5DS1A

Core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
92
Chain Sequence
b'STPADVKEHPNSYVFMVDMPGVKSGDIKVQVEDENVLLISGERKREEKEGVKYLKMERRIGKLMRKFVLPENANIEAISAISQDGVLTVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17.1 kDa class II heat shock protein
molecule tags Chaperone
source organism Pisum sativum
publication title Evolution of oligomeric incompatibility between paralogues is driven by modification of transient states
rcsb
total genus 8
structure length 92
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ds1A00
3GLAA 3AACA 4YE0A 5LUMA 1SHSA 3QORA 4I88A 4ZJ9A 4YLCA 3VQMA 3L1FA 3GUFA 4JUSA 3Q9PA 4M5SA 4YLBA 3AABA 3IGFA 1WFIA 3QORC 4MJHA 2MNWA 2WJ7A 4RZKA 4YL9A 3W1ZA 2CR0A 3J07A 3VQLA 1X5MA 2JKIS 4M5TA 2XCMC 1RL1A 1GMEA 2K8QA 2N0KA 2Y1YA 3GT6A 2N3JA 3QORD 2O30A 3QORB 2BOLA 4PCKA 2Y1ZA 2Y22A 4JUTA 4FEIA 5DS1A 2WJ5A 2CG9X 4YDZA 1EJFA 3Q9QA 3EUDA 4ELDA 3L1EA 1WH0A 2RH0A 1WGVA 2KLRA 2KMWA 3N3EA 3L1GA 5DS2A 4PBDA
chains in the Genus database with same CATH superfamily
3G6DH 1CWVA 1OSYA 4LIQL 5C9JB 2BSEA 4X9FA 1G9ML 4C4UA 2VERA 1F45A 1N7MH 4WFFD 3FZUD 1MHEB 5B4MD 2VDQL 3MRMB 3OAZH 3SGKC 1E50A 3EHBC 1FH5L 2PPCA 5IBTL 1NANI 2C3WA 3VU2A 1AQ8A 3V8OA 1AGBA 3D3VE 3OAUH 4NX0A 12E8H 4PRNB 5IMKA 4ZG1A 4I1PA 1G6VK 3APCA 1P5UB 3KGUA 5BRPA 1UD6A 4FNUA 1NBVH 4RMVA 3HN3A 3TN0B 3F7PC 2YPKB 3MJ9L 4MRCA 1P1VA 4TM9A 5D8JL 1UC6A 4PS4H 1F41A 3O4LE 4PJEA 4AC2A 1BM7A 3DI3B 4ODVH 4FMKA 4OZFB 5F7UA 2E75C 1KLUB 5BO1L 3IDXH 1IGMH 4MNGA 2ZZUT 4RGNE 4LVNC 4Y4HC 5KUKA 1ITCA 1A8ZA 4Y16C 2VL5B 3KYAA 3O11B 1CD1A 3BESR 4ZW7A 2CRMA 1GIGH 2B0SH 4XMKL 3WKQA 4PR5B 3A6BL 1SVBA 4PRDA 4GQRA 1H3WM 2BDNL 1X7TA 2HFGH 1KXTB 1NCJA 1X5YA 3KM1A 1VGKB 4J7RA 5H37H 2Q3AA 5G4NA 1K5NB 2F5BH 4OR1A 3QQ9C 3MOBH 5SWSD 1Z9SA 5F96L 4ERSH 2WJ7A 3ARQA 4ETQA 2NTFA 3KHOA 4AIZA 2JWYA 1BQLL 1QI3A 3QUKB 2B5IC 1MCJA 1RHHB 4QWWC 5IFJA 1G87A 2VDLB 2Y9RT 3DXAD 2G0LA 5TDPA 1I9RL 1J9RA 3L1OL 4LE8A 2A6KB 4NIYE 1S7RA 3BQVA 5DJAB 1CVRA 4DOHE 4ABWA 1WBYB 4R8WL 2B39A 4CUCA 5MENA 1U8CA 1Y7VA 1OGTB 5I8KL 3SCMB 4ZUSB 3CV5A 1V7NH 4RFNB 4ACTA 3G08A 1H3UA 3U9WA 3W56A 4Z3IA 3OKYA 3D39B 4YBQD 3MV8D 5HHVH 5IOKA 1T1XB 2PLTA 5GS1B 1DVFD 3F00A 2YPLA 3GO1L 3QNZA 3DPDA 3SDDB 2XA8L 3WNLA 3WS3B 4DW2H 4XCEB 4CU6A 2EKSA 3MRBB 4G7VH 3OZ9H 5F9DC 3RVWC 2CKBH 4I77L 1F5WA 3Q2CA 3CFCL 1WBYA 2R0WL 1KY7A 1S3KL 2XHNA 4RMSA 3RU8L 3GIVB 3KPLB 2ZNXA 4PRAA 4PP2A 4D0CA 3FSVA 4TQHA 2IBZY 1EGJL 3BFWA 1F58H 2NNAA 4OCRH 1ONQA 1WUNT 3TPUB 1A2YA 3CFQA 1PDKA 3FO9B 4P2YA 4A2MA 4V2CB 3P9LB 4X6CB 5CILL 5CWSB 3O4LA 4FI7A 3MTRA 3G6JB 4KTDL 5C2BL 1K4CA 5AW4B 2FR4A 4P5KA 3VFPB 4NO5A 3RWGB 1DQIA 3ZKQD 4BUGA 5KBPA 2AJVL 5DO2C 3S6CA 3QXDB 4B50A 3NTCL 1MWAB 2CLVA 2HRGA 2IH3B 1QYGL 3MR9A 4UBDC 3UBXI 3FUDA 3FQ4A 4HS3B 1OD7A 1OW0C 2APBA 1JDAA 2ZOOA 2FTAA 2P48B 3UAEA 3FSZA 1OAYL 1LP9F 3VXPA 1HYSC 3SBPA 2H32B 3GLZA 3KLQA 4JFQB 3S4SA 1RIHH 3GMOA 3VX0A 4NCDA 3A23A 2X4TB 5EEWA 3NJVA 1JXKA 2QFRA 4OT1H 4V1DD 2YAHA 3ECBB 1MHHB 1RZJH 4KU1A 3MRCB 3VCLB 1N64H 4R97C 4ZUUB 2HVKB 2IDSA 2NUTB 4HS3A 4AYID 2CO6B 3SBRA 2IJ0C 1DEEA 3LN4A 1BF5A 1FNFA 2CO2A 5KBNC 3UTTE 4KTEH 5EPMA 2WPGA 1WBXA 5ADOH 3KL5A 1A7QL 1AACA 3BX7C 3PWPE 5ESQB 3G6DL 4JUSA 1VA9A 2WBJB 5DUJA 3ZDYB 3AROA 4OD2B 3ZIYA 1QOKA 4DZBB 4ES8A 1LEIB 1Y07A 3SE3C 5I1JH 2XPGB 5HHOD 2FO8A 3VGBA 3VI4E 2ZWNA 2HPOA 4FFYH 5I0DA 4KY2A 2BJMH 4IRJB 2H2PD 1FZOB 2X6UA 2FD6L 1T1ZB 2PW1B 4ZDHA 3MV9B 2D7PA 4Z95H 5AOMA 3WNPA 5DFTA 2AV1A 1JNHA 4RVBA 1L6XA 2OMXA 4JN1L 2WXGA 3CWGA 4F7CA 3IJHA 4LEXL 3PAVA 1YEGH 4D7BA 3H9HB 4N1CA 2A9BA 3V6FA 3K4AA 1AD9A 2AXGB 1A6AB 3WXWL 4Y2LA 2NXZD 3T2NH 2ATPA 4OY9A 5LQBH 1U8PA 1XGQB 4P4RA 1G9NL 5EBLB 3VACA 4KC3B 4AEHH 3I9AA 3R0NA 4JDZB 2X4NB 1OGAD 2RACA 2OMXB 3C6SB 3HG1D 4GSQA 1ZIAA 1NBQA 3ZDZF 1IC5L 1Z9NA 3VXUE 5IQ9A 5I1GL 5KSUA 1IVLA 3V6OC 4Y88A 3N41B 1TFHA 2OK0H 3A6BH 3GB7B 1M1XB 3HUJF 3L4ZA 5IMLB 4H5SA 3BQUD 2FZ3B 4IQHA 3FMGH 1T5WA 1ZSHA 4KPHH 5DHVH 4YN3A 1DQQB 1RSFA 1CTMA 3RRQA 3DRTB 5E6IC 2D3LA 4WHDA 4NKMB 2O61A 4KJWC 1BQRA 1XB3A 2DQFB 4P4RB 3WIHL 3L4CA 3DOSA 1GGCL 3JSSA 3VFUA 4PRBA 3U0PA 1CBVH 2ARWA 2H6PA 1F90L 2A73B 1JDDA 2G9HA 3ECVA 4P4KC 4L4TA 15C8H 4Y9FA 3WOVA 4FXGC 5IMMA 1DQTA 5C0GB 5IQ9B 2E56A 3BJLA 4FCHA 1PW3A 4TTGA 5D1QC 3KYKL 1YNKL 4HSAC 5DS1A 1A1MB 1NFAA 3MRRA 3ULSB 1BJ1J 3Q6GH 3TOPA 3PHQA 1W8EA 2X6MA 3CSFA 2X40A 4U6VH 5DA4A 3RJOA 1TQWA 1LNUA 4QRBA 1CG9B 2YMTA 5F88A 1JN6B 1U9KA 3ZK0A 4OZIB 1JYNA 4QHLA 2JH2A 1M7IB 1YMMD 2D2CC 4ZQTA 2G60H 1OCZB 5DZ9A 3QDGA 4I9XA 3H42H 4G9DA 2JF1A 2YQ2A 5GZOA 3QQ9D 3DBSA 5EU4A 1RK0B 3I6GA 1DANT 3IDIA 3OJ2C 2X5PA 1I7UB 1CG9A 4JFHE 1F42A 1PZBA 2KKQA 2ZUXA 3DOHA 5CJXA 3V4PL 3DX1A 2PXYB 3MGOA 3QZOA 5LKNA 3CZUB 3ILEA 3AADB 6TAAA 1A6ZA 1UTDA 4YXLL 2WWMC 2P5WB 2R0KH 2CR3A 4L18A 1P9MA 3S35X 2O93L 5ISZE 2J1ZA 2Y0SA 1DVUA 1A47A 1E6JH 3QPQD 5HDRA 2RALA 1QUNA 5C0BE 3MLZL 2GJ6A 2D4FA 4F57L 5EBMB 2XXFA 1OT2A 4ICWA 1G84A 4MAYD 2Y07H 2PW2A 3L9EA 5FKAA 3KPLA 4AM0B 4TLUA 1S6NA 4O58H 3APFA 3L1EA 1KTKE 1AQDB 5LGJB 2VABB 3WN5B 3G5YB 1ZEAH 1RZ7L 3EDFA 3OPZH 4RNRB 3MKGA 1AKPA 4HDIB 4P5TB 4FTVA 4DTGH 2R4RL 1GJIA 5C0AD 3O4LB 3PWJB 4YSSA 4PJXB 3G6JA 3JVGC 2BVYA 1N7ML 4IU2A 1ZV2A 4ZX3A 1VADA 3EYQD 3SCMC 2XXMB 1BOGA 1JFHA 2RTTA 4JFFA 4X80L 3KPTA 3ARDB 4FADA 3RWEA 2HT4C 4QT5B 1R3HB 3SE4C 1S7VA 1UUSA 1KXVA 2X53A 3FFDB 3QI9D 4AITA 2LOEA 1YEIH 4AVHA 2XKNB 3ZT5A 1I7RA 4HCIA 2BP0B 1J5DA 1I85C 3OHMB 4IS6B 2EUWA 2BCKB 4QXTA 2OJZH 1EBPA 4G72B 4Z7UF 4KKQA 1JD7A 5F6HI 4KGJA 4LCWD 2GSGA 4YWGL 5HGDA 4X42A 1MRCL 1XXDC 1TLKA 4X4YA 2EH8L 5H94A 2FYVA 5SWQA 2HVKA 2BMKA 3GYRA 4XCYA 5E2UH 1II4E 1BVLB 3I6KB 2ADJB 3CLFH 4BK5C 3UP1A 1XGRA 1RUML 2JFCA 4L3EE 4A7GF 4G1EA 3VI4A 2XSKA 2I60H 3BEWA 2R0ZH 1BPLB 5E2WH 1WWWX 2VWEC 3FQNB 2NYKA 1NIBA 1EAJA 4MCMA 3ZQWA 3K4ZA 4YXHH 1SOXA 3CDCA 3G9AB 1D2OA 2C5DC 1S7XA 2E6PA 4FG4A 4NKOB 1P1ZB 1H8OA 1OAUH 2I26N 4LT7A 3TEWA 3CN2A 4JO2L 1OARL 3L1OH 4HCRL 4OD3L 3EH3B 5I1GH 4DP4X 3AS3A 3MO1A 4UTAA 3UTTA 5D93C 3ZOAA 3FUFA 2RD0A 1CLZL 1IFGA 4NRXA 3WENA 4Z7QB 3NMEA 4QHMB 2HTKC 4OZGF 1OP3K 2D0HA 2E3VA 4HPOL 3NFPB 3Q6FB 5BRQA 3HRZA 5SV4A 1QHOA 1EV2E 1AMYA 2NPLX 4OZGA 4CVZA 3UTPD 3ATAA 2GI0A 2GPZA 1HHGB 1UZGA 4LARL 5CN1A 1JZIA 4WFFE 5F97E 5FC9A 5C0FB 2HG5B 2NXYD 1KG0A 4L4VB 4APQA 1CGSL 2XVGA 3V7AG 4PJHA 4BE6A 3ZMEA 1AQKL 3D3VA 2WIIB 1JPSL 1CXHA 1T20B 4E41A 4WWNA 4AVKA 1YEHL 5IB4B 5MEPA 1FBIL 3QHTC 1ND0A 3O45B 3QNFA 4KDTC 5F3FA 3TTYA 3UBXG 3FSWA 5F93C 3S98A 1TT6A 1OTUC 1AGFA 1M56B 5DMKA 4OB5H 4PIRF 5AB9A 4YSAA 4CVXB 4MKMA 2N1TE 3ETBF 5HI3D 3MRJA 1VSCA 2HTLD 5HYSB 1QEXA 4RBPH 3VD5A 4R4FH 3N42F 3HZKA 1NFDF 3SDCD 3SKNB 5CIPB 4WWKC 4AXWB 5E23A 2WN3A 4M1GH 5E00B 1A6PA 4LLVA 1V7MH 4UIKH 3EF4A 4LPWA 2V5SA 3OKKB 1I8KA 1WS7A 2HKHL 3RDJA 2CIKB 3J07A 4S1RH 4ES9A 3TFKC 3FPXA 1C12B 5FFOA 2XZAH 4E41D 3FAWA 2XV2A 2O6CA 3LRLA 5CFAA 2YPKA 3FQ1A 3IETA 4K3EL 3F7VB 3W0WD 3P77B 3DC0A 5JW4R 2E74C 2WKOF 3GS7A 4H25A 3T4YA 3ESNA 5IB3B 3S8FB 2KDYA 5SWSB 4KTEL 4L29B 1K3IA 1SMDA 1X7SA 4MLSA 4G70B 1N26A 5I8KH 5CCHE 5HYEA 4I88A 5AOLA 4FHJA 35C8H 3FOMA 3FT2B 1KIQB 3BT2L 1NGXB 1U95B 1PPIA 2QQNL 3MAWA 4Y4KD 5C7XL 1S5IL 2AEIT 1BWWA 3QAQA 4OCYH 3FUNA 2DOCA 4G3YH 4G7VL 4LCYB 4Q8BA 2SEBB 1KXTA 1A3RL 3A6CL 2VRKA 2UVEA 3BN9C 3NZHL 3TBSB 4F2ME 2RMNA 4NM8L 1MJ8L 4RAVA 1WD9A 3AWEA 3A47A 4JN1H 4NQDD 2EDOA 3WD5H 3BFQG 4OAWB 3PGCA 5I6MA 1JGIA 1R5WA 1RLWA 2XY2A 3DX7B 2X6VA 1KULA 1R5IB 3SJVB 4MB5A 1YQVH 3CXFA 1BIIB 3K2KA 3R06B 3T0DA 1MUJA 3G5XB 4MA1B 1N6QL 1WFJA 2ED6A 2OTWA 3ZLQC 3IKKA 1B4TA 3LOWA 5F9WB 5ICUA 3HMXH 2IAND 1J0JA 4XVTH 1EVUA 3UADA 3CIQA 1GZPB 3TIDB 3SKUD 3TZVA 3HZYB 5FO9A 4LSVL 4LLWB 1R5WB 3SDAC 4DKFL 4BZYA 3RG1C 2QELA 5KVGL 4I0PB 3IFPB 1YUHB 2VMEA 5IHHA 3MDJA 3B6SA 2YWYA 4XI5C 5K9JL 1E6OH 4Q6IB 3VXQB 1AIFB 3IU4L 4Q4EA 2XZQL 1GYAA 4PJAB 3V6BR 4EIZC 1LGVA 1PD6A 4L8SB 1RIHL 3W81A 3B5HA 3ZZQA 4OT1L 1CL7I 5AYQA 2DICA 2YSSA 5SX4H 1BQSA 1SNRA 2R56L 3VRLF 5CJXC 1QFWI 1GPOL 4IDLA 2WYHA 2J6WA 4R90H 5C8JA 2Z1KA 5KSVA 1A4JA 1TTBA 3D0AA 5JZ7C 2R29L 4Q6IA 4H8WL 5D7IF 4UTAH 2B0SL 4XMKH 2JIXB 1U91A 5AKRA 2MPAH 2IPUG 5IZ7A 3I2CL 3MRLA 4JHWH 1VKXA 2XT1B 1JZHA 3NSDA 4IHOA 2HLEB 4OGXH 5T1LB 3ZE2F 1QQDB 5E4IA 4W4OA 2V3DA 3FRUB 3MJ7A 4HX1A 1TDQA 3T65B 2WLJA 4C56A 3AREC 1KT2A 2EXWC 4IRSC 2AAVA 5FO7A 1KZYA 3QXDA 3GRWL 1A7RH 4P23D 1ZVSB 3BKMH 3FB6A 4WW2A 5AOKA 3MLXL 1FN4B 1NBZB 1XH3A 1NDMB 3FO2B 1XH0A 4LLQA 2WJ5A 3BGMB 3KPRB 3QEUA 5IB2B 2V8MA 5I5RA 1MWAH 2FEDD 3L5JA 5E99L 3M07A 4L3EA 2ICWB 4J27A 1K5NA 5JA9A 4LGPB 1L7TH 5D2NA 1XB6A 3QUXD 1AANA 1HN1A 3BKYL 4OW6A 3VO0A 2HUHA 5DZVA 5EFIB 1YMME 2H2PC 4XPHH 4NQXB 2Y1AA 3QCUH 2ZCHH 3IFNL 3VXMD 2G9KA 4ZPTB 1ACCA 3ARFD 4G9FE 5ITBL 3MXVH 5ALBH 2VLKA 2Q8BH 2G5BA 4JFHD 4GAYB 5KYWA 5DEFA 3TCLA 1F4XH 2J5LB 4EI5C 5E5LA 4MCYB 4O4YL 5B39A 5HPMB 4Q9QH 4EN2A 1IILE 2AK1H 4L9DA 3DGGB 1CLYL 5LUMA 5DWPA 2FJUB 5AKTA 1HWHB 4P9HC 3PXHA 5CLZA 4ZXBC 3RBSA 3D5OF 3IFOA 2E76C 3QIBA 3BPOC 4ZFQA 1R3KA 4BZ1H 5GJTL 1BD2D 4CVXA 4CGTA 1F90H 1FRGL 1DSFL 2PW1A 3BP5B 1I7UA 2WNXA 3PF2A 4ZSOB 2WB7A 1ADQL 3BP7A 2FX8H 2EIJB 5E6YA 5DFVD 5B38B 3TZVD 1DVZA 4GUCA 2Y7LA 3DA0A 3VXUD 5E00A 3QA3A 2E5EA 2WLNA 4AQOA 2UY6B 3CBJB 3EJTA 4OJCA 5MHSE 4QMEA 4XO4A 5KAQF 3DGDA 3FSAA 4FNTA 4WSKA 5K9QI 4DGIH 5EU5B 4IJ3B 2VISB 3I6LD 4R5TA 6PCYA 2YN3A 3M7OA 3V79C 2NNXA 1JGUL 2DS4A 1W0WB 3PP3K 3L3KB 1Z5LB 4KRNA 5E9DE 2JB5L 1IEBA 2P47B 1QMUA 1U2YA 4DPCX 3T2PA 4PGZA 4MJIA 3UAJC 2FQFA 1QFOA 2OP4L 1MCCA 4Y5XA 4M5YL 1NIEA 1VPOL 3R7RA 3IDGA 2Q1EA 1OP5H 2C3VA 2C3GA 3S88H 3DRQA 2BZDA 2P24A 3VE0A 5FHBH 1BXVA 1XD1A 5L4IA 3U2SA 3WI9A 2A6IA 2ZAIA 4Q7DA 4QKXB 5A43C 1WAAF 1QRKA 2FO4A 5TTRA 1E6JL 4GJTB 2WZPD 5KSAC 4NNYB 5I6KA 2XIDA 1OM3L 5T3ZE 1VFBA 1UB5A 4FLOA 3P11L 4WU5A 5CGYD 5JORB 1HVXA 4OF0A 2P7TA 1MRDH 1EWHA 3CFBB 1T0NB 1ZK5A 2RB8A 1QW9A 2XWBB 3PIQB 4AQEB 1AR1D 4LPTA 2YAOA 3Q8AA 4MMZC 2WWKO 4F15B 2IAAC 1PG7H 2FGWH 4XC1H 4XO9A 3CDFA 5EU4B 1YEEH 2R39A 5GRJH 4QRRB 1RLBA 4P5RA 2COVD 2CHZA 4EKXA 5IEKB 3NCBB 4U6YB 5FOJA 4FXGB 4FQLH 3QJVB 1U3HB 1G9NH 2UX7A 2C4XA 3EO0A 4OLUL 5E1IA 3U83A 4Z3FA 3SN6N 5TD4A 4XO8A 1UCBL 1A02N 1S8DB 1JF5A 4UTAL 3V5DA 4JO1H 4M03A 4KKCD 2NNCA 4FNLH 3U7AA 2R1WB 5FYJL 3SDAD 2OTUB 1AR1C 1PAMA 4X5QA 2H1PL 3BRGC 3MVSA 1S7XB 4FL4B 4B7LA 4ELKA 3WEXB 1OB1B 2ADIB 4HJGB 5DZOA 4KV5E 4POUB 5FKAB 5IQNA 1U4FA 1J10A 2NTSP 2Q76A 1TYEB 1T4WA 1W72B 5IUCA 3KYKH 2R0WH 4P06A 5LLIC 2IQ9L 1SDYA 3HG4A 4YSUA 4LCUB 2ENSA 2QLYA 3FUMA 3GXNA 4HQQH 3AUVA 4BE5A 1AQMA 1KB5B 3IDJB 3NABL 1ANUA 3G3LA 4NKMA 1MVFA 5DUBB 2WQVA 4I0PC 1SUHA 3RWJB 3SE9H 4AZ8B 3S5YA 4LLYB 1JWUA 4M7JH 1C08B 3QULB 2W91A 4GRMA 4UM9A 4L2LA 4H2AA 4JL2A 1UJ3B 2PR4H 4Y2OA 5J0BA 1W80A 5ALCH 1IE4A 1IEAB 1NICA 2L0DA 2EXWD 3BUDA 3LDBB 4PD4J 3HE6A 4KFMA 2BCKA 2ZUTA 4XWGH 1UXSA 4PJAE 5L4FA 4JQXC 4KHXL 1CE6A 1J8HB 3S5ZA 3X2QB 4PW9A 4G42B 4U3HA 5AAWA 4WI6A 4ATWA 1ZE3C 4LLYA 1CLZH 4GRWF 2E8ZA 2E7CA 1BOYA 1WCQA 2Y6SC 3BVVA 1D6EA 4UANA 4WTZA 5D96B 2XJKA 5H94B 1UJ3A 4PJGE 1IC0A 3KLHC 1OLLA 2GJZA 5GGQL 1OE1A 4ZUTA 3VD9A 1FRGH 2IDFA 3U6RA 3B9KB 2X05A 4G3YL 4E5XB 2GUOB 1OK0A 4HEME 4Y2DA 3ZTDC 4U1SB 4D9QE 3GI8H 3KPPB 3R4DA 1T6VN 2DEYX 3OKLB 3NJIA 3FZUC 2DJUA 3H9YA 4DEWA 4KZCA 4AGOA 4A63A 5HHXH 4N1HB 1UXWA 1ES0A 2CUAA 2ATAA 5F6IC 3LIZL 5GS0D 4PJHE 4Q14A 2BWIA 4YDLC 1IKNA 3OPZL 1P1ZA 3VG0L 2H2SD 3L5WA 2NY7L 4IDJL 4NZ8A 4WO4A 1QWUA 4A7UA 3J8F7 1MCQA 1TSRA 1OD9A 4P2OB 4ZUVB 1AQDA 2E4FA 1E5UI 3WTUA 1HK6A 2YEQA 1PKQE 2NY2C 5KVEE 1Z3RA 2J8OA 3RWHA 4MX7A 1QWHA 1TZAA 4M7ZB 2HRHA 3UTQA 2C26A 4UNUA 3BVNB 5BQDA 5FHBL 4WU7A 2XKUA 2CHWA 1LWRA 3EYFA 4MJIE 5TF1H 4EDWL 4IU2B 5J1AA 3UTSA 4JNXA 2PWHA 2X9WA 4DESA 3C8DA 3D69B 3OF6A 1PNDA 1PYWB 4W9HC 1MCSA 2JJSA 3FH8A 4X6EB 2CG9X 2DJSA 3NTCH 2JVUA 3LEVL 1TQCC 25C8H 4CSPA 2NY0B 5T33H 5K1VA 3M8OL 4OGXL 1ZLWH 5C08D 4NYLA 4BA0A 3COOA 4HZ1A 7PAZA 3RWCB 3KE0A 3MREB 1RUQH 4HW6A 3K3QA 4I4WA 2DLHA 4LOUC 3T71A 3ULUF 1CF8H 3S35H 3CZSA 3NN8A 4EUPB 4PY7B 2AI0H 4GS7C 4UNTA 4JRYE 5JLZB 3ZR5A 2XTLA 1HCVA 2KQMA 4JFDE 4N8VG 3Q6GL 1NCOA 4OD3H 1TVHA 3UACA 2J71A 3OLEA 4X4MA 1SJEB 3FTUA 1KIRA 1YAZA 5TE4H 1RVFL 2LR4A 1FZJA 2R59A 5CD5D 5IW3A 5SWZD 1YQVL 4K8RD 4KUCF 4CN4A 2DYPA 4HUMB 2JELH 2NZ1A 1ZPUA 3W3BA 2BHUA 1IIIA 4NDMA 4IEFA 5IFHH 1SEQL 3L3DB 5ACZA 1CCZA 1D6VH 4P9HH 1QBMH 2AK4E 4H0LC 1MF2L 4XVTL 3L7FA 2Q8BL 5GSRB 4DEUA 2IBBA 1JZ5A 4UQ3A 4ZQKB 3DO3A 1UD4A 4QJ3B 1Q9WB 5H4YA 3VXMB 3GGWA 5KTEL 5KVGH 1X44A 1DBBH 4P04A 3LH2L 4JAMB 1NEZB 1FNHA 4P99A 4CNIA 3AM8A 1HESA 4JPVL 4DGWC 3S4SB 3ULVC 2X1XR 2LVCA 1P7BA 5CGTA 1PKQA 4A6YL 1IT9L 1CC3A 1RUKL 5J3HC 2HT2D 4YSEA 1CF1A 4I3GA 3BN3B 1MJUL 5F9OH 3JT0A 4EO5A 2B20A 4JRXD 3WXWH 4R84A 1PJ9A 1QRNB 3LZPA 4WUKH 2XC8A 2JKJA 4PTUB 4POZD 5I6XC 3D25B 1ZTXE 3K7UA 4YDJA 1EZUA 1P4IH 3VB9A 3H9HA 4MA8H 4H8WH 1FSKB 1E30A 1IGFH 1SMAA 2AEOA 1LK2A 1LILA 4HSQA 4FQQB 1B90A 4TUUA 4B5EA 4XXWC 1V05A 3NCMA 4G8AC 4A68A 2OLDA 3O2WH 4PM1A 5I16B 1GL4B 3ULAB 1J5HA 2Y6TE 4PG2A 4P3CH 4Y5YB 5E2VH 1MFBL 1U2HA 3AXHA 3KL3A 4WHYH 3ATBA 3GMNB 15C8L 1U42A 3H0TA 1A5FL 1F4WL 2ICEB 1V10A 2WVVA 1RMFH 3O2DH 2O61B 3SDXB 4F7CB 5I6LA 3TNMB 4HJJL 4MMYB 1IKNC 3AUWB 3FQWA 1EX0A 3FT0A 3LKNB 3U7WL 3VSTA 2OW7A 5GRYA 5MI0C 3MROB 2EIMB 1AYOA 4B9GA 4LEEA 3BKYH 4OQTH 2PTVA 5D6CB 2R1YA 3TH4T 2A6KA 5ISZD 4P57A 4X5WB 5I0YA 2ZX8A 5LG6A 4YZFF 3NZSA 2Q86B 3SGJC 1Q72L 3NFSL 4XB7A 2L3BA 3EDKA 3U1QA 5KJRL 3EUUA 4O51B 1XGUA 2CR6A 4PJEF 1ZRUA 1VCBC 4UT6L 3ZL1A 5I76B 4PJIB 3UBXB 1FIEA 3L95B 1FG9C 1RUAL 4MNHA 4MNQA 3V4PA 3ZZLA 3KL0A 4U0QB 2HRPL 1RUMH 5A6IA 3BZFA 1P5UA 2VLMD 5F7BA 1I4FB 3TO2B 4XH2B 1TG8A 2VLKD 1MSPA 4RAUB 4ZX6A 2X0UA 3NEEA 3CMOH 3NACL 2UZYB 2R1XA 4Y7OC 1NBYA 5E2WL 4LCCC 4PRHB 2Z31B 2YLKA 3HBGA 2NZIA 2Y72A 5DURD 5I1DA 1AXTH 2PF6A 2WHVA 3F7RA 2FNBA 3QUMB 4CSTA 1WYJA 5IM7B 1ADQH 2LV4A 3B2UD 3VH8G 4UU9B 5E8NA 4Y1AD 5HD8D 4MNGB 5JR1H 2FJHA 3QQNA 3PHAA 3BUIA 4J28A 3LEVH 1BBDL 3IDMA 3D18A 5EIQA 2B5IB 4OFQA 5AVXB 3B1UA 5LCVL 1N10A 1X9LA 1ZHKA 3C6LB 4FFZA 3VVWA 5F9JB 2XZQH 2FQDA 4LLUA 4K7FA 1PAZA 4U1KB 3GBNH 1UB5B 4U1IB 3ASWA 3VTMA 3GI9L 4N2LA 4GINA 1KB9K 1BLNA 4IKKA 5HHNB 3TEXA 3PWPA 4MHHI 4XPTH 4GT0A 1QFWM 4A66A 3LB6D 3HS8A 4R4BA 3TZVB 1PFCA 1C1EH 1OCOB 1FQ9C 5IR1A 1P7QD 4CC0A 2WYZA 1DR9A 4D9LH 4JHAL 1YJDH 1ZY9A 1QBAA 2BIMA 4L1HA 3GXIA 3N91A 4YC2C 3GSUA 3ZQ9A 2CCVA 2VUOA 4NRZA 4LVNB 3WHE1 5ABZA 4J23A 5TE4L 3IAGC 1SXNA 1SDAB 4NC0B 3SE9L 4KK5D 1LMKA 2E8YA 4BBWA 3JWOL 3KWUA 1L6ZA 4AQ1B 2KT6A 2J8UF 1OSPH 4OUUB 2Z4QA 1T1YA 2Z8WC 4NAJA 2NY2D 3W9EA 5C0CB 2XETA 4FYRA 3VFSA 3WE6A 2ERJC 2G3MA 4K7PH 2KS0A 3IMSA 3AT8A 1CQKA 2NQ3A 3PDGA 1C16B 4UILH 2ZSVB 4HFUH 3CX2A 4N0FA 4TVSa 1D5ZB 1YC7A 4XC3L 5T1LA 1NAMH 1RKRA 2XDHA 1Q1JL 5B3JF 3B6SB 2PUQT 4PV8A 4HKZB 4XPHL 3KPRD 1XR8A 5L4JA 2NW3A 5IVXA 1L9TA 1XL4A 1CIDA 3FTXA 3PQYA 1MW3A 1F6AA 4Z7WA 4QYOA 3GMRA 3KR3H 3UYRH 4P23B 1NGQL 2HVBA 1YMHB 2EQDA 2F8XC 2CGRL 3QWNA 1VFUA 4NO2A 2BRRL 1KJ2H 4XPAH 3KPMA 5IW1A 2BY1A 3RJDA 4XMXA 1P4UA 1RP8A 4NKIL 4NOFA 3L1FA 3Q5TA 2PR9A 2A4ZA 4J8RA 4P2QA 4YSDA 3NZ8B 2AXHA 4N3UA 4P23A 3SPVB 5M7QA 1T04B 3WN5C 3L8QA 4Y0GA 5CJBA 2X4PA 1REIA 1H3TA 3QJRB 6PAZA 2G2RA 1UHVA 4ZS6C 1UH4A 1LO3L 2D9QB 4R0LB 2WXKA 2WVSA 4YE4H 5CAYB 3Q6FA 5TQ0H 2EP6A 3QCTL 4X6CE 3KWVA 1L0XA 2F6AA 3BGMA 3DXAA 1PLAA 3KPRA 3B1TA 1CXEA 5A16B 3VSUA 1NL0L 3LRKA 4WUUE 2GVYA 3R1GL 4HMCA 1H9DA 4KZDL 4QHPA 4PJHB 1NM9A 2XVLA 2J6EH 3KNBB 3CZLA 3D0LB 4KMTL 4K5LA 4IOFD 2N3JA 3IFLL 3DV6A 3TTSA 3O3UN 4JPSA 1KEGL 3W2DH 4NZFA 4ZI8A 5SWZE 3D34A 4KKPA 2WUCH 2ZE0A 3Q43A 4P2QD 2IMMA 1DANU 1YYMH 4G43A 3T3MF 3LS4H 5IBUG 5IMKB 3LXBA 4WFGE 4AYMC 1DJWA 1HHJB 3S36H 4N0UA 5JQ6L 3VFWA 4U2ZA 2XLLA 5B1JC 4AGPA 4Z7VF 3CZJA 4UV7H 5G4OA 1UG9A 1V3KA 2R69A 4UQCA 2XZAL 3QJXA 4LASH 3PHSA 2VCOA 4Y5XC 2F58L 1U58B 2OMUA 1AS7A 1UVQB 5I66A 3CCHA 1BQHA 2KHAA 5LGKA 4JMNA 2QPFA 3KDMB 4QI3A 4X2UA 4D9QD 1A4BA 3LIZH 5DMKB 2Q7YA 3VFTA 5A6LA 4XVUD 2NY6C 1M7UA 4KUZL 3FT3A 4M5ZH 5IQOA 1XAUA 3P3YA 3Q2LA 2BVPA 4N24A 1IGIL 5D1XB 3LXUX 5IFHL 3ALWA 5IM7A 2VN3A 2CM5A 1GS8A 5LAPA 1K8IA 3GMQB 1RXLA 4ODXB 4ZODA 4BK8A 3NOIA 1EH9A 2BLFA 3MRQB 4L4JA 4FRWA 2EYRB 4IRSA 1GSKA 4YIQB 5DVPA 3T04D 5SV3A 1BF2A 5I1EH 1QNZH 4JFDD 2CKBB 5FDWB 3B3BA 2IPKA 1I8UA 1C5CH 1MWAL 1VADB 1FFNB 1E2WA 3VWJA 1BQ5A 3K6IA 5B22A 4AG4L 1BZ7B 5JXEC 5AYUL 4E9VA 2F7OA 3QXWA 5CLTA 8FABA 5L8KB 1NM4A 5DF0A 1T3FA 4YC2B 2P5WD 4YL4A 4LCYA 1MH5A 4QHKI 3POCA 2WZ0A 2Z9TA 5H2BA 3BVTA 1G1KA 1XFPA 3I50H 3P77A 3OZLA 1J11A 3BCDA 4OLZH 4H25B 1ZGLP 4HFWA 3AY2A 1G9EA 5JIMA 2QGCA 4GUPB 1KIRB 4LF3A 1YY8B 2MWCA 1VESA 4JKKA 1YUKB 2EDHA 1YNTF 3FT2A 2VUKA 1TO5A 2BDNH 2Y5QA 4BFGA 1EHNA 4JHZA 5C0RH 5IIEB 3E9TA 3ZPDA 3H55A 4M02A 3TF7C 2H8PB 2OL3H 1V3JA 3GSWB 2Q7AA 2H3KA 3ESUF 4MJID 5FGBC 1XGRB 2V9TA 5T1DL 3UDWA 3WTYA 1G7PA 5FHAL 4NEHB 4PJDF 4BQ6A 5DZLA 1J5OL 2IBZX 1R19A 2GC7C 1N59B 3V4VB 3TJHD 5LAXB 2YD5A 3A6OA 4MX7B 4OQTA 1NEUA 3EYSL 5JMOC 3V4LA 2Z6FA 4WW2C 5EBWA 2A4CA 4WFHE 1KLFA 1UH2A 1XR9B 5D1ZB 3U36A 1VFAB 1TU2A 3K72A 1SJMA 3W1ZA 3HS0C 4N22A 4LXFA 4ZK8A 5F7EH 5EZOH 2FL5B 3G5YA 3Q7JA 4ZUWB 1J88A 1UUNA 4K07A 3BQUB 3KPSD 4KVNH 2Z34A 2K4AA 3HC3L 4P9HL 2ZX5A 3SYCA 1XIWA 1HEHC 2BNUA 3VFRA 2DWEA 2OPCA 4Q6IC 3JWOC 3LEXA 4JPIA 4MB4A 5LDUA 4K71C 3VXSD 2K45A 4M1DH 5JDSB 3L54A 5GHWH 3JV0A 3STLB 3BPCB 3VFUB 3GHPA 5C6WH 3NJNA 3FPYA 1VZGA 2AW2A 3A0OA 4YDIH 3MRFA 4J4PC 4L4VA 2HP4A 1MG2C 2HFTA 2AQPA 1JNLL 3MBEB 3ZUNC 2XJLA 1BHGA 2FECI 4KZDH 4NLHA 4H8VA 1NMBL 1MFCH 3PWUB 3TEUA 3B83A 1QTSA 1RZ8B 1QSEB 2FX7L 2BPBA 3CSPA 4KH2A 3T77A 2NQCA 3SDAA 3VXOA 4K23H 2R2BA 4HHAB 3VTTA 1T2QL 3F62A 1FZJB 2ICES 3OKOB 1E5CA 1BP3B 4KKRA 4HGMA 5HHOB 1QSED 4I3RL 2ZXWB 1F6FB 1GJWA 2D31A 3DPBA 3QNYB 5D5MB 3HTLX 5DHVB 2ENYA 2QVKA 1RUPH 1NDTA 1EDYA 2Z91A 4FQHA 2WBXA 3FHEA 1PTZA 3GBNL 5JO5A 2I07A 2RCSH 5HI5D 2K6WA 3VMOA 2QT6A 1X5ZA 1JNHB 3QI9B 1A5FH 2AQSA 2NMSA 1T1WB 3EJZC 5IB5B 4UV4L 3CN4A 4KI5C 3FQNA 3VXTA 4X6DF 4XPGL 5E5MA 4XI5D 1PZ3A 2JJUA 3QEQE 4B9YA 4KTYA 4FNLL 2VW4A 3ZDXE 5FUZL 4M1CC 2WXJA 4Q6YA 3MRGA 1AE6L 4UT9L 5ID1B 5I6XB 2DW5A 2R2HA 5D9SB 3HI6L 4NJ9H 1CD9B 1N5YH 3LQMA 3UTSB 5PCYA 1YJDC 4YK4C 4GRWE 5IMLA 4UQ2A 1L9PA 1Q72H 2ZCKL 3DJSA 4EZMA 1CF8L 5D6DA 4BSVB 2XACC 1ZT1B 1UVQA 3L6FA 4JPQA 3FU7A 3HRZC 5EIVA 1GY1A 4OJAA 3N0PB 4P46D 5EOTB 3P54A 2R23B 2FUTA 5CU5A 2CDGB 5K9KB 1C5CL 1UD8A 4NQCE 2O6EA 1AG0A 3OLDA 4JRLA 4OCXH 4XN5A 5IW6B 1CL7L 4KX7A 1A14H 4X5XA 3LRSA 1HDMA 5HGBA 3SZ6A 1ERNA 2QFPA 5E1GA 3ARGA 1CGTA 2F1EA 1FJ1A 3JQOB 3ZKXC 3V5KB 3MV01 3BUQA 4P59H 5C09A 2X87A 3GRBA 1NCWL 4KK5C 3S96B 5KSAB 4KKBC 3RTQC 3EYOB 4LCWA 4PJCF 1SMOA 4IOIB 1KCBA 1TZIB 1YO4A 5HY9B 4YX2L 3WSQH 4GW1A 3WL9B 1HQRA 1MFUA 3LZLA 3X1EA 1XCTA 2VAAB 4KPHL 5KVGE 2M83A 4IGBA 2I9TA 3VXRB 1JZ6A 1SJVA 2DYPB 3PYCA 3ZE0E 4OFPA 3BI9X 1P6AB 2BW5A 5AB1A 5SWSE 1KN2L 4OJFL 4Z3GA 4PCYA 1MJUH 5F9OL 1WC7A 4MVBC 2PXYA 1RU9H 3MGOB 4GIOA 3VGFA 4WUKL 1TZ8A 2OR9H 2WSKA 3SQOL 1KWKA 4YR6A 4AJYV 4APQC 3RVVD 2XN9A 2FB4L 1YNKH 5D93B 4TUJB 4P5SA 4MA8L 4ADIA 1UT2A 3F01A 1AMXA 2UVFA 3US9A 1ZLDA 1TQBB 1ACYL 4M62H 4FQ2H 1QBLL 4HIJA 4KI5F 3LPWA 3UTSD 1TJHH 3QFDA 5A2IH 3EOYG 1NCUA 2H1PH 4N90D 3ATEA 3TIEA 4H8QA 1E7UA 1TQVA 1VFBB 2QR0A 3JWOH 5I5JA 3W57A 1YPZA 5DJ6B 1CFVL 2AEWA 3RB5A 1XDTT 4FLHA 3BUPA 4K3DL 1T21A 3GJFH 4XCFL 1F11A 2QPSA 1ICTA 1QPXA 2AJUL 2X2YA 3JVGA 4OCSH 2EIBA 4PJAF 2LAGB 2O5XL 3GSXB 3R7QA 3LRHA 1OB1A 2YXFA 1BEYL 5AVUB 2ZICA 4MDJA 3ARGC 4WI8A 2LW3A 3RGBA 2QVTA 4IIQB 3VDAA 3B2PA 1MW2A 1V3MA 4K55A 1W72A 3ARDA 1A65A 1HJBC 4UNVA 2IGLA 2KQNA 3C12A 4DPAX 3AC0A 5F1NA 4DVBB 3RAJH 2DWYA 2CUIA 4LCUA 2PR4L 4W6YB 3CVHB 4R96B 3ULVL 2UWEE 2VXQH 1MZYA 2YGOA 4S1DC 5HI4D 1CDJA 1T2QH 3BIKB 3TV8A 1ET8A 2ESVB 3X1GA 3RDTA 2XI9A 3IGLA 4XMPH 2IWKA 1B3IA 2MIZA 2CK2A 1KJ2L 1CYXA 3BLBA 2W59A 4OZ4A 4PBDA 4XPAL 1MY7A 4XP6L 3EJSA 4ZOBA 5DEFB 4K94L 3TCLB 3GS4A 3VTAA 3WFHA 4UT7L 1H8NA 4R7DA 2VL4A 1KPUA 1RK1A 3S3DB 4NQED 1L9OA 1AXTL 2IAMD 3IJYA 1NKRA 4QO1A 1I7TA 2Z8RA 3IN2A 1UQSA 4CC4A 3Q48A 1KXVC 3BKJH 3QIBB 3SE4A 3LV3A 3W9DB 2L7QA 1QNZL 5BJTA 2FJFB 1LEKB 2FQGA 1U8PB 5AQ0A 5AUMA 3HR6A 1E5ZA 2AABL 1FYTE 3ZDZE 2MQGA 1WIOA 3OKEB 4FG6C 4N0UB 4RH4A 4IBTA 4MMXC 5EHFA 2F1AA 1MIML 3DECA 4UT9H 3CK0H 5GRVK 2CJUH 4MD0B 2BHZA 4L0PB 2JXMA 3GI9H 2ENJA 4JRWA 2ZCKH 1WZLA 2F5AL 5E8NB 5JHAA 2W07A 3VFTB 2CJ3A 3HHSB 3W0WE 4K71B 5CO1A 3S37L 2V5TA 5BOPA 1DN0A 5CJQH 5HGHA 3CVHH 4MJIB 3SO3B 2BFVH 2CK0L 1CL7H 3RX9A 2F54D 4AW4A 1GGBH 4K7FB 3MUGB 2FNWA 4J3XA 1KLGB 4P3WA 1AXSB 4G6JH 4NC2B 3ZE1F 2KH2B 3MRQA 4YXHL 5BOJA 4TKWA 1CFTB 1HS6A 2YD3A 4R2GC 4UDTA 2PPDA 5FXCH 4AEIH 3ETBJ 4MA3A 1OARH 5IJVB 3FTGA 2DQJL 4QR7A 1JERA 3DHUA 3CNKA 3V10A 1PLBA 1TYJA 1OAKH 3U1SH 4BSJA 5I1IH 4ODTL 4RWYH 3IPEA 2BOBA 3M8OH 3FB5B 3F83A 4L8BB 5E6ZA 4HWEL 1A7BA 5I5IA 4JN2A 4TVPE 4WW1B 3BYTA 3LY6A 1OP5K 4XNAA 1TEGA 2B15A 3MCG1 1Z5YD 4DFHA 3GIVA 3QEHB 3P2TA 4RIRA 2VNCA 3IBEA 1W16A 2R2CA 2WWOA 4LSDA 3C08H 3IFOB 2KBGA 2AK4D 5FW7A 2R4SL 2FLBT 3EDEA 3SE3A 3WN6A 1XHHA 4JPKH 3RVTC 5F7DB 1YSOA 1SQ2N 4HC1L 1UZ6E 3FB5A 3UROR 4MCZB 1IBYA 4FXGA 1LE9A 1A9BB 3L13A 4ZFZB 1GC1C 3JUZA 1JI2A 1JZJA 4YHKL 4PS7A 5LN8A 1UWEL 2AQ3A 3SE6A 3NGBB 3W5NA 1OP4A 3D4CA 3VWJD 4OI9A 5CEZH 1T1XA 3RPBA 2CR0A 3RPIB 3ZTNL 1O6TA 1BA9A 4ZW8A 4NQCB 3IMWA 3B2MA 4I48B 4NIKB 2AJUH 2Y36H 4UAHA 2MNUA 1A4CA 2O72A 1SLXA 5F3HA 3HZVB 2J43A 5JHDD 4JFED 2ZXAA 3DV4A 4FJYA 3RVVC 5DHYA 5HHMD 3L3DA 4NAQA 5ACZB 2VRAA 1X3DA 4I9WD 4Z18A 2OL3L 3S34H 4X6BB 1NBZA 4GRWB 3HKZA 1MFVA 1HH6B 2BSCA 1PJWA 4UAOB 1KFAL 3QFJB 1G7QA 4M7LL 2APXA 4PYHA 3B2XA 4KKAC 3RAJL 1TETL 5DQDH 3ARRA 4EIUA 1RZGB 3ELQA 1WZKA 2CMRL 2WTPA 4JVWA 5C1MB 3PDDA 4KJWD 4PS8A 4MJ4A 5EU3A 1H5BA 1R5VB 2IOIA 3RILA 5C0JA 2E9JA 4LRIA 1U8QB 4NPYA 1AE6H 4A6YB 4CVWA 2DMKA 3KEDA 2J2ZA 4P8QA 5CJOL 4Z3JA 2IIJA 2V7NA 3NESA 3BT2H 4G5AA 2EZ0C 3OR6B 2VJ0A 3NA4A 2PWEA 2FHCA 4OZIF 4FYTA 1NEZA 3TT3H 4HULB 3BAWA 4L5FH 4M48L 5IVOA 1AIFA 3DROB 5CHNA 4DN4L 3L7EB 1KYDA 1QW8A 4W9JC 5IT2L 5D55A 1H0DA 4NZUH 3ZKXB 3OXRB 3TA4D 3QJHB 3GHEH 2WLLB 3WEMA 1K8DB 1HHKB 1NOFA 2FH8A 1I75A 4J3TA 1MCNA 3C9NA 1ZV5A 2APFA 3NJLA 4NC1C 4BWWA 3SIKA 2IALB 3FRPG 5BZZA 4ZTOH 2G2RB 3TGXA 2CXKA 3GIZL 2F8IA 5DJ8B 3QUXA 1E4HA 4LCWE 4X9IA 3V4VL 4YH6A 4XTRD 3UOAB 1Q9OB 4HEMA 1QLEB 1UWXK 1TTFA 1SFHA 4L37B 1MFCL 3EYUH 3FQWB 4QO1B 4UYQA 1X5MA 3O0LA 3QJHA 4ACPA 2BX5A 4FYSA 3DVNA 3NFPA 3S36X 1TQSA 2FJFA 5TFSL 3K8MA 5JPMA 2IDQA 4I3RH 4X0KA 4PB9L 3DTXB 5FO7B 1DQJA 2RH0A 3Q1SH 5AAMC 4NFCA 1ZLVK 3TEYA 1AD0B 1EFXB 4APQB 3BKCH 1X5LA 2YD7A 5DMGD 4PJDB 3T1FB 1KCKA 3CMOL 1NUFA 1HAWA 4LLMA 4BEIA 4HPYL 32C2A 3HN5A 2DI7A 3KPOA 5KYXB 4L1DA 1NTDA 4DKDC 4MNHB 3ABMB 3V4PB 3J27A 4GS7B 4J12A 1THAA 4QRPE 2PCYA 2QL1A 4YFLI 1SBBA 1KFGA 2VUYA 1JHLH 2Y22A 4TYUA 3MROA 4NZRH 1HSBA 4TV3A 1A0QL 5IW6A 2EXSA 1PGRB 2WNKA 5JHDA 3IMVA 4WNJA 4Z7OF 2A9DA 4KROD 5IBLC 3X3FH 4FQ2L 4LBEB 5I1AA 2ZOLB 2E9BA 3I2CH 4JHWL 4KXZI 2VN4A 3ZDYE 1A9VA 2N7SA 3ZE0F 2E9WA 3ABGA 3LRGA 4UU9A 4EF3A 2A4EA 4PWIA 1KGIA 5I19H 4AQ1C 3QBTB 1XTLA 3VDCA 3VMNA 4ODUA 1OCRB 1FO0A 4JREC 3GXFA 1U8KB 5PAZA 2XVKA 5I18L 2V7HA 1IARB 2ZJSH 5L8JB 3TNNB 1T7YA 1UASA 2NY0C 1O9WA 5T5FL 4XH2A 1KC5L 5EEZA 3DJZA 2GITA 4JY4A 2QZ5A 4DCQA 3WUWA 2G2NA 2F53A 3HNSL 4BGLA 1J48A 3H9SB 4S2SA 4EOWL 2I24N 3GMPA 5L2KA 4ENZA 1QKZL 5KVFL 1UXWB 3ME0A 3UJJL 3BWUC 4W4NA 5CEZL 1PIGA 1VEPA 2OKMA 3ARBA 2LU5A 3QYNA 3KBHE 5AZUA 2ZCZA 2CCLA 1L7IH 2YA1A 4M7ZC 3ZTNH 5ITBH 4XAWL 3M1BA 2C1PA 3IEAA 4A2DA 1MCIA 1L3WA 5AG8A 4HLEA 2VDKL 3VFOA 4ZPVB 4DGYL 3CHXA 4EN3C 5DEJA 1XF1A 3IJSA 3V4PH 3DX9B 4FQJL 1HNGA 4FQXD 3AAZA 3SGEI 2YEVB 4F2MA 4YDIL 3P02A 5IBUB 1F3JB 4HWBH 1B9ZA 2AXWA 1IQDA 1P84K 1ZT1A 1G7IA 2NSQA 2O5YH 3L6FB 4R4BB 4AT6B 4OKVB 3PGCB 4OGZA 5JIHA 1XIWB 2EEAA 1RU9L 3VFRB 5B3NA 2D2OA 3BAEH 3MUJA 4J4PD 4Y9GA 3BKJL 4ZPVA 4KZ0A 3BSHA 3GSWA 4FXKB 3RGHA 5GISH 1MLCA 2XKSA 4TSAL 1JVOA 3FCBA 4HJ0D 3BVWA 5KVDE 1OCWH 2NY4B 2CMRH 4GXVH 1U3NA 3FT4B 3T3ME 1WBZA 2PNDA 1ETB1 2R8SH 1X5HA 5D96C 4C56D 4FEMA 3V5KA 3Q05A 1FVEB 1TNNA 1X9QA 3MBWB 4JRFA 3ISWA 4OCWH 5IEHB 1KGYE 2DQTL 4EN3D 3BUTA 4M00A 3VJ6B 1OOAA 3D1MC 4NKDA 1CFVH 4F7TB 2OX5B 3O6MH 5DD3L 4OI7A 1UXSB 5ADPL 1INDH 1TZIA 4NQTA 4CDGC 4XRCB 3B7YA 1UGKA 5F71A 1D9KD 5D4IA 5B21A 4PG9A 3D09A 5B7FA 1FCGA 2EYTB 1MCEA 1TZHB 2DMBA 3D51A 3KM2A 1L6PA 1UKSA 4KO9A 5LCVA 3WTSA 3NN8B 4EUPA 1HZHL 1ZAGA 1I7RB 2GJZB 5FA4B 3T2OA 1AGEA 2FLMA 1LP9E 4NKDB 4WO0A 2K8MA 3EGXB 1EJ8A 2YR3A 1FFPB 1WUZA 2BY2A 3DX4A 3J2PA 4JFXA 3S2CA 3KPNB 1H15A 1WT5C 4JQVC 4D8PA 4UWQB 4LRNH 3Q8FA 3S9DB 1AO7A 1G7JB 2R69L 3UCRA 3MYJA 1FAIL 1J0YA 3MV8A 1K9TA 4FFVD 4W9ZA 3RY6C 4XOEA 3PGDB 2LTQB 1WA2X 3NCYP 4LAJH 4PJ6A 5L8LB 5ETUB 1QSEA 1OAKL 3N42B 3WEXA 1UOWA 4N0CC 2ADIA 2WQ8A 3VWKC 1JZEA 4E9QA 1P7HL 1YPZB 4G7YL 5DJ6A 3RA7L 2VZ3A 3SKOA 4FE9A 1AFVH 4EI0A 4IKLA 1D5MB 3LS4L 4ZO6A 3X12B 1DBMH 1QZ1A 3MA7A 1M6OA 1BJMA 1A21A 3V0DA 1YEEL 2J20A 2QKSA 5A2CA 5DWUH 1QATA 4Z7VA 5E08L 1XB8A 3G6AA 1S4IA 1DQML 3VXSA 1JXJA 2LLLA 1A6VL 4AENB 4XNDA 2VM4A 4QTIH 1NC4D 2HLFC 1NCWH 4JO3L 4G43B 5EOTA 3UTQB 3RI5F 3F8UB 3WGVB 4CSZA 4QJ5B 1B4RA 4GO8A 3QI9A 1D5MA 4N1EA 3U7YH 1MW0A 4LOEA 1LQSR 2EDKA 3SOTA 1V5JA 3V9EA 1U3JA 2VQ4A 4UM9B 5J4MA 4GAFB 5KSUB 3EYVA 3MRKB 1T89C 5JZ7D 4KUZH 1XV8A 1ADWA 2ZYRA 4P2QE 5LBVA 3WS6C 3LD8B 1INEH 5L88H 5DZJA 3IAPA 5IB1B 3MNZB 3HZMB 1QPKA 1CE6B 1J8HA 3MNDA 3GSNL 3NDYE 3H85A 4F9PA 3KMDA 1B0RA 5FM8A 3WXVH 3QQ4A 4XNQA 4X7TB 3S3CB 2DLFL 3WEBA 1J9CT 2GTWB 3D50A 3TO4A 3HFML 2MQCA 4OU3A 4GMSL 3I6SA 4Q9CA 4GLRH 4BSVA 4HQQL 1DVXA 2NR6A 4ZTEA 4JCMA 1P6WA 4QRRD 3H3KA 2VXUL 1RFDL 2EEBA 1EXUA 5L0QC 4PJ8B 1EZVY 2EYRA 4IRSB 2X1OA 3IPBA 3FCUB 4OZIA 1UWYA 1ZMYA 5BPPA 1JFQH 4GQPH 3QUML 3KW8A 3U1PA 4M7LH 4LMQE 1YEWA 1DQLL 1XH2A 3UJJH 3O0RL 2VLRA 2Y2YA 2Z7ZA 4QRPA 3GZOA 4PV9A 3AWFA 1WHOA 2NY1D 2NY6B 1IGTA 2VC2B 1G6RH 2WP3T 3CDGA 3VRIB 3ZHFA 4I1RA 3VWKB 4ZZKA 3V2AR 3L3KA 2MMXA 5DD0H 5JHDE 2HX7A 1Z5LA 4WCYL 1MKFA 5AOZA 4FA8A 5I24A 1U0QA 2B7DT 2AANA 4KO6A 4LBAA 1KGJA 4QTHB 5ACMA 3ZZ1A 3ECWA 4NNXB 5GSRA 1XL6A 3RL1B 1SLWA 4R2GD 1E2VA 2C3VB 3TO4D 2VAAA 5IKCB 1ZTXH 3ARBB 3DMMA 2AJYL 1HE8A 1FFNA 4RX4D 4RFOL 2CBOA 4DPBX 3CDZB 2YAFA 3M6DA 1I1RA 3VXSE 1KACB 4PJEE 2F18A 1VACA 3LNHA 2F8VA 4WHYG 4XOBA 2CLVB 2IH3A 4P2OC 2X09A 1XTMA 4Z7NE 1F97A 1G7PB 4P0DA 2EDYA 2IFFL 3TL5A 5DJZA 3CFBA 2AXFA 4BKLA 1A6TB 4P46A 2A9ML 3E6FB 4XB3A 3PS6A 4P9MH 1J1OH 1AHKA 1JGVH 4GQ9H 3SY0B 4F24A 4X6DE 2P5ED 3PJSB 4UDUA 3O6FA 1XR9A 3WY1A 2DPKA 4LFHG 4ZXBB 4P49A 4JKPL 5EO9A 4U1KA 3HB3C 1NCHA 2EVHA 4FFZL 4N2BA 1KUMA 1CFSB 2WQRA 2Z3FA 4OGAD 3UL4A 5BVJB 5K59F 3P0VL 5DHEA 3Q9QA 5FK9B 3ZJAA 1TTUA 1JPTH 2CA4A 3OKMB 2J5WA 3GKWH 4KKLD 5FYJU 1M7DB 4Q4IA 2WWNA 2GHZA 3NIDB 2VB5A 1FUNA 5E8EB 3DUSB 4GBXC 4HOMA 3G9VA 3OAZK 1D5IH 1SYSB 3RUGA 1KGUA 3WFCL 5IHBA 1SDDB 4GFTB 3HE7A 1NUGA 1OTSD 3ZHLA 3OKNA 5AYTA 1J8HD 1NMBH 3MJ8B 5FUOH 4A7QA 3S4SG 3UC0H 5C9JA 1T0MA 1TETH 3GZQA 3OXRA 5IHUL 1R3IH 1ACZA 5BJTB 1FZOA 3D0VA 1QEWB 3OAUL 4MZ3A 2C7UB 1LQBC 4YX2H 3QUYC 1KT2B 1ZVHA 3QIWD 1LHZA 2ADGB 4ZX4A 1HHHB 1WAPA 5E6IB 4RLDA 4PWKA 2VITA 1IGCL 3VFSB 3WE6B 5CJQL 1EHXA 1LO2L 1JGEA 2YPLE 5D8JH 1ILSA 1DO6A 3QIUA 3GJEA 4FFYA 2X0VA 2DDQH 1N3NA 1QSZA 1IZJA 3AREB 5DWUL 3CVIL 5C0ND 1NEZG 3LZFL 5C3IA 1IM3D 4E9SA 3HZVA 5JDSA 2UZPA 4FKHA 2WAHA 1YN7B 5KSVB 1C7TA 4L9LC 2VDOL 3E2HB 3UPCA 2ZKMX 1KC5H 1TCRB 5FLVA 4G1MA 3C6LC 1BZOA 4PJFE 3G04A 4NQXA 1AXIB 3HNSH 3UZQA 5F0JB 3UTZA 3GZKA 3GMRB 1UJ3C 2VLME 2JKXA 2EDWA 4ONHA 3EJCA 4YHLL 3WCYA 1XX9C 2WK2A 5J1TC 3RP1A 1HCYA 4WDIA 4XNZB 5HPMA 3LZNA 2RJMA 4UQAA 4PCSA 5BZWA 2DQHL 3SQBA 4NENB 3FQXB 1YEJL 3K5RA 5A7BA 1RSYA 4MB1A 4DQAA 1DJZA 1AZRA 4LLQB 2QSTA 4CADA 5DQJB 4N6QA 4JPKL 3BO8A 4F1SA 1U8QA 3NG5A 2QHRL 2X44D 7CGTA 1XZWA 1IBFA 1AC6A 1JPST 4CMMB 2VMFA 5KN5A 1JXGA 4PRHD 2HZHA 3NIFE 3RGVB 4A6YH 5MP6H 3FQXA 4HPYH 1KCVH 3VQMA 3DROA 5CHNB 2WXPA 4XXDA 5IHWA 3QUMH 1AR1B 1X6NA 1QFWH 3ULVH 2NT1A 1IC4L 1JNNL 4D8OA 5FX3A 5SX4I 4F15C 3EO9H 2TSAA 5AWNH 1Q9LB 1TEYA 2VLJE 2V3EA 5DK2B 3MTXA 4KK9C 3LEYH 2R8SL 4U05A 4GG6F 3FTSA 2AMGA 2EO9A 1MFEH 2ZWZA 3JWNE 4NWUH 4DHLA 2ZF8A 3DX8A 5EO0A 4X99A 1TJMA 1JNJA 2V0AA 2DQTH 3AACA 2OYKA 4ILDA 3WFBL 4ELMF 1JZ8A 5IFJB 3UJTH 1J1PL 3O6FC 5AW0B 2AEPL 5ANME 2ODIA 2CWRA 3BAYA 4HK0A 1IC1A 1TZGH 4HKBA 5EWIH 1AOHA 4GW1B 3WL9A 1PZCA 4P5MB 2V2TB 2EE6A 4FGMA 1Y0LA 4C83A 1SOKA 3X1FA 2JKIS 3PE9A 4WW1A 2DI9A 4RFOH 4YDVB 2XG4A 4ANUA 1YDPA 4B9PA 2CCWA 1XAKA 3DVGA 4P5KB 3VFPA 5I73C 1JYWA 2G3ZA 4DKEL 4NZTH 2ZSWB 4D0BA 2FBOJ 5EOCL 5L0QB 2WNGA 2WXOA 3TBWB 1FJ1B 5HI5C 4YHIA 1FFOB 2Y2WA 3MMEB 1JZFA 1TUPA 5CMAA 1VGEH 3TT1L 3MLWL 4K8RL 5FV1L 1X5JA 2VSCA 5JORA 5E1AA 1Q94A 3VXPB 1T89A 2WC7A 3N1PC 1Y6MR 2O6DA 3KLLA 1J1OL 2Q7YB 1BFSA 4HBQA 4LL9A 4CC1A 2XV6B 3IDMB 2AS5M 4FQPA 1E5AA 5BOZG 5L2KE 4OF5A 5IFAH 1XVSA 1N6VA 2X2UA 4XAWH 3I75A 2OZNA 3CZFA 3OHXB 1QPPA 5BXFA 4DCQB 1H3PH 4OFVA 2NSMA 4J8RB 1BD2B 4Y7MA 3SOBL 3IDYB 4JRXB 3QZWG 3HS9A 2J21A 4HWBL 4X4ME 2VXQA 5FKPB 5B7EA 4CBPA 4ELMB 3L81A 1ZHNA 2BNQD 2ZUSA 3B56A 3X3GL 1WG3A 3A4FA 1UT1A 4FLSA 2JCCB 3BAEL 3SKMA 4GP5B 1OM3H 1ED3B 2V5RA 2HT3C 1M3JA 1RZKH 3B8SA 4FF9A 4JO3H 3QISA 1MREH 5IHUH 3VYPA 4AYGA 4EJ1C 3BZDA 2BNRB 4DP0X 3MOAH 3PWLA 1X5XA 1IAKB 3B2VH 1N68A 4K15A 3W0WA 2B14A 4ODTH 3ZE1E 5E9AA 3QDHA 4QXGH 4JQVA 3TA3D 2CLRB 2VR7A 1SBSH 1Q9WA 1SY6L 1IGCH 3H53A 3VXMA 1BWMA 4EVNA 2XXGA 4FQIL 1A9EB 1JK9B 4OLWL 1KIUB 4U3XA 2PCFB 2X4SA 3FO1A 4I2XB 3WS6A 2ZSVA 4Q56A 3C08L 3UIYA 4BZ2H 2OMBA 4H20L 3Q44A 2J2ZB 4RGOL 1TOXA 4S1SL 5D1ZI 4TVUA 2QDWA 4NM4L 1TIUA 1UCBH 2HT3D 3AG4B 1J0ZA 4GRLC 1B88A 1I1YA 1UWGH 3RTQB 2V5MA 1KOAA 4N5UA 4HIXL 5FYJH 3NIDF 3NCWA 1KGCD 1XGZA 2H2SC 2OMYA 3WIIH 2LABA 3ZKND 3GJEB 2NNFA 1D5XB 3BUBA 1ADQA 3NSFA 4ONFH 1SN0A 4BXVA 4B9KC 3IS0X 3EFFB 3KPQA 3CC1A 2W1NA 5FCUH 1HHGA 4YK4B 4KDVA 5D7JA 2ZWSA 3VGEA 3KZ8A 3L3GA 1AJ7L 1KV3A 5KSBF 5TK4A 4Z0XB 1CYWA 2BNUB 2YPVL 4ABUA 1I8MB 4QRTA 5DRWA 4BHUA 4JW3A 2G75A 3PRZA 4H0HB 4KO7A 4U6VL 4MMYA 4QRRE 2Z31D 3QXAA 3HZMA 4R2GB 4XCCH 2PWDA 2PP9A 4JG1H 1JN6A 4ENEC 5JOFA 5E08H 4Y89A 1DVFC 2COQA 1QUPA 3Q9PA 2B2XL 4NENA 2VQTA 5I8EB 4I0PD 1JUFA 3RIFK 1UA7A 5FUCC 4TPRL 4CADB 3B9VA 2VH5L 1EO8H 4DAGH 3F5WA 1NMAH 5JUEH 3Q2NA 4M93C 3EJYC 4G71B 3WTTA 4BXSV 1BPVA 2DBJA 3U0PB 2F0CA 1SRDA 4QF1A 5ISZB 4N86A 3CFEB 1WP6A 5CNHA 1YYLH 3EYOA 4LCWB 4LSUL 3GTTA 4PGEB 3F7QA 3T4AA 3KW7A 5CJOH 3GJFK 2W60B 4MA3B 5DJ2B 2P5WA 2K9FB 2LU4A 4H13C 5D5MA 1SXSA 4H8WC 5D7EA 4LCCB 4GEJA 4MA1C 4G9FB 1CFQB 1OPOA 1M71B 2Q3ZA 2GEEA 5DK2A 2EDXA 2GK0B 3QORD 4OSUL 4QIRA 2DZEA 1OCWL 2F2HA 2UZXB 5D4QA 1EHKB 5SWSA 3CSYA 3QDGB 4JEGB 2YAEA 5EO0B 5HHXL 4LSTL 3VA2C 4Z7VB 3WU1A 2P45B 3O4OB 4NNPH 3V0AC 1CD8A 5LGYA 1JIBA 5KVFE 3WO3B 5EV7A 4TQEL 5JHBA 4UOQA 3JXAA 4DTGL 3H7BA 3EG9B 4N2MA 4M6ML 2YAPA 4UM9D 2XWDA 1BFTA 4MXWL 1Q0YH 4Z5RA 4MQ7A 3OXSA 1YNLL 4GY4A 4MD5B 2QR0B 1UM5L 2GI7A 1S3RA 1JHTA 1RIUL 3KG5A 3QARA 1FHGA 1NC4B 1EJ6A 4MDIB 4JFFB 4OJDH 1GS6X 4IOSD 5I23A 3E8UH 3WDJA 3R4RA 2VQUA 3BQUA 2GCYB 3GUTA 3H6AA 2HCZX 4FYQA 2VDNL 2VLKE 4HLJA 4XVSL 2CNZA 3PJSA 2N7BA 4AY0A 2GYSA 5J8OA 3GXMA 4F5CA 4XZ4A 1X9UA 3VI3A 3FTZA 1JTTA 3L5HA 5CCGE 3T0EA 5LGHH 4MMZA 2J88H 1FZMB 2F7QA 2CALA 2AJYH 2P42B 4LIQH 4ZFOL 2F19L 1EO7A 4WQOA 5JYMA 5M95B 4K9JA 4ODSL 1A9BA 3ML8A 5FK9A 5E24E 4YZFE 4ISVA 2FYYB 1A0QH 1COBA 1PU0A 1Q4NX 5CCKH 4N2OA 3ARPA 4F9LC 1M2VA 5E8OB 1TVDA 1OV8A 2DWXA 2WOBA 3BPLC 3V6OE 2Y2TA 1BYOA 2V9QA 2IH1B 2FRGP 4K7PY 4NYLB 1SYVB 3QUYB 1DQDL 4RZCB 1ETZB 2R2BB 1HCZA 3N9GH 4E9RA 1PG7W 2FDBP 3ETSA 1AHMA 4HS8L 2FLRT 2MNWA 1B4JL 2CPCA 3WKPA 4U1JB 2CO6A 1WZ1L 2VC2H 1R0AH 5CBAA 4S1SH 1OSZB 1MNUH 4QXVA 1AZCA 3JV6B 3T2LA 4HUNB 4Z77B 4TRPH 2TAAA 2HTKD 3HC4L 1S8DA 2JQZA 5ANMB 4L8DA 3RE0A 3MA7B 1AVAA 3WIIL 4ZAKA 3I9PA 2GBUA 4QKTA 3L9RB 3LXCA 2BMKB 4KXAA 2JELL 4X6FA 3SZKC 2F5BL 1PX3A 1WHPA 2FIRT 1YN7A 3Q2WA 5E70A 1AY1H 1AGEB 4KVCH 3EYUL 3RVTD 4LSQH 4A2FA 2H41A 2B9BA 3GSRB 2WZPA 1IQWH 1T1ZA 2XRAL 3QXTA 5DZNA 4ZDHB 4F7PA 3EO9L 2H26A 4ANVA 2YARA 3MRGB 5J12B 1XF3A 1DZBA 5ANMA 1SN2A 1ML0A 2DQIH 2WBWB 1SY6A 5IF0B 3ZMRA 1LE5B 1EPFA 4PI2A 4HLZH 1TJGL 1G9NC 3F84A 5BVPH 2J8UB 3K2MC 3KGTA 1S9XB 2X70B 4H4NA 2EC9U 3GMMB 1RURH 3VD2A 2DDQL 2HKFH 3X1NA 5HJ3A 5INDA 5BS0A 5HD8C 3MZTA 4XHJC 4JMXA 2WUBH 1LTXA 4L1BA 1EUUA 5AG9A 4YUEL 2D7QA 4IK6A 1KYOJ 4XBEH 5GISL 3O3DB 5BW7C 3P2DA 1JHLL 3LRSB 1IEAA 2NY6D 4GXVL 2X70A 2Z93B 4BDVB 1KCWA 1DQQA 1BJ8A 2ED7A 4ETYA 1P7KB 3EUDA 4X4ZA 2W0FA 2DH3A 3QWOA 4PJ9A 4XPBH 3RU8H 3WE1A 4AYDC 2GAZB 2QSQA 5SWZA 2DY2A 3TT1H 4ELME 4DP2X 5A2BA 3LN5A 1OP3H 1MI5B 1WD8A 3E3QC 4DN3L 5IMMB 3TFKD 1NGWA 3HC2A 4OZ4B 5IVXE 5CILH 4UUJB 1H19A 2D3VA 4PJGF 3B4NA 5C09D 3BLKA 4HWUA 2YJQA 2Z91B 3D9AH 1BV8A 3VRJB 2GUOA 2ICWJ 2JK5A 4Y19A 1JGEB 3B9KD 4KX8A 1Z3GH 2EKJA 4YXKH 1GGIL 1VAHA 3ORJA 3GINA 3WJMA 5C0AB 4HCRA 1NPNA 1AKJD 3HA0A 5E5MB 2LAAA 4CMHC 3FN0H 2OJ1A 1N4XH 1V55B 3MCLH 3N0AA 3P4MB 2VDOB 5GRVL 2ROXA 2WINB 4P9ML 1CFQA 5EU6D 4KROB 1UWFA 4EBQH 4L0YA 1ZT7B 1E4WL 5D1XA 1RZJL 3OJMB 1HHIB 5I1CH 2D3JA 5E94B 5ID1A 4WO4B 2HPTA 2QVFB 4L3CA 3LEYL 3BAKA 4FJ6A 4QLRA 5HYSG 4E0RB 1NCDL 2A3TA 3HI5L 5D7IA 2W95A 2EAEA 2CKBA 3CX5J 4OGAC 4TSCH 5AB2A 4RMUA 4WSGA 3NACH 3WFCH 4D2NA 2I25N 3FUIA 3MFFB 3NIDE 1I85A 5C70A 3BPNC 4K5OA 1QFUH 4KZEH 2UWEF 4TVPH 4JY4B 3MR9B 4QEGA 5HDOA 4GFXA 1DSYA 4U1HA 1GXEA 2HFFA 1JZ3A 3G6JF 4H26A 3OKDB 1XO8A 4GP8B 3IJEB 2Q8AH 1N8ZB 1FVDA 4YEFA 2X9XA 2Y25A 3B9DA 4H1LH 1QLRA 4TUOA 1I8IA 3B37A 4ETQB 1DYZA 4Z95L 1XF5B 3FTGB 4BCZA 4DGVL 3BDBA 2GJ6D 2EJ1A 1VACB 1GHFL 1NJ9B 4B3EA 4GG8B 4XNMB 2Y1VA 1U8NB 2FIKA 3N9GL 1H5BB 4JPWL 1YMMA 5FGRA 1B0IA 3FH7A 4B9IA 3L3JB 4OD1L 1XCTB 3NPZB 3QDGD 3KWTA 3AJ7A 1GJUA 4LAQL 2KC0A 4OLXL 4S11A 4XN7A 4Q89A 5B39G 3LNIA 2VR6A 4M6OH 5IR1B 3RBGA 3IU3A 1NFIB 3ARWA 3ULUE 2VDOH 5E0FA 4GMSH 1MDTA 1YJDL 2ERJB 4B9JA 3QDAA 2VDMB 1KBVA 1QSFB 2Y06H 4JZJC 1EMTH 4NCC1 2UXTA 3JV4B 4AT6A 4PTTB 2PWFA 3S2AA 5FO2A 5J6HA 1A14L 1T7XA 2E46A 3MRBA 1I1FB 4HBCH 3BXNA 1QLFB 3LQAC 1PFOA 3L3HA 1BQHG 1FO0H 5DSCB 3CSTA 1KPVB 1NCAL 3MRPA 4JRYD 1GVIA 2Y6SD 4C56B 5FA4A 4LEOA 4NRYB 5BRZD 2XCMC 4IMLA 5D7KD 3HG1B 3AXLB 3VI4F 5MERA 1QTPA 1A2YB 4ANXA 4O02A 1WICA 4A7GA 2VQ1A 5CWSA 4J3OC 2P5EA 4UILL 5GS2D 3QFJD 4HFUL 4W6XB 1JMXA 4PJCA 5E99H 3UZVB 1B4LA 1H9VA 1U8JB 4F8OA 5T3XE 1DBJH 1J9TA 1ID5I 1PEWA 2AJXH 4HSCX 3V0WH 3FFOA 3CQPA 1DQMH 4D0DA 2HKFL 3H8NA 5BZWB 5EU6A 4Y4KA 4CDHA 3ILPB 1ZLEA 3WIFB 1AHWB 4M61B 1CD1B 3QCVH 2I7SA 3H42L 3RX5A 4WI5A 5EEXA 2X4RB 3GXDA 1ORSA 2QMJA 3PQYB 4XBEL 4L05A 5EUOB 3VD1A 4ZPTA 1BZ9B 3QXAB 3P4OB 2AC0A 1YMHA 1S7WB 4LSTH 3MX0B 1OPGL 1BSIA 4UZUA 1AH1A 2L7JA 2XFXB 5HGAB 5KSBA 2PPEA 1XGPB 3A21A 4X7FC 2IG2H 2BIQA 1JGVL 4GQ9L 2RBLA 1P7QA 1MQKL 2UYLB 4G6AD 3QUKA 4LBEA 2PP7A 4ZFOB 2YKLL 2BC4A 1EHAA 4Q74A 3W0WB 4XX1G 4MXQC 2K6YA 3CXHK 3PV7A 1EANA 3DHPA 3HCVA 4F57H 3N85L 1AS8A 4HF5L 2ICEA 2SODB 2B8OT 1T20A 4N2HA 4E41B 3T0EE 5FF6A 3WAJA 1H8SA 4JB9L 2LLGA 3GKWL 4NUGH 1ZA6B 1PLGL 1BEYH 3Q8EA 5GGSA 2WXHA 4MQXC 2FT7A 3PP3H 4PJXE 3BSZH 4GMTL 2B77A 4IGBC 3ZTJG 4JKNA 2NYYC 3BEVA 2IALA 4A1RA 2DIEA 4FXTA 3OKEA 2DLEA 3UAJD 4JG0L 3EOTH 1G6RL 4CKVX 4AYFB 3ME0B 4G5ZH 1YYCA 2BNRD 1BVKA 4R4ND 3BWUF 2PYFB 2IVFC 3AB0C 5ECJE 4FL4C 1MJ7L 3FAXA 4ZYKB 2WUCL 2JXMB 5FAAA 1J0HA 2HLFD 1BAFH 3EFOA 4JM2C 3F05A 4PVMA 3UTTD 3W11D 5ICYB 2F74B 3MRDB 2P5EE 1I4FA 3TO2A 2DN7A 3L4VA 5AKVA 4APQD 1EK3A 1KNOA 3VFVA 4JK0D 1ZD6A 1R3JA 4L2YA 5C86A 3QUMA 4L4TE 4GKLA 3ESMA 4H8UA 3BSZA 4M4RA 2O30A 1E40A 2QGEA 2XWJA 1IFRA 1K2DA 3WJJC 3PP4L 5TDNB 3RB7A 1PX4A 2A6JB 5FYJD 1Y6NR 3KDMA 4AL8C 3QFJA 3ARSA 4LL1A 3L4YA 1UJTA 1YDPB 5CUSL 3SDDC 4MB3A 4U3SB 5T1JA 5T1LD 1IU1A 4NZJA 1XSKA 3BVDB 3Q0HA 4YSQA 3KPSE 4LFHD 3MV7E 2P5WE 3WJLA 4JM0A 2GBAA 1E8WA 4EKJA 5JPNC 4JM2F 3M86A 3U6XA 3OM3B 1JTOA 4HXAL 2P3YA 1RK7A 1NZRA 4FEIA 2Y7MA 3D8MA 3US0A 4XBPB 1CDGA 1HXKA 3P3TA 2ICCA 1TENA 1WWAX 4G8EA 2YFNA 3DX6A 5E1QA 4NQEB 1XGTB 2GT9A 5DJCB 5GIRA 4HAFA 1YNTB 1D5IL 4DUVA 2WD0A 1S7UB 7FABL 1GZQA 1RJCA 3INUL 4G6MH 1FNLA 2CM6A 2OQJB 3FTYA 4H8PA 1CI5A 4X0NA 4R5XA 3STZA 2QKIC 4MAZA 4JM4L 2GBVA 4ZFZA 3VI3E 2NY5H 5E9DD 1E0OB 4A67A 4MTMA 2XWTA 4ELMA 1FC2D 3VFNB 2IANB 2IH8A 3OQ3B 4GH7B 3U4BL 1A6TA 2A9AA 2CKNA 4DP9X 2P28B 4JVPA 4MA7H 3U1SL 5I1IL 3K71A 4RDQF 4S1QL 1DBAL 4LP5A 4KRLB 3U79A 3FNKA 3K4DA 3FUKA 2ATKA 2CJTA 3PY9A 5AVWB 4XR8C 3UBFA 1OZTG 2J8UE 1EQWA 2JKRM 4HS8H 4NQDB 2XZZA 5C07D 3F7LA 4PTUA 4YL9A 1T22B 5FHAH 5TH2B 1NLBH 2EICA 4JFEB 5D4HA 5JNYA 4PFEA 1ZXKA 1URLA 5F1IA 2EUVA 4AW7A 4P5TC 4JZJB 1DDHB 1ZJAA 3C5ZA 2PTTB 1KBBA 4FQQA 3CVHA 4O2CB 4U7SA 2IWFA 2QDVA 1W2KT 4XN8A 4DJMA 5EZJB 2WZAA 2GK2A 4NT6B 1I9JL 2YUZA 5D1XE 1CQYA 3C5XA 4JQIA 2H6UA 2AVFA 2OMVA 4KQ3H 3DVFA 9PCYA 2ZIDA 2BSED 4KVCL 5IVXF 4JKWA 1GZHC 3GMNA 3H0TB 1HIMH 4PPTA 4HPHA 2K3HA 4UTBA 3QEUB 2IPUK 1R17A 2QQLH 3WIHA 5C0BD 5CM1A 3BQUC 4A04A 4M6NH 1Z6JT 1WEJH 5INCB 5DUPL 3RFZC 4X7SH 3BPCA 5GHWL 4LNRA 3X1BA 3X17A 5KYUA 4F58L 1PMYA 1ZK9A 1F1AA 1C5BL 1S7TA 3AMKA 4I5BB 3ROOB 1YEDA 3O11A 4A7TA 4P3DA 4NUJB 4PWJA 4UIMA 3RWIA 1UB6B 1FORL 5C0AE 2Q86A 3TP4A 3ZY7A 1KEML 3RI5K 2ADJA 1VJSA 5AVZB 4A37A 4FFWD 4PLOB 1DE4A 2QQNH 3UZEA 5LHDA 4O2EB 4YMPA 2DM4A 1OLZA 1A8JH 1W72H 4OCYL 3C5JB 4G8IA 5A3IC 3PFQA 5GGSB 1OVZA 2Z92A 4GUQA 2ZUWA 3IS1X 5KSBE 3N3EA 3BSGA 4BM7A 4J2XA 1MI5E 3MJ9H 2AK4A 4ZMOA 2AQQA 2WN2A 4QRAA 5D7JD 4QTFA 1LDPL 2H9GB 1FNAA 1EVTC 1TFPA 2MJWA 4AGMA 5IF0A 2BH0A 4XO3A 4RGOH 3VGAC 3WNIA 4FA6A 5G4MA 1M05B 4HXBL 1OGAA 2YD0A 1U6AH 1QX1A 1HEZB 3ZO9A 1OF2B 5E0QA 1AYRA 3SPCA 2HMIC 4LDLB 2V2TA 2XWCA 4GKZA 4Y8AA 3A67L 2B16A 4YE0A 3VI3B 3AWGA 4C58B 3GEFA 4W9DC 3N06B 3UDWC 1AGCB 1AKJB 2DQEH 3Q13A 3CGTA 4AX3A 3ECUA 1XCWA 2IANE 3D3VB 3RUGE 1HXYA 3FC8A 4FLRA 4DVRL 3O3EA 3V55A 2ZUQB 2XWZA 2DQDL 4FDWA 4GLRI 1MNUL 3QIBD 1I9RH 1C8QA 1MVYA 2PCPA 4JFVA 4PB9H 3AG1B 1N0LA 5DC9B 4EZLA 2R29H 3GK8H 3GBML 1ORQA 5HHPA 2GSGB 3TO4B 5JHLL 3N43B 3IJ9A 4FN0A 4JY6A 5HGBB 2GIMA 1DBJL 1WCBA 4RRPM 4PY8J 3UXFA 2H32H 5H37G 1KSRA 2P1YA 3FFCD 1F8TH 2BSRB 3F6JA 4Z78B 1BD2A 1T83A 2E9IA 2JKLA 2ZG3A 3MV9D 4NPKA 5GGVY 5BRZE 1IQWL 1MREL 2H32A 1R3LA 2XRAH 1G7MA 4QGTA 3VA6A 3OQRA 2DWDB 4WSJA 3TPUA 4DWHA 4JFXB 3FBKA 4DZ8B 5K39B 4HD9A 3OZ9L 4JY6B 4XVUC 3EOBA 4X4KA 1KYAA 3JBG7 4CNIB 2WBJD 4NP4L 1YYLL 4LSUH 1FZKA 2NUTA 4CAGA 1JYVA 2FR4B 3APDA 4OCRL 2IXQB 4PJFA 5JLZA 4X98B 4U6TA 4NQEE 4AIOA 4J3OF 5FGSA 3ULVE 1HH9B 4M8RA 2NRDA 1U36A 1T0PB 3OGOE 1IBGH 1XF3B 2IEPA 4TUJA 5LWYH 1M6OB 1MFAL 4I18A 1O6SB 5CP7B 3BMWA 2ZP9A 1GIGL 3RHWF 1UWGL 5AB0A 5ICXB 2B08A 3KPSB 1MG3C 3HFFA 2HN7B 3DI2B 5AL8A 3GMMA 2NXYC 1QKZH 4H26B 1PQZA 5B1JA 4DP8X 5D71L 3UTZB 4DN3H 1N6UA 2W9EH 5D1ZD 4PREB 1Q0YL 3QNXB 4K5MA 4H2CA 3L2LA 2C9RA 5FCUL 5GS1C 5EN2B 3V6FB 1RIUH 3O8XC 4JJOA 1OGSA 2X1WL 5DFWH 3LQAL 1VDGA 1CE1H 3CFMA 1FL6A 1KYOK 4JANB 1NCBL 5DJDB 4ADJA 2J1YA 1UEYA 1G4MA 1CZ8L 3JTTA 1JL8A 5GGUB 4DP5X 4HA1A 3C6SA 4IRJA 4PJ7E 4Q0XL 4JDTH 2DYPD 1JWMB 1Z9PA 2DQCL 3I84A 5E8EA 2YAQA 1WAAE 5KN5B 3FCGA 3T9WA 2VDRL 1U93B 4EBQL 4XCYB 3C8KB 2GJRA 5FYLD 4IGBD 3NCYS 1UKTA 2J4WH 1A6WL 1CUOA 3BAXA 2X89D 1VZIA 2OL3A 2Y5TA 1WPCA 2Z35A 4Y4HA 1JXFA 4ZMNA 3RVUD 4WIQA 4L4TB 3MJGX 3MV8B 1IAII 2HX9A 4IBVA 4CRPA 5CUSH 5JPMB 2VOTA 4BFJA 4BDVA 3PGDA 2EYSA 3RJQB 1CXLA 3F12A 4HIQA 2VIRA 5I8CA 1QA9B 3HG1A 3US1A 2B1OA 4M56A 1UQSB 1DHKA 1I8MA 2H1LM 5IHLB 4ZOAA 1OY3B 1WRFA 1TPXB 32C2B 3C5JA 3KPOB 1E43A 1MI5A 4OSUH 5I66B 1HL8A 3P11H 2OV0A 2IAMC 3ZYJA 2WXFA 4WFEE 3EFOB 4Y9CA 2OJEB 3SGKA 2FWLB 4PWGA 2E27L 3IRZA 1QYGH 3V0FA 2H0PA 2OSLA 4KWUA 1Z9OA 2RR3A 5HYJA 4WW2F 3RWDB 1KXQE 2Q2EB 1PG7L 1U41A 2FGWL 4XC1L 3SEPA 4OZHF 5TGBA 4HT1L 4NC1E 1H8LA 4P2RA 3NAAH 3PHQB 4S1DD 3CSYB 4ZRGA 4G2AA 1KLUA 4F7KA 2VLRD 5I17A 3PWVA 4FQLL 4G5ZL 2N01B 3MCYA 4LGRB 3VE0B 3QORB 5DJAA 2D9CA 3FQTB 3S37H 1NGPH 4JHAH 1TJGH 3N1FC 1XF5A 3ZDXF 1AP2A 5BVPL 2ZPKL 4G9DB 4PR5A 5C07B 3ES6B 5F89B 4LCCA 3TM6A 1PZUB 1HT6A 2GITB 1T0OA 1KTLA 4JHUA 5K1NA 1KJ3H 2VDPH 4ORZC 3SDDA 4X8JB 4QNPF 4DEPC 5F44A 2IAMA 1ZWIB 2HT4D 2J12B 3H2PA 4YDKL 3WKNA 5B39B 1E9OB 4JFPB 4ODSH 1BGXL 3UGEA 5CN2A 5E2JA 4BWTA 4J5VA 1S46A 2W94A 4Z3EA 4AEIL 2QKIB 1ID2A 2DQGH 3C6LA 3IMRA 1YNTA 4DP6X 1HQ4B 3QG6B 2IQ9H 3E6HA 1JTPA 4HH9B 1TR7A 1A66A 4X6CA 1G7LB 3DIFA 1E28B 4Y16B 5HXMA 3MREA 2ADFH 3MGTA 4I48A 1U3HA 4ISVB 4PIBA 2QQQA 1U8CB 3MOBL 5T5NG 3ZL4L 3DX8B 4XNXL 4JM2A 1SXBA 1W0VB 3NUKA 4HETA 4LLAA 3AS1A 3F7YA 3IAQA 4LP4A 3CC5B 1BQLH 2WIMA 4YEEA 4EEEA 3S3BB 1FG2B 3OTTA 4ABVA 4TNEA 4G83A 2CHNA 3V4VA 5ILTH 1SYVA 3B34A 2VISA 3QUYA 4G6FD 2OTUA 3TN0C 4IBYA 5ICYA 3MBEC 4U7MA 5F0PB 4G8FB 4XGZA 4XWGL 2UZIL 5AZEH 5CSBA 1ZGLB 4GKSA 1BZDA 1C5BH 1G0DA 1UATA 1S7SB 2BVQA 4JS7A 4PRNA 2IXQA 4AEEA 4NN5B 3D85D 1OSZA 1WE5A 4FS0A 5DVMA 2JQMA 1MCWW 1FVEA 1EDQA 1MQKH 2D03L 1F0LA 4JRYA 3A4DA 4K9EH 3RTQD 4AQAA 3MRHB 5D7SH 1DEEB 3MHZA 3VD7A 1TTRA 3QRGH 5DUBA 1IKOP 2A6IB 4JDVA 1T5XA 3OBAA 3D07A 3O81A 3SYOA 4KJQD 3EFFA 4HZLB 1CDUA 2HTLC 4OLEA <