B 3M8ZA 4DL3A 3BO3A 1S9FA 2ZFHA 5HQ8A 4LIWA 4C3KA 1M5PC 3MD3A 1IKXA 1HNZF 2VUGA 1JJHA 4CH1A 2N3LA 4QOTA 4AE5A 3JSMB 2Z2LA 4QWAA 2GVDB 3DLEA 1ZZNA 3AOBA 3IM9A 4DG1A 3SXLA 2P9CA 4DV2F 3KLIA 1N32J 4E98A 4O44A 4CM2A 2HBYB 3DOLB 3MUVP 2M8HA 5BYRA 2CQ3A 4ZVSB 2XMTA 2ACMA 4UY85 4R5PA 1HPZA 2P6TA 4DCOB 3ZFVA 3GU0A 3V6KA 1S6QA 2GHVC 3MFHA 3NL0A 4RNMA 2K1RA 5BR8F 1UZDA 4FF4A 1MG7A 1WHWA 3L9ZA 1NKCA 4M95A 3DRPA 3KK1A 2KZZA 3I82A 1SCJB 3KK2A 4FBTA 5E3PA 2BE2B 1YJ7A 2PN6A 3UCGA 1XMQF 4DL4A 5HQMA 2J7UA 1FDAA 4ES3A 4Z37A 1BWEA 5F9LA 1WWHA 2DR6A 3R1HA 2UUBF 2VG7A 3POTB 3ZNUA 3LQVA 1EAYC 3M32B 1W25A 2WSEC 2DKOB 2MGZB 3M6XA 1B7FA 4WP8A 3PACA 4DWIA 3NP5A 2XSFA 1SQEA 1QD1A 2V2ZA 2GGPA 5T7LB 2HWIA 5KAKA 1WF2A 2V8VA 3CMQA 1FRKA 2WW8A 1HNVA 3OQ2A 1UVKA 1KNZA 2MKYA 4FNIA 1N6QA 2AKWB 2NPFA 2VH7A 2XMWA 2FPHX 2LQ9A 1QM9A 4ILRA 4G6VB 4NLYA 3AOCA 4USMA 3F44A 3W9JA 2ZJRQ 2DNGA 5HVFA 4YFUA 1FX4A 4HACB 3OLAA 4KH0B 1D8ZA 2HFUA 3NEKA 1NJIT 5ADZA 4U7UD 1N56A 5ETKA 5D4PA 5A6WA 1HARA 1RWWB 2MZTA 3HT3A 2D9OA 1H2TZ 1UWBB 1TUWA 4YB7A 4K50A 1WKKA 2R2SA 4I56A 1M1KT 1UEVA 4N41A 2FD2A 1U1KA 4YHHJ 1YJ9S 1CS4A 2DO4A 1NZ8A 4ELVA 3V5RA 4A8YA 3MUTP 1REGX 1H38A 4J9UE 1NPPA 2HFNA 2WVCA 1OMSA 1N34J 2LQ5A 1JQGA 1RTDA 1UKUA 1APSA 5FLXY 4JUZA 3JQJA 5HLFB 4B9NA 4LRBA 1SJFA 4URQU 2QV6A 4DSJA 1HNIB 3THVA 5B0GA 1WUUA 4UZBA 1YJWS 3ILJA 4ETZA 4MH8A 2G0CA 2JOQA 1UWAA 3EICA 4J9KA 2FVPA 4AXIA 3PJWA 2V94A 2W7AA 2DB1A 1X9MA 1NJZA 4Q2MA 4WIIA 2C3OA 2OUGA 1M5HA 4C7QA 3CJSA 5DG7A 1IKXB 1S99A 1WACA 2FIUA 3UDEA 4FYYB 4HTIA 1HWIA 1NSKL 3DLEB 1RLDA 1NPKA 4DG1B 2YPYA 4DFJA 3CJKA 2MY7A 3D66A 1FDBA 1OQ6A 3KLIB 1FXDA 2CFXA 3W65A 2JC1A 1K0TA 4WFZA 1F5CA 4O44B 3SZ2A 2LKZA 1F2HA 3PR4A 4R5PB 4OLOA 4DV5J 1HPZB 3NGSA 1S6QB 2R2UA 2K1RB 3NMAA 2XS2A 2Z57B 5D4LA 5ETMA 2M3DA 1WC1A 4IO1A 2G0JA 4TY9A 3DRPB 3DLBA 3KK1B 2BBEA 1B70B 1LKZA 3KK2B 4C9DA 3Q8SB 4JI2J 4BC9A 3A1YG 3IBFB 1S1TA 5GADU 1N5SA 4G1PA 1JLBA 2W8LA 2H1YA 4OYOA 2VG7B 3I5CA 3CMES 2L08A 4DV3F 1XTZA 3S7RA 4HVZA 2E29A 1FWPA 2MKKA 1L5UA 2A10A 4TY8B 4RWXA 3D5MA 2GGPB 3RRHA 1MU2A 2KYXA 5DDRC 2RQCA 2UU9F 4BLGA 1JLAA 3AODA 1HNVB 1CG2A 1HLWA 2XLJA 5L1KA 4NLDA 2MLZA 3SDEB 2R8KA 4BC7A 1SIZA 3QLHA 3Q0AA 1N36F 3BBCA 4JI7F 4JI5F 5JJBA 2J5AA 2GHPA 1VQ9S 2IAJA 3U1NA 2LLZA 3VWSA 1CC8A 3BSCA 5IV3A 3C19A 3TA1A 3UR3C 2CJXB 5DETA 1EIYB 2YWGA 2F4VJ 4B08A 4RW4A 4YOEA 2VJUA 2RS2A 1SKSA 2YXLA 1C1BA 4ECZA 3N6LA 3O3LA 4C48A 4AD6A 4ATNA 3LPEA 3K59A 4B3RF 1FFGB 3A13A 5K14A 1CS4B 3DGVA 1IBCB 2KL8A 2AJ1A 2MMYA 2LXIA 2GA7A 3LAMA 5IXUA 4F4AA 1BQMA 1QTMA 2VONA 2MQOA 3ZTSA 1RTDB 4DSIA 2VL1A 3LO3A 1QSYA 4RW6A 3MD1A 1XIQA 4DSKA 4J91A 5DM7Q 1WC6A 3BGOP 5GAHU 2C2DA 4OZJA 3CEDA 1RT7A 3DRSA 1U1OA 2C3PA 1IM4A 2XY7A 4L3KA 2AGQA 4NZ6A 4LSNA 2BJ7A 1Y3KA 3LA0A 1QUPA 1GQEA 2LVWA 1QAXA 3MMAA 3QSIA 3K58A 4LRDA 2BR0A 5DO2A 5EWFA 4F4YA 3LGNA 1VFJA 5KT5A 3C14A 1AUSL 3EYZA 3G82A 3AFGA 2RUGA 1M0SA 1NBEB 4DSLA 4LR9A 3CJKB 4WXWA 1IJFB 4HKQA 5A0YA 2BYCA 2F8EX 3F73A 5KFPA 2VV5A 1EQMA 2VG6A 3R5DA 3EE3A 3U02A 2XMVA 1VQSA 1Y3JA 1VC5A 1K47A 3FGVA 4OYAA 4PG8A 5H9EJ 1BQXA 3MDFA 3SFUA 3A8JA 3N28A 1NHVA 4GC7A 3T1HF 1FD8A 1WOPA 1NK5A 3PKMA 1WC4A 1Y9OA 3GIKA 3KHLA 2RDDA 1S1TB 4NA3A 1NMEB 2Z30B 3TZZA 1Q95G 1F60B 1JLBB 1FE4A 1V9OA 3DDKA 3M9NB 2CPHA 3NNAA 1HI1A 4DF8A 2DR7A 2XZDB 5HQLA 3J7YU 3RBXA 2HFZA 3SSQA 3FEXB 2DEJA 3J7A1 3DHWC 2DR5A 2CA9A 3B4MA 4DS4A 3BZQA 3H4BA 1UMJA 4NLGA 1MU2B 1JLAB 3HT0A 2QSWA 3SIPB 2VDIA 2FVQA 4P9SA 2I5JA 3QLHB 2BV3A 3ICLA 1KEKA 1U1RA 4R0JA 2OD4A 1ZBTA 2RRNA 2ABYA 1H2VZ 4PYAA 3CD5A 4GO5X 1YKWA 5HK4A 4HT5A 2HBZB 5KG6A 5C24A 2CQ0A 1M5KC 2KJVA 2CQPA 4RW4B 1NPRA 4OMFG 4MIWA 3PRVA 4X4NA 5KFMA 1RDRA 5L38A 3FC9A 1U49A 3RB0A 1S7IA 3HHDA 2JVRA 4Y2CA 2D7SA 2LYVA 3PX6A 3VGUA 1CJKA 1SH2A 4ES1A 3MPVA 4CRJA 3IRXA 1VIXA 3G9CA 2PEBA 1M1GA 1M5SA 5K14B 4UW2A 2GCFA 2C42A 2VG5B 3FEYB 2AT1B 1HQUA 4F36A 4USKA 2H54B 2EFNA 2R7OA 3FCWA 3GIMA 3MR6A 2W1BA 3ZZRA 2R7UA 3K5MA 3UR0A 4WKRA 1F6TA 1R0BG 3I5AA 2MQQA 1KFSA 1YVFA 1T7PA 3D68A 3MR2A 2DGQA 1SC3B 4PCQA 2QL7B 3ENWA 3MCSA 3U1MA 2IRUA 1PJ7A 4DJBA 4UOGA 4K8RA 4Q5VA 3QO9A 3FFIA 4WZQA 2P8IA 3QT6A 2RB7A 1FVQA 5CYQA 3HVTA 4HEA9 1PYSB 1Q7LB 3MCMA 3THPA 3K7RA 3OFHA 1RT7B 1EKSA 3DRSB 2HG4A 4OV1A 2HNZA 1SQFA 2LDIA 3H2LA 3I0RA 4ZKAA 3M6WA 5J2MA 3W8PA 4LSNB 2CDRB 5DJBA 1HL6A 3TNVA 5KG2A 5I4MA 3PYFA 5KG5A 1JB0C 4I7FA 4DFPA 4TNOA 1MROA 2BQUA 2YKQA 1NUEA 3W60A 4DEZA 3CVKA 3C14B 3KFWX 3PX4A 3NKYA 3QJLA 3KJVA 3G82B 4EWTA 3BBFA 3MR7A 3W8GA 4LFBF 3NOGA 2OMLA 3OUYA 1NNDA 1O8BA 2COLA 3R7BB 4OZ1A 5K20B 2PI4A 3A3PB 4DU7A 3KHRA 3F56A 4TVAB 5A0YB 2DNYA 3OFEA 3J81U 4PPZA 5D6GA 5CQGA 2ZBPA 2VG6B 4LF1A 1T3NA 2ROGA 3VQSA 1PBUA 4AXJA 3MR5A 3KLVA 1QSLA 4ED5A 1JKHA 4DDFA 2V4RA 3PHEA 1KKHA 3MTJA 4X4RA 4USIA 1X5OA 3D4JA 4C3MA 4ZPTR 1N33J 3QGPA 3A3NB 1OIAA 1RAJA 1U1PA 1UPMB 1Q81T 1ZPWX 2BW2A 1QSSA 3FVYA 3DOKB 1X4EA 4ZP6A 2X3GA 3U1LA 2GJ2A 3ADAC 4MKAA 2BKPA 1ACMB 3T6BA 3TUZC 1OQ3A 4NE9C 2KZMA 3OTEA 2I9SA 1IUJA 3NS5A 4FNHA 1C4AA 2XSJB 2DNMA 3DOMB 1FNOA 3EX7B 2CZ9A 2JJ4D 2VBWA 2L9NA 5A76A 4ZN1A 1IBMJ 3DLLQ 1R8HA 3MOJB 1VC0A 4I68A 4DPTA 3TQ1A 2MXYA 5SUHA 2AX0A 2FJBB 4R25A 3SEOA 2V68A 3SSRA 2I5JB 4ENOA 4DR4J 2M88A 3HVWA 1Q8LA 4IG3A 3MEGA 1GEHA 4HHHA 1CEZA 5IFMA 4DCPB 3CJ4A 3LP1A 4M5MA 1YJNS 5CZXA 2EFQA 4NLWA 5KFLA 3GJQB 5C24B 1WF0A 2O5DA 1RKJA 4DSEA 1D1UA 4LR7A 1VQMS 3PRDA 2QMWA 4DZDA 1DQAA 2LQJA 3T1YF 4QYZK 3SV4A 2UVRA 2B3TB 2BM1A 1CJKB 4YDDB 1NEEA 3IRXB 3A4TA 4C98A 1FE0A 2A6OA 1RACB 1JX4A 2KXFA 4OLPA 4RNOA 4CLTA 2DNOA 1HQUB 4EUVA 2RQ4A 2LEAA 3BREA 5FD1A 3H4DA 2CPFA 2J6UA 4HI1A 5AJ3F 2HQDA 3LP0A 1VLOA 5HVHA 2BRKA 4C97A 3BN7A 3MI7X 2IM1A 1TK0A 1YRUA 2VBZA 3ENAA 3GFXA 4DHVA 1ZOTA 2X1AA 2B7BB 2E7XA 3SFGA 3NGUA 3ITHA 3HFZB 3Q8UA 3OSNA 2JC0A 3QO9B 1UJ5A 3FFIB 3RAMA 3EWGA 4DBQA 3HXMA 5CYQB 3HVTB 1VBYA 2Y1RI 3V6DA 2MZRA 3MCNA 4OYBA 5D78A 1JIHA 2HNZB 1RWOB 1MMNA 1OWXA 3OR2A 3I0RB 4DMZA 4OZ0A 3TOQA 5J2MB 2RSQA 5HJXA 3BJYA 4QJVA 1TZ0A 3DCAA 5KT3A 4KHRA 3J7ZT 4I7FB 1KVJA 4NL5A 1MROB 2AEMA 3KG1A 3PTWA 3W5XA 2HRYA 2RU9A 2XYPB 2J0QD 4DR5F 2ZH9A 1YI2S 3E51A 1S1UA 3KJVB 1GTHA 1DTQA 4CT9A 1NB7A 3H25A 1JLEA 2QGFB 3B54A 3KJNB 5KFXA 4DV4J 3OUYB 3N0VA 5E33A 4OYIA 3PY8A 2CNNB 4CI0B 4WE1A 3BEGB 3MPUB 1AFJA 2DRAA 3HSZA 2FGOA 4UUXA 1TL7A 3GMGA 3CCWA 2VKRA 3QT5A 1JKHB 1ELOA 1DRZA 3BF4A 1P9YA 4U7UK 2BQRA 3QWUA 1N54B 3IR6B 1TKXA 5CCMA 4UY8T 5EWGA 4ILMA 1KONA 4EBDA 2G1DA 1FF2A 1KHWA 3QAUA 4HL9A 3EM1A 5LSOA 2CNKB 1JLQA 1U0SA 3TUJC 3GCWP 1WC0A 1VMBA 2GC8A 2VDHA 2Z2MA 2AU0A 3RGIA 3NOCA 4NLRA 1TAUA 1VDHA 4DU8A 4ILLA 3VF0B 1Q82T 2PMHA 5K8MA 1GH8A 2CJQA 4HT7A 4KH1B 1NSQA 4PYDA 1FJGJ 2MB0B 1F3VA 1UL3A 3X3UA 2QSFA 5CH7B 2JHEA 3EDQB 3A12A 3TA0A 2B6AA 4DL7A 3RAXA 2CQ1A 4IFYA 3PR5B 4LF5F 3AJ1A 1EQ0A 1NCLA 1P9QC 1ZA2B 4IG3B 4ED8A 3W64A 1S10A 1C1CA 1CLFA 2ZITA 2LXUA 5BYQA 3VAIA 4I0WA 2CJ9A 1SKWA 2H4YB 3LP1B 5HANA 2QG9B 4ECWA 5I3UA 3E3XA 5DZ7A 1RT2A 4S0MA 5DZ6A 2M7SA 3UCZP 3VAMA 4U67Q 1KR4A 1WJ9A 2YQ1A 2VC1A 5B0AA 3M8PA 2B56A 1O5JA 4F02A 3MAHA 4RUAA 5I3PA 4LF7J 3GFHA 1VK8A 2J0XA 3M05A 5CA5A 1RWVB 2JH3A 2R8HA 2BW7A 3EGWB 2GO9A 3M2UA 4FVMA 3RBZA 1FESA 3UNYA 5KT6A 3LP0B 3I55S 4DR1J 1YZ7A 2YX7A 5H1SV 4FVCA 3T1AA 2ZBQA 1S6UA 4C0OC 4LJMA 4DR6J 4ANEA 2B4PA 3ITHB 4ERDA 1EJ7L 3DMJA 2FZKB 4DOZA 3R5GA 5M2PA 4FPIA 3RRKA 2FVCA 3AXKA 3IC1A 1XC9A 4YS2A 2ZOGA 3QWPA 1FNMA 3V6DB 1F5BA 1GMWD 3HULA 2CQCA 2WK4A 3GFYA 3PKYA 2UUCF 2JDJA 2QTWA 2VOOA 4HH0A 1PBAA 3ZTPA 4DSFA 1WTFA 3OR2B 2YVSA 2OGUA 2Y1LB 1PYTA 3W5ZA 1TL5A 2OEJA 3AOAA 2DR9A 4DUYF 3TJ9A 4LF4F 3T9NA 4B17A 1RT5A 5H9FK 2HK2A 1G4CA 2YTCA 2DK2A 1WEXA 3EVOA 1S1UB 1DTQB 1M5OC 1JLEB 4PG6A 1NKBA 2OFHX 1WDDA 3BGRA 3FRYA 1SC6A 4WE1B 3BYPA 2OPSA 1U2RA 3QJPA 1Q8IA 1B64A 4PWUA 5F8LA 1TL7B 3KYLA 1FEHA 2J9CA 2HZVA 2VB6A 4WP3A 2XCPA 4NXMF 4DPXA 4WU3A 4LR8A 2OLWA 1D8YA 3J81Y 1H74A 2LU1A 3D1OA 3AAWB 3MHYA 4ZPBA 4X84A 4ZVHA 5A8WA 1LK5A 2D74B 1TKXB 3RTVA 2EI5A 4Q7AA 2NUUG 4ECUA 4DUZJ 1SVDA 2IRXA 2QMXA 4Q8EA 1UZHA 1AZSA 5L9NA 2VKZG 4B3TJ 4KHPJ 1JLQB 1MNEA 1HR0F 4PPDA 4JI4F 2W25A 2A2CA 1JJ2R 2KH9A 3MM6A 4Q2LA 4DN9A 4QW9A 1FEEA 2ZC3A 3KNAA 3JTNA 4F0MA 5KFEA 2CPXA 1JXLA 4WU2A 4X66J 1FRHA 2C3MA 4RLEA 4DX5A 1S6PA 5A2QY 4GKJJ 2VA3A 2AEFA 4WZMA 2CDQA 2VFRA 5KFFA 4DV7F 1Q53A 3TUIC 4H4MA 4XO0A 2HNYB 1VQYA 2ADCA 3W63A 5AE1A 5AXLA 2DHAA 1ZAVA 4J9PA 1FT8A 2B6AB 5IWAF 3Q8RB 4U8VA 2VQFJ 4IFYB 4IDKA 4DR7F 1ZETA 3DC2A 2ZH5A 2NXNA 4ZLNA 1TU0B 3EPGA 1HHTP 4ED1A 4OI2A 2AHOB 4KGXB 2FJVA 3M6VA 3D7SB 2A0FB 2FLPA 2J0WA 5E3QA 5I3UB 2LP4A 4LF9J 3I9ZA 3GJTB 4NZ7A 1N5VA 5T14A 3JSBA 1RT2B 2QX0A 4V1Ak 1UEKA 1NH8A 2K7KA 1HBUA 1VBKA 1RBOB 3UQSA 1Z2ZA 4I67A 4E0DA 2ZUGA 3HHKA 4DS5A 4NEYA 3DRXA 3N9UC 3NGTA 2NYIA 3IA0A 3VGSA 2EKNA 1J5EF 3V81A 5HVGA 3C15B 2IDLA 3M2UB 2H9ZA 5C42A 5ETPA 3FCVA 1RK8A 1UW4A 4WJBA 2IYGA 4P2XA 3FBBA 2MJUA 2E5LF 1KD1T 1AXQA 3BKUA 3CC7S 1IBLF 2UXDF 2JLEA 1SIWB 4RBTA 5DQGA 3SYZA 4QWDA 3DMJB 3BH7B 1AT1B 3TUPA 3VZHA 5HBMB 2OO4A 2YQ0A 4FS1A 3CSKA 3KK3A 2HLTA 2KI2A 1UVIA 2YH0A 3HP6A 3T5JA 1M90T 4TU9A 4B9TA 1X9SA 5F8GA 2W01A 2FYXA 2DGUA 5K8NA 3HLUA 3B82A 5LXRA 4KTQA 1N32F 3AQPA 4LSLA 3P8BB 3HJFA 2RD5C 4C8LA 3V6JA 2FHKA 1RT5B 2D69A 2CAJA 1AFIA 4OI4A 2J8AA 4IKAA 4EEYA 3IWLA 1PC4A 4WBFA 4F2RA 2XYGB 5AE3A 5DRKA 2B4UA 2QT7A 3BGRB 3FBEA 2OPSB 4MKYA 5KFIA 1U09A 2QL9B 3C6TA 5HO4A 3FJ2A 1RT1A 3ILIA 1PJ6A 4TKTA 3P5BP 4QWCA 5A8WB 1B4SA 5GMKa 1QY7A 4RBUA 3ZC4A 1H72C 4NXNJ 3WQPA 3K0JA 4RNFA 1AZSB 5C2CA 3UN3A 4X4TA 4RKUC 1V5VA 1VJWA 2OTLS 4KYZA 5DGAA 2MEWA 4G1QA 3MM6B 2W2PP 4CLWA 1G7CB 4QIGA 4RU9A 1GXUA 3MAAA 3JAMU 3AB4B 3OTDA 1HWUA 1SH0A 1HMVB 4ZS6A 5D77A 3ZZUA 2YNGA 5ETLA 4TXSA 1S6PB 3CNQP 3BQ1A 4DV6J 1NDLA 5KFSA 2PGCA 2MTLA 3U7JA 2ZH7A 3A8IA 1FJEB 4H4MB 1NK7A 1IWAA 1NK4A 3DYAA 2IJFA 4P74A 3G8TA 3SQGB 2WTFA 5G0RB 3DLGA 4N76A 1YGYA 3NCQA 2W24A 1UEUA 2V8PA 1HNXJ 4RZRA 1NK8A 3HHLD 3CC4S 4IDKB 1WNEA 4KV8A 1RWNB 3CUNA 1TVRA 2XLKA 5L9XA 2XS5A 2OHDA 1OO0B 3SI8A 4YHHF 1FDNA 2LQ8A 3PV8A 2JX2A 4HHJA 4K4UA 1FD2A 4NLXA 3IR7B 2NSCA 3T6JA 1N34F 4DV2J 5GADI 1EP4A 1HBUB 4Y00A 1Y7PA 2V2VA 1FWKA 5AXMA 1T9TA 4ZLLA 4ZVFA 5IS2A 3CDBA 2WSCC 4KGKA 2XHWA 3V81B 3G87A 1AA1B 2EPIA 3G86A 4V19X 1FXRA 2RILA 5C42B 3BH6B 1P1LA 5BR8J 4X62J 3UW1A 3JYTA 2IVMA 3QIDA 2QFJA 2GHWA 2AEJA 2DT9A 3W9IA 5EGYA 4DI6A 1CULA 3MMJA 2V4JA 4DLGA 1RBLA 1R8BA 5HMZA 3G8SA 2HZCA 4DV1F 3UD5A 3KK3B 3C66A 2W4CA 2WSFC 2L3MA 2R2RA 3RZAA 2CVEA 3I56S 3CIZA 3Q22A 4WPAA 2HHSA 5FIIA 1TV6A 4LSLB 4OI1A 1Q5VA 4J9QA 2N7CA 1X9WA 2XI2A 5ETOA 4DX8H 2ASLA 4DQQA 3WX4A 4RW7A 2I6WA 4RPFA 3ZNJ1 5LJ5Y 2L9WA 3N4WA 4JBCA 3GIJA 1YBUA 2EWHA 1LEOA 3VALA 2DY1A 1QLNA 4N47A 3DRRA 3C6TB 4DR2J 2BA9A 4JI2F 3V4IA 1RT1B 4Y2MA 2BE9B 4OX7A 3UI3A 2HEKA 4ZCKA 4TLRA 3CPWR 1QJHA 2ZKUA 5KFVA 1S72S 1VJQA 5F3TA 2RRAA 1FVSA 2NQPA 1WG1A 2ILYA 4PG5A 1H98A 1VHFA 3PYEA 1R0CB 3KUHA 1LWXA 5GAHI 1LWEA 2Y1JA 2EKYA 2KVQE 4TN2A 3DGPA 3IO1A 5F8JA 5J1NA 2R7QA 3MZIA 5KTQA 5HI7A 1REVA 2HBQB 1WTBA 4G1QB 2FLLA 1ZS6A 3U27A 1N4LA 5CABA 4P71A 1RA6A 3MAAB 2EG1A 2Z2YB 2QLFB 1OS5A 2UV8A 4EFAC 4DN0A 3B6BA 2YNGB 3DDIA 2O01C 4Z7CA 4H4OA 2N82B 3BBBA 4X4SA 3GONA 5D8HB 2GNKA 4M5KA 2WVEA 4Y2KA 4EGLA 2JLFA 2OMOA 2OSRA 3QRQA 2Z4PA 3DYAB 5GAGU 2FJWA 4ZPVR 3CF5Q 1RTZA 1B0TA 4LFCJ 3H5YA 3DLGB 5MAOA 3EJMA 7AT1B 6FD1A 4DPWA 1KWMA 2F4VF 2BRLA 4O0NA 3LOUA 4JI3J 2OPPA 3HK2A 2DNRA 4KGZB 2H4WB 4O3OA 4ER8A 4ICLA 3P3DA 3EVMA 4KV8B 3IBWA 2Y9HA 2BJEA 1NK9A 1WEZA 5F9NA 1TVRB 2CXEA 4LSZB 3GP9A 4KE5A 4NA1A 1F9EB 1VBXA 3DLJA 4IUFA 2ZOMA 1W2BR 4CLZA 1MW7A 4FYDA 3T5LA 4ELTA 3HKZD 1RI7A 2JRSA 5CCLA 4ZJOA 1HQEA 4O3NA 2FQQB 1S5ZA 1UP1A 3EDRB 1EP4B 4CWBA 2FY1A 2DISA 2BM0A 2JEFA 2BANB 1KOHA 4N56A 3UO0A 5E7OB 3P6YC 4EK2A 2DCLA 1LXJA 1XMOJ 1R7IA 3J7YI 4CZCA 1UFLA 2A3JA 4LFAJ 2O66A 5B08A 3ZTOA 2IY5B 4WTYA 4FZVA 4DL0C 2RH3A 5C5JA 2QRRA 3FKBA 3RU0A 2AZ3A 4NEZA 3JYTB 5KFBA 4C11B 4Y34A 3IRWP 3D0GE 4EO6A 2LA4A 3A8KA 5JVGQ 1U25A 1CULB 2G0IA 2ASJA 2V4JB 2HAIA 3BM7A 2XQCA 4PUOA 2BKNA 4CCHA 3RR8A 2GFFA 2A6MA 2E1AA 2U2FA 4TYBA 4ZA1A 1TKZA 2MYFA 1UA1A 4JI0J 1NHKL 2W2NP 1NU4A 3NNCA 1EARA 5C25A 2MQ8A 4NYPA 1VBZA 2CG8A 1DURA 3KLHB 4F2SA 4EBEA 3ILOA 2ZJQQ 3SCJE 4LRFA 1XR7A 1S12A 2B5JA 2D1CA 4FDFA 5I42A 1TV6B 1X60A 3EPIA 3K5LA 3FUYA 3HD1A 2UU9J 4PABA 2RKIA 1HYSA 4I2PA 2G2OA 4CO5A 1N48A 2BJ8A 4RU2A 4KGVB 3WC0A 4RW7B 2UVUA 1YTYA 3BR8A 4F4KA 1NLKL 1V6HA 1QAYA 1TFWA 2M52A 3DRRB 2XTJP 4K59A 1UVLA 3V4IB 1QE1A 3KLFA 2LA6A 1B3TA 4AUKA 2QYCA 1NDKA 2F1FA 4KPYA 2C2EA 2B9EA 3ZTQA 1SJ3P 2KU7A 2AWZA 2EFVA 1ULRA 2BQ3A 2XM3A 2FHJA 4RUHA 1KSPA 4WYLA 2EFOA 4IO9Q 2BMBA 2HHUA 9RUBA 2DGWA 5B0EA 1LWEB 3L95X 3S01A 2IA0A 2JEIA 1YITS 4DL6A 3GYXB 3TR5A 4CLUA 3DGPB 4Y28C 4A46A 3BN4A 3LTOA 1VC6A 3N6NA 1F1BB 1REVB 3AT1B 2ZWPA 2O67A 2ROPA 3EUNA 2KG1A 1I1GA 5CAAA 4B9VA 1FTRA 4I64A 4A4JA 2MY8A 4MYTA 4O4RA 2IYIA 4E8UA 1S1WA 3MM5A 2XO7A 2UZAA 2PMZD 4QPXA 3P45B 2XS7A 5FDLA 4M5JA 4DF4A 3L09A 1U1MA 1SH3A 4RW8A 2CQIA 1TR0A 5E0OA 4C8YA 2OPRA 3PYDA 4ZVQB 2F9DA 4DUTA 2OPPB 1RHMB 3NWGA 1UETA 4ICLB 3I5BA 3GQCA 2MDAA 1JLGA 1R6YA 2UVVA 4WYWA 4NWBA 1B0VA 1NDCA 5D15A 2XMAA 2MQMA 3H7HB 4FYWB 4OJ3A 2VA2A 3D67A 4K4ZA 4KFBA 3QMQA 4G1IA 4GO7X 4AT1B 1VRTA 4IQMA 4C8NA 9ATCB 1KLMA 5J1PA 1MWQA 1HQEB 2CZ4A 3QGHA 2NXCA 4LF6J 1X5PA 1BHNA 2CG4A 3HO1A 3FMBA 4B3MF 3K5OA 1X8DA 3QAEA 1M1HA 4U7CA 4PQUA 1RLCL 2YWHA 3MTKA 2ZH8A 5IT0A 1SUQA 1G6BA 2KB2A 4OX8A 1D9DA 2QO3A 2BX6A 2DPJA 5J2QA 1U6ZA 2AJ4A 4KIAA 4QIWD 3HHNB 1N52B 4QR1A 2BUNA 5DLGA 3PIPQ 3R5AA 7FDRA 4DLEA 4FP9A 3KKFA 4URSA 4NYZA 5EUHA 2HBRB 3FQKA 4I6YA 2F5GA 4KJIA 2DRDA 4D3HA 1NJYA 1IKWA 2VJVA 3NWRA 1S9EA 1TKZB 3KWMA 2YKAA 4OFZA 3CD6S 1T9VA 2HK3A 2IJNA 2E7WA 3GB0A 4X2BA 3FEZA 5THWA 1NKEA 5C25B 3PZPA 4B9MA 1Q78A 3CJ0A 2Y8YA 2PA8D
chains in the Genus database with same CATH topology
1VQMS 3PRDA 1SJRA 5KG7A 1ZH5A 2IBOA 2QMWA 2KO1A 1FRXA 1VRUB 5L1JA 2XMKA 4TU8A 1KLNA 1N5YB 1DQAA 4FF1A 2CPIA 3IAM9 2LQJA 3T1YF 3CWJA 2B5JB 2XB2D 1B0PA 2VASA 3CDWA 3OXLA 5I42B 3SV4A 4KKOB 2HHQA 2UVRA 2R8JA 3FSYA 4ZP8A 2V8HA 1LWFB 2B3TB 3HVRA 3M2VA 1Q4RA 2BM1A 2RKIB 1HYSB 4I2PB 1VQKS 1R0AA 1LW2A 4QR0A 1E6VB 4XDCA 1N0UA 5A8KA 3OJUA 2E5GA 4CO0A 4YDDB 2XWYA 4J37A 2EFGA 1NEEA 3IRXB 4ZP7A 5H9FJ 3G6YA 4AL7A 1YSJA 4C98A 1FE0A 5JXSA 4TLQA 2JEGA 1JX4A 4QIVA 3NCPA 3ZZZA 2KXFA 4OLPA 4RNOA 4WCEQ 2Q6BA 3BGFA 2DNOA 1HQUB 2AJFE 4EUVA 5GAEU 2EK6A 2RQ4A 3C6UA 5CXTA 2LEAA 3D28A 3BREA 5FD1A 1N33F 2J7WA 4F3QA 1H0HB 3H4DA 2CPFA 1Y5LB 5B0DA 1D9FA 2J6UA 4HI1A 3OR1A 5GAEI 5AJ3F 1FTCA 1Q8BA 2ZH4A 4QIEA 1KQSR 1JLFA 2O1PA 4TYAA 5B09A 3PO4A 4K4XA 3LP0A 2KXHA 4WF9Q 2BRKA 4NA2A 3VZIA 4HDGA 2ZHBA 4C97A 1C1CB 3BN7A 3MI7X 1S1VA 2IM1A 4IR9A 4WXOA 3LANA 1TK0A 4AL5A 4USJC 1KS2A 4CO2A 3TX8A 1YRUA 2ZJPQ 2KVIA 2VBZA 3T19A 2PSZA 3GFXA 4DHVA 1F9FA 1FK9B 2RDJA 1ZOTA 1QE1B 5KFRA 5HMYA 2X1AA 3KLFB 2B7BB 2E7XA 1WHXA 3SFGA 4N5SA 3CCES 3ITHA 5IQ6A 1YWXA 3OSNA 4M94A 1HNWF 5JVHQ 4NZ0A 4F25A 2JC0A 3QO9B 4LF6F 1UJ5A 4NLQA 3FFIB 3RAMA 5KFJA 1HFEL 2XBPA 2W7OA 3C46A 1LFWA 4AYBD 4DBQA 3HXMA 4BCAA 1V3RA 4MKBA 5CYQB 3HVTB 1VBYA 1UVJA 2Y1RI 2GIRA 3OL9A 3IS9A 1IKYB 3V6DA 2MZRA 5MLCV 4M1KA 5J1EB 4DV0F 1JJ4A 1SJ4P 5D78A 4B9SA 1JIHA 3O5TB 3PO5A 3PVXA 3ZZTA 5IT9Y 2DIUA 1P27B 3B8HA 3G8QA 3M8PB 2HHHF 2HNZB 1IBMF 3E01B 3BGUA 4J9LA 1MMNA 3BQ2A 1OWXA 3OR2A 4DR3F 3I0RB 5KFHA 4Q44A 4FBUA 4U6PA 4EZ6A 4DMZA 2QZ8A 4OZ0A 3TOQA 5J2MB 2PD1A 2RSQA 2DGSA 4OZNA 4NCGA 3BJYA 5HMWA 4QJVA 1ZM9A 1TZ0A 2VPWB 3DCAA 4ID8A 1PO6A 2I0XA 2QA2A 4YB5A 3GFZA 2E66A 5KT3A 4KHRA 3J7ZT 1MSWD 2HNDA 4I7FB 2QA4G 1KVJA 4NL5A 4MFBA 3BSOA 1MROB 1RISA 3CMAS 1V3ZA 3GYNA 3KG1A 4RNHA 3BB5A 4F4ZA 1X0FA 3DOKA 3VTIA 2HRYA 2KRBA 3MMCA 1R3NA 4X64F 2RU9A 4QIFA 2HIQA 4AL6A 2CJAA 2N3OA 2J0QD 4F3OA 4DR5F 4NPOA 4XPEA 2ZH9A 4DR4F 3BO4A 1YI2S 3PFEA 4OI6A 2R9LA 3E51A 1HBOA 3ISND 2J6SA 1S1UA 3OW2R 3KJVB 1GTHA 2CIMA 2HVZA 3KG0A 4KT0C 1S48A 1DTQA 2IC3A 4CT9A 1C0TB 2FTRA 3KLGA 2E44A 4ZOSA 3Q8QB 1RT3B 1NB7A 2ZKTA 2XGPA 4Y2AA 2JL9A 3H25A 3N5BA 4OJ1A 1JLEA 2O3DA 3DN9A 2YX4A 1S1WB 2W9BA 3MM5B 5DDPC 5KFXA 3TO8A 4UQGA 3OUYB 3N0VA 5E33A 3MWBA 3PY8A 2LQBA 1PC5A 3H2UB 4UUWA 5F0WA 4WE1A 4CI0B 3HZEA 5ITHA 3BEGB 5CYMA 1X4HA 2DHGA 2XSJA 1AFJA 1NJWA 2W9CB 2DRAA 3CJ5A 4M5DA 3HMJG 1UJ4A 2FGOA 1Q16B 1Y00A 3P96A 4RW8B 4UUXA 4DQRA 3DOMA 3RW7A 2AYGA 2WRMA 3MAQA 1S0NA 4X66F 2OPRB 3LW5C 2EFPA 3GMGA 4ZPWR 2W8KA 1C4CA 3CCWA 2EBEA 2NS1B 2VKRA 4MAKA 1Q1KA 3S8SA 3OBIA 3SMZA 1LQ9A 5F8IA 2VPZB 4YY3F 3JSRA 2MZJA 5T41A 4O3RA 1JKHB 1N88A 1ELOA 1QAJA 1XR5A 2FVSA 1DRZA 1YJVA 3BF4A 4U7UK 1NAQA 2BQRA 2DGVA 4L72B 2A2DA 3MEDA 3QWUA 2QIFA 4NLVA 2HHTA 1N54B 3ENVA 2XY5A 3MM9A 2ZBIA 5FJ4A 3IR6B 3D0IE 1TKXA 1GT8A 3DM2A 1TL3A 5CCMA 4GKKF 3OFGA 4UY8T 4W92B 5EWGA 2GQ2A 3OJSA 4ILMA 1KONA 4EBDA 1KQFB 3FRZA 1WG4A 2G1DA 1FF2A 3D1HA 3NS6A 1KHWA 3QAUA 3UD3P 4OHYA 1HWJA 4KFBB 2E5HA 4IQXA 1J2VA 4HL9A 2OJ3A 3FDSA 3GR1A 3IAS9 5LSOA 2HQIA 5HMXA 3LWLA 2E5IA 3BO2A 1ZTWA 3Q2SC 1Y4ZB 5J2NB 2ZBCA 2W4DA 1LK7A 1JLQA 1VRTB 4HDHA 3TUJC 2VQFF 4ECSA 2XZWA 2QLXA 1K8AT 1LW0A 1SB6A 2V9KA 4J9SA 2YNHA 1Y0HA 5GVQA 5LMUF 3WDOA 2A18A 2K7JA 2KG0A 3I31A 1VMBA 3PRBA 1KLMB 5KFYA 2MSTA 3KHHA 1RA7A 2GC8A 3HI9A 2PO4A 2BDPA 2Z2MA 3IFEA 2AU0A 4FS2A 4LVNP 3RRGA 1S0VA 4NLRA 3NGDA 1TAUA 1XWLA 4DFKA 4ILLA 3QIPA 3VF0B 2QA4S 4Y6IA 4CH0S 4PR6A 1S4FA 1FKAF 1KVIA 1Q82T 2PMHA 2AX1A 3CCSS 5EN1A 5DS7A 5K8MA 3I0SA 1GH8A 2CJQA 1Q79A 3TW0A 4N8OA 4HT7A 1RT4A 3VR1A 2Q1LA 2R2TA 4I2QB 3JSMA 2MB0B 1GTEA 1UL3A 3X3UA 3NGKA 2RMLA 2DBBA 4F8RA 2QSFA 1SUQB 5CH7B 1IQTA 4BHQA 2FHOB 4H4KC 4GC6A 1QAIA 3TA2A 4LUBA 4KKOA 3RB3A 1J5OA 2JHEA 2NSBA 5E3AA 4KC5A 5J2QB 3TA0A 3W7BA 1YG0A 4HH1A 2YWKA 3CO9A 3CCUS 4LF8F 2ADBA 2M5YA 4CH7A 2L48A 3PXGa 3DOLA 2B6AA 2ZDOA 4F4XA 2K2PA 1K73T 3KLEA 1IKVA 4DL7A 3RAXA 1T95A 2CQ1A 5DLFA 4I67A 4IFYA 2IVYA 2FC9A 1QUVA 3PR5B 2IM0A 4LF5F 2CJKA 1LV5A 4OL8A 3AJ1A 2ZH6A 3PEHA 3R3TA 1DQ9A 4ELUA 3M2RB 1GAOA 1VOMA 4UQTA 3V4MA 5F3ZA 4A8FA 1U6FA 3MECB 1FCAA 1P9QC 2ZHOA 1BD6A 1XEZA 4IG3B 4ED8A 1IKWB 1V3SA 4PG7A 2DPIA 1FKPA 1S9EB 1S10A 1C1CA 2ATLA 3NG8A 1DTTB 2ZITA 2N4DA 1CLFA 2LXUA 5BYQA 5EX3A 3VAIA 4I0WA 2CJ9A 1SKWA 2DRBA 3LP1B 3QZ7A 4CT8A 1RTIB 1VQ8S 4JV2A 1FK9A 4ED6A 4J9OA 4J9NA 1TAQA 4ECWA 5I3UA 2FLOA 1VQNS 1DHMA 1U26A 4H4KA 2YX1A 1KFDA 4H54A 4I4BA 4KQZA 4XDDA 5M2UA 4KHMA 1TP7A 3DDNA 2KFZA 5KG4A 4DV4F 3KMSA 2BE2A 4ZPAA 1XERA 4PXBA 2X1GA 3E3XA 1RT2A 3K8WA 2ERRA 2E9ZA 1L3UA 5DG8A 2M7SA 1WELA 1D9AA 2AW0A 2B51A 3OTOF 3UCZP 3VAMA 4U67Q 4NX9A 5DQIA 2BZ2A 1KR4A 1U6BA 2FHMA 3SCKE 2VC1A 2RIJA 3M2VB 5B0AA 1BY9A 3M8PA 3KNGA 3TVKA 3ONQA 2B56A 3POTA 4RW9A 3E01A 1O5JA 1R0AB 1LW2B 2IRYA 2GW8A 3MAHA 5A8KB 4F02A 4RUAA 3AH6A 5I3PA 3GFHA 1VK8A 2J0XA 3UNGC 5B0BA 2B9YA 1IBKF 3AJ2A 1VQ7S 1PGZA 3M05A 2CKWA 3EXYA 5CA5A 7FD1A 2MGZA 1O0PA 3RR7A 2JH3A 1K9MT 2MKSA 4ECQA 3SCIE 4K5RA 2R8HA 3EGWB 2GO9A 3M2UA 3S1TA 1ZPVA 3GV7B 4FVMA 3FZBA 1HD0A 3C6UB 1LFPA 1KTVA 2LCWA 1FESA 1XMBA 2AYMA 1SXLA 2D3OR 4ZHRA 5T7LA 3OR1B 3ENQA 3FSIA 1DZ5A 4PXDA 1JLFB 4KGMA 5KT6A 5F0UA 3LP0B 3KOAA 3I55S 5DGBA 1FRJA 1I6JA 1HI0P 3IGVA 1RKIA 1S1VB 2YX7A 5H1SV 4FVCA 2POKA 3T1AA 3CCZA 4P6QA 2XMMA 3JAMY 5KOWA 2KRRA 1S6UA 4C0OC 4A8MP 1U2FA 3T9ZA 3I96A 2CQ4A 4MIAA 3IWXA 2GJIA 2RNEA 4OZLA 4LJMA 3M1VA 3BSNA 2EG2A 2B4PA 3ITHB 2HS0A 4ERDA 2HGMA 1YRXA 3DMJA 1H7WA 3B4DA 1ZM2A 2BVZA 3GG1A 4DOZA 1HI8A 2Y0SD 4BWMA 5M2PA 3RRKA 2FVCA 4ECYA 1BC6A 1SV5A 2UUTA 3IC1A 1XC9A 1CQNA 3PNIA 3IS9B 2ZOGA 3QWPA 4NYOA 1FNMA 4F3MA 3V6DB 3DU5A 1F5BA 1UJ6A 3V2UC 4XPCA 2CQCA 4OHZA 3NAIA 4QQBA 4JI8F 2GMLA 5AXKA 3VAKA 2WK4A 3GFYA 3PKYA 2UUCF 1X4BA 2JDJA 2R8IA 2XMJA 2VOOA 2Q79A 1KRPA 3DNCA 4HH0A 2P9GA 3PJXA 4DSFA 1WTFA 2KFYA 3OR2B 3M9MB 1VK3A 2JVOA 2YVSA 1F2GA 1GXLA 2ROEA 4U9RA 5KFQA 1MWZA 4NCGB 4ZP9A 3HPOA 3MEKA 1TL5A 1ZAXA 4ED7A 1Q86T 3G6VA 1N5TA 5IT4A 2HWTA 2HNDB 2HWHA 2DR9A 4DUYF 2VBYA 3DI6A 3JSYA 4MFBB 2ZM6F 4LF4F 2JFDA 3T9NA 4B17A 4I1TA 5L1IA 1KC8T 2Q6CA 1RT5A 4YEAA 2ZNYA 3MMCB 3SV3A 4K4YA 2YTCA 1U47A 2DK2A 1WEXA 2YWFA 3G96A 4C8ZA 2ZNZA 2R7TA 1HBOB 1S1UB 1GX6A 4LT6A 1DTQB 2IC3B 2WBMA 4OI0A 1HBNB 3KLGB 3CCTA 4L6V3 1N6QB 4IRKA 4IG0A 4IFVB 1M5OC 1JLEB 1U1LA 2HHVA 4PG6A 2W9BB 2VC0A 1NKBA 2JSXA 2V2KA 2OFHX 3TP2A 3K57A 4IRCA 3BGRA 1WD6A 2FC8A 3FRYA 2UXBF 1X4FA 1WHVA 4DL2A 2ZC4A 1SC6A 2DR8A 3PW4A 4WE1B 3GIIA 2F8HA 2M9KA 2OPSA 1U2RA 5CYMB 4ED3A 1Q8IA 1VQLS 2DHSA 3OL7A 3QJPA 1G1XA 1B64A 4IR1A 3OTBA 2OD6A 1KQGB 2GMHA 4M5DB 3PW2A 2WONA 2B9XA 1TKDA 2PA3A 1YJTA 3CDAA 5IQQA 2HGLA 4PWUA 5F8LA 4PKDB 5K5MA 3KYLA 1FEHA 1SKRA 2J9CA 2MKHA 2AJ0A 3K8VA 4X4OA 2VB6A 2XCPA 3ISNC 2G4BA 4JYAF 1RTHA 5E3RA 1CSJA 1K1QA 4NXMF 2I2YA 4WU3A 5HLFA 2OTJS 1WG5A 4DV6F 4K4SA 3LAKA 2DGXA 1D0EA 2OLWA 1D8YA 2KT5A 3J81Y 5KFNA 2LU1A 3PDNA 4KB7A 4D3GA 3D1OA 3AAWB 3MHYA 2DH7A 4ZPBA 1FRMA 3CE8A 2RT3A 4X84A 2Z0GA 3L7OA 3HDSA 4ZVHA 5K8PA 2YKOA 4OI3A 4JOUA 5A8WA 1HNIA 3MEDB 4MK7A 1DAXA 1LK5A 4KRWA 2D74B 1ZM3A 3MM9B 4URGA 1FJCA 2E5JA 3O2IA 5KOXA 2YKPA 1U24A 1TKXB 1X7VA 3RTVA 2EI5A 2GIQA 1TL3B 3DM2B 4M63A 4Q7AA 3RBDA 4ZVEA 2NUUG 4ECUA 4ALZA 1TFYA 3DXBA 2IRXA 2CQBA 3DU6A 4JV5F 1A6LA 2QMXA 4Q8EA 3DHXA 5L9NA 2ZVSA 2ZD1B 2VKZG 3CTRA 5D3GA 3FCHA 5IZHA 5AXNA 1JLQB 1MNEA 1TKTB 2AYEA 3H8YA 4IOBA 4PPDA 1HR0F 3NNHA 4CO3A 1LXNA 1ROFA 1F5AA 2YNHB 4DV5F 4C0HA 4JI4F 2W25A 2A2CA 2C22A 2V0NA 1JJ2R 3H98A 2H5EA 1Z2LA 1YJRA 1T8EA 2MQLA 2KH9A 3Q2TC 2MHNA 1SBRA 1X4GA 3MM6A 4CNZA 4ECTA 4Q2LA 4BDPA 1RTIA 3QIPB 4DL3A 4DR1F 4DN9A 3BO3A 3IGNA 4QW9A 1S9FA 1FEEA 4KO0A 1R43A 2ZFHA 2ZZMA 5HQ8A 1H6KX 2ZC3A 3CD0A 4LIWA 3JTNA 4C3KA 1HW8A 1M5PC 5KFEA 3KNAA 2CPXA 3MEEA 2BACA 5J2PA 1JXLA 2J7KA 3H59A 3MD3A 4WU2A 1IKXA 1HNZF 2VUGA 1JJHA 1ZTTA 2HHPA 1FRHA 2C3MA 4RLEA 1RT4B 4DR6F 5LT5A 4CH1A 1S6PA 2N3LA 4QOTA 2NLWA 5A2QY 4AE5A 4YR2A 3G6ES 3JSMB 3UD4P 2VA3A