5DRNB

Context-independent anti-hypusine antibody fabhpu24 in complex with hypusine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
b'AAVLTQTPSPVSAAVGGTVTISCQSSETVYRGDWLSWFQKKPGQPPKLLIYDASYLASGVSSRFSGSGSGTHFTLTISGVQCDDAATYYCLGGYYDDADDTFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Hpu24 Heavy chain
molecule tags Immune system
source organism Oryctolagus cuniculus
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
total genus 51
structure length 215
sequence length 215
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5drnB01
1MFDL 1A7BA 4O51B 3LN5B 1V3MA 4X5XA 1AO7B 3OKNA 4YFLF 1RHFA 3OKKB 2DI8A 2Z31D 4S1QL 4G8FA 4HKXB 4EIZC 3WE6B 3IDJA 4DEPB 2K7QA 5E6IB 3U2SB 4TVPE 1J5OH 4TNVK 3HA0A 1CLOL 1DQDH 5C7XL 1VGKA 5EZJA 3QUXD 1S7UA 5T1MB 2MNUA 1YEFL 5C3TA 4JB9L 5D7SH 3KHOA 4DN4H 5E99H 3RIAK 2CKBL 4K55A 1VERA 3PWPA 4Z7NF 4N0YL 1HNFA 1UB5B 3WLBA 5KS9F 3QO0B 1H8OA 5CKGA 3VE0B 1OW0A 3GKWH 3UZVB 3H7BB 5D96B 5TH2B 5BXFA 5F7DB 3RL2B 4W4OC 1QA9B 2ITCB 3FAWA 5CZVH 1BGXL 2ERJC 5JW4Q 1AQKH 3PABB 1XGTB 5FYLE 4ALAL 1NGWA 1QR1B 5AAWA 5C0IB 1R6VA 2V9QA 1K8DB 1QRNA 2VTFA 1QPXA 3P11H 1CGYA 4GKSB 4ZUSB 4DGYH 4HGMA 3U36A 3V4UH 4WCYL 1CI5A 1VGEL 1YJDL 4DFHA 3SDCC 1IEAB 3LKOA 5FF6B 4WW2F 4JFHD 3HI1B 5EU5B 5JO5B 4JKPL 1AQDB 3L9RA 3JTTA 5CHNA 1OD7A 4QOKD 3DOSA 3QWRA 5IQ9A 4HV8A 1GVIA 1KCKA 1ZHBA 3VGBA 2CO7B 4BZ1H 2E7LA 1NPUA 5EO9B 1KN4H 4Y4FA 1FL6B 4OF7A 3BPNB 5BJTA 4NZTL 4MMXC 2OTPA 3T2QA 4PJXA 4KQ4H 3V4PH 1LDSA 2I9LB 3DSNA 2QQKL 4HC1A 3BW9B 4JGUA 4NQSB 3G08A 3OG4B 2FRGP 2ILLA 3PWNA 5SV3A 3IDXL 4C56B 4S1RH 4YHZL 2MSPA 4LHJB 4POZD 2QADC 3B5GA 1CFTB 1FZOB 1KTDB 2DN7A 2X6MA 2EKSB 5DO2C 1A6UH 2BSED 5HDLA 1A2YB 4KRPD 4Y5YC 3OXRB 1AKJA 5C0EB 5B21A 1IILE 2ZOLB 3ALWA 2HJLB 3FTGA 3RVTC 5F7NC 2XIDA 1GRWA 3U0PA 2F5AH 4LF3B 1J0ZA 4JO1L 3RWGB 3MJ9H 4NQEB 5K9KA 4K9EC 4BZ2L 3BH9B 5D72L 1YNLH 3WJJA 4G7YL 5TDOB 2ZCKH 3SDDB 1CN4A 3I6GB 1IGCH 3U7AA 1TQCB 3FO9B 5C0AE 4HMCA 3QUMA 4QHLB 3RUGB 1G9NH 4GKNA 2KKQA 3GI9H 4KZEL 4RNRA 4K3DL 3LB6C 2F74A 2BCKB 4WDIB 4P23C 1KEMH 4GG6B 3S96B 4U1MB 1MFBL 4NQSA 5D6DA 3RVVD 2PTVA 3GMRA 1BJ1J 3GJEA 3AS0A 1L6XA 1YEHH 5GS1C 5KVEL 1BOYA 1JP5A 1YNKL 5E95B 1RK0A 2VXSL 1UA6H 5HD8C 4P3WA 3ZE0F 1RZ7H 3PL6B 1HH9A 4Q0XH 3QEHA 3QO1A 3TWCL 3W9DB 1WFUA 1CQYA 4LLAA 1V5JA 1CQKA 2IAND 4PJEB 4U1GB 2A9ML 5BO1L 4CVUA 2EDNA 5MERB 4B7LA 5B3JE 1GAFH 4OZFH 2NX5B 2R0LL 4YGVB 4QRRB 1I8IB 1BBDH 3JBG7 4KI5F 2IPTH 1JMZA 4YHOL 1NGPH 2O5XL 3PWUB 3ZL4L 3QULA 1X9QA 4RMTA 4BZ2H 1KELH 3VDAA 4YXLL 4HWEL 5BZDB 3BWUC 4XBPB 4L4TB 1CU4L 4XWOC 1ZGLP 1XF1A 2F54D 1HCVA 1NBQA 2VOTA 3CGTA 3KDMB 1OLLA 3VFTA 1DDHB 3AXLB 1F11B 4BH7A 4PJ9D 1WUNT 2HTKC 3DURB 4FQIH 1F00I 5IFJA 3EW3B 3RWIB 4OD3H 5DD0L 5FGRA 4DQOL 4GRMA 3ARUA 4PFEA 1CE6A 4QRTA 4K23L 1RUKL 2F19H 1FCGA 4ZPVB 2J88L 3SO3C 2ZJSH 4YAQA 4IBLT 4WI4A 1S7SB 4F80A 4YXKH 3FQRB 4OZFB 4WUKH 2EDLA 4CJ1A 1J8HE 3IDMA 3IGAA 3I6GA 2FGWL 1KBGL 3B9VA 1KTKE 1JHTB 1WWCA 3UCRA 3DRTB 3WXWH 4I9WD 4PJHE 4JFOA 1A6AA 1NGXB 4U6TA 4PB0H 2V5MA 2XXCB 3TYFB 2ZUYA 3MRPB 1RU9L 5KVFH 1BLNB 5TE7L 3OF6D 2VITB 5E5MA 5GGTA 1U8PA 4FXKB 4XCCL 3KDMA 3VFTB 1OTSD 3KGRA 3BJLA 1KFAL 1Q38A 4LLUA 1NCBL 1LEIA 3FRUA 1IAIL 4UINL 5JHDD 3D85B 1VACB 1T66C 4GSDH 1MF2H 4X98B 4LU5H 1NFDF 1UZ8B 3EYUH 2AABH 3GSVB 4XB8A 3GHBL 4Y88A 1YY9C 1UKTA 1II4E 5EU4B 4NDMA 2QQNH 4NBYB 1B9ZA 3MLSL 4QT5B 1IGCL 1GOFA 1FNFA 3KJ4C 3S98A 2IPUK 3ILPA 3W9EA 4OZFA 2IBZX 4I18C 3VFVA 5BZWB 1B4RA 1EO7A 3BT2L 4XAKD 1A1OA 1HIML 3BD3A 5IEHB 4JGJA 1EEZA 3GI8H 4C56D 5BZDA 4KDWA 3UYRL 2ZSVB 4MA1B 4ODWB 4Q9QH 3QRFM 3BPLC 4JB9H 4M00A 5D7SL 3L5XL 4GXVH 2ICWJ 5D1ZB 5BS0D 3V6OC 12E8L 2QR0A 1EGJA 5L2KE 1NCAH 3DO3A 4UV7H 3MROB 3EYSH 4KHTL 4DGVL 4XP5L 2EC9U 4R90L 2UY7A 3IXTA 2K3TA 1PSKH 4N8VG 1DLFL 4HKZA 5JTWA 2XZAL 1AGDB 2HLAA 1DQLL 4ZUWB 3U0WH 1FVCB 1MELA 3HCVB 3RQ3A 3JVGA 1WJ3A 1IGTB 1T1WB 1JYNA 4TNWK 4HQQH 3IDNA 5C08B 1KCUH 5GRVL 4XP6L 1J10A 3QDMA 5L7XH 5I0ZA 1HWHB 3UAJD 4PS4H 2HKFL 5EPMB 5B38G 4AT6B 5JNYA 2DBLL 5FOBA 4GS7C 3BKYL 3QA3A 5GGTL 2NXYD 3W0WD 1I75A 3EBAA 4DCQA 3ZT5A 1I8KB 5DHYA 3FO2B 4HC1L 1RJLA 2CJUL 4G9FE 2LV4A 3VG0H 3TBWA 3V6OA 2X89A 4X6CA 4ELKB 2DQGH 5CAYB 1LGVA 3FL7A 2FWOA 2MQ3A 1D3CA 3DX9B 3MLVH 5GGTH 3RP1A 3N9GH 1ND0A 3Q5OA 1R5VB 5EU6E 1DEEB 3C2AL 4ZUUB 4MMZC 4X8JA 2FSEB 2I9TA 2R2HB 3GJFK 1J1OH 2A0LD 32C2A 1SYSA 3PWPE 2E27L 3VGAB 4XAKE 5BCAA 1RVFH 3ZZ1A 5JZ7C 2ARWA 5FIEA 3KLAB 3MLRH 1OT2A 4XVJH 4XMPL 5EU5A 4JFDE 1MCNA 1TFHA 4O2CA 5I8CA 2C9AA 3D69A 4D8PA 2VL4A 3LEXB 4HK0B 4Z78B 3GHBH 3IU3B 2Z8VC 4RQQB 5B38A 4U7SA 2IFGA 4PJ7A 1IKNA 2FHBA 1WT5C 4E41D 1HINL 5DMJB 2XTJC 1I3RB 3NA9L 5EZLB 5HHPB 4BZYA 5FM5M 4IHOB 5C92A 1KFAH 3Q3GB 2Q8BH 4S1QH 1AE6L 2P49B 2AJ3A 3MRJA 5FYLH 1M7IA 1N5AA 5ENWB 3RVXC 4GW1A 3LB6D 4XXDB 3GMOB 2M1KA 4QHMA 3ZHLA 1P2CA 4A6YA 4XNUL 4L8BA 4M1DL 1ZLWH 4PJGA 3U0PB 1KC5L 3IS1X 4S2SA 2FD6H 2XZZA 2D4DA 2X4UB 3MLUL 2YN5A 3MRRB 4G6JL 2CRIA 4NRXA 3T3PE 1MCLA 4X9HA 4ELMA 4O5LH 3OJ2C 4LCIH 4FTVA 3EDEA 5ALCH 5B39B 1OTUC 4YDLC 3WUZA 2H3NB 1YEGH 5HGDA 1NMCB 4HCRA 2EE9A 2EE2A 1A4JA 4PJ9B 1V3JA 3OMZA 4OF5A 4X83A 1F4XH 1JWUB 1P4LB 4NJAL 3V0WH 2D0FA 4JN1H 5BMFL 2RFXA 4JZOB 3L3JA 4L5FH 5L0QC 5BS0A 1R3IL 3MRNA 1ACYH 2R4SH 5IROC 1M4KA 5HHVL 3CFKB 4IMLA 5HHQB 2B4CC 3AM8A 2PYEB 2HRPL 2H2SD 2NNAB 2OZ4H 4KY1L 3VGGA 3MR9A 5J89A 1CZ8L 4HIJB 1F8TH 4U2ZA 5TF1H 2Q8BL 4J4PD 4D8PB 3H9HA 4NUJA 2VYRE 3VXMA 1NAMH 2FH8A 1WC7A 2AK4D 3T1FB 4ZD3H 5IHUL 3MFFA 3T65B 1SVZA 4TPRL 4DGVH 1FZKB 3KPNA 2EDBA 3RWHB 4F57H 3VD5A 1E27B 3ULVC 2VDKL 3WNNA 4G9FB 2W0FA 4NQDA 5SX4H 1YECL 5DVOA 3P2TA 4WW1B 4RAUB 1DBMH 1NFDB 2HWZH 3GSNA 5TE6H 5J1AA 5DMKA 4ZAKC 1I9RL 4OFKA 4M7LT 2ZUXA 3EO0A 5IB5A 1UEYA 1Z5LB 4HFUH 1UH2A 4JZNB 4HK3N 4PJGE 4NPYB 1MNUH 3SCMD 2NXYB 4ODHL 1Z9MA 4YWGL 3C09B 2YWZA 4LLQA 4MJIA 1QO3B 4OZGE 4W6XB 5INDB 1RUML 2NNAA 3MV9D 3NAAL 4GQ9L 5IJVA 2IPKB 2WUBL 3T4YA 4I77H 3LSOA 1QBLH 1KJ3H 3OKYA 3MXWL 2M2DA 4RISH 2Z8SA 4YDKH 4QRSA 2AJZA 1IE5A 3SPVB 1NDGA 4QTHB 4RRPA 5E2JA 4OD3L 3I02B 5DD0H 1JE6A 3L5WB 3BXNB 4XTRC 1YEDA 3QUZC 3W39A 3SCMC 1P4LA 1JPFA 4CVXB 4PRPE 2R9HD 2IH3A 3EYOA 1CXHA 3NH7L 3WKNA 5IJKC 1JK8A 3GMMA 3HMWL 2D03H 3SDAA 4N5UA 3P4MA 5D72H 1A7QL 2YUWA 1EJOL 1YMMB 5DJ2B 1HZHH 3CFKA 4XVSH 1B0GB 3RTQB 1EX0A 1FVEA 4U6YB 4N68A 2V5SA 4UAOC 5C08D 1EIBA 3UJIL 4I4WB 3LIZH 3QCTL 4C4KT 5FM8A 4P9MH 3P3YA 2IANA 4LSTL 1QG3A 1NCCH 3UBXG 2DRUA 3ME0A 3QUKA 5I15L 3WUWA 2P1YA 1KENL 1CICA 4OQTH 3LQAC 2CKBA 1SY6L 4NO2A 3QPXH 5IJVB 3VXTB 4FTVE 1KJ3L 4HWEH 4S1RL 3QUXB 3ZKND 5DD3L 3JWDL 5KSBE 3TBTA 2OYPA 1EFQA 4WCYH 2PO6D 3E3QE 5EULV 4IDJH 5I1GH 2AAVA 2MCPL 4UILH 3GSWB 4NZJA 2UV3A 4P4KD 5D2LF 2GK0B 4RWHA 3I02A 3MCLH 4KZDH 3LQZB 3OZ9L 3QFJA 1C5CL 5FYLD 2E9JA 5LJYH 3TO4A 3JV0A 4LBEB 4C58B 2AABL 3T0XA 2B2XH 1CFVH 5DJDB 4U05A 2LU4A 2LTQC 1OGAD 2F58L 3MRLB 4DZ8A 4NKMB 1UCBL 3BD4A 5IIEB 4MYWB 5T1KA 4HMDA 1ZT4A 4Y8DC 5E2VH 4IOFC 1YNLL 2BNQE 5HHNA 3VFOB 3HE6A 5DRNA 3GSQA 4MZ2A 3WO4B 2JB6B 3G5YA 4RIRB 4X4ZA 1R3LB 3O3EA 1CIUA 4ETQA 1FDLH 3PABA 1JIBA 2W65A 5FHBL 4TPRH 5DEGB 2AKRB 2GSGB 1BP3B 1C7SA 4YC2B 4MXQC 1OTTC 3LDBC 3TM6A 3O0RH 2QSCL 1N59B 2EO1A 1AKJD 1KPVB 1KEML 2FEEL 2H9GA 4IMKC 1W0VB 5E00B 4ZUSA 3GSXA 5IR1A 1XF3B 3DYPA 3NZ8B 1T3FA 4KMQA 1CGXA 4OFVA 5ISZA 4Z5RB 3H9YA 3O2DA 3N1MC 1EK3A 5D2NC 3FT2B 3PWPB 1X4ZA 4MNQE 1OAXH 5C0GB 4RGOH 4P2RB 2XRAH 4GUPB 1S3KL 3C5ZD 3OB0H 1ZTXH 2B1AL 4HEPG 4XH2B 2VLLA 1NGQL 5DD3H 1FVEB 5DJ0A 3D25A 3T4AB 1CG9A 3T3PF 1CFSB 1FFQA 3DROB 3AAZB 5LBSL 3RY6A 5IBLD 4PLJC 5F7YC 2FX7L 2XKNA 3INUL 4HKXA 3K7UA 4QOKA 1N3NA 2ATPA 4KRPB 4QXUH 3WUWB 1IT9L 4KROB 2WP3T 2XG5A 2AXFB 3HG1D 5HYEA 5E2TL 1WTGT 4HT1L 3IDGA 3MXVH 1BZ9B 2X4UA 2WBWB 2D7QA 3AVEA 5CEYB 2DM3A 1HI6B 4G8GE 4KJPC 4FQJL 2GUOB 4IRJB 2G2RA 1IEHA 4KUCF 2OQJB 4MLIA 1SBSH 4Q9RH 2Y06H 4NNYB 1XF4A 1Z0NA 2X2YA 3NN8B 5HI4C 3GSXB 5ACMA 4E41E 5IR1B 3PP4H 4AM0B 1FFPB 3KPLA 5KS9E 1G9NC 5C0CE 1A8JH 3VXSE 3BDYH 2HT2C 4Z18A 4X6FB 3NIGE 4YHLL 1DFBL 2DM7A 1R3KB 5IMKA 3SJVB 3IDIA 3H0TB 4KH2A 1FYTD 3QNZA 2O5YL 5CP3A 3MV9A 4JY4B 3G6JB 5K93A 1YECH 4KI1A 4LLVA 1IFHH 1IAOB 3QQNA 2YZ8A 4Q74A 5LAXB 1Z9OA 1KB5L 2VE6A 5IF0A 4MCYB 4JDZB 2HFTA 4BSJA 2NTFA 3IYLW 1MCWM 5J7CC 1U8QA 3BUYB 3BQUD 4X4YB 4FQPA 5CEYA 3WFCH 3R06B 4JANA 5DA4A 4OCMC 3X14B 3QQ4B 5E8EB 3PG2A 4QCIB 4HBCH 1JN6B 1MHCB 3QXUA 4XCNB 5GQBA 2JCCB 4GT7A 2NX5A 3LMJL 2W0FB 4NQDB 3QI9C 2JJWA 4HIHA 1L0YA 3WIFB 1MIML 4XNXL 4DGIL 3BPNC 1YEGL 3AAZA 1XR8B 2AK4A 4PGEB 1JPTL 3HZVA 3HI6H 5ID1B 2VDML 4R4ND 5K9OB 4OF0A 4JFXB 3P30L 4I2XA 2Y5TB 2WLYA 1T6WA 4PBXA 4HC1H 3CPLA 5EN2A 4UT6H 1JNNL 3EHBC 3JWOC 4LLWB 2A83A 3E6FB 5D7JA 4Y4HC 3RWDB 4NNPL 3ZT6A 4JM4H 4AJ0A 4P2RE 1Y0LB 3BQUB 1CE6B 2X4OB 2EH8L 4TOYH 2Q1EA 4R7NA 3DMMA 4HLJA 1SHMA 1ZLWK 5AEAA 1JNLL 1O5DT 1B4JL 2PETA 3GZKA 4F7MB 3FQRA 1NDGB 4QTHA 3WS3B 4ZYKA 5FCSH 4M9PA 3AM8C 4LSRH 3GMPA 1T89A 2FL5B 1B3JA 1U36A 3GMNA 3HPJB 4QYOA 2YD5A 1AD0A 4WVRA 5KVGH 3B3IB 1R5WB 5D70H 2AJUL 5IFJB 3C8HA 5FV1L 5F1SA 5J12B 5E03A 4H25B 4HCRH 1HWGB 2H6PA 3NIDE 1WBZA 2FJFB 3MOAH 1FC2D 4QWWC 5GRYA 3TGXA 1A9EA 3F58L 3T08A 1NH6A 1QRNE 5D1QB 4H8WC 2EYTA 5L2JB 2GCYB 3K4DA 3V9FA 1G7IB 2WSKA 4IJ3C 4Q9CA 2PYFB 2E27H 4U7MA 3RFZC 4WGWB 3SKOA 4TULL 3GSOA 2ED9A 2XN9B 3OKDB 2JK5B 3BZ4A 3GIVA 3O9WA 1RZJL 3FONB 3C2AH 4MAYC 4MX7A 4E41A 4D0CB 4PG9A 3QUML 1F90L 2IH3B 3EYOB 3NFNA 5C0RH 4OZIA 2O61A 3TNMB 4N9GA 4XPHL 4DJMA 3QXAB 5HYJD 2WZPD 4P4KC 3LQZA 4BH7B 1XGUB 4I5BB 5KSUA 5CBEA 1JWSA 1I85C 3LPFA 4GRLB 2X4PB 1CZ8H 2CGRH 2V7HA 4HFWA 5TF1L 1BLNA 3WCYA 3DHJA 3RTQA 3S35X 3UTTE 1ZLUH 1DL7H 5LXGH 1E4KA 3Q5YA 3UROR 4HHAA 1GHFH 4U3CA 4Y16C 4POUB 2CSPA 5CILL 4D9LH 4MA7L 1EHLL 4JGMA 5IIEA 4PP2B 4RMWA 2VIRB 5EBLB 3P9LA 1B6DA 4F7CB 1INEH 5HVHB 4Q97A 1TVHA 4KJYB 2QKIA 4NJAH 3V8CA 3OB0K 5A2FA 4I3GA 1BBJB 2VR9A 3MRGA 3IKCB 1W72L 1LQSR 2VC2L 4G42B 5EIIB 1MI5B 1WTLA 3OKDA 3W81A 4M1GL 1BAFH 3BISA 4LQ1A 3SGEI 2FATL 3KNBB 5I74B 4KJWC 3B4NA 3VI4E 5KOVC 3LKSA 1W72B 3T2NL 5BW7A 3ARVA 2HG5A 3HZYB 1W0YT 5F8QC 4YDJB 3NIFF 1RJZB 4Z7QF 5LGJB 1V05A 5EO1B 3CUPB 1FSKC 4RFEA 2Z4QA 3VRIA 5HYQA 3SHSA 1NAMB 5AZ2L 3FB8A 3HE6B 5DRNB 3SKNA 5DC9B 1YC8A 3U46B 3VXOB 3ARQA 3RNKA 3U1SL 3GRWH 3RL1B 1MPAL 2R56L 4MNQD 1NBYA 1TTFA 2NY5L 3HE7A 3Q6GL 1ND0B 1BHGA 1UACL 1NEZB 3U7YL 5CEXB 5LGHL 4JPVH 5MEOA 2PYFA 4K8RD 2GTZA 2CDFA 3MRQA 2ORBH 4MA3B 7CGTA 2AGJH 2DYPD 4KI5D 1OW0C 3PJSA 2PYED 4Z95H 5DLML 3EGSB 4X6CF 1GGIL 1CDHA 3FQNA 4IRSD 4WW2B 4LSQL 1MFAH 1JNHA 1G7HB 5C0JA 3HLAA 3PGDA 1UQSB 1HHHA 2V17L 1KB5H 4BFGA 4JHAH 5J1TC 4B0MM 2VLRD 1G1YA 1UM6L 3PDOB 4OLWL 1EVUA 4EUPA 3V8OA 5JDJA 2R69H 2QSQA 4LMQI 3G08B 4MAYD 2GJZB 4OT1H 5KAQG 3TN0B 4MA1C 1HKFA 3O2DL 4X5WB 4WJ5A 3BPLB 1QLEL 3EOBA 1RMFH 3KPOA 3QZWA 2XZQL 3OR7A 3R0NA 1ORQA 3KPSE 3MLSH 3DUHA 1RJZA 5DUBA 5LGJA 4MNGE 3ELAT 4YHMH 4OCWL 4XPBH 3IF1B 4KKAC 2NW3A 1IQWH 2HTLC 3ECBA 5JHDA 1QSFB 5ISZE 4LCWD 4GRWH 1VESA 1RMFL 3F6LA 1ZHKB 4FFYL 4QHKJ 5K9KB 4UILL 2PF6A 3O3AA 2FJGA 4N8PA 3L7EA 1BWWA 3IKCA 1NLDL 4G8EA 2CMRL 2EIEA 2XN9E 4XNQA 3OF6A 4U1KB 4G8IB 2ICCA 1UJ3C 3D9AH 5L6YL 3V0VA 4POYA 3CLEL 1FBIH 1R5IB 3ZLQC 1ERNA 3MLXL 3N1GC 3FQNB 5DQJA 1F42A 4UTAH 3MODH 4GO6B 2XZCL 4QLRA 5E4EB 1NC4A 1WAAE 4WI8A 4P23D 2KQMA 1BX2B 5JW4M 5JA8B 1JRHL 2K1MA 3TBYA 3WHE0 4N0CC 2YD1A 4GMSL 3G9VA 3KPQB 3H7BA 3UJIH 2HAZA 2OXHA 4J3VA 1U92B 1AO7A 3OKNB 4FQXD 4J6RL 3QIWC 3VXOA 3RNKB 4JPKH 4Z7VE 3MV8D 3TZVB 3ULUH 4I48B 5DFVC 3QDJD 1K2DA 4JHBA 1U6AL 2UZYB 2EE6A 2ZNWA 4XI5D 1I9IL 4F8TA 3I3EA 5IK3B 3L3JB 5A16B 1RHHA 1VGKB 3IAPA 4FABH 4N0CD 3DHMA 2KBGA 2FJHA 5J1SC 5HVGB 4KJQD 1IAIH 3SDXE 4ZTPL 3BHBA 4PRDA 3RRQA 1OP5H 4OZGA 1EV2E 1D5XA 1URLA 4WO4B 4XHQA 5JPNB 4JVPA 3GIZL 1JWMB 3NAAH 1S5IH 4Y4KD 4ZQKB 3GJFA 5I1CH 4OCSL 1CGUA 5KBNC 4D0DA 4YEFA 3B9DA 4G7VL 3TYFA 1MF2L 4MNGA 1IGIL 1P4BH 4KI5E 5F3BA 1VEPA 4JN2B 4M6OH 4OLXH 3NFPA 3QB7C 4PJAA 1MHEA 4KK9C 1EHAA 4YGAB 3KYOA 3GMNB 4FG6D 2EXYD 3OAYK 4LLMA 4QRTB 4Z7OF 4PGCB 3LV3A 3QDAA 5D71L 4X0KB 1QSFA 1ES0B 1YZZA 1LEIB 1C08A 5GSVB 1NMBH 5JR1L 4WFHD 2BRRH 3I75B 4ZPTB 5I2IA 1VEMA 4OLWH 1S7VB 1KLUB 2GQHA 1RU9H 2HT4D 2AJXL 1YQVL 1FVDA 4BKLB 1HH6A 3DV6A 4FFZL 5DF0A 4AEHH 2FX7H 3INUH 1QZ1A 2AK4E 2PN5A 4U0RB 5LBSH 3K8LA 5I15H 4MCZB 2JJVA 2OK0L 4NC1E 2VABB 1GH7A 4KUZL 5GGUA 1NGQH 2EECA 3QCTH 4PJXF 4LEXH 4TSCH 2AV1A 3PQYE 1G0DA 3QEUB 5MENA 4M5YL 1A1MA 3RUGF 3SE8L 2ZUSA 4R97B 5MP6L 1MIEH 3QUYB 2J6EH 2J8UA 1NFDA 4I48A 3IETB 4JO2L 4MZ3A 1MJ7L 3NPZB 3UZQA 3QFJE 5EBMA 3ILQC 2OJEB 3DX8A 2YKLH 3MBXL 1UM5L 4Y19B 1IGJA 4HHAB 2C26A 5CEZL 1T5XB 5FGSA 5L0QB 1KN4L 1IC7L 5FB8B 5KTEH 5KVGL 1U42A 3G6AB 4OF6A 5DI8A 1A7NH 4MS8C 2R2EB 3G5ZA 3T65A 1AR1C 5BQ7B 5E5UB 5BZWA 2OBGA 3CU7A 5J13B 1NCWH 1T1XB 5EU3B 5H2BA 1UCBH 1DUYB 2VLRA 4KQ4L 1AQKL 3V4PL 4X7TB 1P7HL 1GAFL 1KJVB 4F7TA 1H3UA 4IRSA 3HUJF 5K59E 1XGQA 3MLTB 3S96A 1KCSL 1L7IH 2W0LA 3FMGL 3FB6B 3SKMB 4JRXB 1T5WB 3SY0B 5DQ9A 1GPOH 3VXNA 3Q0HA 1B6UA 2FBJL 4WI2A 4JPIA 4G7YH 2HJKA 3ARBC 3TV3H 1QRND 4U6YA 3WJLC 4QY8B 4XRCB 1QLRA 2HFFA 5GIRB 4Z77B 3MJ9L 2IH1A 5J6GA 3T0WA 4ZPVA 3A6OA 5KOMC 3LSOB 3HPLA 4MJ5B 1E6OH 5TE4L 1J0JA 1G7LB 2NXYC 4EUPH 5KSVB 4TSAL 4NRZB 4O02H 3RWJB 4RAVB 3FB7B 4FZ8L 3W2DH 3L5WA 1Q9WB 3IRZA 1P7KB 3SBWA 1TMCB 1PVHA 5EO0A 1SJVA 1KB5A 3PQYA 1FAIH 1AIFA 2IALA 4JRWA 4S1SL 2ENSA 1A7QH 1X6LA 3C8DA 4OKVB 3PWPD 5EWIH 3WJLA 4AEIL 1NEZG 1NFDE 3QUZB 4N8VA 3RKDD 1FCCA 2WWKO 4EJ1C 4PBVC 2VLME 5BJTB 4BZ1L 4PTUA 3VFWB 4OM1H 3S88H 1T03L 1IEBB 4OD2A 1QQDB 3QWQB 3L3KB 4LLUB 1NC2D 4YDIL 1FNSL 3VFMA 1AGCA 1QEWA 2Z31A 5DHVH 3BYTA 1J86A 2FBJH 4FQLL 5TPWH 4JQVC 5DI8B 5GJSL 3NTCH 2CH8A 1QD0A 2UYLB 2QTEA 5D6CB 2W60A 5MEPB 4PP1D 2EDOA 5F1NB 1DUZA 3CDYA 2VLJA 2DQEH 1N3NB 3GKZA 4ERSL 4RA3A 2NY0D 4M4RA 5FK9B 4U7KA 4UV4L 5HYJA 1YDPA 4F3FA 1FLRL 5HVFB 5TGBA 1ZT1A 5GS0D 2EZ0C 1A1OB 4UUJB 4XNUH 3S8WA 2XI9A 1OPGL 1QFWI 2V9TA 35C8L 5GS1B 2LU7A 3MRKA 1NGZA 2A9NH 4Z9KB 3DX6A 2APFA 4JFPA 2VR4A 3VXPB 1LK3H 5DJYA 2EE3A 4N0FB 5JIIA 5IMMB 3WFCL 1AJ7H 1CGVA 1OAQH 4TUOA 4R6UA 3KPQA 3S36X 4YHPB 1D5IH 2IF7A 1RY7B 2VSCA 1Q0XL 2NY6B 5F89B 3ZYIA 3QIWD 4DN4L 1OP3H 1EVTC 2GJ6D 2EZ0D 4ZXBB 2I5YH 2X40A 1N6VA 3OGCA 2Q7YB 1T03H 4XHJC 3SJVA 4ZFFB 3DXAE 4JZJA 4ZUVA 3TA3D 1FGVL 4ZNCD 2B1AH 1T89C 5CGYC 2BMKA 2UZIH 3UPCA 3M17B 3WFEH 5TQ0H 1ZLVH 3QG6B 3KWWB 2IMNA 1X3DA 3CMOH 3AB0C 4OIIH 4RGMB 5FOBB 4R9HA 3FQUA 4X6DF 1JNJA 2WBKA 4R4BA 2E9WA 2A38A 2DIJA 1QKZH 3H3PH 4FRWA 5DS8B 4LP5A 3OQ3B 1NCNA 4PRPA 1RJLB 4GSDL 4GLRH 4YX2L 2VXQH 5DMYA 3VWKC 2NY1C 5HHOD 4AL8L 1U8IA 2VKWA 1NGYA 3GUTA 2VZVA 5D7JD 3SGKA 1R3HA 5DZOA 5D5ME 1YEEL 2NY3B 3W0WB 4QOKB 4HWBH 1GZQA 1YNTB 4UIMB 5CP7B 5HGBA 5T3XH 2Z92B 3MR9B 4E0RA 3P4OA 5GGSA 3DIFA 1I3UA 3MLUH 5I1AB 3KJ6L 4ZUTB 3QRGH 3HZMA 4XC3H 4YDVB 5DO2D 3BESR 1OCWL 3QQ3A 3WHXB 3MFFB 1OWWA 4DCQB 2IAMC 5E8PB 4KROC 1ZT1B 4TNWF 1PKOA 1LO2H 3EFFA 3CZJA 5D8JL 5J3HC 4JRXD 5CJBA 3ARYA 3KXFA 3FB5B 4LAJH 4WUUD 4OCYL 4HK0A 1W0WB 3MV7B 1I8IA 4GAYB 4OGZA 2ADIA 5LQBH 1XIWD 4W68A 2X4OA 3ZDXE 4DUWA 5HGHB 4QRPD 5FOJA 4FQLH 5TPWL 1DBAL 1MLCA 4P99A 5I16B 3D0LB 4LVEA 4PRIA 2MHAA 4FQHA 5DXWA 2WBJD 4FABL 4KAQH 4DK3A 5IB2A 3VI3E 4OCLC 4U1SA 3FFCA 3P4NA 5CD5D 4WY7H 2VNCA 5KN5A 2ICEB 5DT1H 1QLFA 3QISA 5CP7A 5HGBB 1MJ7H 1E0OB 4JFDA 2NY4C 2BNQD 5IQ7L 5DQDL 5EUOE 2XWJA 1CE1H 5ESAA 3LRHA 3HMWH 2BJML 1SYVB 3QEQD 4P2QB 4ZS6D 3K2UH 2Q8AL 2AXGA 3IDYC 2QSTA 3U4EB 3KLSA 4HX1A 3EO9L 5ALBL 2HFEA 4U6XB 5FDYA 3RZCB 1E6OL 5TE4H 3VH8A 5I1DB 4RRPG 4AEHL 5HGDB 2E7MA 3P77B 3QIBA 2JK5A 5BRZE 4IRSB 3DXAB 5HYSG 1R3HB 3MJGX 2OSLB 2V2WB 1PG7H 5EUOF 5GJTH 5HDOA 3TCLA 2R8SL 4NM8H 5TFSL 1RIUL 1WZMA 3UO1H 3LPGA 4XWOD 1YUHB 7FABH 4LCCA 1F4WH 3VXNB 1XGUA 5DHVA 2HTKD 3W82A 4TTGA 5I8OL 3C60C 1AR2A 4PJFE 4YDVA 3CMGA 3IXTB 2H6PB 1I1CA 3RAJL 3NCJL 1CXIA 5GISH 3S36H 2FYYA 2O93L 5KJRH 5C08E 4P2QD 3F5WA 2YKLL 3MBXH 1UZ8A 5I1GL 3D87B 5ETUA 3ROOA 1HYRC 3B9KD 4X4ME 4EI5B 5IM7A 5F88A 3KXFE 2VLKD 4HF5L 4MXVF 1KXTB 2G60H 4GRWF 3L3GB 1BVLB 4G3YL 1WAAF 5C8JA 1RUAL 4YE4L 3MNVA 4WU5A 1NL0L 4FQHB 4XP9H 3OXSB 3HFMH 4JZOA 5J3HD 1G84A 5DRXB 4Z76B 4LPWA 2F5BL 4Z95L 4P9ML 3C5JA 5C0CA 4HXBL 2GY5A 2QSVA 3B3IA 3MRLA 2YZ1A 2MTPA 3OHXB 5D5MA 2ADJB 4IOFD 3BH8B 1SJEB 5BW7C 3QDGA 4EKXA 1PGRB 4QHUA 2HFFB 5GIRA 5I6XB 3E2HC 4K2UL 2BSTA 4Q2ZA 4ZS7H 3GO1L 5DEFB 3NH7H 5F9DC 3ZE2E 1BFOA 2APBA 4NN6C 4M8QB 2ADGA 2SEBA 1U8LB 4PPTA 4F7CA 3RWJA 1S9KC 3BOVA 3MV8B 5J06A 3FFCD 3NCCB 3TT1L 3BGAA 2DYPB 3D3VA 1Z2KA 3Q6FB 2P5WD 5MEPA 1CIDA 4YDKL 5JOPD 1TZHB 1B90A 5KANG 1RIHL 3I2CL 3VH8B 4PRHB 1WBYB 5CILH 4PRID 2FEDD 2G2RB 3S5LG 1MWAH 4PJHB 2PO6A 3DI3B 1RULH 5T3ZH 1HHJB 3RDTA 1MCEA 3W39B 1DL7L 3U82B 4XH2A 1YQ2A 4UIKH 2VLLB 4P57B 1BIIA 1MY7A 1BMGA 1XR9A 2YD6A 3HNTH 4WUUA 4O2EA 1NMAL 3KXFD 4J2XA 1MNUL 3ARGD 5CINH 3B2UC 3CC5B 4TSBL 1CICD 3LZFL 3QCUL 4PJ7B 4X6FA 3C60A 4P2QE 3VE0A 1ZVSA 4Q9BA 4LSPH 2XT1B 2ORBL 3HHRB 4O58H 4ZFZA 3HI5H 5KVDH 5C08A 3VMNA 4LSVL 1N5AB 3BZDA 5ENWA 4J7RA 5I1LA 4X6DB 3MUGB 5D2LE 1F3DH 4WTWA 4OGXH 1HI6A 4MGXA 1U93B 1AXSB 4QRSB 5HPOA 1VADA 1MAKA 5E94B 1CICC 5SWQA 3MRHA 3OKEA 4NRYA 4G9DB 3T1WA 4CNIB 1D9KA 4TVPD 4Z7WE 4PJDB 3RGVD 3I84A 5D7IA 5FKPB 1YMME 3GGWA 3IJHB 4YHKL 5C0CB 1RUQH 3FZUD 4IIQC 1X4XA 3FHAA 4XPGH 3TO4B 3LIZL 3IU4L 3IDIB 1M71B 3EJYD 3VGHA 3QJHA 3DVNA 2A77L 1OPGH 1EBPA 5DYOA 1YN7B 5EC1A 4H5SB 3TYGL 1EFXA 3FRPG 4RGNC 1BQLH 4K3EL 2AEIT 1TXKA 2PUQT 1JZ3A 1KCRH 1YNTA 4UIMA 5IGXH 2UWEF 3HN3A 5HI3D 1G0XA 3CLFH 2EEBA 3HAEB 4DN3H 3BIAX 4KAQL 5HJ3B 4LLWA 4JR9L 5IBUB 2BK8A 3BPOB 2Q76A 1KJMA 1JCKA 4M48L 1HXMA 4DKFH 4WFFE 3WHXA 1ZVHA 3VFGL 2BVOB 3MUZ1 4XC1H 5CSZA 1VFAB 2GTWA 5GJTL 4JFEE 1P84K 3P30H 2BVEA 4OT1L 4FFWD 1WGOA 1VPOL 4HWZA 4ZTOH 5AWNL 3QI9D 4I0PD 5MEQB 5H37H 4DZBA 3VXRE 5IHZA 1XIWC 2UWEE 1C5DA 1PEZA 4PJXB 1TJHH 4KRMB 4LHUB 5C0FA 3AU1B 2GT9B 4XP6H 2I07A 4J4PA 4R0LC 4RMUA 3GJFB 4L4VE 2FDBP 2ZSWA 2Z8WC 3IFPB 4S2SB 3MLRL 4XVJL 5MENE 4PRHE 5T1DL 2C5DC 4HG4K 3MUJA 2NY7L 4LCYB 1RZ8A 1G6RB 3KYOB 3SKUD 4JFDB 2BNUA 5K9QI 3QT2A 3MCKB 1LWRA 1DQQB 2NY4D 2HVJA 4PUBL 3LEVH 4FNLH 1YN6B 1EUTA 4KPHH 4KXZH 1AP2A 2RHEA 3O2VL 1J0KA 2EYSA 2R2BA 3MA7A 1FGNH 4GXUN 1S78D 4IOIB 3R8BB 1ZS8A 1S7VA 3TVMA 4APQC 4XNZC 2RQ8A 5GGQH 2FZ3A 4P5TB 3U7WH 5AD0B 4WO4A 5GZOD 1JPGB 4F58H 4LHUD 1M1SA 1J1OL 4OQTA 4J3UA 3O3BA 5C07E 3BGMA 2AERT 5C0AA 5CIPH 3MCG1 3SOBH 1MHHA 1NCDH 2ZCLH 2X4RB 4OIAA 4F8QA 4OLUL 3PWVB 1HQ4B 1XCQB 1FNHA 1WC7B 2PW1B 3DX7A 4P3CH 4L3CA 3SE4C 1RFDL 2VQUA 4HUUB 5IF0B 5JLZB 1CTOA 5A3ID 1X7QB 4RZCB 1DN2A 3LKNB 1IGJB 3MCKA 1JF5A 5CS7A 3UJTH 3VWJB 3NTCL 1J12A 3T4YB 4G8FB 5HHME 2C1OA 3TIDA 1Z9LA 3MA9L 3B9KC 3QUKB 5DRWA 4XX1G 5E9DA 1CLCA 1XEDA 3TVMB 1MJUL 3IKKA 5CJQL 3IDMB 3BXNA 5ELIA 5C3LD 1YYLL 1KF9B 1RZKL 4TOYL 2NY0B 1LO4H 3AU1A 2I07B 1IKFL 3VFUA 3VXQA 2XICA 4WEBL 4NO5A 5ANMB 5CIPB 1VFBB 2A6JA 3WIFA 3LV3B 2I60L 5TQ0L 2L4OA 3WLBB 2CKBH 4JRYD 3EJJX 2DWDB 2BP3A 5K9JL 1QO3A 4HULB 1U8JA 4OF3A 3MLWH 4AZ8A 4ZAKD 4L8DA 5B8CC 3D2UB 1CFNA 3HI6L 4EN3B 2BHYA 3O9WC 1ZVYA 4HH8A 1CLYL 3PWVA 5C2BL 2R29L 2MPAL 4HWNA 4HPOL 3F7RA 2UUDH 4MWFA 4Z7UB 3TBVA 4PGJA 5I17A 4ZODA 2ICWI 2OI9C 2ARJB 2IQAB 3Q6FA 3GSVA 3STLB 5HDQL 2DB8A 2A6KA 3F7YB 2YS4A 3TA3B 2BVPA 1DUYA 3RPIB 4I9WE 3ZTJG 5HYSB 1J8HA 4U0RC 4JEGB 3K2MC 4AK1A 3MO1A 5GISL 3CVHB 3RZWA 4F37F 3OX8A 1ZHBB 5DVKA 5B3NA 3PF2A 1X4YA 2CLRA 5IV2B 1U95B 2YC1B 3RNQA 3VG9C 4BSWB 4JFXA 3QDGB 1YPZE 3CXHK 3BZEB 4NBZB 4ACPA 3JWOL 4U6VH 5E8OB 4NKMA 3MV7E 1PEWA 4XPTL 4NZRH 3VI4F 2EYRB 3TPUA 4L3CB 4RMRA 4IS6B 1U8OB 1A3LH 1IAMA 2EO9A 2HT2D 4Z77A 5DK0A 1IMHC 1MJJA 4U31A 4CRPA 3QIUD 2X7LA 4K3HA 4K3DH 4WTZA 2AEQH 3OWEA 1CL7H 1YEJL 4PJCB 2QQQA 3T0ED 5E6IC 5F1IB 5CFHA 2WLZA 3IT8D 1N4XH 1HSBB 3THMH 5DD5H 4HJGB 4P59L 2H26B 4C54A 1A6AB 1NGXA 3TNNA 1FZJA 4KTEL 5D7KD 3ZE1F 1D9KB 2B20A 4UOW0 4AT6A 1OTUD 4NQEA 4NO5B 2ESVD 4OKVA 1IBGL 1T6VN 4OQTL 1BQHA 1UKSA 3X11B 5IWLC 1CBVH 1N4XL 3THML 4OGYL 2VJXA 4KUZH 5EUOB 2VO5A 3T0EC 3EJYC 3L95A 5IT2L 3RBGA 4HKJB 1G7LA 3QIUB 4U1MA 4HBCL 4AG4L 1X5XA 1DQML 1IL1A 3WD5H 2DQFA 1LO3H 3BD5A 4LSVH 3WKMH 3VXUD 2X1OA 1EAJA 1WBXB 4NZTH 3QI9B 4NFDA 2WQ8A 4FMFA 3KYNA 3SDCB 3QDME 4ZFOL 1D5XB 1HOCB 3GSUB 2QBWA 3CVIH 1U8KA 3I3DA 1WIPA 1X5ZA 2JCCE 4Z78A 5EC2B 5MHSE 4QNPE 4LPVA 3TBSB 1P4IH 2P42B 1DVFB 3WSQH 3EJZC 4QCIA 3WEXA 2M26A 3RWCB 3FN9A 4XVUC 1VKXB 1M7XA 3BKMH 3OB8A 4OLEA 2VQTA 5JQ6L 3RY5A 2BNRE 3PIQA 2VAAA 4Z7NE 5HJ3A 5IVZB 4HZAA 4B53A 4QO1A 4TYUA 5FYJD 1C08B 5E56A 1Q8MA 2PXYA 1ZOXA 4CU6A 4X7EC 3DARA 4P9HL 1KUMA 3BZFA 2BNUB 4Z7VF 5HI5D 4G42A 5EIIA 4C4KO 3D69B 4EEEA 4KY1H 4NNYA 4AG4H 1FZJB 2ESVA 2A83B 3E6FA 2CLZA 2G75A 5HHVH 4ORGB 1CDIA 3X13B 4APQD 2E8ZA 4XMLH 2CK0L 3I9GH 5IJKA 1KN2L 1IT9H 1KYOK 4H1LH 4B5EA 1UH3A 2OP4H 1TQCC 4L4TE 1DEEA 1F2QA 2EDXA 1DCLA 2H3NA 3HFML 3PP3H 4LSDA 1T1YB 5HGHA 4AEEA 5DJCB 5IOPA 15C8L 3MODL 5JW3L 2FLRT 4XXDA 1FRGL 5GS3A 4MDIA 4PJ8C 3WIHL 4X6EB 1AFVH 1R24A 3M8OH 1FPTL 3HS0A 4MD0B 1IKFH 3FOLA 2ADFH 5IB1B 1JF1B 4ZNEA 3HZKB 4CU8A 1LNUB 3TO2A 4YHOH 3ZKSD 2HJFB 1UB6B 1REIA 4JPWL 3LKNA 3QAZB 4M03A 3VWJA 3QHZH 4LOUC 4KQ3H 2WWMC 1OGTB 1ZA6A 1F4WL 2X70A 1T1XA 5EU3A 2BHZA 5H2BB 4FQQA 3WJJC 4DGYL 4X6DE 4U6VL 3Q3GA 5D2LB 4Y4FB 1S7RA 4BK5A 4P3CL 3S4SG 5I8KH 4ZYKB 1U0QA 2MCPH 3IB4A 4F7EA 3D6GA 4J8RA 5GSRA 3ZMRA 3HZVB 1KIRA 3K4ZA 5GGQL 3CSBA 2K9UA 4D0CA 4XAWH 2AJVL 1QFUH 3GMLA 2DJSA 3K3QA 4NQCE 3LS5H 4ZO7A 4HUWB 3D2UD 4BH8B 3K8KA 1AD0B 4KDVA 3AREC 1QPPA 2O5ZH 4RX4A 3ZDZE 4UB0L 2YBRA 3O6FA 4UDUA 3S35L 4DVRL 1FVCA 4EOWL 1JGEB 5GGVY 2YUVA 4U1JA 1KJ2B 2DMKA 5E0QA 4MLSA 1R3IH 4H20H 2R29H 4JFFE 1SYVA 1CD1A 1MCOH 1WAAA 4Y4FD 3P0YL 4K94L 4NZUH 2BNRB 5C0BE 1QSEB 3ZT7A 5E08L 3JZ7A 2FL5A 3U4BL 3TFKD 4H1LA 2YEZA 4S10A 1C8PA 2AEWA 5FAAA 5ICZA 5JW4R 4OI9A 4P5MA 3BIKB 5T1DH 3MO1B 1YEDB 4YZFF 2E6PA 2P43B 2FO4A 5FDWB 4OFDA 5DFTA 2EC9T 4YEEA 3UTPE 1TDQA 4ODTL 2HLAB 2WUBH 5FKAA 3MRMB 1LP9F 4LCUB 1F3DJ 2R1WB 2R1XA 1E4WL 1H15A 5BV7C 1GJIA 1WZKA 3P4MB 3TF7C 3KLDA 4HH9B 5D5MB 3C9NB 2YUZA 2CIIA 3OKMA 5DMIL 1TJGH 4MWFB 4WIQA 3DI2B 3ARFC 1QP1A 3C6LB 3U46A 4EXKA 3V0WL 4KMLB 4LPXA 3W9DA 3RWHA 2ZUQB 3QDGE 4CMMB 1K4DB 1TJIH 3BIBX 5FHAL 1ZT7A 4PYGA 3OL2A 6FABH 3TNMA 2L7JA 4KVNH 1S7RB 4DKFL 2NTSP 1H3PL 2VXVH 4ONGL 2X4TA 4RAUA 1NCDL 43C9B 4XZUA 1EMTL 4CGTA 1QOKA 4O5LL 3BI9X 4M6AA 2UVFA 4HUMB 4NZUL 2IFFH 5E8NB 3TH3T 1E28A 4LSQH 2FEEI 4PLNC 4Y2DC 4PRAB 2B4CH 3FRPA 4RFEB 1ETZA 4IRSC 1EAPB 1PZ5B 1QHOA 3D0VB 5ID0A 4CAGA 4MB5A 5MP6H 2HKHH 3O6KL 4WEUD 2COQA 3OKLB 5DUML 1WCQA 4OIIL 4WJ5B 2ITCA 4NC2B 3CX5K 3MTRA 2NY5H 3EOAB 5DTFB 2IPUG 4M5YH 4JREC 5ADPH 3SGEH 5FB8A 2IWGA 5ETUB 3ROOB 1DUZB 1NDMA 3BGFC 3DBXA 4GKOA 1FFRA 3OKMB 1RUPH 1FHGA 5IW6A 5J11B 1G1CA 3NA9H 3U0TB 3PGCB 4XBGB 4XPAH 1HDMB 3LS5L 1CFBA 3MNVB 1F58H 4CVXA 3QCUH 3S6CA 3QI9A 2Y07L 4TSBH 3TJHD 2AJUH 4FA8A 5FO8A 1A1MB 3N1FC 2BVTA 1MVUB 4P5MB 3VCLB 1EMTH 2PO6B 4U1KA 4G8IA 2OZ4L 3QCVL 5SWZD 5C86A 5CJXA 1A9BB 2QADB 1FORL 1HHKB 1H3PH 5IBUG 4HD9A 4JLRB 2YA2A 3ULVH 2GJZA 4NKOB 1ZGLB 1P84J 1TJIL 3A6CH 4HEME 2R1WA 3GUTB 4JY5L 5FO7A 4ONHB 1U8NA 2YSSA 4G6JH 1BD2D 1BFTA 1QFWM 2DKUA 4WI9A 4XMKH 5T1LD 2XXMB 1G7PA 1FLRH 4XVUD 2ADGB 1F4XL 1G7JB 1U9KA 1A6WL 1GC1L 1GGYA 4ODVL 3ROLA 5FFLA 5HXMA 2AV7A 4PLOB 1FYTA 4OZHB 4KHXH 1TZHA 2D7OA 3HUJA 1PY4A 3DECA 5T33L 5GPRA 1RZIA 1FNSH 1U58A 3V6FB 4N8CH 1KPVA 3KPRB 4CMHB 4JM2C 1UXWA 4KI5C 4OLUH 4OCXL 4PJEE 3QP3A 3L3OA 1XF2A 5C6TH 2ZSVA 12E8H 4JFZH 4L9LC 4X99B 1R3JB 4DAGL 1DANT 4ODXA 3SY0A 3WHE1 3CSYA 3OR7B 3DNKA 3GSNH 5F96H 1TQBB 1LP9A 3QYCA 3RWFA 5F7EL 3RIFK 4HJ0D 4P2RD 2XTJB 3PWNB 5MEQA 4ZFZB 4JPKL 2VERN 3ECBB 1XZ0B 4JM2A 3NIDF 4LSSL 4TTDC 3QNYB 2EDKA 2QSCH 3MRRA 4NRXB 2CXGA 1AGCB 1QEWB 5LGKA 1B2WL 2VN4A 3GNML 3EO0B 5IB5B 4B50A 1DQTA 3TN0D 1QFOA 1WSST 3IDGB 2YD2A 1R5IA 3AMLA 5I66A 5D93C 4Q7DA 3L5JA 4OFPA 1I7UB 5GSVA 3FT4A 1UA6L 5ADPL 4BSVB 2FJHB 5FKPA 4NM8L 4WHTA 1MLBB 4NFBA 4KU1A 1PG7L 3F62A 1RZFH 2HKHL 3O6KH 5DUMH 1XF4B 4LOUD 1I1FA 1HH6B 3DV6B 4M02A 1S7WA 4WHYH 2B5IB 4YUEL 5F7WC 2P5WA 4YDLB 2Z93A 4OD2B 5KSAC 1IQWL 4KFZC 5I71B 5AYUL 1NJ9B 4ZUUA 1BVKB 4K94C 2AJVH 3O6ML 2AJYL 2ZJSL 1WFTA 1YY9D 4K07A 1T2QH 2HLFD 1DANU 5JIHA 2RGSA 3OPZH 4Y1AA 3QDGD 2ZCHL 4MAUL 2EH7H 1CWVA 1T83A 3LN5A 3VI3F 1S5HA 4ZS6C 3MX0A 2BVOA 3ALXA 1VFAA 1VFOA 3U4EA 1FRGH 1CLZH 2X4QB 3VWJD 2JJSA 1JGEA 1CT8A 1FIGH 5JA9A 3CFEB 1J0YA 4YAQB 3SGKC 1E4KC 1EHXA 1JGVH 3U2SA 2YPVH 1O7VA 3G6AA 4J23A 4UV7L 1EJ6A 3PWUA 4BQ9A 1UWXK 3QZWG 3V5KB 1J05A 2PR4L 3BVNB 4P4KA 4JPVL 4HIIA 1MHCA 3ZL4H 1OAUL 4XCNA 4WFFD 5JHLL 2PTTB 3B9KA 5F7MC 5E6YA 5GRUL 4JY4A 1SBBA 2IEPA 5E9DE 5ABDE 4NHCL 4NM4H 1YEJH 3WNLA 4OV5B 4GBXC 2NLJB 4F7PB 4PV8B 3QNYA 4LU5L 5GRJH 2DQDH 1UEMA 3PWLB 5DJAB 4DOHB 2YRPA 4DZ8B 4KMTH 1WISA 5AUMA 2DL9A 4PRNA 3HUJE 5K59F 3DX7B 1S3KH 1U8LA 1NMBL 4JANB 1OM3H 5K33A 4WFHE 5D1QA 4LRNL 4X6CE 4OLVL 4ETQB 2BOCA 1AD9B 1YMMD 4ZG1A 4PJIA 4JHWL 1P4IL 2YPLD 4P2OD 4L29A 2CIKA 2FH6A 3FN0H 5T1LB 1NUFA 4M61A 4XC3L 2RBLA 4P46C 2P5EB 5A2KH 3WXWL 1XMWA 5DJ2A 4XZUB 3OAZH 1FDLL 3X3FL 1WIOA 4L3AA 2ADFL 5ANMA 4CW1A 4R96B 4P49A 2DLEA 2XKSA 4JQXC 3MV01 3WFBL 3CVHA 1DSFH 1XCQA 2X1PA 2YA0A 4UT7L 2DM4A 4ZTPH 5CD3A 3HZMB 4MXWL 3QXDB 2NY2B 1EO5A 4QRPB 3UTSE 3KPRD 4P2OC 3JV4B 2RAMA 1S7TB 3O81A 1VSCA 3BDBA 3G5YB 4M93B 4RIRA 4UNTA 4OUOA 3A6BL 4PD4K 1J11A 1ZV5A 3QNXB 3U30B 4AQOA 5C0RL 3TC9A 1D6VH 2FHFA 1DE4A 4ONFL 2WBJA 3MV7A 2Z9TA 3IDNB 4POZC 1XGPB 4O4YL 1OAQL 3I50H 3DSFL 4HS6A 5L8JB 1Q9WA 4C55A 3U1SH 4XB7A 4MSWB 3RVTD 1A14L 3PGFL 4P46A 4JRXA 4N9GB 4E9LA 5D7LE 3VXRA 4WV1B 4JAMA 4L4TD 4HUVA 3T77B 3B83A 4DVBA 5I8EA 5E8DL 1VHPA 3EDKA 1P9MC 3E1F1 1FFPA 3KPLB 3VXMD 3EYFB 3BE1H 3S34L 1IQDB 1A6UL 5DJYB 4J3OC 5EC1B 4H5SA 2AEPL 2BCKA 4JG1L 5C09D 4NPYA 5L2JA 1XGRA 1P6FA 4Y1AE 2W91A 4PJFB 4U1HB 3UTTA 4NQED 4U1NA 3ETBF 3ILPB 1UZ6E 2A6DA 4FS0A 5F89A 4OJFH 4XBGA 3HB3D 3O9WB 1CD9B 1XF3A 4YK4B 4EI5A 4MVBD 4PJDA 3RWEA 1DE4B 4Z7VB 2EEDA 1BQUA 1HHIB 5D1ZA 1T4KB 4OSUH 2DQEL 3FZUC 4YHML 4S1DC 1MVUA 4O2CB 4OIBA 5I8CB 3I6LE 1MAML 5FYJH 5C70A 5FO9A 4OFIA 2P8MB 5DJ6B 2AQ3A 1VA9A 1INDL 2CLRB 1MRCL 4X4YA 3NMEA 1KIPB 1CR9L 1AGDA 2CLVB 1FAIL 5J6HA 4NN5C 3N1PC 3VXSB 2IMMA 1RUMH 2YSSB 1HCFX 3OHXA 2VIRA 4WI7A 5EBLA 3WUWG 1CLOH 1ZANH 4HUKB 2GY7B 3O45A 4KPHL 5HI3C 3WIIL 4F57L 4AQ1B 3OKOA 2IAMB 4HIHB 1CF8L 3DUSB 2OS7A 1RJYA 5D6CA 4W4OA 4NN7C 3RWIA 2IANB 1HYSC 2PYEE 4OCNC 4U1HA 1AJ7L 4DTGH 3IF1A 4JZJB 4ZUVB 5F9WC 2DQHL 4U6HB 1LEKA 5K9JH 1OAUH 4JO4L 3U9UA 2XTJE 1H3VA 4LLYB 4NQDE 5GGSB 1NFIB 5D7JC 4V2CB 2MWCA 2D03L 1IGYB 4KK6C 3VD9A 1H5BA 3QWOB 1T66D 1D5BA 4DZBB 1ZEAL 1JHLH 1HHIA 1X5IA 3BZFB 2ICWA 4LVOB 4WHTB 4XCYA 3K46A 3ZTNL 4WV1A 4UV4H 2VN7A 4EQ2A 3P40A 2DQJH 5EOCL 5D2NA 3WIHA 3GHEH 2VLJD 5DQJB 1NAMA 5EO9A 2YRLA 3MV9B 2P5WB 4NO0D 3PDDA 4MDJB 1GXEA 2IAMD 2NZIA 4JY6A 4L1DA 1KSRA 3O4LE 1AGFA 4HK3J 5T33H 3D0LA 4PRIB 3RWCA 3S7GA 1I9JH 1F13A 3J7HA 1BWMA 4DN3L 5D7KE 4M62L 2FIRT 4MQ7A 1LO4L 1KPRB 1Q94A 4CVWA 1ZA3A 3RZCC 4YFEA 4ERSH 4R8WH 1E6JH 4YR6A 4JO3L 1W2KT 3OXRA 3L3DB 1PYWB 3GRWA 1Q9LB 1OTSC 4FQCH 2HWZL 2FLBT 2I26N 2WINB 5H35A 3L9RB 5CHNB 4W70A 5FO9B 3NBNA 3ULVL 1X44A 3ARDC 4H88H 4LFHD 1JZ7A 4GG8B 5D7IB 2JB5L 2XQBH 3IJHA 3TBSA 3CFBB 5M95B 4XCYB 5CGTA 1PKQA 2EXYC 4XXCA 3ZKMD 4O02L 3W0WA 2XKUA 3ZTNH 1E27A 1BJ8A 2OK0H 3OJVC 4P23B 1S9YB 5J0BA 1D6EA 1G6RL 4K94H 3ET9F 4GKNB 1MCRA 4RFOL 1ODAA 1I8MA 4TUKH 4FQXB 2HT4C 1J0IA 2EKSA 4X80L 5FUOL 4GBXD 1R24B 4JJHA 1U8JB 3TJEL 1WQVT 3W2DL 1T7XA 2HRPH 4Z0BL 2GFBA 2JJSC 3F6IA 3RHWF 4F58L 2QQNL 5J57B 5DJAA 4LF3A 3O3DB 4A6YH 1V3LA 4DAGH 5INDA 4QRUA 1ZAGA 1IGIH 4JN1L 5CSZB 1MI5E 5D7IF 2APWA 1K6QL 3F7PC 1BF8A 25C8H 4HX1B 2VH5H 3N85L 5EOTB 4JFYB 4OZIB 5FYKD 2GHWB 5ITBH 3C87A 1VPOH 5DJCA 1X5AA 5FA4A 4IMLB 3TH2T 5HHQA 5JDSA 2C7UB 3CH1B 3DUUB 4RSVA 3Q5TA 4WNQA 3QHZL 3C5JB 5C0BA 2C4FU 3L3HB 1RHHB 1F11A 4MD4B 3FN0L 1HKLL 5ILTH 3WDJA 1KJMB 2AI0L 4I0PA 3UZEA 2OTWA 5J12C 3L3DA 1NQBA 2X44D 2FSEA 2I9TB 3BHBB 3B6SB 3DO7A 1FORH 4PRDB 3BZ4B 4YNYB 5DJZB 4HWBA 4ODTH 3HE7B 1AY1H 1AE6H 3H3KA 2Z91A 1CD0A 2NY5C 1N5YH 1QR4A 4F9PC 1FL5B 4MD5A 3C5ZC 4I5BA 1M05A 4F7EB 3OX8B 4M6MH 4V1DB 2UZXB 4EBQL 1S9YA 4FNLL 2YEZB 1C5BH 3QEUA 5MENB 1YUHA 3ISWA 1ONQB 1S8DA 4L4VA 5I19L 2CQVA 3LD8C 4PJHA 4NKDB 1P1ZA 5F6IB 2CK2A 1UWXH 3WO4C 1ES0A 3ZKMC 4ZOAA 4OCRL 1X5GA 4WHYG 2AP2A 2DLFL 3OAUL 4XT1C 4YIQA 4Z7OE 1IC4H 3SKNB 1J1XH 2VDQH 2VXTH 3CDCA 1QSFD 2P8PA 3DRQB 4G8GA 4XWGL 1IC5L 5GHWL 3OV6A 5DA0B 2MCG1 3GK8L 3BKCL 2R2BB 4XCFH 3STZB 4PB9L 1OSPL 3C6LA 4I0KA 2VABA 3A67L 1C16A 3EOTL 4PJCF 3ZYOA 1QLEH 1JJUA 2IADB 1MWAA 2XWBA 2HH0L 3DRTA 4F7TB 4FFYH 1G9ML 2C3HA 3PDOA 1OP3K 2F15A 5JORA 1RD6A 1P7KA 1QNZL 5FYKE 2B2XL 3OJDB 1FNGA 1TVDA 1JGLL 2R4RL 3D1MC 4J3SA 4LARL 3QZWB 2AJSL 2ZWLT 3VXRD 3O6LL 3DWTA 3HRZB 1BD2B 5F7FA 3RX8A 5L7XL 5DHXB 1RSFA 5CJ5A 5C6WH 2VDQL 4JLRA 3O45B 1LP9E 4Q6IC 3QDJA 5SWSD 4F15C 1RZFL 5E2UH 5JHLH 3B9AA 3MV8A 2NPLX 1HE7A 1GGCL 3DLQR 3B6SA 4AENA 3DO7B 2WV3A 1I3GH 4M7KL 2JKXA 4HLZG 4FXGB 3CXDH 1AO7D 1GZPB 4OD1H 2W65B 5I75B 1SQ2N 4WW2A 1G7HA 1JRHH 1JFQL 2CD0A 2Z31B 1ZLSL 5BRZB 3KYNB 5IK3A 4HIXH 4JG1H 2BRQA 5IEKB 1Z3GL 5JZ7D 4XPFL 3D3VD 4LLDB 4FZEH 1CL7I 4KHTH 5FXCH 3FCTB 5L88L 1YA5A 1T3FB 2DTSA 4YBHA 2VLJB 3OBAA 2V5YA 1NAML 4MQSB 5EC2A 4JFQA 1U3HA 3ZDXF 1G7QA 1BQSA 4GAGL 5D9SB 1HK6A 4DKEL 3O4LD 3VCLA 4Z8FH 1H0DA 4NKIH 2DTMH 4OZFG 3C09C 1UYWL 2WUCH 3C08H 4PY8J 2V7NB 4LCWB 3MRIB 5D8JH 2FX8L 1R3JA 2JB6A 4LEXL 1K5NB 4TSCL 1LE9A 1FIGL 4L5FL 1BBDL 4KKLD 4PG2C 5I1LB 4ZO6A 4JDTH 4ODSL 4MDIB 3KS0J 4P2OA 5EU6A 3N0PB 1NSNH 2ATPB 2P5EE 4FQIL 4XNZB 1RURL 3D9AL 4RBPH 5L6YH 2YOCA 1RIUH 4MQ7B 1NL0H 2CKNA 4OB5H 3MRHB 2AV7B 3ULUC 1ZK9A 1H3GA 5F8RC 1GHFL 5I8KL 5GS0L 5F3HB 1W72H 2V2XA 3PL6A 1IAIM 4Q6YA 5HDBE 1MREH 5AYUH 2CGRL 4ALAH 3MNZA 2DIBA 3BAEL 1KV3A 1WIUA 4TRPH 1CFVL 3ARDD 1S9XA 3A0OA 4Y5XA 2FGWH 5HYFA 1PKQB 5I8OH 4GQPH 5T5FL 4LQFH 1U3YA 3NPSC 1IC4L 1RZ7L 1T04A 3BEWB 5E8OA 1JN6A 4XPBL 3V7AG 4MNGB 3PHQA 1YEKH 5EZOL 4HS3A 2DQTL 2HJLA 4Y19D 1G7JA 3FB8B 1A22B 4LRNH 5TFSH 1DDHA 3RGVB 3GIZH 4NJ9H 1KOAA 3OTTA 4QXTB 1JPSH 3GMQA 5F7KC 3AS2A 2G5RA 1NAKL 3HC4L 4HJJL 2CXKA 4G5ZL 4TQEH 2R9HC 4JVWA 1D5ZB 3VFPB 3FFCE 4FXLA 4QHMB 4OLYL 2HVKA 1A64A 1RIVH 5IT2H 2H26A 3PP3K 4GRLD 5EOQL 3LPWA 1RZGB 1KB9K 4NQEE 2C1PA 3LOWA 4NHCH 2R56H 3HLAB 3MRKB 3DX6B 4Y1AD 4O9HL 5F7EH 4XVSL 1ITBB 2G60L 2W92A 5AZ2H 1Y18B 3O41B 1SMAA 2BHUA 4FQCL 3QXVA 2DI9A 1MPAH 3MRBB 3FQXA 5FUZH 1ITCA 4R26L 3UJJH 1AI1H 4NQVB 5F9OL 4PRBA 4DK6A 4GW1B 5HHOB 5EU7C 4PJ7F 3RDTC 3LKRA 3CSPA 1M6OA 4M6ML 5C0NC 4M1GH 4M7ZB 5FKAB 3WBDA 5FECB 4PD4J 4X9GA 4Y19E 3ZE2F 2VLKE 2X9WA 7FABL 3Q2CA 4KVNL 4MQXD 3MRFA 1NKRA 4LHQB 3IXAA 4LGRB 3WS6C 4NT6B 1LE5A 3QBTB 2G9HA 1DBBH 4G8EB 4ODBD 4HIJA 1YEEH 4R7NB 4JDVB 1PG7X 5KJRL 2ZCLL 3WDIA 1ZE3C 2XWJB 5ESAB 4O2FA 5GRZA 4AIZB 1I7TA 1S7XB 2BC4A 4AL8H 2JCCA 1S9XB 5D93B 4MA7H 1CFQB 1N59A 1EXUA 3O9WD 4TULH 2XN9D 4MQXC 1AHWC 3QUZD 5D7LD 2X5PA 5JUEH 2ZCKL 2H2PD 3VRJA 5ID1A 2J2ZA 3V4UL 2BVPB 3RPIA 1T7ZA 2O61B 5EORH 4YFLI 1FLTX 4P3DA 3BFOA 3DV4B 3VD3A 3CCHB 4WW1A 4G80A 3MROA 5HHOA 1ED3B 3L3IA 2GITB 3C5SA 4ZD3L 5IHUH 4R7DA 2NY2D 4QY8A 4HUUA 5DJ0B 1MHPL 1N2RA 2K7PA 2WP3O 4EBQH 1E4XL 1T80A 3IGAB 4UQ3B 1R0AH 2X4QA 3EFFB 2GCYA 5E7BA 1WVZA 1CDBA 1Q0XH 1IBGH 3QEQE 4D0BA 2D0GA 3O4LB 4KKCC 2LVCA 3P9LB 5T3XE 4NRZA 1VCAA 2Y72A 2FBOJ 4DWHA 3L6FA 4TVPL 1OGTA 1BM3L 3IVKB 4HIIB 4C57C 2MKWA 4D94A 1E6JL 2D7TL 3KPSA 1NUNB 1YY8B 3RU8H 2EKJA 2CIKB 3ZDZF 2QL1A 3CSGA 4Y2DD 5T1LA 2AI0H 2GJ6A 2YMXH 1TZIA 3QIWA 5CBEB 2UY6A 3MOAL 1J5OL 4J8RB 1SBSL 4OV5A 4Q9RL 1J7VR 2I27N 2Y36L 1NBZA 2VB5A 3WFDL 1Q9KB 2FO1A 3WFHB 1FNGB 5DMKB 1AY1L 1W72A 5I1JL 2XQBL 2JB5H 2D7MA 1C12B 1MCJA 1FO0A 2APVA 2OL3H 2VXUL 4OCYH 1EZVX 1F6LL 3DBXB 4NCDA 2A73B 1R5VA 4RGND 4DKAA 3RVWC 4KQ3L 1UB6A 2Y36H 3G6JA 5EUKB 2LFGA 3UC0H 1X5KA 3QFDA 1OHQA 2HFEB 3PUCA 3NIFE 4MB3A 4U6XA 3VRLF 3RZCA 1KB5B 4PJFA 5EWIL 4AEIH 4NHUA 2NR6C 4W6YB 5D2LA 1IJ9A 3MRQB 3HMXH 4L8SA 4G6KL 1I7ZA 4KKBD 5CJXC 1BM3H 5JORB 5HY9A 1UXWB 1BZQK 1WWAX 1JHKH 5GGUB 1AO7E 4U3XA 3ULVD 4YFDB 4M1CC 2VWEC 1JNNH 3I6KA 1MUJA 4EVNA 1L7TH 4DQOH 1OY3B 5EO1A 4GG6E 3BQUC 2X1WL 5DGRA 3QXDA 2ZZUT 3MYZA 1RAMA 2F8OA 2J7LA 1BJ1H 5JW4N 1IQDA 3BSZH 3SE9L 4HGWB 4OZGF 3EKCA 5JNYB 3C9NA 3BRFA 2DQUL 4UZGA 5MEOB 3SQOH 5F7HA 1FG9C 4U1IA 5ITFB 1MCBA 5HGAB 3BWAA 35C8H 2VDOL 4PGBA 5I66B 4Y4KC 3TIEA 3V6BR 3RHWK 5L8LB 4K3JL 2FX9L 3ARXA 3OXSA 2AKRA 4NHUB 1JGUL 1JYXA 2W9EH 4KKCD 4RWYH 1HILA 1T0MB 5ICZB 3UTQA 2AS5M 1Q1JH 4UT7H 3JTTB 1SEBA 2DAVA 2IQ9H 3QIWB 2XOTA 1I1FB 5EOCJ 2F8VA 3MOBL 3S4SB 3UJTL 1OSZA 4DUXA 1SJEA 3ZYZA 3ULSA 2JJTC 2VXSH 3BKJH 4F37K 2AEPH 2ADIB 3QHTC 5T3ZD 4H88L 2X41A 4JKKA 5DJDA 3JWDH 3RL1A 4LFHG 4EDWH 3MRCA 2D9CA 3BDXA 3I2CH 2AQ1A 1N6QL 4CVZB 1QBAA 5ID0B 3KLAA 1CDGA 1XF5B 3IFOB 4MDJA 4I1NB 5EOCH 1U3JA 2P44B 2R39A 4PY8I 1NLBL 4UNVA 2FX8H 4FN0A 2IG2L 5EU4A 3QEQB 4PJAF 4X6EA 4E42A 2DMCA 4WO4C 5I1KL 2DTML 5KSVA 4PRHA 3RVWD 4U1IB 4NNPH 5L8KB 2F9BT 4Y16D 5IFHL 5ITFA 1DEDA 1I9JL 2HVKB 2XY2A 3NFSH 5ICXB 4IRJC 2X4TB 5KSBF 1W0VA 5E00A 4PGZA 3BP6A 1UM4L 4PJ8D 3O6FD 3GBNH 2IALB 4QWWD 5A2IH 1MI5D 1DP0A 2VR5A 2VLMD 1Q9LA 5A2LH 5J6HB 2H1PL 3EYSL 3O3UN 2XZCH 2P45B 4XMLL 3PHQB 2X70B 1KG0A 1CF8H 3NCBB 3EO1A 2X09A 4RMSA 2J8UF 2Z92A 4A6YB 4RISL 3QIBB 1T1YA 2ZCHH 2VISA 3FKUS 3AGVA 4V1DD 1KULA 4PRBB 2RJMA 4WDIA 3HE6D 5MEND 4F7PA 2PXYB 5KZCB 2ICEA 1T1ZB 4RAHA 4PJEF 3IFNL 1AXSA 4G6ML 2XRAL 2W59A 4P59H 1D7FA 2Q6WB 1U3HD 3G6JE 2A9MH 1OGAA 5BO1H 5MI0C 4GH7B 5EB9A 2CLZB 1K8IA 3AY4A 3VFNB 5GZOC 3MJ8B 5AZEH 3QA3B 2YBRB 3O6FB 3NGBB 1YDPB 4F3FB 2IPKA 4G5ZH 4HLZH 3VWKA 2OTUA 3PNWA 2ZUUA 1TCMA 2DLIA 4OAWA 5ICYB 1HHKA 4BKLA 3WSQL 5I1CL 4W81A 2OL3A 1DSFL 3TBWB 4L29B 4WWKB 4EIGB 5J56B 3E0GA 4JFEA 4P5KB 1TTUA 3CSYB 5C8JB 4LVOC 1P7QA 2X4SB 2EDHA 4XBPA 1R3KA 5IMKB 4CVZA 2ZPKL 4H1LB 2YRZA 3C6LC 5KZCD 2IBGA 4S11A 4P2YA 5KS9A 1P4BL 4LIQH 3LKPB 4K3JH 2ZUQC 2DLHA 1P5UA 4O51A 3HUJB 4Y4KA 3IXAB 1C5CH 5EA0H 4PJXE 4OLVH 4Y4HB 2E3VA 3MRMA 3QEHB 1ZWIA 5H35B 4XVTH 3CPLB 3MJ7B 3R1GH 1PJ9A 2MPAH 4FQQB 1IC7H 3MA7B 3ZKXB 1GGUA 2AJZB 1UG9A 3AY4C 3LEYH 1XGPA 4LSSH 4CADB 1MLBA 5CJOL 1CBVL 3DMMB 2YR3A 4NCC1 2OTUB 3PNWB 3UYOD 3PWJB 4HS8L 1MSPA 1WT5A 4G8GD 3NFPB 1JPSL 1H9VA 4F9PA 5BV7H 1NGYB 5GS2D 2E5EA 2ZSWB 3MSPA 4OD1L 4ZFOB 3IFPA 3V0AC 4Z7QE 1U8HA 3DYMA 4FQXA 3P73B 1BIIB 1XR9B 3GFUA 2R0ZH 4WTXA 3BP7A 1NLDH 2P8LB 5I2IB 1NLBH 3GM8A 2OR9H 2BSTB 3EOBB 3KPOB 1D6VL 4FFVD 3CDGB 5IESL 3R8QA 3L1OH 1NC4D 1OCWH 2NCMA 5T1KB 3LZFH 3MC0A 4LARH 2EDFA 4JFFD 4QEGA 2ZP0T 5DR5H 1RPQA 3DPBA 1QLRB 3D5OF 3HNSH 3B43A 4Y89A 1QRNB 2HT3D 5DTFA 5CMAB 4HDIB 3FJTA 3ZSSA 5AD0A 1KIQB 4NQDD 4JHAL 1XH3B 4F7MA 1AQDA 1A4JB 3O8XC 2H41A 3PGCA 2YPKA 2PW2B 3GIVB 2A6IB 1NSNL 3BGMB 3FONA 5KSAA 3PWJA 4K7PX 2Q7NA 2VDRL 1NJ9A 5E2WH 3VXQB 4Y5YB 1MFAL 5C71A 3BKCH 5KS9B 4IIQA 2XACC 2BSRA 1DJSA 1BX2A 5D1XB 3FFCB 4G6MH 1WICA 1BFOB 2XZQH 1F6AB 5IV2A 4FQ2L 3UTTB 1RJCA 2WUCL 3ZHKA 5K9QG 3SE3C 1JBJA 3KPMB 2R2EA 3G5ZB 3DETC 1BEYH 4CMHC 5E7FA 5EUKA 3EOTH 1RZKH 5I6XC 3GSRA 1G6RH 4R2GD 5KG9A 4GOSA 3T0EA 1UWGH 4FG6C 4KTDH 4LCCC 4X7TA 2AXJA 2E9BA 2B8OT 1OAKL 5A2JH 1X5HA 1YMHA 2DOCA 1T0NB 1ROWA 6CGTA 3VMPA 4JJ5B 3QQ9C 2AGJL 1GC1C 1AIFB 5EORL 1FBIL 4UTBH 1LO5A 1MVFA 1J18A 1I1AD 1QVOA 1TITA 3O2WH 3H9ZA 3HR6A 3UMTA 3RX5A 3REVA 4FTVD 5IKCA 4ZFOA 4LKCB 3UPRA 2V2WA 2DI7A 1JYWA 1LO2L 4JY5H 3P4LA 1UXSB 2FWOB 2G5BA 3LD8B 1N6UA 1KXQE 4R2GB 3CUPA 3FAXA 4QOKE 5JXEC 3H2WA 4U1GC 4U6HA 3ES6A 3IFOA 1QA9A 1I1AC 2XQYG 4UDTA 2FATH 1BFVH 3SGDH 4BA8A 3IDJB 5I0DA 3V6ZA 5FK9A 5HYJB 3QR2A 4YWGH 3IS0X 3NVQA 4F9LA 4QHNB 2P5EA 2BMKB 4FP8H 1EHNA 3LEXA 2VXQL 5LCVL 3EJZD 4ONOA 1JPFB 4JCMA 5GS1A 4BSWA 3QJHB 3R06A 1NGZB 1LO5B 4HIEB 4H20L 4D3CH 4JRYA 3CIQA 3UTSD 3SDYH 1WFOA 3P0GB 4YDJA 3WS6A 5BVJA 5IG7A 4Z0BH 3EYQD 4IDLA 5DMGC 2HN7B 3TO4C 4IS6A 3UTOA 3EDJA 1FJ1A 3U4BH 3OKKA 1KPRA 3U9PL 4H1LG 1BIHA 1LDPL 1C5BL 1IAOA 1K6QH 5F96L 1AC0A 5E9DD 3HR5A 3HE6C 5SWZB 4M8QA 1NGWB 3N9GL 4UI2A 4XCEA 3MNWA 2GUOA 4M43H 1QFUL 5C9JB 2FB4L 1T7VA 4Q6IB 3F12A 3U4AA 1A7PL 2IBZY 1LK2A 1NBVL 3LRSA 5GGRB 1UADC 4ZUTA 3ARBD 4NQUA 2XY1A 4KRNA 3V5DA 3S37X 1S5HB 3GRWL 1WBYA 3ZSTA 5CSBA 1KT2B 5KVFL 1TVBB 3VJ6B 3QO0A 3Q1SH 1TPXC 3BX7C 3CH8A 4DVBB 2DMBA 4U2YA 3GSUA 3T8XA 1JHTA 3RUGE 5ILTL 4IHOA 3QNZB 1NC4B 1EGJL 4JRYB 3VFSB 4JFFB 2GK2A 1HNGA 1QRKA 3K0WA 4HQQL 4EZMA 1DLHA 3WEXB 1ADQH 3P0VL 1NUDA 4KGLA 4M62H 4X7CC 4UU9B 5F93C 4EDXB 3SKMA 4EN3D 1T20A 4PGDA 5IFAH 2VXVL 1U92A 3GSQB 5F1KC 2Y23A 3IU4H 2AK1L 5IOPB 3W11D 4NQCA 4TVSa 3T0EE 5C6PB 4YPJA 1G6VK 3FT4B 1OB1B 3FTGB 1NCAL 5HHOE 3QQ4A 5H37G 4H8WH 4YHIA 2JTDA 3DMMD 5D1ZC 1RQ5A 1UM5H 5EOTA 3HC0A 4NC0B 4LGSB 5HDBF 4LEOB 1HQRB 1Q72H 3O2WL 1O0VA 2VDLH 3H9SB 4WI3A 1BZ7A 2P24A 1AFVL 4WHDA 2ICWB 4FQ2H 2YUXA 3UTTD 1JMXA 1TVBA 2R0KL 3VJ6A 3PHOA 4AEFA 2HFGL 3FO1A 1KPUA 4JO4H 1KNOB 1FGVH 1RUKH 2F19L 2BFVL 4QNPF 1GZQB 1UVQA 2HN7A 5M94B 4RFOH 4YHNA 1ONQA 1S8DB 2Y07H 4L4VB 2VAAB 3U30C 1F58L 3VFSA 5F9JB 1AGFB 5HYJE 5GSRB 2GYSA 4L4TA 5FYKL 4KKNA 1RZJH 1WBZB 2FJFA 4XCEB 4Y4HA 4PGCA 2VUOA 4HF5H 5DD1L 3RVVC 1BECA 4M6NL 1LK3L 3G6DL 4BM7A 1DBJH 2XA3A 4JVUA 2IBBA 4PB0L 1D5BB 4R0LA 5INCA 4CN1A 3MYJB 4LQFL 3TFKC 3C8KB 5DJXA 1MFBH 3NCMA 3QO1B 2VRAA 3KPNB 3BPCA 3VWJC 2Q3ZA 1JWMA 3MGAA 4QHLA 3RUGA 3UX9B 1KYOJ 4R8WL 4N9OB 4UNUA 3B9KB 3NOIA 4PJFF 3SPVA 2FIKA 3P9MA 4MNHB 1QYGL 4MJ6A 3DXAA 1PLGL 1FPTH 5E2TH 3IVKA 3FO1B 4QXGL 5F9AC 4V1DE 2DF3A 1MHEB 1JK8B 3VG0L 4R3SA 3WFZA 5FHAH 1RV6X 5IMMA 4YK4C 5IB1A 5AZEL 1F6AA 5DFVD 4HG4J 1OSPH 4ZPTA 4QHKI 1OB1A 1FH5L 3EYFA 4Q2ZB 4NSKB 2YPLA 1GSMA 4BQ8A 4I8DA 4JM4L 4HH9A 3GO1H 5BV7L 2OR9L 1MWAB 5CEXA 5D1QD 1UYWH 3TYGH 4QRRA 4NC1C 2Y9RT 3PHSA 4OCRH 2NY3C 3EFDL 4P9HH 4WEMB 4NP4L 3BMWA 3I50L 5FUCE 1WBXA 1MCIA 1FIEA 1JV5A 1V3KA 1JNHB 2YC1A 5C0JB 1DVFD 4LVNB 4UOJA 4ZSOE 4NN7B 2GK0A 2AEQL 2O5ZL 2FHCA 5CUSH 2QV2A 1TZIB 4ZFGL 4JFOB 4UTAL 2CDEB 1A0QH 5FA4B 3MLTA 1BD2E 4HMEA 1XGQB 1P7QD 4LVHC 2EYRA 2OXGA 5C0AB 3TPUB 5F9WB 3CLEH 1MJ8H 1QBLL 2J12B 2J5LC 3R1GL 1CR9H 5T3ZE 5HVWA 2RIKA 3KLHD 1MCPL 4E5XB 1LILA 2WBJC 1OAXL 1FE8L 5DGQA 3O4OB 3D0VA 2E7HA 4I0PB 2W07A 3VWKD 1MCQA 3I3BA 3MBEA 5ESVA 1KCSH 1L7IL 2BZDA 4OBRA 3ESUF 1BVLA 3ZTJH 4FFWC 4HS6B 5E2WL 1MQ8A 5I1AA 1U8MB 3A6BH 5CZVL 4NDMB 2NXZB 3RWEB 1U3HB 4PJBE 1IFHL 3L7EB 1FFOB 4UINH 5ESQA 3BN9D 1EO8L 5I9QC 3P9MB 4MNHA 5SWQB 5J13C 4LNRA 3DJ9A 1NMAH 4NGHH 1PBYA 3IJSB 1PG7W 3M1BB 4V1DA 2EDQA 3VRIB 3JV6A 3EZ8A 3A67H 1GYAA 3L95B 4HT1H 4ZFGH 1I4FA 3E6HA 4X7FC 5L9DL 4NWUL 1WV7T 2H32B 5C0CD 3NACH 3QPXL 1U91A 2H1PH 3C6SA 2VDOH 3ILQD 1SEQH 3TO4D 1CGSH 1ZGLA 3DUSA 3CX5J 1K8DA 2KQNA 3QFJD 1G9NL 3UXFA 1A14H 3PGFH 3JSSA 4HGWA 4PJ8A 4PJIF 1L9MA 2P46B 4K8RH 2I60H 4IEFB 3VFMB 3H3BC 3ULVE 2J4WL 1PD6A 1JZ4A 1B88A 3FOLB 3WIHH 1LD9B 3O11A 1OLZA 3F12B 4KWUA 3VXMB 3AUVA 1OF2B 2HMID 4C59B 2OJZL 4PG9B 5FGBA 3TN0A 2I5YL 5CEZE 3ULUF 3I6KB 4Y5XB 3QWRD 1DVFA 3QH3A 5ESQB 5F72S 4FQXC 3LEYL 3C60B 2DDQH 4HIXL 3B8SA 4MHHG 5JXEA 1CLZL 4QTIH 1A4KA 4G9FA 3EOYG 2V7HB 4HFWB 5DRZA 2NW3B 1BAFL 1FN4B 5KANI 4XVTL 5J9PA 1I4FB 4QRRD 1OVZA 1S9VA 2VDPH 1B0RA 4MAYB 3F65A 1PAMA 4G8GB 1KTDA 2ZOKA 3PXHA 43CAB 8FABB 3GSNB 3MGOA 4EXPX 1M6OB 2CRMA 2FJGB 5SX4I 4YHPA 4LLMB 2QHRH 3MA9H 3CVIL 5HGAA 3ULUE 4AIXA 5F44A 2X4NB 5DJ8B 5JMOC 4NYLA 3UBXA 3OAYH 4ESKA 1U8MA 4NWUH 3QEQA 4URTB 4E42B 2HJFA 2YXFA 2AVGA 2OL3L 2VXUH 4PJCA 3QCVH 4PJ5E 5I1IL 4MAUH 2WINA 5IMOA 3SO5A 2BNQA 5LXGL 1QBMH 1CDJA 3UO1L 3IJSA 2AJYH 3FQTB 2V6HA 1UKQA 2VLJE 1OQXA 2EYSB 5C2BH 4RFNB 5HPMB 5B38B 4WWKD 3SCMA 3CFBA 4Z6AT 2NY1B 3MQIA 2X10A 4NN6B 5HYIA 4XCFL 3G9AB 1BD2A 3G04A 1J8KA 4HFUL 3LH2H 3GMLB 1T20B 4PGDB 4LPCA 3MPCA 5TE6L 4F9LC 3T3ME 3KYAA 3AS1A 2ZG3A 1TNNA 3G5XA 5F9JA 2V5RA 4PJDF 5LGHH 2EXWC 1H5BC 1GZPA 1HZHL 2D0HA 5EFIA 2PR4H 1YYLH 1N2RB 3RVXD 2D7NA 2VDKH 4UBDC 1DQQA 4L8BB 3O2VH 3QG6A 1EEQA 5A40E 3RWDA 2X05A 3DVIA 5E5RB 2ITDB 3MJ8A 5I73B 2R15A 1BZ7B 4BSVA 2BY2A 1OWRM 5D70L 2UVEA 1CD1B 2ATKB 4WTZG 3MACL 5BMFH 3SDXB 4ODXB 5E8EA 5CSGA 3MNZB 3MLWL 4CMMA 1Y6MR 4JQIL 5I1HH 1F8TL 2AQ2A 5C9KA 3CNKA 1FNLA 4DEPC 1Q9OA 1XCTB 3CZFB 1UH4A 2I24N 4M48H 4NZRL 4QF1A 2QQKH 2ICES 4G80B 5GS2H 2Q20A 3E8UL 4ZOBA 4PRIE 2J8UE 5HSFA 2N7AA 2W38A 4OSUL 5EU6B 1A7RH 4CJ0A 5JXAL 2YA1A 3CC5A 4PRPD 4Y2DA 2P5WE 4YBLC 1I9EA 5GRVK 2FNBA 4U1JB 1HHGB 1X5JA 1EAPA 1FL3B 1PZ5A 5BVPH 1S7SA 5F3HA 4L1HA 5J1AB 3Q1SL 3QQ3B 5JIPA 3SO3B 3TA3C 4EN3A 4YDIH 2R69L 3KJ4B 1XAUA 4HKBB 5F1OB 5LVEA 3VW3H 3UPAA 2XZAH 2OZ4A 3TIDB 4TNVF 4MJ5A 3HB3C 5AUMB 3GHEL 3MV9E 4RBPK 5I1EH 4J12A 1NDMB 3LAFA 5DFWH 1A5FH 4LLQB 4MJIB 4ZDHB 2CUMA 1JPTH 3TPKA 4L8SB 4N0UE 4S1DD 3NGBC 5IEHA 3C2SA 1EEZB 3O41A 1KB9J 1IARB 3ARTA 1FYHB 2W0KA 4EQ3A 1HSAB 1CXKA 1T22A 3FB6A 2EDDA 5CCKH 1DBJL 2MJWA 3Q6GH 1EDQA 3MMEB 5EBWA 4D3CL 1IGMH 3ARBA 4UB0H 4Y1AB 2A73A 3QUZA 4N8VB 1TENA 4N0YH 3ZYJA 1A6PA 3JUYA 3L7FA 4NKOA