5DRNB

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
AAVLTQTPSPVSAAVGGTVTISCQSSETVYRGDWLSWFQKKPGQPPKLLIYDASYLASGVSSRFSGSGSGTHFTLTISGVQCDDAATYYCLGGYYDDADDTFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Fab Hpu24 Heavy chain
total genus 51
structure length 215
sequence length 215
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnB01
4WDIB 4R4ND 2XWTA 4UINH 1CF8L 1P7QB 3GM0A 1YEHL 1TIUA 5K93A 5CINL 1CXHA 5E0QA 4NN5B 5DJDB 5BS0E 2BVPB 3QIUD 1BF8A 1Q0XH 2FYYB 4UI2A 3NH7H 5FYKH 5I66B 5TQ0L 2VISA 1FVEB 5GGTH 3H3PL 4TRPL 5B8CB 5A3IC 2ED7A 2H32B 3L3GB 3IDJB 4NNXA 3K8KA 5IM7B 3QQ4B 1SEQL 5DJ2B 4G8IB 3REWB 4OIIH 5HVFB 1YPZF 4LF3A 3EJZD 3B5GA 3DTXA 3SGKA 3VFVA 1U8QA 2Z92A 4KRLB 4J3UA 3OHXB 3STBA 3PQYB 3W82A 3PL6B 4K8RD 1YMME 2V2XA 1BD2A 3BXNA 4HUUA 4YHMH 1JYNA 3QIBC 1R6VA 2EEDA 2F8VA 1CFQA 4NZJA 5GGVL 2HTLC 4S1DD 3TBTA 2GJ6B 4M48H 3OWEA 4W6WB 5EDXA 3WIHL 3QNYB 5IF0A 2CIKA 2X40A 4RGND 2QSTA 2C1PA 3VW3L 3G5VA 3GRWA 1U3HC 1EX0A 4C83B 4LMQE 3JBG7 3SN6N 2J5LC 5ALBH 2XN9B 4BFIB 4TQEH 1P4IH 4CJ1A 4NQTA 3VWJB 1S7TA 4ZD3L 5IIEB 4Y4HC 5JNYA 2AEWA 4P59L 1S7XB 2I26N 1UXWA 1J0YA 3UYRL 5D1ZC 4M1DL 5C0ND 5JHDB 1AGBB 1KENL 5DMIL 5I1HH 3DUUB 2P7TA 3LHPH 2EXYD 5ESQB 1FAKT 3KLSA 3ZE1E 3HI5L 4JJHA 3ARXA 3QPXL 5FM5O 5I18L 4LKXA 5FIEA 3WXVH 1X5HA 4X7FC 2IC2A 3IS0X 4EI5A 3KYKH 3DURA 1O7SA 3HUJE 4JKKA 5DJXA 1T0PB 2E7LA 1QTYT 4I0PB 3UTQA 1H5BC 5BW7A 1QHPA 2VTFA 4NSKB 2HLAA 5CGMA 1QRNB 3W2DL 3K4AA 1SM3L 3V0WH 1IC5L 2P5WA 1XIWC 2PN5A 2C1PB 3NTCH 3OZ9L 4XVTL 1F4XL 5GRYA 3QNYA 1RZ8A 4EVNA 3U9PL 1MJ7L 5CEYA 3VGFA 2ITCA 1X6LA 5D2LE 4RFEB 2IH3A 3S34L 3ES6B 4L3EB 3U83A 4JY4A 3KDMB 1VFBB 4Y16C 2O5ZL 5CZXD 3UBXB 4YPJA 2P7TB 3MGTB 2VDKH 4LNRB 3O8XA 3H3PH 2OL3A 3NFNA 3S4SG 5I1LA 1FG2A 3MLYL 1KCLA 5DRWA 3KPSE 2UWEF 3O3EA 2NY4B 4JLRA 4OLUH 1QZ1A 1ADQA 2GIYA 1UM6L 4ELMB 4F7MA 3IDJA 4NNXB 3S37X 5ID0B 1O0VA 4NO0D 1NEUA 1VFAA 4GW5B 5KVGL 1QLEL 2OSLB 5EUOA 1U3YA 2XN9A 3I3EA 4LHQB 3VWKB 4H20L 4IIQB 5HHNA 4PJGB 1T7ZA 1ZHNB 1OTTD 1RURL 1FL5A 4K71B 5E08L 4ODHL 1QNZL 1ADQH 5GS1C 3PJSA 4XWGH 4OI7A 3RQ3A 4CU8A 1QBMH 4Z7VE 4QYOA 4MHHG 2EIEA 5IHLB 5DD3H 3VGAC 3WJJC 2ZJSL 5L7XL 3DGGB 3JWNC 4Q6IC 1OF2A 1XF3A 3FL7A 4P4KD 3PV6A 3VI4E 2E9WA 4UQ3A 1JYVA 2WBJD 2UWEB 1HHKA 3MJ9L 4RWYL 1LO4L 1AHWB 2QR0A 2AJXL 3PABA 1IQDA 4IOSD 2F53A 4GMSH 1PX4A 3CVHH 4HQQH 1EEYB 3OKDB 4OQ1A 4RMTA 4PJDE 5TH2A 1HH9B 1J1PL 3ROOB 3P40A 2H41A 5IM7A 1NBQA 3MLWH 1MH5B 3KPTA 2L4OA 5J6GB 1DFBL 1ZK9A 4OV5A 3BMVA 3SY0A 4K9EL 1HXMB 3QO1B 1T21A 3K46A 3WO4C 3BKCL 5CEZE 3KYNA 2W59A 3CXHJ 3SJVD 1NMCB 3CC5B 4ELME 4PYGA 2D0GA 3QH3B 5EBLB 1ZV5A 1SMAA 2YA2A 4UDTB 1MJJB 1UEMA 3B9AA 1U0QA 3MA7B 4WEMB 4BSVA 2HH0L 3S5LA 4XAWH 4HJGB 3RAJH 5GZOD 5I8KH 2QSQA 3QI9C 5FF6B 4GBXC 5SWZB 1IC4L 4C56E 3WBDA 3T0WA 2V2TB 1SYVB 1OW0C 5DMIH 5I1HL 1HSAB 1HHJB 2OCFD 2G75B 2XICA 3T2NH 1QRKA 3QDGA 3ULVD 4CAGA 5FDYA 1RIUH 3TFKC 1BM3H 5LQBL 5MERA 3L3HA 4OI9A 3BI9X 3BFOA 1F6AA 3UPRA 1H3PL 5HYQA 1JV5A 2OJZL 5D2LA 1I8IA 3ILPA 3UROR 2EH7H 5IR1A 5J7CC 4LCIL 1ERNA 1KF9B 4CDGC 4YDJB 1YPZE 2ZUSA 1X5LA 3LKSA 1CFNB 4L8CB 3UAJD 1RJCA 2DLGA 2XA8H 3O2DH 5I1EH 5JIHA 5F6HI 1NCAL 1HZHL 1S9VB 4G6MH 4A6YH 1FZMA 4PJEF 1KTKE 1V05A 1A6AB 4U05A 1MVUB 4YFDB 1YZZA 4Z7QE 1W72A 3KPQB 3QHTC 1JHLH 4LARH 3BPLB 5LQBH 1JF1B 3BAEH 5F21B 1B2WL 4D8PB 1NGPL 3KS0J 2CRIA 1OP5K 2FJFB 3INUL 1DQLL 1T80A 4FG6D 2EDLA 1DP0A 2F5BH 5FYLE 2UVEA 4J8RA 4BA8A 3BRDA 1SBBA 3AUVA 1FJ1A 3TWCH 2BHZA 1BJ8A 4P23B 1WGOA 5DHVB 4NHUB 1MF2H 4ZQKB 3EYFA 3Q2CA 4FFZL 3NZ8B 4BH8A 3BD5A 3RWCB 4JKPH 3MUY1 1HHGB 3KPOB 1KJVA 4NN6C 3IT8D 3QIWA 3KLHD 3O2DL 3NABH 5C0BB 5I1EL 3E6HA 4I5BA 2D7NA 4HWBA 1ZA3B 3HFMH 3CMGA 1N5AA 2ZUQC 2XXCB 3FQXB 5C0FA 2AEQL 2LFGA 3U7AA 1J1PH 1BVKA 5CJ5A 5L0QC 1IM3B 5CCKL 3FMGL 2DIBA 4HS8H 1PBYA 3DV6A 4YC2B 3QQ3A 1B0GA 1YEJL 4X9HA 1RU9H 2OMBA 3O3BA 4U7KA 3REVB 1FL6B 5CBAB 1FGVH 4X7TB 1ZT4A 3SDAD 4K7PY 2VABA 3FONB 4PLOB 1YNTA 4U6XA 2ZSVB 1QFWM 5GS1B 5HPMA 1VGKB 4XAWL 2CR3A 4ZFOL 1AH1A 1KB5H 5IROA 2R8SL 4PP1C 4QHMB 4PJIE 3O4LB 1FYHB 2A83A 4M5YL 4NYLA 2FO4B 2EE3A 2M26A 1JBJA 3WFHA 1EGJH 1A4JB 2UV3A 1J11A 4EZMA 3BKCH 3MLRH 4LPTA 3FO2A 1CDGA 4FFWD 3H9YA 4LPCA 1D5XB 3MO1A 2MQ0A 4HW6A 1F5WA 4K7PH 4B50A 4DGVL 4LRNL 4QHUB 4WV1B 5DURD 5EUOF 5T1LA 4XBPB 1AY1H 1BAFH 3FFCD 5GISH 3FB7A 5E2VL 5I19H 3RZCD 1A1MB 4JQXC 3NCJH 3CFBA 5EO9A 4KI1A 2YSSB 2F5AL 1MAJA 5E1HB 1XF1A 4NKMA 1ZVYA 4YDKH 3MRQB 1B88A 5KOMC 1W0WA 4DEPC 4Y7MA 2LE9A 4JPVH 3J8F7 4KUCF 2VLMD 4ODHH 1OB1A 2G5RA 5GZND 3CLFL 1WAAA 1DLFL 5FGBA 4AMKH 5ID1B 5FCUL 2PETA 5DD5H 2EKSB 1MCWM 3D18B 4PTUB 5B39G 1P4BL 1MHPH 4L5FH 4XCYA 2ID5A 4GQPH 1IEBB 5D7IB 5IVOA 4Q0XL 1F3JA 3H7LA 2DQJL 4OUOA 5GGQL 3K8MA 4MB3A 2WUBL 2E9IA 4Z6AT 1OCWL 3N9GL 1BQSA 3UPCA 5IT2H 3MV7E 1NMCC 4QHMA 1NLDH 3QO0A 1D6EB 1SBSH 5J12C 5I1AB 4DKFH 4PPTA 3A0OA 3F62A 3TZVA 4ZO8A 1J0JA 3QAZB 5ADPL 1OLZA 5EO0B 3MNVA 2DQJH 1I7UB 3TF7C 4I9WE 4OFPA 2MHAA 3BP5B 2H8PB 4XPAH 1N8ZB 3QDGD 4MQXD 3UPAA 4UBDD 3V6FA 4CMHC 1QR1B 5FO7A 2NY3D 1A6UH 4XCNB 1W0VB 2QQQA 1U8HA 3MTRA 4GMSL 2AK1L 5IP4A 4RISL 4M61B 1J0HA 2HTKD 2JJSA 5E5RB 1SY6A 5DEGB 1ZA3A 4NWUL 2Q6WB 4R0LC 3CXDH 1PYWB 1D9KC 4NBYB 3U0TB 3SE9H 5BRZD 2X10A 1P9MC 3K1DA 3QXUA 1LK3L 4MJ5A 4ZNCD 1R0AH 3ZDYF 4LSTL 4U6HB 3RWEB 4M7JH 2DYPA 2R1WB 3KYKL 4MS8D 3RU8H 4R2GC 3W0WB 4J1UA 3VFSA 2G75A 3D0VA 3TBWA 4KU1A 1GIGL 3BPOC 4A2LA 4FNLL 4FQQB 4OF3A 3RWCA 3MV01 4UT6L 3EDDA 3IJSB 1L4IA 2V2WB 3Q3GA 5JW3H 4E42B 3HZMB 4KH2A 1FE8L 3E8UL 3G6JB 3NCBB 2XRAL 3PWVB 4X9IA 4H26A 3MR9A 4F3FB 1KC5H 2EYTA 4HHAB 5FOJA 3D3VA 1K8IB 3QXDA 5FA3B 2VR4A 2DM4A 7CGTA 3LKQB 5DHYA 2FLRT 2WUCH 1HHHB 2YBRB 2YUZA 3LKPA 5GRUH 1MCHA 3QG7H 5EWIH 2ZUUA 1F8TL 4JY6A 4YLQT 1AO7E 4RAVB 3NPSB 2AQ2A 1GGYA 1XAUA 1BBJB 4NC1C 3MCKA 1F97A 3QUMH 4MJ6B 2H2PC 1RV6X 4YUEL 4R4NC 5GHWL 1S9VA 1P7HL 3QQ9C 1WWAX 4HXBH 4M6MH 3SDDA 2Z8RA 4V1DD 4QTHA 2JE8A 1MCKA 1WC7B 1M05B 4YHLL 3CPLA 2CLZB 1M6OB 4JCLA 2D03H 4MAUH 5DD1L 43C9B 1I8LA 1JFQL 2FL5B 5ILTL 3ULSA 4YFLF 5DURB 1C16A 1Y18A 5KAQG 1F11B 1U93B 3GMQA 2B39A 1QOKA 4KZEH 4N9GA 3IKCA 4QYOB 1JPFB 1Z6JT 1Z3GL 4HKZA 5BZWB 3N1GC 4JN2B 4W68A 2UYLB 4BYHA 5KTEH 4XXDA 1RZ7L 4WTWA 4H1LG 3C5JB 2GAZB 2GYSA 1WFOA 3QFJE 5CZVH 1A4KA 4XPHL 1CBVL 2WBJA 1NGQL 4Q6YA 3KNBB 4G6AC 1MRFH 4TUKH 1L7TH 3IETA 2FGWL 3OKLA 1HH6B 1PY4A 3HZKA 3AS1A 3LKOB 1DVFA 4D9QE 4IRJB 2A0LC 2Q76A 4UINL 4P4KC 2NTFA 4JFEA 4N0FA 3P9MA 3MOAL 3PIQA 3QG6A 4Y16B 5CUSH 4JRXB 4Y5XA 2PNDA 4L4VB 3LQZB 4O00A 2E8YA 1G7HA 4Q9QH 1AQKH 1PW3A 3TESA 1VFBA 5J8OA 5C07A 3TBYB 1NBYB 4IRSD 2B8OT 2DQUH 3D5OF 3MRNB 3SKMB 4NRZB 1LNUA 5BVJB 3W2DH 1S7UA 2APWA 4GQ9H 5EU5B 4U6YB 3MYJA 5E9DA 1XH3A 1J8HA 1X5KA 1OF2B 3MJ7A 3VH8A 1S3KL 1BBDH 12E8H 1T0NA 1A6VH 1T7WA 4E9LA 1CQYA 4QRTA 1D5ZB 4HUWB 5IB3A 3SJVA 1QBML 1AFVH 4DGIL 4QRQB 3U46A 1PYWA 1PG7X 3PV7A 1EAPA 1ZXQA 1WZMA 1R3KA 1S8DB 4NPYB 4WVRA 5EFIB 4WI5A 2R56H 2X4QB 3ZDZF 2WLZA 4NWUH 3EFFA 5KSAD 2YK1L 4RQQA 1A7BA 3CX5K 1X5AA 4WI7A 4HJJH 1PKQA 5HGGS 3RL1A 1J86A 3UTSA 1MCSA 3RVWC 3IJHB 3ARVA 1U3ZA 2F53D 4PS4L 2EDYA 3GSVB 5D1ZB 1A6WL 2BVTA 3MRLA 2EE2A 5DRXA 3UZEA 3MRPA 4I0KA 4PJCB 2B4CL 3UZQA 4YO0B 5B8CC 4TQEL 3L3JA 1JPSL 3GBNL 2FX7H 3GJEB 2O61A 3JV4B 5HJ3A 4GXVH 1HDMB 1QFUH 4LDEB 3EGSB 4MDIA 4MSWB 5C08B 4WFEE 2EDHA 1KFAH 2C3GA 2VZOA 2I9LA 3CDGB 1L0XA 5T3XH 1UB6A 1FV1B 3O9WB 4LFHG 4NZUL 4UT9L 1MFNA 2CIIB 6CGTA 2CXGA 1Q72L 3KDMA 1F13A 4F7CB 4W4OC 2JCCA 1FGNL 1U95A 2W91A 2QADC 3U4BH 1RI8A 3I75A 2WV3A 1TQCC 3ALPA 1YNKH 1QSEA 4WWKA 5CP3H 5IV2B 2YEZA 3C5ZC 1L0QA 1WCBB 1JWSA 2AV1A 4ELKB 4N5UA 3GI8H 4L4TB 3S98A 4HIXL 5F9OL 3UTSE 5ESVA 3D2UD 3JV6A 2N4IA 4PV8A 3SGJC 4I0PA 2X4TB 2HT2C 3NABL 2CKNA 1MCCA 3VXSA 3WIFA 4DN3L 5EUOE 4R97B 4OZIF 1F3DJ 1KJ2H 1J5OH 5C6PB 5IGXH 4R97C 3SDYL 2JK5A 2ENYA 1TJGH 1AJ7L 2Y06H 4JKMA 6FABL 5K59E 3DVNB 2EICA 5F8RC 3RX8A 4LIQE 3L9RB 3RDTA 1CICB 4LLQA 4R3SA 3MV11 1E27A 1RFDL 3VWJA 4KROC 3VDBA 5E9DE 3LD8B 1JHTA 4NQEA 1JWMA 2NTSP 4NO5A 4UOJA 3TIEB 3BT2L 1T04A 3MRMA 3JWOC 1V7NL 1XGQB 2O5YH 3V52L 5JNYB 4ORZC 5GS2D 3VE0B 5D72L 2DJUA 4XTRD 5MEQB 1PVHA 4MA3B 3TJEH 2AJZB 5HVHB 2C5DC 4KY1H 5LGJA 4PJDB 1DUZA 4LPXA 4Y88A 4JPKH 1XCQA 4OFDA 3MRJB 5E2TH 2F5AH 3GKWH 4KUZL 3TNNA 4E5XB 3PGFH 3T0BA 4OKDA 2DMCA 4BZ2L 5D1XC 5E9DB 5DVNA 3TO4A 3DROA 5ABDE 2VH5L 4B7IA 1TXKA 1BAFL 1G9MC 2ARJB 4HGWA 1I8KA 5C3LD 3U4BL 3QIWB 4QXGL 3U82B 1E4XI 4L4VA 3QFJD 4NQDB 3LQAH 3IXAA 1KN2H 1FNGB 3VXSD 1QLFA 3VG0L 2G2RB 4N9OB 4MAYA 2VZ3A 3GMMA 3IFOB 5DK0B 4S1DC 1G1CA 5I1IH 3IDMA 1CLZH 3ABZA 2AJVH 2R2HA 4G8FB 4QRRE 4WEBH 2CUIA 1FL3B 4L4TE 2E9JA 3D85D 2VUOA 3EAKA 1T0MB 4R0LA 3E1F1 4JFOA 1PG7L 2KUTA 1ORSA 2IFFL 2HVKB 1UWGL 4QOKD 3EOBA 2B4CH 3PXJA 3E2HB 4OJFL 5J3HC 3CFDA 1EEZB 4MYWB 1JK8A 3MRHA 5J57B 3SKOA 3BSZH 1RULL 4OLYH 4UBDC 2WIIB 4XX1E 1A8JH 1LK2B 3L6FA 1U93A 4N0UA 1PGRB 3VXQA 2BSSA 2ATKB 4I2XB 2P46B 3MRKA 1FAIL 4JG1H 3SGEH 4QOKA 2X1PA 1NAMH 2Z4QB 5C08E 3RHWK 2A38A 4JFPB 2CJUH 1BD2E 5LCVL 2J3SA 2CK0L 3U48A 4BJLA 4I2XE 3PWJB 4LSSH 1T1ZA 4A2MA 4LSVL 4CMMA 4PUBL 4WW1A 4DVRH 3HMXA 5EZOH 2A6KA 1AC6A 3KLAB 5D96B 1Z0MA 4JM2F 1NAML 3LN5B 1MJUH 2ATKA 4BFEA 3L6FB 4XP6L 1I9IH 4LCCA 5M94B 4PJXB 5F71A 1VEOA 3QFJA 2QTEA 4G80B 4AH2A 1QFPA 4MCYB 4E41D 5JQHC 2DQUL 1DBJL 1HHHA 1P6FA 2YBRA 4U7SA 4JZJB 4JB9L 3DXAE 2JTDA 5CSBA 1JZ7A 2V2TA 4HS3B 5FK9B 1G6RB 2AEIT 2RR3A 3CZFB 4GW1B 2WQ8A 2AP2A 1A21A 3ARDB 3QUZC 2BOCA 4RZCA 1WICA 1CG9A 4PJHB 3IDXH 3CLFH 5TDPB 5IHUH 2H9GA 1KPUA 2X4RB 3QDMD 1OAYH 3GSNA 4WEBL 2E3VA 2X7LB 4E42A 3QEQD 2AJYL 4ZYKB 4MAYB 3D2UB 2YZ1A 3MV7D 1QP1A 4GW1A 5A2LH 4D9RE 5E2WH 2IMMA 2E5EA 5F7DA 3S3SA 3TC9A 1YMMD 3RGVA 4WUKH 1GGCH 4C56D 3W81A 3T77A 2EE9A 1WCQA 2G2RA 3RDTC 4F2MB 1FBIH 3WFDH 1VFMA 1YEDB 4WUUB 2G9HB 1YNLH 5IBLD 2ZG1A 3EYQC 5J56B 5JXEA 4JFED 2FX8L 2HWZL 4XP4L 5KJRL 4PV9A 5DEFA 1A1OA 4NZRH 3OZ9H 4NBXB 3MJ9A 4XVTH 4OBRA 3BSZL 3RBSA 3KG5A 5DC9B 1MREH 3QXAA 3BW9A 4P48A 3T2NL 4JFQB 5E00B 1VKXB 3TVMD 3PWPA 3CSPA 3KGRA 1A7NL 2VLRB 4QWWD 3GB7A 3Q5YA 2AJZA 2MHAB 3BP5A 5HYFA 3CVHB 3MXWL 3GUTA 2OL3L 4ZUSA 3VE0A 4J6RH 1GC1H 4HXAL 5AAWA 3DX9B 4L1HA 5EBMB 1OAZH 2EDOA 2HJFB 3RZCA 2NY6C 4FQ2L 1Q8MA 1YPZB 4O9HL 3GB7B 3HG1D 5HYJA 5D7IA 4KVCH 4HIEA 2NW3A 4NBZB 3UYRH 4HUKB 3X11A 2Q3ZA 2VDRL 5CWSB 1OAUH 1A02N 1AE6L 1YN7B 5C09D 1OWRM 4XHJD 1BX2A 4YHKL 4XHJC 3BEWB 1LHZA 1F58H 1ZEAL 3P4MA 4GAJH 4JVWA 5C3TA 5KOVC 3SDCD 3VXSB 3O8XB 3B3IA 4QRRA 3HZVA 2AJUH 3ZTJH 1A7QH 5T3XD 1KJMB 3S3JA 2JK5B 1A7OH 4EOWH 4L3EA 5FUZH 5F9OH 3V5KB 1JUFA 4K2UL 4OZFA 4TVPE 1EV2E 4I0CC 3QEHA 2DI8A 4YHZH 4YDVB 1OTUC 1A6VL 3MV9E 2NXZD 3WL9B 1ZA6B 5ISZB 5GGVH 3I6LD 4PBWD 4OQTA 4GW4A 1KGCD 2K7PA 3ARWA 3IVKA 4PJ8D 3VA6A 1FGNH 2JF1A 1XF4B 4P5MA 1BQHG 3EOAA 1UADC 4MNGA 4OZGF 3CNKA 3NA9H 3PWPD 5H35A 3ZKND 2XZQL 4DFHA 4LSQH 4Y19E 4D0CB 2EEAA 1ES0B 3Q1SL 1G6RA 3SKJH 5F7WC 4UT7L 5DTFA 4HWZB 4AENB 3GMLA 2JJWA 5E6IC 1KLGA 2R2BB 2PKDA 4MNQD 3V6ZB 4JFDA 2PW1B 3EIFA 1UWXH 3T65A 4DN3H 4KDTA 3DWTA 5DUPH 3LN5A 5BRZA 3BN9D 1LGVA 1S7XA 1Y6KR 4WHTB 5DJAB 4FTVB 3RGVC 1KEGH 5HHVH 4OUUB 5EU3A 5E6YA 3RL1B 4G5ZL 3BVNB 4U49A 3UJTL 1CIDA 4OD1L 4Z7VB 4CN1A 4JVUA 2VLKA 1RUKH 1DVFC 1YC7A 3EFFB 1JPTH 1FZJB 1JJUA 4JRYA 3W5MA 4HIHB 3T8XA 2DQIL 3LRGA 3ELAT 5ACMA 1OGAE 2Q8BH 4CU6A 1QKZL 4FFVD 2VXTH 1WCBA 1WAAF 2V9RA 3R8QA 4DZBB 4MXVE 4M6NL 3UCRA 4M7ZB 1XF5A 1U8JA 3I75B 1BBDL 3MLVL 1MUJB 3QISA 4KK5C 4PP1D 3WFBL 1LO0H 1YEGL 1SYSB 4M7LT 2B5IC 4LU5L 1KJVB 4P57B 3SOBH 1IGFL 5ICXA 1BWWA 5I1DA 2W1NA 8FABB 4TVPL 4WUUD 1MCPH 2J7LA 2R1YA 1MLCB 1MIMH 3QCVH 1UENA 3G6AA 1S5HB 2JIXD 5TQ2L 1QFWH 1R5IB 4O4YH 3RHWF 1CE6A 5IBLC 5C07B 3TBYA 2NW2A 4JREB 4JAMA 2QEJA 4L8SA 3DHMA 3VFNA 4XNQB 3DX7A 1CR9H 2XTJB 4PJCA 3P2TA 3BGFB 4LLMA 5IJVA 3DBXB 3GNMH 1MEXL 1SEBB 3VGGA 4IEFB 3T1FA 3RIFK 3VGBA 1ACYH 3AB0C 3O11B 4MHHI 3OKEA 4UQ2B 1D7FA 4Z0BL 2VQTA 5CINH 2BNRB 2LVCA 2A0LD 2H32H 1KBGL 2VXQH 3ZYIA 3MXWH 3FZUC 1VESA 4KI5C 1CN4A 3SE8H 4F9LA 1EFXD 3C5ZB 2MCPH 5F9JB 5MEPA 2ZCKL 2A6DB 1UZ6F 3LPWA 5J3HD 2J8UF 1MHCB 3O6KL 1XGUA 1QKZH 2DICA 1JZ8A 1XEDA 2VR5A 3RVTC 2HJKB 4F37F 5F9WC 1XH3B 3VH8B 2Z35B 4XB8A 5TDOB 3ZT6A 4KQ3H 2XWJA 1TETL 1ZSDB 4M1GL 3SDXB 5KW9L 3M8OH 5SWSD 1BFVH 3G6DH 4U0QB 1RUPL 3AREA 4BFGA 5DMYA 3QNXA 1Z9LA 5CP7A 2N56A 3LKPB 3AM8A 4IMLB 5E8EB 4WTZG 3HMWL 2NZ9D 4OLWL 4KAQH 1K8DA 2YPLA 5IT2L 4WTXA 1I85A 1KENH 1MJJA 4HHAA 3H3BC 1FNSH 1TMCB 2J4WL 3PGDB 3F5WB 1SEBA 5DO2D 3OF6D 5E8DL 2A77L 3CDFA 5KVFL 3RWGA 2NY1C 4JHZA 3QO1A 5D70L 3IAGC 1UM5H 2BNRE 3ECBA 4DQOH 4ZOCA 4OB5L 1GYAA 1N59B 2PCPA 4P9HL 3O6FA 3MRDB 1UH4A 5EORL 2X4OB 3H9SD 4G6JH 1MNUL 5DD6A 1P84J 3BUTA 3HZMA 2ARWA 2VLLB 5IESH 3WNOA 2GUOA 3GRWL 3QPQC 3OX8A 5HHXH 1UB6B 1DEEA 2QSCH 1CGWA 5IFAL 3VFGL 5AZ2H 4J12A 4OGYH 1B3JA 5A3ID 2PXYD 3TP4A 5I18H 1VDGA 1KNOA 1MUJA 2VLJD 1HDMA 3C6LC 4Z5RB 4FP8H 5GQBA 1F45A 4HEPG 4MS8C 1QR4A 3WJLC 1QUNA 4JPIA 1EERB 4R26L 2QQLL 1U58A 3IXTA 3K80A 2F9BT 3S5LG 2R0KL 3BIKA 5MHSE 1HKLL 4CN6A 3SQBA 2HT2D 1K8IA 1NCWL 3M1BB 3QXDB 5BRZE 4S1SL 1K3ZA 1W8NA 4RCAA 2YUVA 4MA1C 3VRJA 1AO7A 4DUVA 4LOUD 3FQRB 3KPNA 1CE6B 1QD0A 1HHIB 5C0AB 1MWAA 2P24A 3FZUD 4KI5D 4F58H 1VHPA 1CLZL 5L9DH 1RJZB 3KJ6H 1PQZA 1TZGL 2IQ9L 1WBXA 4FFYL 4HK3N 3OXSA 4GG6E 3TFKD 1VFOA 4S1RL 2CKBL 3EYUL 3HAEG 3U1SH 1ZLVH 1C5BL 4RFEA 4L3AA 3RPIA 2QHLA 2GT9A 4W70A 3RKPA 4CVXB 5MP6H 3MNZB 1OP3H 2SEBB 3GRWH 3GSRA 4IS6B 4JZOB 4HT1H 4Y4FB 1G7HB 5ID1A 3HG1E 4QGTA 5KANI 4HIHA 4UV7L 4X6FA 1WWWX 2Z93A 1P4LB 4HS6B 3P3YA 1EIBA 4XAKD 2D7PA 5C0CE 4WUKL 4IRJC 4ZS6D 5TQ0H 4ZOEA 1MCFA 1EMTL 3UMTA 3KXFB 2KPNA 2DI7A 5E8EA 3C5ZD 2PYFA 4IJ3C 4WHTA 3DI2B 3BEVB 3JSSA 3RA7L 3K0WA 2GAZA 1A3RL 2XY1A 3PXHA 1V7MH 3ZHKA 4PRAA 4TVPD 1CXFA 4QRRB 4D9RD 3AY4C 4WI8A 2AW2A 4ZUTB 3VRLE 2CDFB 3ARUA 4JFFD 5GS3A 4LPYA 2CH8A 5C70A 3ARBB 1ZLSL 3WMSA 1F3JB 5L8KB 4OZFH 5K9OB 2LU4A 2OJEA 1KLGB 1CFTB 2OQJA 4DOHE 1I1YA 3DJ9A 4H25A 1UACL 1EDQA 1GGBH 2XZZA 4WHYG 4JFFE 1BJMA 2P43B 1Q9OB 4CNIA 3BQUD 1A4JA 1YEFH 5DR5H 4JKWA 3IDUA 4I18B 4QCIA 2ICWI 3EO0A 3NN8B 4JM4H 3L7FA 1I3GL 2AV7A 3H9SE 4GKOA 1P69B 1Z0NA 3U0PA 3O3DB 1AKJB 2R0LH 4AIOA 3PP3H 4FQXA 3D9AH 5KSVB 3KXFA 2EDEA 5C0CD 1H8OA 3HC3H 4K94L 1R24B 3ZT5A 1LE5A 5HYSB 4UTAL 1KELH 4JFQA 5E00A 1RUQL 4XMPH 3QWRD 3C6LA 3VDCA 4LLMB 4NNYB 4IOIA 3D3VD 3O3BB 3O45B 4Q74A 3LKQA 3RIFF 2PTVA 1A1OB 4XVUD 1BM3L 4MD5B 3D39B 3SKNB 3A67H 4FFVC 4NRXA 1LP9F 4J4PC 2FECL 1BVKB 2CKBH 3EYUH 1G7QB 5EU4B 2QBWA 4NQVB 1NCBL 4NOFA 4LCUB 5C0FB 2UY7A 1JRHL 3SE4C 3MMEA 3IJSA 3T4AA 2HFGL 4QO1A 5HYJB 4R2GD 3D0VB 3TBWB 5D5MB 2VL5A 1YJDH 1CTNA 4Y0GA 4S10A 1JPST 2BX5A 3MMEB 3D0LB 3FJTA 2JCCF 4P23A 3GSNB 4M1DH 3LS4L 1KPUB 2X4RA 4ZPVB 2DB8A 3AB0B 1JF6A 3QIBB 4Q2ZA 3SBWA 1TTGA 1K3IA 3BQUC 3U0TA 4U6XB 4CVWA 3O6MH 3M07A 1ZT1B 3FRUB 3BJLA 2J1KA 1T5WA 4XC1L 5DK2A 4ZUVA 1B0RB 1KG0B 3QQ3B 1XFPA 3L3KA 4KJYA 4AH2B 5GJTH 2ZUTA 1T6WA 2H8PA 5IUSA 3FB8B 1KV3A 1FLRH 1RK0A 2IANE 4IM8A 1S7RB 1LWRA 2X4UA 4EI5C 4NC2B 4E41E 5FHAL 3UTZA 4ZFGH 1U8IA 4R90H 4QF1B 2OYPA 1NGXB 4GXUN 4OKVB 3VFWA 4Z7WB 2I5YH 2NXYD 1CFNA 2P47B 5DXWA 3EO0B 2NMSA 3NN8A 5AZEH 2W9DL 4NJAL 4MQ7B 4H5SA 1DSFH 4R9HA 1PEZA 3UTTE 5A16B 4YXLL 5DTFB 1I7RB 1I7ZA 5D1XA 3E0GA 3D69A 5C8JB 4KHXH 1DQLH 1MHEB 4HFUH 5K9OA 2GKIA 2R4RH 4DQOL 4JFZH 3QRGH 1BJ1J 1OTUD 3S35L 2X42A 4UT7H 5EUKA 3SKUD 4P2RB 1ZLUK 1QSVA 1EO8H 4YNYA 4ODSL 1HIMH 2ADIA 1BGXL 1MFDL 4LSQL 4ZAKD 5IGXL 1QLRA 4MZ3A 3QB7C 2EYSA 4HS3A 3FT2B 1G9ML 3O2VH 1C1EL 5INCA 3LEXB 3CFJA 4FQXD 1EPFA 3FTGA 3OAYK 3TT3L 3K8LA 3MLZL 5KW9H 4XRCA 1KJMA 4QRRD 3U0PB 5C2BL 4O02H 1ORQA 2W38A 1Q38A 1JE6A 1HXMA 3HTLX 5C0AE 5BOPA 4NQED 4K2UH 4WW1B 4TOYH 4F7PB 3QNXB 1ZGLA 2B0SL 2E8ZA 4KHTL 4A6YA 3RWDB 4QY8B 4RGMC 3MNZA 4L8DB 4M6OH 4H8WC 5DMKA 4C55A 2VQUA 2WBWB 2COQA 2XWJB 2IQAA 3D87B 3QCUH 4X5WB 5CMAA 4M02A 2NY2C 1JRHI 2OK0H 3G04A 2FJHB 4G43A 1URLA 2WIIA 4Z7VF 4GT7A 1UH2A 1J1XH 3LS5L 5HGBA 1F4AA 4Y19D 5E08H 3C5ZA 3C6LD 5DS8A 5C0CB 1VGKA 2FX7L 4JFOB 1KIPB 2Z8SA 1A14H 5GS1A 1C12A 2JJVA 3LCYA 5F96H 1MEXH 2Y9RT 3SDAC 4AZ8A 1RMFH 3CXHK 3BKMH 2F54B 1IEHA 1F4YL 1VFAB 4JHWL 5EBLA 1EBPA 5CILH 1G7PB 4QT5B 1R5VA 4GJTB 1ZHNA 4LGSB 4KDTC 3HLAB 1RY7B 4Y1AA 1G7JA 5DGRA 1GC1C 3D1MC 5IKCA 5D6CB 4MMZC 4LLQB 5T3ZD 3LAFA 1U8PB 3MACL 3PF2A 5IWLC 2HKFH 2DWEA 1UZ8B 2VUYA 1KUMA 3KPLB 5DUBA 4HFWA 4ELMA 3MUGB 5SWQA 2CLVB 4KDWA 3HG1A 5HYJD 5IB4B 4XNYH 5EIIA 2BJMH 2LABA 1TVHB 1JZ3A 3ARFA 1MLCA 1MFAH 3T2OA 5FKAB 4U1IB 5TE7H 4R8WL 2FIRT 3C60D 4JFDD 4JY4B 4JCMA 1INEH 3P4LA 3BPNC 1ZLVK 4PJDA 3U6RB 1TQCB 5ANMA 1IGYB 4MJ4A 5IVXF 2ZCHL 1AO7B 4I3SL 3UTQB 4QNPF 1QSEB 4WWKB 3FN0H 3BH9B 3WS6C 2AI0H 1XCTB 3WS6A 4DFIA 1CGTA 2QQNL 3HPLB 5ICZB 1XGQA 4F80A 3CCHA 2GEEA 3MXVL 3RKDD 1GOHA 4OLXH 5IBTH 4JRYD 3B4NA 2W9EH 4MXWL 4YPGB 5CKAA 4Z7VA 5D5ME 5L2KE 3RDTB 4WFFE 3CVIL 4UILH 1I1AB 3EGSA 4MDIB 5DVMA 4CKVX 1J8HD 5FA4B 2PYED 1AGCA 2EO1A 3HAEA 4P46D 1QBLL 4G9FD 4Q0XH 1AD9B 3FKUS 4HUVB 4U1MB 4LASL 2K1MA 4K3DH 2VN7A 4WRLA 4Y5XC 5DC4B 1X5GA 3O3AA 4D3CH 1U6AH 3MRPB 3C8HA 5LBSH 2R2EA 2HRPL 1QFHA 2W92A 5HYQB 4KRPC 4XPGH 4WU5B 3UPRB 1FLTX 5BVPH 1IQWH 5C0EA 3HI1A 2EIBA 1W0YT 4XCCH 3GMOB 4YXKH 4M9OA 1EEUA 3FO0H 3G5XA 3WHE1 4PJ7B 2IH1A 3SCMB 4N1CA 3T3MF 4BQ9A 1N5YL 3S6CA 4YHZL 3IU4H 3V0VB 4P2CG 1A9BA 3VFUA 4R0LB 2D7OA 3TT1L 4EUPB 3QUML 3S5LB 2WNGA 3OHXA 3PGDA 1OAXH 3HC4L 4NSKA 3UZVB 2VDPH 2BNRA 4H88L 2Q1EA 1T0NB 3DXAD 3ZTNH 4KXZH 4DJMA 5TE6H 4RGNC 1CFQB 1CLYL 3EHBD 1OARL 3B9DA 4JO1H 3LVEA 5HJ3B 2D7QA 4QRUB 4OM0H 4K7PL 1IKFH 1OAUL 2H32A 3GDBA 1I8KB 3PHOB 3DX7B 2DL9A 1DANU 3NCEB 4L29A 3DRTA 1T1YB 4OLVH 5D7JC 1N6QH 3MUHL 2R69H 2I60H 4OCXL 4QHLB 5JQ6H 4OFYA 3NIDF 3G6AB 5FGSA 2Z35A 4OF6A 2R0KH 3U0WH 1IGML 5IVXB 1IBGL 4K3HA 2D31A 1FH5H 1PKQB 3PWUB 3MRJA 2E7MA 2YPKB 4M7JL 5F44A 3RPKA 1NJ9B 3VFUB 4OGAD 4GLRI 1VPOH 5DRZB 1YN6B 4UV4L 3DX6A 4KUZH 4PGCA 3VFOB 3F65A 2CIKB 1D5ZA 4JPKL 3FO9A 1R3HB 1CL7H 4OCLC 2WZPD 3RI5K 1JNNH 4PJ5D 5JPNB 3VXRD 3ZKXB 4PJEE 1TZIB 4GRWF 5L2KA 2CLZA 3DOSA 5HGDB 5CBEB 5GJSH 2VLKB 3FB6B 4YXHL 5HHMD 1T4KA 4HPYL 4KJPD 1DBBL 3NZHL 4P9HC 4AL8L 3P9LB 5MEND 3NPSC 5GGTL 3TO2A 1BEYH 3AVEA 4N0FB 5EG6C 2IADB 2IGFL 5AAMA 5I8CA 5CEXB 3BESR 3DSNA 3L3GA 4JFDB 3CFEB 1FG9C 1FVDB 1YYML 3EYQD 1AI1L 1S9YB 3KHOA 5ANME 5I66A 1U2CA 4XVJL 1MHPL 1AIFB 1LD9B 3C9NB 4AIZB 5C2UB 4OGXH 2AXGB 1CVRA 4S11A 3GHBH 1ES0A 1NGZB 4HLZH 3CJJA 4AEEA 2VDPL 4RGNB 3QUYD 1JPGA 2OTUA 1RZJH 1IGTA 4ZFFB 3QXWA 2H9GB 1FYTB 2J5LB 3L1OH 4LLAA 2ADJB 5TDPA 4LSUH 1YECH 4M8QA 2EH8L 2RBLA 3GIZL 2JCCB 1CXEA 3RVWD 1IFHL 2XN9D 3G6JF 4GAGL 1C16B 5DGQA 3E2HC 4JRYB 4P2QD 3MCLL 2YHGA 1EO7A 2FX9H 4PRHB 1I1AD 5HD8C 3G6JE 3F58H 1KYOK 4X83A 3W0WA 4G80A 5EZIH 5EZOL 4XP9H 3UTOA 4P46B 2MKWA 25C8L 3BO8A 1B9ZA 2J8OA 3IDNA 2LU3A 5I1GH 4HGKC 1X9QA 1JN6A 5DUML 2GCYA 4HH9A 4Y4KB 1I1FA 1Z9OA 3PWJA 1AD9A 3BYTA 1I9RH 4Y1AB 4IRSC 1KG0A 1GGIL 4XCNA 5FO7B 2ICWA 2IPTH 1MAMH 3HMXH 5EU6B 3OJ2C 4RAUA 4N0UB 4ZO6A 3UTTD 3P0YH 3LN9A 3U7YL 1KJ3H 2BCKB 2VN4A 3MLXL 1N26A 2DMKA 4HUNB 4K3EH 4M6AA 3NIFF 5T1MB 4ODVL 1KB5L 1U3HD 3CCHB 4OD3L 5SV4A 5BW7C 4JO1L 4JPWL 3BN3B 5EBMA 3TBSB 3TZVD 2ZCLH 3GO1H 1NKRA 1G6RL 3N85H 1J8KA 4L4JA 1AXTH 1F6FB 3VFSB 1FGVL 1P5UA 1J10A 4WWKC 1KT2A 1OAXL 3HC4H 3CFKA 3PNWB 4X5WA 5D7LA 5ANMB 2CLVA 5I9QB 2HYMA 3D18A 3PP4H 3FRPA 4LEXH 5E6ID 1OY3B 2R0ZH 5DEFB 1U8QB 1R3LB 3SQOL 5HGHA 5HI5D 2NY4D 1KPRB 4PJHE 4XMLL 3QG6B 1N7MH 4FQ1L 43CAB 2EYRB 4LVNC 4FFWC 2VITA 4YBHA 5TGBA 4NO0B 4B5EA 5EORH 5JORA 2AK4E 5ERWB 5HYSA 4EXPX 2YZ8A 3IDYB 4HPOL 5DLMH 5E5UB 2VR9A 2YKLH 4KGLA 4TSBL 2FYYA 4JEGB 5JIPA 1FFNB 1HEZA 5C0DA 1G7JB 3C60A 2NYYC 2AK4A 3V4VH 2EDKA 4ZYKA 2X41A 5I1KL 5EC1B 4I1NB 1CDBA 1AXSB 1U8KA 3TYFA 3LKNA 3IKCB 1D9KD 2ESVD 5JPMB 1A6ZB 3GMQB 5IEKA 3FAWA 5CMAB 3P73B 3ZL4L 1LEIB 3QFDB 5AUMB 4BH7A 4GSDL 5F9WB 4JZJA 5CJXA 2ENSA 1L6ZA 2ZNXA 5ADOH 3JV0A 5E7FA 2BY3A 5GRZA 1LMKA 3DPBA 3STZA 4TSCL 5FYJH 3SDDB 1OB1B 2F54E 2GCYB 2Q86A 4CJ0A 4Z7NF 4AEIL 1RJLA 1S9XA 2XIDA 3BZEA 4KHTH 4NUGH 5T5NF 3BUYA 5ALCH 3BIAX 1ZGLB 4LEOA 3FFDA 3UDWC 4ORGB 1PG7W 2NY0B 3GI8L 4NFDA 3OJMB 2BSRB 3BGAA 3WNLA 5B3NA 3MRBA 4ZTOL 2YD9A 3TVMC 1FFOB 1IGMH 2IG2H 1P2CA 5L88L 3D2UA 5K33A 1FYTD 1KJ2A 3FB7B 3HE7B 1DL7L 3QIBA 4Q2ZB 1NCDH 2C3XA 5HTSA 1G9MH 2OMNA 1J05A 1Q0YH 3VXUD 4GS7C 4CDHA 4PJFF 1EAJA 1G7MB 3CX5J 4LAQL 5E2UH 5ITFB 5D8JL 4G8GE 1C5CH 4NO2A 3TLRA 3D69B 2ERJC 1K6QH 5JO5A 4FQQA 3TH2T 5DJ6B 2V6HA 4HC1H 1OSZB 4ODXB 1NFDB 2V7NA 5DQJA 2VNCA 3CFEA 3IDMB 5D2LF 3GMMB 4JZJC 4HWEH 1VADA 3ZKMC 3JV5A 4KQ4L 2IADA 4Y4HA 1RD6A 2JB5L 3UO1L 3DMMD 3UBXI 3IU4L 1N0LA 2HFGH 4IDLA 4NQCB 3U4AA 3MLXH 4K3EL 1T4KB 3QRFM 3QUXB 4YO0A 3HNTL 5CD5D 4DKEL 1LK3H 5LVEA 4UOW1 5GGUB 5L2KB 2YK1H 1A22B 1NGXA 5T1DH 3MYZA 1S7WA 3PDDA 4D9LL 2Q8BL 4I2XA 2C4XA 3EYVB 3G5ZB 3MRIA 4DK3A 3V6OA 2NX5E 5LJYH 2YD8A 2VDLH 3X12A 2FCBA 5GRXG 4PJ9B 1T22B 1CDJA 1B0RA 1LQSR 1TCRB 3DX6B 3BDYH 4OCYL 4P49A 2BRRH 2FB4L 4G5ZH 4XBEH 1ACZA 3RVVC 3SO3C 4J3SA 5EIVA 4PRIA 2DQFB 2CLRB 3HUJB 4C4KT 2BXZA 4NZDA 2IPKA 4WCYH 4XPFH 3RVUD 1IMHC 3P30H 1IEBA 1RVFL 2JELL 4M7LH 4N8VA 4EIGB 5INDA 1QEWB 5F3HB 2XNAB 2EKSA 1MCNA 1NBVL 4KGJA 3LOWA 5T1KB 5DA0B 1F4HA 2FDBP 3ZDZE 4N8CH 1OAYL 4O2EA 3V4PL 4NRXB 3TEUA 4XBGB 4MD0B 1LP9A 1WEJL 2MJWA 3U7YH 4HZAA 1NSNL 4GRLD 3T0EA 1SJEA 1X44A 3DO3A 4JRXA 4Y5XB 2X1XR 1WIOA 3OKKA 3T3PF 4EQ3A 2Q76B 3GBMH 4BUGA 3HB3D 1EA9C 5IW1B 4KVNH 1I4FB 4PV8B 1P7QD 2YSSA 1A6AA 1MQKL 1DVFD 2GK0B 1K8DB 1D5MB 1A9EB 2GY7B 1LO3L 2AV7B 1GAFH 5EIQA 4QTIH 3QIUB 1RAMA 1AGDB 1JZ5A 1JWSB 5E2JA 5IG7B 4XXDB 3RZWA 5GRVK 2YEZB 3GSRB 4IS6A 1A7OL 4EXKA 5CEZH 4ZFZB 1TQBC 5C6WH 4LGPB 1NUDA 4HKXA 1IGCH 1D5XA 2VDQH 4XMLH 4H25B 1I1YB 3FO2B 5KVDL 3X3GH 1T04B 3MRMB 2YC1A 5MERB 1IC7H 2IALA 1WBXB 4I18C 1CYGA 3OGOE 1JTOA 1JHKH 1GOFA 3GK8H 1IILE 2J6EL 2XZCH 4FA8A 1JWUA 4YBQD 1WBYA 5SWZA 2AGJH 2IFFH 2OJEB 3F8UB 4WW2F 2EECA 3VGEA 3KR3L 2JJUA 2DOCA 3I85A 1FO0L 3L3JB 2HFFA 1JF5A 4FHBD 1BZ7A 1I8MB 1Q9LB 1GC1L 4M43H 1IL1A 3V9FA 4YDLB 2RAMA 2P5WD 5F3BB 4KI5F 3VGHA 4WGWB 2YKLL 3OJVC 5TDNB 2X4NB 4DW2L 4L3CA 1TITA 1BEYL 4FQXC 2JB6A 2VDQL 4Y4FA 1MREL 5DFWH 2YN3A 4FZ8H 4AL8H 4RNRA 3MQIA 2R9HD 3U36B 1RUAL 3P0VL 4BK5A 1MELA 5JORB 5TPWL 3MR9B 5CJOH 4YHYC 1GIGH 4U1HA 1J7VR 1W72H 2BHYA 3E6HB 4GRMA 4I5BB 4R26H 1GAFL 2VWEC 4KK8D 4PJFA 5KSBB 1HYSC 4FQLH 1ZHLA 2Z31C 4K23H 5IB5A 2SEBA 3EYFB 1RJZA 4GRMB 3GSXA 4PGDB 2VLLA 2YA0A 1S7SB 1MJ8L 2PYEA 4NQCD 4OGYL 5DI8A 3PNWA 2CDGB 4QEGA 1XF5B 5J4MA 3QUXD 4X7SH 5IB5B 3S3PA 1KIRB 4P2OA 3M1BA 4YE4H 3QZWA 5A2KH 1JZ6A 3U7WH 4FOMA 1CGSL 3TBSA 4L3CB 5B4MD 3ALXA 2W60B 5I1CL 1QRNA 1MWAB 2NY7L 3F5WA 3HLAA 2QADD 5C0AA 1JI2A 4IRJA 1EEQA 1NCWH 3BKYH 5KBNC 4I9WD 3HMXL 3SE3A 1GCFA 4L9LB 4LLYB 3GGWA 1K85A 1TPXB 4YR6B 1FFPB 1FZMB 3I6KA 3Q5TA 4TULL 3EFDH 1ROWA 4LASH 4MMXC 4LCWA 3H42L 5GZOC 3QQ9D 2WBJC 5CP7B 4HK0A 1UGNA 5K9JH 4NN6B 5BRZB 2VO5A 1IAIL 2UYLA 3T65B 1UC6A 1Q9LA 1UJTA 2KDGA 3S88L 3MGTA 1ZSDA 5HHOE 1DEEB 4Y5YC 2R23B 3VGDA 3KHQA 3SDCA 4I3RL 4OTXL 5T1KD 3DUSB 1IT9L 3B2UC 4ONFH 1M7IB 1J18A 3O41B 1MY7A 1BOGB 3MRNA 3SKMA 2D0HA 3WIIL 4MA8L 1AR1C 5J13B 3U7WL 4OM1H 5FYLH 1MHCA 1HHJA 1IC7L 1D6VH 2F15A 3EJZC 1H0DA 4YBLC 3EZJB 4F8QA 2PCPB 1N59A 1OAKH 4LIQL 3LQZA 2P8PB 1C8PA 3RWGB 1DR9A 1GXEA 4UZGA 1IVLA 1EJ6A 4HKXB 3C5SA 2GJ6A 3OPZH 1JL8A 5BO1L 2B20A 4EI5B 5E8OB 1HXYA 4P4KB 4R7DA 4X5LA 1AY1L 3HRZA 4Q9RH 3TNMA 1I9JL 2WBJB 3DBXA 3BP4A 1K4CB 3VRLF 4LBEA 2FECI 3FQTB 2FHFA 3G9VA 5LG1A 2EDJA 3QIWC 3L5XH 5D1QB 4RMRA 2NW2B 4HX1B 4BQ6A 1CGYA 4GMTH 3LQAL 1CE1L 2LAGB 3RVTD 1UKQA 4V1DB 5DMGD 3V7AE 4IMLA 1FO0B 2Y5EA 2APTA 43C9A 4Z76A 5T33L 3FB6A 5A16A 2J88H 1WJ3A 5J9PA 4DOHB 2HLFD 3PDOA 1VACB 4H5SB 3TA3C 5GRVL 5T3ZE 4YBQC 1LE9A 4G3YL 3WFCH 3DX9A 5JW4M 2CUHA 2DKUA 4JO4L 2XZCL 1OTSD 3EDFA 8CGTA 5IF0B 3RUGF 5JW4Q 3MCKB 4MJ6A 4P9ML 1R5WB 5BS0B 1QBAA 1FFRA 3DHJA 3O9WC 3ZZ1A 2GTWB 4PY8J 1HQ4A 4X0KA 4JO3H 3ARRA 1QR1A 1NGYA 4MA7H 4IRJD 4GW5A 3BH8B 1FFQA 5CLWA 4ONHA 1HYRC 3V5HA 5IW1A 1EHXA 1IM3A 1BIIB 4OZGB 3RVUC 4FTVA 5DMGC 3W9DB 1RHHB 3M17B 1EZVX 5GRJL 4FQJH 4WUUA 4AK1A 4XB7A 5C0JA 4LVHC 5FHBL 3ETBF 1WZ1L 5DT1H 5I2IA 1T1YA 4EUPH 4PP2B 2HN7A 3QUXA 1MF2L 2FWOA 4IRSB 4YWGH 5H2BB 4OQTL 1FVEA 1XGRB 3VU2A 1NBZB 1GPOL 4TYUA 1FIEA 5FDWA 5B21A 2F74B 4ZNEE 2XTJE 5F96L 5T1KA 5BO1H 4BH8B 1T7YA 1XZ0B 2ED9A 2F58H 1EH9A 2W9EL 3OTTA 2VDKL 3EYOA 4Y8AA 5LGKA 1T20A 4P5TC 5I1DB 4NUJA 1H8SA 2A6JA 4ODSH 1CGUA 1RZ8B 4EVNB 1U2HA 2GW5A 3CFCL 2CDEB 3S34H 4HULB 2QADB 1OAKL 2Q6WA 2GSIA 3VXPB 3WUWG 2DQCH 1JGLH 4JG0L 3O6FD 3SBWC 1PJ9A 3LH2L 4MXVF 4PJ7A 4PJ9A 1UA6H 4GAYA 1EK3A 4RIRA 1QPXA 4LLWA 3ESUF 5DHVH 3MRCB 1EUTA 2BSTA 3HE6A 4LLVA 4LCIH 4Z7UF 4LCYA 2X9WA 4N5EC 2ADFL 4W81A 5D7IE 1KFAL 4CN4A 2BSRA 4PJAE 4ZFGL 3DUUA 3BDXA 4DZ8B 3N1FC 4YDJA 1PZUB 4DN4L 2VZVA 2YUXA 3JUYA 1KCVH 2BVQB 4OUUA 5EU3B 3P0VH 5F7KC 1YN7A 4KMTH 1BJ1H 1X3DA 2NR6C 3TCLA 1UQSA 3GMLB 4K8RC 4HG4J 1S9XB 1I1AA 3GNML 2OQJB 3MODH 5DFTA 2V5YA 5CJQH 3UX9B 5E5MB 5JZ7C 3KPRA 1X5IA 2CPCA 3AS3A 3F7VA 3V6ZA 4BKLB 1YUHA 2FSEB 3QRGL 4EIZC 1R3JA 5TQ2H 1OD9A 1RMFL 4I0PC 2VLJE 1X4XA 3H9SA 3FN0L 5JW3L 3BZ4A 5ACLA 2DQTL 4FTVE 5FF6A 3CVHA 1KLFA 5F8QC 1J05B 1L6XA 3WKMH 1YJDL 2XYCA 3MBXH 3RVXD 2XG4A 2WQRA 3PQYA 2Z93B 3NCFB 5HHXL 5L8LB 1FNGA 1FQ9C 2EC8A 3ARQA 2Y36L 3AREC 1HILA 4G42A 4X4YA 1NFIB 4D94A 2PTUA 3H2WA 1EJOL 4XCCL 3GMNA 1JUFB 2OXHA 4XVSH 3MUGA 1U8OB 4NO0A 2R15A 3I9GL 3R06B 5F7HA 5E03A 4ZPTA 4HAFA 4HIEB 4XMPL 1KPRA 1RUMH 4QTIL 3B3IB 4RFOH 1NC4B 3HRPA 4JQVA 2XQBH 4X4YB 1IQDB 5C2BH 4AJ0A 3EJJX 1KPVB 5DD3L 4ZQKA 1XCQB 1R5VB 3UAJC 1F6LL 4JVPA 5BS0D 4P3CL 3WN5A 1OTSC 4WO4D 2XZAH 2ZSVA 5JPMA 2V5MA 4UUJB 3K4DA 1YEFL 5DZLA 5E8NA 1KTDB 2CRYA 3NAAL 1CGSH 4N8CL 4KV5F 1HINH 3THML 1TJIH 3FCTB 1WVZA 3TIEA 4PLNC 2Q8AH 2PO6A 2ZOKA 3F6IA 4WIQA 3HE7C 3CSBA 3JVGC 3V8CA 2R9HC 1F42A 1YMHA 5DD1H 3WNKA 2OTPA 2ICWB 3DGCR 5ERWA 4NM4H 4P2OC 1EHLH 4P0DA 3BO8B 2MMXA 5IK3B 3ZYJA 4CMMB 1NQBA 1ED3A 3JTTA 5JDSA 3V7AG 4HMCA 3QT2A 5DUMH 4UDUB 3BZFA 5F7DB 4JO2L 2LV4A 3NZ8A 3PHQA 3PGCA 1FLRL 1F6AB 1U3HA 1N6UA 1RUAH 4OI8A 1OTTC 5EZIL 1WITA 3UYOD 2IH3B 2EDBA 5HBBA 4L4TA 4FQ1H 32C2B 4POZC 5E2VH 5I19L 1NC2B 3QDGB 5HVHC 5GPRA 1BZ9B 4PG2C 2C3VB 1NMAH 3O6FB 1IE5A 4HDIA 5F1IA 2ADIB 3RVVD 4N0RA 5KSAC 3QI9A 2ZKHL 5H8DA 3F7VB 1FV1A 5DQDL 5IQ7L 4E0RA 2FH6A 5DD0H 3AFLA 1BLNA 1I7RA 4QRPB 5FUCC 2X70A 2B1AL 1NBZA 1Q1JH 4JFXB 1CK0L 2RGSA 1U8MA 1N5YH 3BGFC 3IYLW 5CBEA 2HAZA 4KJQD 5JHDA 1CD1B 4LSRL 2PYEE 1YQVH 4PREB 3WFEH 4OAWB 1A0QL 4YXKL 4O2FB 3WHXB 3IDNB 1NCCH 1ZTXL 4IBLT 3ZKQD 4GAYB 4RIRB 4U2YA 2FX8H 4KJYB 2IBZX 5FYKU 5I8OL 3MSPA 4J3TA 4JFPA 2YPVL 5JR1L 3EBAA 2QLVB 3MZGB 1TVBA 2XQYK 1DUZB 3ARDD 1Q9KA 4U1KA 2B2XL 2DLFH 1Z5LB 4PG2A 1KXQE 4ZS6C 3QDMB 1MOEA 3HFML 1FL3A 4JO4H 3QEQB 5DSCB 3RWJB 4G8EB 2GJ6D 4Y5VB 5D2NB 4CL7A 2C7UA 2DQHH 3TBTB 3KYMB 3OKEB 5DRZA 5ISZE 2WUBH 5DYOB 4M4RA 5BVJA 1WEJH 1BD2B 4LPUA 4R96B 4NP4L 3THMH 4KK8C 1T0MA 1QVOA 3ARED 1M71A 5HHQA 1N3NB 3A6CL 3PWUA 4IRSA 4F7EB 5JLZB 4KJWC 5MENE 3HKFA 4L8SB 4KKLD 3C6SB 3HI6L 4IHOA 4IDJH 1BQHB 3NPZB 4JFEB 4RMVA 4Y2OA 2D7TL 2FEDD 1A3LH 4NRYB 3SGDH 4FQHA 3QJHA 1UG9A 4EN3A 1JP5A 3QA3A 2AXJA 1FNSL 2IMNA 4L29B 4XP1L 2J8UB 1ZLWK 3NOIA 5JHDD 4FXGB 1IRAY 3LKRB 2YRLA 5EN2B 1I9IL 4WTZA 4X99B 1V3KA 1GRWA 3TVMB 5IMMB 5DO2C 1TZIA 3EDKA 3MROA 5FUZL 4JE4B 4K3JL 1LO5A 3SCMA 5FXCH 1DQTA 1E4WL 4LHUG 4LSSL 5L6YH 4D9LH 1NUNB 5DJ0B 1B6UA 4Q6IB 1UJ3B 5IHZA 4F7CA 4PLJC 3V0VA 4KKAD 4YHKH 3UJJL 3LSOB 2ZG3A 3Q0HA 4L8SC 2AEPH 5J9PB 3CPLB 4MA8H 4U2ZA 5SWSA 3O6LH 3KAAA 2A1WL 2Z31B 3G5XB 4ZDHB 3NGBC 4U1MA 4Y8DC 3TIDB 2XN9E 3DVNA 5DD0L 5I0ZA 3K3QA 3QEUA 2VAAB 3H9HA 4NT6B 4WU5A 3SDCB 2DBLL 1LO3H 4YZFE 4L3EE 2D9QB 3D25A 5DZNA 3JWDC 4HX1A 3P4NB 5J89A 1AI1H 4KROB 3ZHLA 2NY4C 4OF0A 3UBXA 1CICC 5T5NG 4JANB 4J3WA 5D1ZA 3VXNA 1ACYL 4EUPG 4Z7QF 5FGBC 3HNSL 1QQDA 3WE6B 4UMGA 3DETD 3H9ZA 1C7TA 3T0DA 5ISZD 4X8JA 5IEHA 4CU7A 4PRIE 2Z9TA 5FUOH 1OM3L 4HD9A 3VXTB 1XF4A 4P5MB 2W60A 2ZUQB 3VWKD 3NFSL 2NY6B 1TTUA 1KCSL 1MQKH 5JXAL 2VMFA 5HXMA 4UTBH 1MRCL 4QRPD 3LPGA 5FKAA 5EU5A 1BOGA 4AG4H 2H26A 2FGZA 2UZYB 4JRWA 2OZ4L 5C0EB 2VLJA 2HFTA 1OL0A 3NCCB 3PL6A 4TSCH 4Z78A 5FO9B 3VCLB 5A2FA 4XT1C 1A7PH 2Q8AL 1JGLL 3OXSB 4Y19A 2YN5A 1HKFA 3HZVB 2PR4H 3BZFB 5I8OH 3CDGA 3A6CH 3WS3B 4NKIL 4KRPB 2H6PA 4X6DF 5E1AA 2C4FU 2NTFB 1FSKC 3DECA 1P9MA 2F5BL 4QT5A 3MACH 4CMHB 1YQVL 2ITDA 5KN5B 3V6FB 5HI4C 5EBGA 2BY1A 3MV9A 1UCBL 3L5WB 3S37H 5I1KH 3QAZC 1IAIH 3HA0A 4BFIA 5IVZA 4QRSB 5CD5C 5LWYL 4TNVK 5EPMB 4HC1A 5D93B 3C5JA 1Q94B 5B38B 4YX2H 5I1AA 2JB5H 4R4FH 4HCRA 5GGSY 5FHBH 4TULH 1FORH 3SJVB 4KAQL 1FDLH 5E8NB 5I30H 2NZIA 4OZHE 4DVRL 1KYOJ 3G04B 1KIPA 1HE7A 2CDGA 2DM7A 3ULSB 3A6BH 3UBXG 3BW9B 1DBKL 5DMKB 5SWZD 3VFGH 4QNPE 5J1SC 3KWWA 5FM5M 4X4ZA 5HGBB 1RZIA 3FT4A 4FMFA 3FQNA 2HKHL 3U9PH 3QCUL 1WK0A 3WLBA 5BMFL 1NL0H 1LNUB 3F7PC 2BRQA 1CTOA 1MI5A 5CEZL 4L8DA 4MXQC 3R0MA 5DVLA 5SX4H 3T0VA 5SWQB 3LIZH 4HBQA 4M7KL 1R3IL 2F58L 4RNRB 3GMNB 4QKXB 3QHFL 4JY6B 1T1XA 4M1CC 1UM5L 5IG7A 4Q7DA 1MY5A 3CFJB 1CT8B 3L3OB 3KLDA 5FECA 1VSCA 3PWPE 3WO4B 4KKAC 2X89A 7FABL 2BNRD 3LEVH 5D71H 4JFYB 2ZOLB 3OAYH 4P2RA 4LAQH 5E2UL 3LHPL 1BZ7B 4PFEA 1X4ZA 1OGAB 1WZLA 3TN0D 3FO1A 4HIIA 2CKBB 5FOBB 3FT2A 1G9EA 3T0EB 3BZ4B 3QJFA 3LEVL 1HI6B 2O26U 2Q20A 3AU1A 1TNNA 4MCYA 4PLKC 5CAYB 1NDGB 3V95A 1HSBA 3QFJB 4NQDD 4AQOA 5ENWA 3BN9C 3RWEA 3OG4B 4HUXA 4RRPG 5HY9B 1IGFH 3BE1H 4P23D 1EHLL 2VXVH 5HHPA 3F58L 1J1XL 1XGUB 3LS5H 4U1SB 2AVGA 2V5TA 2CLRA 2NY2B 1S7VB 3UTPE 3MCLH 1EFQA 2BDNH 5F9JA 4F7PA 1RUML 3X14A 1BFOA 4JY5H 2AERT 4XNYL 3MV7A 1A47A 1B0GB 1FNEA 1BFTA 3DXAA 3L1OL 2X4UB 2YOCA 3V52H 3HE6B 4PGJA 1BVLB 3VXUA 4GG6B 1KB5A 3MNVB 1MQ8A 4U33A 4XZUB 4UU9A 3S36H 5MEOA 4TSAL 4EBQL 5INCB 1RFDH 1RUKL 3L3IB 1CU4H 2OZ4A 4TUOA 1CDHA 1SJEB 4RMQA 1ZLWH 5IB2A 1ZT1A 3FRUA 2DJ4A 1JGUH 1DDHA 2A6IB 2X4SA 2OXGA 3SDAB 3ET9F 3E8UH 3GSQB 1SBSL 1ZHBA 4Y4HB 1YEKL 3DMMA 1CBVH 5IB1A 4P23C 4QHNB 4U1LA 5DHVA 1E4KA 1S9KC 5KTEL 3TGXA 4N0UE 1G7QA 2AJ3A 4DGYH 1B4JH 5T5FL 3P11L 3TH3T 4JDTH 2WWMC 4Z0XB 1VERA 5AYUL 3BPOB 1X5FA 3IDXL 3HNVH 1U3JA 2HKHH 1SHMA 4MQ7A 3T4AB 1D5BA 4OSUL 5GIRA 3CLEH 1U8JB 2RCSH 1W0WB 2DQHL 3MV8D 3DNKA 4YC2C 3HAEH 3W0WE 2OTWB 2EC9U 3F7YA 4NKMB 5IOPA 5JOFA 1YJDC 5HHOA 4G3YH 2Q7NA 4CBPA 1T89C 1I7UA 1MRCH 4XPGL 1H15B 4RAHA 3BD4A 3FCTA 2NY1D 1D6EA 4UNTA 4NO3B 4LVOC 4Q58C 1TJHH 5DWUH 4PJHF 5TPWH 5CGTA 4Z0BH 3V5DA 3RNKA 4J4PD 1ZHKA 3ILPB 5CJQL 5DFVC 1AKJA 3WFEL 4PY8I 5SWSE 3R1GH 3OAUH 3VFRB 4GMTL 3L7FB 1E4XL 5I9QC 1FAIH 4JG1L 3GSNL 3IFPA 1T03L 4AY0A 4M5ZL 3RUGB 3ARBA 1NKOA 3J7HA 5HVGB 2JCCE 3EUUA 1E4KC 4N8VG 4XP5L 4I48B 3W39B 1PSKL 3CSYB 3QCVL 3PDGA 4DKAA 1HOCB 4XH2B 4PTUA 2QHRH 1F00I 5IQ7H 3MLTA 4JM2D 1RZGA 3JWDH 1UM4L 5C0RH 4YEFA 4X7TA 4L8BA 3DV4A 4PJFE 4KDVA 5I1IL 1NAMA 5DT1L 3WNMA 3DIFB 2DLTA 4OSUH 4WY7H 3MRBB 3ARPA 1ZANH 3OBAA 2DI9A 2YPVH 4R7NB 2MWCA 5JR1H 4LFHD 2OK0L 2ZUVA 2MNUA 4JQXA 3QEHB 3I9GH 1J0IA 3X17A 5KSVA 3MV9D 1INDL 2PUQT 4EI6A 3LZFL 1JGVL 3C87A 2NY3B 2KZWA 4XP4H 1RJLB 1AR2A 2EYRA 5LAXB 3ZE1F 4NKDA 1EHAA 3HR5B 1MI5D 2X44D 4LQFH 4C4KO 5I75B 4BKLA 1JCKA 5HVWA 4AM0B 4I18A 5DJ8A 3R8BB 4KTDL 4QHUA 4WV1A 5F7NC 2I9LB 2QR0B 1MIEH 4NGHH 3SJVE 5E2TL 5JW5A 1QG3A 4TRPH 4OJFH 2VDNL 2K3TA 2NY2D 3U79A 5I73C 3N85L 4KKCD 1ONQB 4MXWH 3JZ7A 1OPGH 1TFHA 2ARJQ 4M93C 3N9GH 2IQ9H 3JTSA 3QUKB 1MFDH 3RGHA 4OT1L 2Y23A 2FO4A 1ZT4B 5C07E 4DZ8A 1K9TA 3MNWB 3IAPA 3PHSA 4Z7UB 2WSKA 1Z3GH 3HE6D 4YAQB 4IIQC 4OV6F 3X3FH 1JF1A 3DV6B 1X5ZA 5HPMB 3MBEA 3KPNB 4XAKE 3ZKSD 4KK6C 1IGIH 2XZAL 4WO4C 2CR6A 1NAKH 3GGWB 5FM8A 5KSUB 4MWFA 4RQQB 2ITDB 2A9NH 5ID0A 4G6KL 3IJYB 4NGHL 1P4LA 1WQVT 4PJIB 1A64A 1JNJA 4FXKB 3WSQL 1RUQH 5I8EA 5I16B 5IR1B 3WUWB 3SPVA 4OZHF 4HH9B 3OAZK 2CRZA 2FZ3A 5KZCD 2P5EE 5BJTA 2D4FA 4PGBB 4U6VL 3P4OB 1BWMA 3ARGB 3EYOB 2IPUK 4NKQB 3L3HB 1GGCL 4X6EA 3G5YB 1KT2B 3B2VL 4IDJL 2Y7QA 3V8OA 1PDKA 1JZ4A 4YK4C 1ZANL 2I07B 1ZEAH 4GAJL 4PRHA 2H1PH 2CRMA 5E2WL 2GITB 5KSBA 4PY7A 1I3RA 3B6SB 3IF1A 3RBGA 3T1WA 4OM0L 5B4MC 1BQLH 2E6JA 3QIBD 4M8QB 1C5BH 4BSVB 5MEOB 2AQ3A 3B9KB 4K7FB 4MDJB 4NQSB 3INUH 4OTXH 1NDMB 4K94C 3HZKB 2DQTH 4UT6H 3MFGB 3DURB 4P3CH 2JB6B 3LQMA 5ESAA 2V17H 3QULB 1SVCP 2YXMA 1NEZA 3ZMRA 2OL3H 3MBED 1JMZA 1OSPL 3IXTB 3VG0H 5DVKA 1K2DB 1R5WA 5BZWA 1U91B 2B4CC 1NUGA 3ZKMD 4J2XA 1HH9A 1JV5B 5GGRB 4EJ1C 4PTTA 1RQ5A 2HT4D 2JIXB 3ARFC 5T1LD 3GIVB 1AD0B 5BVPL 4YFLI 1JWUB 2XT1B 4Y5YA 3Q48A 2QQLH 3ULVF 5IW6B 4WFGE 1SYVA 2X4PB 2MSPA 1LDSA 5HDBF 4YX2L 5HHVL 5E95B 3TM6A 1IAMA 2FHBA 2NY5C 1QSFA 2VXVL 1OGAA 3DYOA 1FYTA 3CFDB 1KACB 1H5BB 3Q6FA 2H2SD 1HSAA 2X4OA 5D1QA 3CC5A 4MNHB 2ZCLL 1TDQA 2NYYD 3VG9B 3MC0A 1IM9D 3ECBB 4N5ED 1EFXB 1U8NA 2YPKA 1BQLL 4MJIB 1D5MA 4UAOC 2X9YA 3SY0B 4F37K 4DGYL 1FVDA 3IFOA 5DK0A 5DD5L 2D0FA 3MODL 4F3FA 4F7MB 5I8CB 1MI5B 2ZG2A 3TBVB 2VZSA 5JIKA 2VQ1B 3BYYA 2F53B 3ULVH 1VB9A 3DVIA 3QP3A 3MLWL 1TJHL 5DWUL 2CD0A 4XNQA 4XBGA 1EVTC 2BRRL 1J88A 4KTEL 4X80L 4LKCB 4FN0A 4WJ5A 1CFBA 2K9UA 4AEFA 4TNWK 5TF1H 3BDBA 4N1HB 4G9FA 1MCPL 1WT5C 4M00A 3S36L 2BOBA 2BSED 3K81A 2V5RA 5I1JL 1RZKC 2C7UB 4YGVB 1TZHB 4Z95H 1V3MA 5HGAA 4EUPA 4OIBA 5CLTA 4PGCB 2P1YA 3O9WD 3CAFA 4F9PC 4GRLC 4HT1L 1Q94A 2Q7YA 5B38A 2FO1A 1OVZA 5C0IB 5F88B 3PV6B 4DGVH 1C5DA 3K4ZA 1U8HB 5IVZB 1UZ6E 2OI9B 5ESAB 5F1SA 3LS4H 1N8ZA 4LP4A 5DFVD 2MCPL 3T8XB 1RJYA 1KULA 3ULUD 1JWMB 4JKLA 3VWKA 1LO2L 1G9NC 4PJAA 3QO0B 3RAJL 1M7XA 4KTEH 4R4BB 4X80H 5C92A 5KZCB 4KKBC 4OQTH 4Z9KB 3AM8C 5EOTB 1IKNC 4ODVH 3BVNA 4M03A 5BZDB 3H42H 4K7PX 2H26B 4HWZA 1MRFL 4WV1C 1S7QA 2DAVA 2YR3A 3GSXB 4PGDA 1VGEL 4OBSA 1CXKA 3OJDA 4LNRA 2IAMA 4HPYH 1A6WH 2PTTB 2O5ZH 3GKZA 1IKFL 2K7QA 2HFEB 1Y0LB 4P2RE 1MFEL 2EIZA 5ICZA 2ZPKL 3ZE0E 3HR5A 3B9KD 1AO7D 1B90A 4RWHA 2AEQH 4KHXL 5E70A 2Z0BA 5CEYB 4FNLH 4YQXL 3KPSB 2MPAL 3JWDL 5C0AD 1A1NB 2D7TH 4S1RH 3U6RA 1MI5E 4KK5D 5IFAH 1OD7A 1XGPB 2XY2A 4GW4B 4LSTH 1KCRH 3CLEL 3O9WA 5F7UA 5DA4A 4S1QH 3QEGL 4KZDH 3VA2C 4Q9CA 4XPTH 3V4PH 1YECL 1ADQL 5T1LB 4TN9A 1DE4A 3OGCA 4LKXB 4ZXBA 2DQIH 4XCEB 4LOUC 5JOEA 1IQWL 5DJAA 2DKSA 2ERJB 4XMKH 3OR6A 1UZ8A 5FKPA 1KTLA 3I2CL 1U8PA 4IRZH 4YPGA 4WCYL 2VISB 2ZOKB 5ETUA 2LVEA 4JREC 2BNUA 3TV3H 3WFHB 1ODAA 3BHBA 4HAGA 2E7BA 3RJQB 1AJ7H 2Y06L 2E7CA 5CILL 2HG5A 2HT3C 3JUZA 4KVCL 3UC0L 5HDOA 3IRZA 3SCMD 5FO8A 4IRZL 4R90L 3U30B 1CS6A 4K55A 3HS0A 5FYKL 3RTQB 3WDIA 5E7BA 2DLHA 3V5DB 1DJSA 3TN0C 1IM9B 3EOAB 5TFSH 2J6EH 4OGAC 5EC1A 1K6QL 4QRQA 3U46B 3QEGH 4ZAKA 1HN1A 3MFFA 4KZDL 3GSUA 2GK0A 2XWBB 1HEZB 4Q97A 5C0DB 2DQDH 4CADB 2Z92B 1G6VK 5I71B 5J6HA 1I3UA 4OF5A 2MQCA 1DBKH 1TVHA 4JZNB 4ERSH 4ZPTB 2MPAH 2ZSWB 3BXNB 4HUUB 5I17A 1BQHA 1MFBH 2ZWLT 2J6EA 1KIQA 4MXQD 3T77B 3H3KA 2GJ6E 4U3CA 1KCUH 2BVOA 2PW2A 2VXQL 4YHPA 3DTXB 4M93B 4QOKE 4JFFA 1NFIA 3ESVF 3NFSH 4LRIC 2AJ3B 2KQNA 5F97E 1CL7I 1U8LB 3IFPB 2Y6SC 1QEWA 3X11B 4S0TD 3GBNH 3RIAF 5E6IA 4P3DA 3VFPB 1JMXA 3HMWH 2ZZUT 2UWEE 5FYJL 2YMXL 1FVCB 3BWUC 2BVPA 2NY3C 1TJIL 1Q9KB 5GGTA 3BP7B 1FE8H 1JPFA 4GBXB 1CFSA 3C09C 3MOQA 4HKJB 5DJZA 4OF7A 2BNQB 1MHEA 2GQHA 3QI9D 3QUMB 2VC2L 4JB9H 3ZE2E 3KPMB 4RBPK 4YXLH 1SQ2N 2IQAB 3MV7B 4RA3A 3VW3H 3TCLB 4I4WB 4K23L 4NCDA 2BC4A 2P5EA 4KKBD 5MENB 1U8MB 1ND0B 1T1ZB 4LCWE 2DQDL 3MA9H 4HSQA 4JGMA 5I71C 5JXEC 1TQBB 4W6YB 1U8IB 3ZDXF 5L6YL 4LHJB 1RU9L 4RDQF 3FRPG 5FYKE 1VADB 1WSST 1GOGA 3C2AH 4BSWB 1J1OH 3FB8A 3ROLA 1ZHBB 5D7SL 3FTGB 2F53E 1YY8B 3UTSD 3GSQA 2IFGA 1ZWIA 1T83C 3QDME 3CDYA 3AU1B 1Q1JL 2BSSB 3VXQB 4WHDA 3QDJE 3FHQA 2XTLA 5LWYH 5D1QC 1DBML 1G7MA 1CLOL 4OLZH 2X7LA 3FQWA 5EUKB 4QXTA 1ZWIB 2VLRD 3MA7A 1CU4L 4AT6A 1FO0H 5DUPL 3L3DA 3VRIA 4V2CB 1KJ2B 1XT5A 5AD0B 2HT4C 4M5YH 2NXYB 4XP5H 3SOBL 1IAIM 2A1WH 1CF8H 2AJVL 2EEBA 1EJOH 2YD3A 2VL5B 1S9YA 2B5IB 1JYXA 4OZGE 4IOFD 3W11D 2DYPB 3C8KA 4ETYA 4M7ZC 2JELH 3IXAB 3EO1B 1OGTA 3DETC 3CXDL 2A6KB 5J6HB 2P48B 3BE1L 3EJYD 1FP5A 1JHLL 2APFA 4ONHB 3FQNB 1B0WA 4I3RH 1HSBB 2ARJA 5D96C 5DMJB 4XXCC 1KCSH 4YDKL 4BM7A 4M61A 5HGDA 5L8JB 5DK2B 4ZUVB 4OD1H 1I9EA 1T5WB 1DZBA 1T3FB 1MVFA 1MFEH 4F58L 1X5XA 3U30C 3I3DA 2BNQA 1KEML 4YDIL 3ULVL 5HPOA 2IPUG 3ZKNC 1A0QH 4ZPVA 1EEZA 2YMXH 2NXZB 3TZVB 1IGIL 3VFOA 2FH8A 2YPLD 1FL5B 1M4KA 2M1KA 1UXSB 2ZOLA 4POUB 1ORSB 5FB8B 3FOMB 2RFXA 1X7QA 4DN4H 4CNIB 1FC2D 2Q87A 4MQTB 1JTTA 5MI0C 1KTLB 4HJJL 1T1XB 4PD4K 5F89B 5E6IB 2DBLH 1A7PL 4MX7B 5CSZB 1CFTA 4EDWH 2ZCHH 4LCUA 1IC4H 25C8H 1N64L 3I6LE 1I7TA 5E8DH 5KVFH 4Y89A 4TPRH 1X6NA 1AXIB 5C71A 1MWAH 1DSFL 4OCRH 4Y19B 3ARSA 5JXAH 3WIHH 4JG0H 4KJQC 1A6TB 1Z2KA 2H1PL 3BEVA 3O45A 4IOIB 1FHGA 1IFHH 3TNMB 2YWYA 3HNVL 3HRZB 2AV1B 3TN0A 1P53A 4X6DA 3NA4A 2ITCB 2F54D 2BFVL 1A7QL 3BKJH 1U92A 4K3JH 5ESVB 1WISA 4TOYL 3MRGA 3MRRB 4NM8H 4X6FB 1FDLL 4N68A 4PG9B 4GBXD 2R4SL 2XG5A 4EKXA 4HLJA 1UCTA 2VSDA 2MQ3A 4YHOH 2BNQD 3SDXF 5E5MA 4L9DA 2B1AH 4UIMA 1ULVA 1UM4H 4AEIH 5C0RL 2AGJL 3GO1L 3GJEA 3O2WH 2CIIA 4UIKH 5DQDH 4NO5B 3V6OE 3T09A 1DE4B 2DLEA 1LEGA 4IOFC 3G6DL 2CDFA 2R8SH 1EHNA 4P5TB 4R3SB 1P7KB 3LRHA 3Q5OA 3TWCL 3PL6D 4XWGL 4XPTL 3QWOB 1OWWA 2VZUA 1CCZA 2GJZB 4ZO7A 5KS9E 2P5WE 5D9SB 4D2NA 1MAKA 1DQML 4FQIL 3VCLA 5HYEA 2XZQH 2FEDC 3JV4A 1WUNT 4QWWC 2CO7B 3VG9C 4KKCC 4KK6D 4M62H 3HB3C 1K5NB 1FL6A 4KMTL 5CBAA 1DFBH 2V5SA 5D71L 3VXUE 1F2XK 4JPVL 1DCLA 5F7EH 1SJVA 3T0AA 3FOLB 3PE9A 1FNFA 3WFZA 5L0QB 1T89A 4YHOL 3IDYC 3L7EB 3N0PB 3HPLA 3L95B 2XQBL 1UJ3A 4OCNC 4X6CB 3WIHA 3CVHL 4XI5C 3MRGB 3MRRA 4XPBL 3DVFA 5GHWH 3T4YA 1XCTA 3B8YA 2VDOL 1IGTB 4ZFFA 3QDAA 3VI3E 2VDLL 4X8JB 3QXTA 5IEHB 5DK3A 1IZKA 1J8HB 1HWHB 3MJ7B 4XWOC 4KWUA 3U0WL 3GMPA 4JRYE 2GT9B 4CVXA 4U6YA 1NGZA 1QBBA 2A9NL 3RPIB 3IDIB 1ZVSA 2F74A 4NOBA 3B43A 3RWFB 4C59B 1A6TA 2FEEI 2HFEA 1T83A 2XPGA 3LB6C 4FXGA 1BGXH 4LRNH 4HUMB 1NFDF 1HINL 3O6ML 3BJ91 1H3GA 3K2MC 4PJAB 4WHYH 2ZNWA 4MB5A 4NP4H 5AWNL 1BVZA 3STLB 4NT6A 5TFSL 4G6JL 1SM3H 4IHOB 1HHIA 4POZD 4PJIF 3RWHA 5J1AB 1CI5A 2AAVA 4JFDE 1EGJL 2DWEB 1PZ5A 1PG7H 4LDLB 4WFFD 3BPLC 3HCVB 5SWSB 3OXRB 4XGZB 4D8PA 3B9KC 5DRXB 5AWNH 1JGUL 1C5DB 3BIKB 1O7VA 2ESVE 2G5BA 3NIDE 1DTUA 5CD3B 1HNGA 5C86A 3U2SA 4ENED 1QO3A 4JGJA 3UEZA 4KK9C 1T03H 4M6NH 2XTJC 1NCBH 2NX5D 3FT3B 4B53A 3X3GL 2NY5H 2F54A 3I2CH 3PWNA 1F90H 1FZKB 1O5DT 4UOW0 3KNBA 3BKJL 3RVXC 4XVSL 1NCUA 1IT9H 2BOBB 4PRDB 1KNOB 1N7ML 4NPYA 1VACA 3PDOB 5E24E 4JY5L 2R1XA 2EE6A 4LKCA 4WJ5B 1UB5A 1WC7A 3LB6D 5HGAB 4WY7L 5EBWA 5SX5H 2CK2A 3WFDL 4I3SH 2L0DA 5BV7L 3GIVA 2VZTA 4GUPB 4KUCD 1JFQH 5ILTH 1F11A 5LKNA 2W0FB 1B6DA 3F12A 4XP9L 3MLUH 1M6OA 1NBYA 4KMLB 1U91A 1C1EH 5SV3A 1BBJA 3SE8L 4OZHA 5C0NC 5IFJA 3LDBB 3WNNA 2PXYB 1MFAL 2ICEA 2HH0H 4LLUB 1RSFA 4NCC1 2ORBL 5A43C 4JN1H 3PWLA 2OBGA 5F9AC 1ORQB 5J11C 4X8XA 3DRQA 4RSVA 4P4KA 4R7DB 5CJOL 1HXYB 3ZL4H 3QUYC 4WW2C 1JRHH 4NZTL 1DVFB 4O2CB 4WHCA 5FCUH 2IPTL 1RZFH 3PWVA 1RVFH 4MJIA 1QSFB 1FZOB 3TPUA 1DBJH 4NCC2 3IDGA 2EYSB 1QLRB 3FFCE 5DJCB 2WINB 5E94A 4F8TA 1KEMH 5FA3A 4LP5A 3RA7H 4LHUD 4MD0A 4JN2A 3HZYA 4XPBH 2DM3A 1SJXA 3MRFA 2DMBA 1G0XA 1HZHH 3OKDA 4N9GB 5D6DA 5K9KB 2Y5TA 4G8GD 4LDOB 5BJTB 3PGCB 1I7ZB 1UWEH 5D1XB 1RUPH 2HJKA 4HBCH 3QHZH 4P5TD 2GFBA 2XA3A 3SPVB 3O3AB 1K2DA 1SYSA 4PJBA 3KPPB 4PRIB 1HHKB 3A6OA 4PRDA 3KVQA 1NEZB 3SDDC 2Y07L 4MJ5B 5FYLD 4OCWL 1ETZA 1CL7L 3MLSH 4ZTPH 4QF1A 2P44B 4MAUL 4DZBA 3ULUE 1G7LA 3QUYB 4WW2B 3PWNB 1E4WH 4U31A 5DJZB 3UTPD 1RK0B 2PO6B 4V2BA 5C09E 4HLZG 4IIQA 4P2QB 2FEEL 2ADGA 3OXRA 4XGZA 4ELMF 4JHAL 1MIEL 3FN3A 4GKZB 3SHSA 3JTSB 2EYTB 2BXYA 2P8MA 1NANH 5EO0A 2DQGL 2VXSH 3V6OC 3G6JA 1RZFL 3UXFA 1J0ZA 5I75C 1DLHB 2DWDB 1IGCL 4D9QD 4YEEA 2R1YB 3D0LA 1J1OL 5IMOB 4BZYA 4L1DA 4Y4KD 4P59H 1NFDA 2V7NB 1S78D 1KC5L 4JFFB 3S4SA 5I16A 3IGAB 4JFZL 1RZKL 4QXWA 2R1WA 1FRGH 4TUJB 3F7RA 3P4OA 3MPCA 4H88H 5HI4D 3MUJA 4PGZA 1NCNA 4WNQB 3T4YB 4YHLH 5L2JA 1UA6L 3OF6A 1D9KA 2ESVA 3BQUB 5BMFH 1GHFL 5CHNB 3O2VL 4UT9H 3L7EA 2IBGA 1FFOA 4FFYH 2KKQA 5AZEL 4ODUA 2XWBA 2NX5B 1NSNH 1IL1B 4G9DB 3MRQA 1W72L 3QDHA 3B5HA 1KTDA 4ORGA 3HUJF 3QUKA 3DUHA 1NGWA 1RZJL 5IMKB 1WZKA 4PJEA 2WIMA 3EOTL 3V7MA 4G6FB 4MVBC 4YAQA 5ESQA 5FM4A 5HDQH 1F58L 3QPQD 4UNUA 1T6VN 1GGIH 1AGBA 1DQDL 3KYOA 2BNUB 2HLFC 1I1AC 5HD8D 5JXED 2YC1B 1L0YA 5GSRB 4TSBH 3O4LE 3VWJC 3EW3B 2N7BA 1J5OL 3VFRA 1EMTH 5HDQL 4FQJL 1FSKB 3OSKA 4UIMB 3DARA 5JOPD 4TNVF 4XMKL 2E9BA 1A6ZA 3OGCB 15C8H 3MXVH 1P6AB 4NWTH 4HIXH 3HE6C 2UZIH 4RMUA 3LH2H 2X05A 1GZPA 3IS1X 4FQPA 4JO3L 2AK4B 3AS2A 2Y07H 2HA1A 3QNZA 4KQ3L 4ENEC 4XRCB 4EDXB 3MRCA 1ZS8A 3BQUA 1D9KB 2ESVB 5AYUH 1WBZA 4P9MH 2W65A 1DLFH 4H1LA 4NWTL 3CFCH 3VGAB 2FNBA 3V5KA 3KJ4C 2P4AB 3O4OB 1ZE3C 2FR4B 2V2XB 3FHAA 3L5IA 2AXHA 4APQB 2GI7A 1FCGA 1D5BB 5GIRB 3PG2A 3C08H 1A6UL 1FRGL 2ZKHH 3ARBC 5C0BE 1PAMA 4LK4A 4N0CD 4CVZA 3FN9A 3WXVL 1BX2B 5D1XD 1L9MA 4KVNL 5ADPH 5GS0D 1KJ3L