5DSFA

Crystal structure of the mercury-bound form of merb mutant d99s
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALSTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase,metal binding protein
total genus 61
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5dsfA00
3FN8A 5C17A 3F0PA 3F2FA 5C0TA 3F0OA 3F2GA 3F2HA 5DSFA 5C0UA
chains in the Genus database with same CATH superfamily
1HPGA 4IMZA 3E91A 2JH5D 4TWWA 2XCNA 1ZJKA 4ZXXH 4NFEA 1O5CB 1UK2A 1BQYA 2BY9X 1H1BA 2ZZUH 4X8UH 4ESTE 3T5FH 4IBLH 3PTNA 1KLIH 1TPPA 4YZUA 1JWTA 1V6DA 1A1RA 2L6OA 2OC8A 2J9NA 2WINI 1U6QA 3TJNA 2C8WB 3RP2A 2J92A 1GVKB 4ZHMU 4TY6A 1FY5A 1MABB 2IJOB 4WWYA 5SGAE 1LHEH 4TSFD 2HPPH 3RXVA 1W0ZU 2SGPE 3RLYH 1ZGIA 4TPIZ 3MH7A 5K0HA 4AG2A 3R0FA 2R0LA 1HAOH 2BM2A 5JB8S 3BEUA 2Q6GA 1HBTH 4F48B 1TNHA 1VITG 3U69H 3UY9A 4ABEA 3PV2A 1PFXC 3MU1A 1Z8JB 2Y5FA 1O5GH 2ZFSA 1EASA 1XKAC 3DFLA 4YLUA 1H8DH 4UFFH 1H9LB 5AFZH 3LC3A 3SNAA 1VJAU 3A86A 4X2VA 2FWWA 3LOXA 1HXFH 1Q3XA 5AFYH 1FPHH 4J1YA 3HATH 4YOIA 3PMBB 1S83A 1V2LT 3LGVA 3I29A 2A4GA 1TMTH 1Y5UT 5EXNA 2UUYA 2VBCA 1J9CH 2XBYA 1K0HA 4H6SB 1FIWA 3RXKA 3TH2H 3F2HA 4E05H 4BXSA 3K2UA 1GMHF 1KY9A 2FIRH 4BTIB 1P2KA 3M7QA 4CRGA 1IQLA 2BY8X 5L2ZH 2FTLE 4UFDH 1BA8B 4JYVH 2PW8H 1EAIA 3SQHE 1SMFE 1K9OE 4OS6A 5C0UA 4BNRA 3LT3A 2H1UA 3VG8A 1ESBA 2FMJA 3UWIA 3T62A 1O36A 1YWUA 2Q6FA 3P95A 4ZH8A 3AW1A 1O2KA 4TY7A 3SNEA 3ZZAA 4JYTA 1O5BB 1GBIA 2QYIA 1SGFA 1AWHB 4Y71A 4F55A 3GDVA 1ELCA 1QIXB 1NRQH 2GT8A 1P04A 2PLXA 3OE7D 4FUGA 5C17A 2IOTA 1GHZA 2ZHEH 1FONA 2ZGXH 1O2MA 3A89A 4A1XA 1UCYH 4XBDA 5F03A 3GCOA 1NFUA 2O8UA 1AHTH 1ESTA 4FUCA 3QDZB 5GIBA 3SU0A 1UW7A 1OXGA 1IQMA 3BIVH 1FN8A 1FPCH 4Q7ZA 2Z7FE 1W0YH 2G5NA 1ETTH 2ZU3A 1ZPZA 3KQEA 4ACBA 1NBMD 4YO9A 2FODA 3PROA 1NT1A 1O5DH 2FOEA 2NU4E 1LPZB 3Q3KA 4WXIA 4F4OC 2UUJB 4XSKU 1SQAA 2YNAA 5FCKA 4P02A 3ATIA 2Z6BD 3DHKH 1KLJH 5ESTE 2ZDVH 2TIOA 1J17T 2Y7ZA 3ZVGA 2AH4X 5EJLA 1C5YB 1LHDH 4OS5A 1NRPH 4X2XA 5GJ4B 2FOCA 3SORA 4AB9A 5T3HA 4GVUA 1EZUC 2OTVA 2DE8A 1C2EA 1O2PA 4GPGA 2GT7A 3LU9B 2Z3EA 2XTTB 5FPSA 2NU3E 1C1RA 2W6JD 4CREA 1T7CA 1WCZA 4CH8B 3UFAA 1PQ8A 3QGNB 1EKBB 2V7QD 1ELGA 3SU4A 3MH4A 1BMFD 1FXYA 5HMAA 1XKBC 1NESE 4Y10E 2ZA5A 3A85A 3RMNH 3RXOA 1ELTA 4UDWH 3RXIA 1LVBA 3M36A 2FI3E 3OSYA 3PRDA 3ZZ6A 2QXGA 2Y6TA 1C1WH 2Z9IA 3K9XB 1C5QA 1AUJA 4K69A 1ANEA 1P9SA 1O5FH 4NSVA 1BRCE 1T4UH 2WYGA 3MO6A 3DT0H 1F92A 3PO1B 1UK3A 4IC5A 4JK6A 5DP3A 2G8TA 1GBLA 1AMHA 3F2GA 4YOGA 2ESTE 5TJXA 1QBOA 1SQRA 2O9QA 4X2WA 2UWLA 1V2TT 2KCYA 3GYMA 3SV6A 2GV7A 1UTKA 1XVOA 3U8OH 1O2UA 1D3TB 2KAIB 3A7TA 2ZF0H 1NU7B 1P05A 1TA6A 2P3TB 2V3HH 4CRBA 1RTLA 3WWBA 1GI6A 1TONA 2H5CA 4X0WU 3GISB 2QF4A 2UWOA 2FYQA 4IC6A 3TNTA 1QZ8A 3FZDA 2KAIA 4MNXA 1LQEA 3N99A 3CS0A 3MOCA 3S9BA 2WHXA 1DITH 1ORFA 2FOBA 1OS8A 1MKXH 3D49H 3VGCC 4WH8A 3KYFA 3A7ZA 1O2GH 4MQAA 2WPMS 9ESTA 1WQSA 3L6PA 2NWNA 3TK6A 5FX6A 1HJ8A 1SQOA 3SV7A 3VB4A 4IN2A 1IAUA 3RXEA 3RDZA 4O9VA 1TX8A 1TA2A 1P3EA 2AIQA 4BANB 2IN2A 4HTCH 1MZAA 2A7HA 5DKMA 1O3GA 2FEQH 5GNDA 1KMHB 3OX7U 2EC9H 3OEED 1VKYA 1NS3A 2SGFE 1L0ZA 3TPIZ 1O5EH 3LH1A 4Z6AH 5JDUB 1EATA 1J8AA 2SGQE 2XRCA 5DGJA 2OLGA 2ZFRH 3MMGA 4SGAE 3BF6H 1TB6H 1AKSB 1MTWA 3ODFA 1WTHD 3O8RA 1OOKB 1GCTB 1ZSJA 4LZ1H 1GHAF 4YESB 3ZZ8A 1CA0C 4OGYA 1ELAA 2W7UA 3MWIU 4FOUC 2F9UA 1C2FA 3TU7H 5EPNA 1V2VT 1Y8TA 3F68H 3Q3XA 1WU1A 2QAAA 1OSSA 1AKSA 3E1XB 4KKDA 3ATWA 1V2KT 3FP6E 4ABHA 3PMJA 1O3EA 1GL0E 5A0BA 2YMSC 5ETXA 1G3CA 1EOJA 1GJ8B 3AW0A 2STBE 1G3DA 4X6PA 1IOEA 8GCHF 1L1NA 1SLVB 2VWMA 4ABDA 3A7XA 1LO6A 1S85A 1P01A 1ABIH 1OHHD 1HRTH 2FOFA 2D1JA 1P02A 1T8NA 1C5XB 1N1LA 4Y8ZA 2QC2A 2O8LA 1TALA 5A8ZA 2P3UB 3PV4A 1H9IE 1C5MD 3OEHD 2XC4A 1YLNA 3FANA 4NFFA 1FY4A 1KXAA 2TGDA 1FN6A 3WWFA 1KXDA 1HJ9A 1XMNB 2ZCKP 3HGPA 4MPWA 1BTPA 4AOQA 3S9CA 4DCDA 3EQ0H 1DDJA 3P8NA 5FPTA 1AUTC 1UO6A 1C4Y2 1D6RA 3E6PH 3KCGH 3QWCH 3EE7A 2FX4A 1GI2A 3RU4T 2ZO3H 3RM0H 2ASUB 3PTBA 1HCGA 5JBBS 1W8BH 4D7FA 1JXPA 2PKSB 1QQ4A 4AN7A 1SL3A 2AHME 3BEFB 1IQGA 4AFUA 5CMXH 1GBKA 2PKAB 8LPRA 1C1NA 1AD8H 1ETSH 1ZMJA 2BYAX 1A2CH 1W0JD 5DP5A 1YCPM 1YPKH 1RXPA 1LCYA 3VFEA 4Z1MD 3OU0A 3SU6A 5DP6A 1HUTH 1EX3A 1RTKA 3LGUA 4NWLA 2PKAA 3P8GA 3B9FH 1QL7A 1FV9A 1C1VH 1Q2WA 3OY6U 1L4DA 2GTBA 3TLOA 1LDTT 4D76A 1H8IH 2VIOA 1GBCA 1O3MA 4UD9H 5DP4A 3MNBA 1YPMH 4MNWA 2L74A 3A8DA 2RCEA 1P57B 3AVZA 3F9FA 3RXUA 4XE4A 1UTJA 1BHXF 2BX3A 4MPUA 4AZ2B 1O33A 1ZHPA 1DT2A 3RXDA 2AGGX 1C2DA 1NROH 2W7SA 1PPBH 2FS8A 3GY7A 1O3KA 4QT8C 3GY5A 5E2PA 2SGDE 3GYLB 1QA0A 3BTTE 3SGQE 2B7DH 2ZU5A 1MCTA 3DFJA 2OK5A 3KNXA 3LJOA 3LPRA 1EFRD 3M3TA 4INLA 2FTMA 1C5SA 1EP6A 4YOJA 5C0TA 1SLWB 2V3OH 1XUGA 5EG4A 4B76A 1F5LA 2FO9A 1NC6A 3BG4B 4I8JA 3N7EA 3LH3A 1CA8B 1S81A 3MH5A 1BZXE 1P2OA 3T28A 4K60A 1SGCA 2VB0A 1RIWB 1TGCA 1DS2E 3QZQA 4ASUD 2RFKC 4KP0A 4U01A 4Y8YA 3SN8A 1TQ7B 1EJMA 5JBAS 1C2GA 1WUNH 3PB1E 4O3UA 3ZYDA 2Y5HA 3UR9A 2QA9E 2G81E 4DJZB 3VB6A 1INCA 4DY7B 2HVXA 3F0OA 3W95A 1EJNA 2PUQH 3C27B 5E0GA 1GBFA 5JPMH 3Q3YA 3IITA 1MU6B 3SNCA 3ZZ9A 1SHHB 2BY6X 1A5GH 5C94A 4R8TB 1ELDE 3PLPA 2V3MA 3EAJA 3MH6A 4YXWD 1SI5H 2RDEA 3NUMA 1RRKA 2QF3A 1QJ7B 2EY4C 2TBSA 1XUFA 2P94A 1BTWA 3HK6B 4FUDA 1GGDC 3GCNA 3MU8A 4BXWA 2F4LA 4DURA 3H09A 1TGSZ 5JYIA 1O2WA 2B0FA 2WPIS 2BLOA 2LNCA 1DWDH 3SUDA 2XBWA 3GS9A 1OWDA 4E7NA 1KXCA 3GDSA 2Z9GA 3IWMA 3RXLA 2GZ7A 5TCCA 1TNKA 1SLXB 2SNWA 1SOZA 1GJ5H 1P2JA 2OQ5A 3M7TA 3N7DA 2XBXA 1UTLM 1MAXA 1DUAA 1O2OA 4RKOB 2BD5A 3T27A 3A8BA 2ZDNA 3HKJB 1S84A 2PSYA 1O3NA 1B0EA 2Y81A 5I46H 3A83A 2FM2A 2QN5T 1O0DH 3A8AA 1P03A 1TPSA 1HNEE 4GCHF 1LPKB 1ZYOA 1NRNH 2AYWA 1SFIA 3V13A 4WXVA 1JRTA 2IPHA 4AG1A 1KDQB 1OWIA 5E8EH 3GOVB 3ZVEA 1E1QD 1E1RD 1HAIH 3F1SB 1P06A 1YPLH 2VIDA 1FNIA 2BHGA 2ZEBA 3AAVA 1KDQA 1SFQB 1T8MA 1EJAA 1GBAA 4DIHH 4A6LA 3ZVFA 1EPTB 2PGBB 1O37A 1MD8A 3O8CA 3TK5A 2OBOA 1ZPBA 4X8SH 3S7KB 2GJGA 3DD2H 1E34B 3ZZ3A 4CBOA 3S7HB 3LIWA 1GJ4H 1MCVA 1TNJA 4WMFA 2AS9A 4B2AA 2VNTA 5EQRA 1EPTA 3GDUA 3RMOH 1SPJA 3QK1A 4MG3A 1G3BA 1G9IE 3QO6A 5C5OA 1HYLA 3TGKE 3TGJE 1FX0B 3TK9A 2DE9A 3HK3B 4MTBA 1ACBE 2QXIA 2PTCE 4CR5A 3LGWA 1GHBF 2Q1JA 5A09A 1CE5A 1FY1A 2A7JA 3NRLA 5HGGA 2H6MA 3JZ1B 3V3MA 1OX1A 1UK4A 1CT2E 3JZ2B 1SGYE 2ZTZA 2FI5E 1K1MA 1QBNA 1EOLA 2ZCLP 3RXSA 3U28C 1O5AB 1NFYA 1MBMA 2CGAA 4FU8A 1GBTA 1NU9A 1O2RA 2GZ9A 3MNCA 1K22H 5FPYA 3SQEE 1O3DA 2GCTB 3SNBA 2FYRA 3VB3A 2YMSD 3PYHA 1JIRA 4UFEH 2A4QA 4ABFA 2BDGA 1UCYK 2HPQH 1BUIA 2AEIH 1O30A 1ZTJA 1DVAH 2CHAB 1A5HA 1SGEE 3PLKA 1Z6JH 2ZDKA 1GVZA 3GCTG 4YLQH 5T6DA 1UMAH 4FU7A 4DT4A 1L1GA 2C90B 2V6NA 1QB9A 1NY22 2ZPSA 3KF2A 1CVWH 1F7ZA 1GHYH 1RTFB 2QXHA 3B8JA 4INHA 2K0QA 5CHAC 4Y0YE 5FX5A 3HKIB 1GI5A 1TX7A 5JBCS 1NM6A 1TBQH 1BMLA 3CP7A 3ZZDA 1QA7A 1V3XA 1A0LA 2OUAA 2VWLA 4M7GA 3SO3A 1SSXA 3I77A 1TFXA 1AE8H 1NBME 3UB0A 2VIQA 1YLCA 2P93A 2RA3A 4Y0ZE 2BQWB 1GJCB 3RMLH 1AI8H 2BD7A 2CXVA 2P8OC 3P8FA 3DCLA 1O2TA 4UFGH 1JBUH 1GDNA 1RJXB 2D26C 2ALVA 2KX4A 1DLEA 3R3GB 1T31A 3M37A 4MDSA 1UTOA 2XC5A 4K1EA 4BAQB 2ZQ1A 2BVXH 1KYNA 1L1JA 2K8IA 1GHXH 5L6NH 2VH0A 1TBRH 2O8WA 3ZZBA 1HJAC 2QF5A 3PWBA 1UCYE 1GI7B 4I8HA 1TIOA 4ABBA 1CO7E 1Z8GA 1BOQA 4FVBA 4OS4A 4UEHH 3MU4A 3ZZ5A 4RT1A 1GBMA 1O2NA 2WPJS 2ULLA 3RXBA 2QF0A 1F0TA 3AAUA 4K8YA 1GI4A 2GD4B 5LGOA 3DSOA 1QNJA 5C5NA 3FP7E 3Q77A 3UNQA 1C1UH 3LDXH 1NFXA 2RG3A 1GDQA 2C4FH 4NSYA 3E16B 4NIWA 4K3JA 1TNGA 3D23A 3UOPA 2GZ8A 1BMNH 2XC0A 5ESBA 2P59A 1GI1A 1LPGB 1YPHC 3RXQA 3UREA 2J97A 4A92A 5L2YH 2C8ZB 3KHVA 1EZSC 1OKXA 4A5TS 1TLDA 2F9PA 1N8OB 2OP9A 1UHBB 3P92A 5F8ZA 3UAIC 3M5MA 1C1SA 4H4FA 1GG6C 3SV8A 2WPKS 2HVYB 2FOHA 1NRSH 1H8ED 4ZMAH 2A5KA 5TCAA 2JIZD 3OAAD 2G00A 2BQ7B 1C5ZB 1QCPA 2BQ6B 2ZPRA 6CHAB 1UHBA 2AMPA 1K1LA 4MNVA 3T29A 1MKXK 2VIWA 1MZDA 1ELBA 1O2YA 1W2KH 2UWPA 3RXTA 3SBKA 8ESTE 1GMDG 1G37A 1HAGE 1SGNE 1GI3A 1P8VC 5PTPA 3SUEA 4JZ1A 2HNTC 1ARCA 1PPHE 1A0JA 2F9NA 3VGCB 2VINA 3I78A 1QB1A 4WY3A 4Y7AA 4I32A 1LVOA 4CH2B 1ZGVA 1GHVH 1OP0A 1CHGA 1DFPA 1F2SE 1JIMA 1V2ST 2BDIA 3ZIAD 7KMEH 1H8HD 4GCHG 2VWNA 4X6OA 7GCHG 4MPXA 3K65B 3FVFB 1V2WT 1YM0A 1A61H 1O3AA 1QGFA 4Y76A 1Z7KA 2XXLA 1YP9A 4K1TA 1ANCA 4AFZA 1QB6A 1MTNB 4BAOB 3ZVCA 4ISHH 1MKWH 4FUBA 1DX5M 1CA0B 1E37B 4O97A 2H9HA 3PV5A 1DSTA 2Y7XA 3GY8A 2SGAA 4NGAH 3ATMA 1QRZA 2PV9B 6LPRA 1O2SA 2OXSA 3RLWH 3U8RH 4Q2KA 1BJUA 3STJA 3CNRA 3GY4A 1G32B 1B0FA 1O34A 2FP7B 3GCHB 4OS7A 1YCPH 5C1UA 5T1VA 3VB5A 4ZKNU 1O2ZA 3BTKE 4OGXA 3D65E 3EA8A 1K28D 3GY3A 2CF9H 3TJUA 2GKVE 4X1SU 1PYTC 5GXPA 2BY7X 4H6TA 1D3DB 3KYGA 4ISOA 4SGBE 1HB0B 2XCFA 1ID5H 5AHGH 2F43B 3LC5A 4MLFB 1GHBG 4X8VH 1AIXH 4MNYA 4X1RU 1LQDB 1GI0A 3UPEA 1TWXB 5I25A 3D62A 3ENSB 4NG9H 3RC4A 3QUMP 1T4VH 1O2HA 1EAWA 5GDSH 1XUIA 2A5IA 2GDDA 2VGCB 1C1OA 2BB4A 2JJ1D 4NCYA 2GCHF 1DE7H 2ODYB 1YPEH 2RA0A 2BXUH 1C5NH 3BEIB 3MFJA 5FAHA 3DA9B 1YY3A 2FXRA 1ZMLA 1UTPA 5C3NA 3QLPH 3BV9B 2NU0E 3SU1A 1C4U2 2OC1A 1WSSH 3ESTA 1A0HB 2A45B 2KM0A 2FOGA 4PROA 1K21H 3ATLA 2B5TB 2WUCA 2EI8A 3RXRA 3PO1C 2G52A 2NU1E 2GX4A 2BOHB 1RGQA 3KQCA 1S82A 1ARBA 1V2NT 1NO9H 4FETA 1GHWH 1F0UA 2BD3A 3MU5A 3SHCH 1SQTA 1GL1A 1DWEH 1E36B 3M5LA 2J34A 3QGJA 1FY8E 2Z9KA 1ZSKA 4BTTB 3PLBA 2VU8E 5EU8A 1WAYB 4K5ZA 1P10A 1GMHG 2QE7D 4FUEA 1C2LA 2ZTYA 1Z6EA 1A3BH 3NZIA 2JETB 3RC5A 4J2YB 3P17H 2J98B 5B6LA 4AGKA 3KEEA 5G4BA 2SNVA 5EXLA 1Q31A 1FAXA 2M5TA 4JZFH 1COWD 5LH8A 1HAPH 1K1NA 3WW7A 1SVPA 3H7TA 1G2MA 2J98A 2A2QH 4AORA 1O35A 1Z1JA 3TJVA 2J4IA 4GUXA 5FHTA 3LKWA 1UVUH 4ZKRU 1QY6A 1AVXA 1THRH 5EJZA 1O2LA 1AY6H 1LTOA 3SU5A 5DPAA 5ABWA 9LPRA 1LKAA 1AFEH 3E8LA 1C5TA 2CV3A 4X8TH 1S0RA 1CHOF 1HV7A 5EXMA 1V2PT 2O8MA 1F5RA 4ISIH 1EAXA 1AFQB 1DUEA 4NZQA 1THPB 2R9PA 3MO3A 1TRMA 1BTYA 2WSSD 4Q63A 2BLVA 4B74A 1AVWA 4MVNA 2Q6DA 1IQJA 1QBVH 1YPHE 4CRDA 4I8LA 3UQOA 1O3JA 1VGCC 1XVMA 2R2MB 4B2CA 3MNXA 3W1EA 4JZEH 1XXDA 3F6UH 1C5OH 1ZR0A 1QHRB 4RN6A 3RXAA 1Z8IB 3A84A 1NPMA 3ITIA 3DSPA 1PPCE 2PUXB 2H5DA 1TPOA 1IQEA 1KTSB 2CN0H 3OY5U 2XYAA 4IN1A 3GICB 4AGJA 2ZDMA 1A7SA 1E0FD 1X7AC 5DJ7A 4A1VA 2WV9A 1K1IA 1GGDB 1QJ1B 5FBEA 1LMWB 4ABGA 4CBNA 3TH4H 1O3PB 2HLDD 2GDEH 1E35B 2KCOA 2QGRA 3S9AA 2AFQB 1FDPA 1O2XA 2HNTE 4X1PU 1SHYA 5JB9S 4NIXA 3MQKC 2A4RA 2ZU2A 3K6YA 4ZROA 1G3EA 4Y7BA 2TGAA 2VVCA 3FAOA 1CSOE 3NPSA 3VPKA 1SKYE 2J5UA 3A7YA 1TBZH 1BMAA 1HLTH 1MQ6A 1LHGH 2JKHA 3B23B 1S5SA 2PR3A 1GJDB 1MUEB 1O3BA 2ZCHP 4RI0A 4LOYH 2G5VA 1GBEA 1AB9B 3FO8D 2XOKD 1F0SA 2ZC9H 1YGCH 2F9OA 1OP2A 3PMAB 4CHAB 3ELAH 1IQIA 2F9VA 1ANBA 2D8WA 2ANKH 2C8YB 2OQUA 5K7RA 1SGFG 2GMTB 2PKSC 2BD2A 1DY8A 2JJ2D 1YYY1 4GLYA 4JYUH 1T32A 2R2WU 2LP6A 5HM9A 1CBWB 1S6LA 2IPQX 4HGCA 1BDAA 5T6GA 1EAUA 2WPHS 2FLBH 1W10U 1ZMNA 2OCVB 4WF8A 3SJOA 3URCA 2QY0B 3Q00A 2ZHDA 5GPIB 2OC7A 1GI8B 1HDTH 1SGIB 3HGNA 1P2MA 4VGCB 2ODQA 2UUFB 3EDXB 3TITA 1BTZA 2VJ1A 4A7IB 5T6FA 4ISLA 5CE1A 3OTPA 3PRBA 3W94A 3M5NA 1FAKH 5KGOA 4BAKB 1QRXA 1MAYA 4HFPB 3KN2A 1OWHA 4RT0A 2ZIQH 4X1NU 1MTVA 5EGMA 3QX5H 4DIIH 2AIPA 5L30H 3QN7A 1FIZA 4Z0KA 5LPRA 1KIGH 2F3CE 3FFGA 5A0CA 5C20A 1O3OA 1BTHH 2PTNA 5DSFA 4U32A 4ABAA 1TMBH 2AGIX 1XUKA 1P2QA 3T25A 1HAXB 1HIAB 5BPEA 1O2IA 1ZJDA 1KLTA 4BAHB 1AVGH 3UNSA 2ZKSA 1O31A 1ANDA 3BG4C 3V7TA 1V2UT 2A32A 2KCPA 4K1SA 1DXWA 3P8OA 3BG8A 1HIAA 2R3UA 1GBBA 2GP9B 1RIWC 1BJVA 3LGTA 5EODA 1OWEA 1ZZZA 1CGHA 1BRBE 1AWFH 1FMGA 5C2ZA 1ZRBA 2ZTXA 2Z3CA 1D6WA 1QTFA 2PFEA 3M3VA 2Y80A 4XBCA 1UVPA 1C5LH 1GBJA 1Y3XA 2BDYA 4JZDH 5J4SA 2QV1A 1WXRA 4ZKOU 1MTSA 5EW2H 3ZV8A 1NN6A 5HM2A 4A1TA 1IQNA 1P12E 1PYTD 1GHAG 2JH0D 4TWYA 4ZHAA 6GCHF 1KSNA 2ZGHA 4IS5A 5FBIA 2EA3A 2G4UA 1ELEE 1K2I1 4XDEA 1TAWA 1GDUA 3OTJE 1P2NA 3OFND 1P9UA 3F9GA 3BTWE 3G01A 2Z9LA 4XFQA 1G36A 3L33A 3KQBA 1W7XH 4NIYA 1CGIE 3LONA 8GCHG 2FZZA 2BTCE 3EA9A 3LGYA 3SOSA 2I6QA 2BD4A 2C3SA 3SJ8A 1EP5A 2B9LA 1DOJA 1LHFH 2ZWLH 4K2YA 3MU0A 1VZQH 1C2MA 1T8LA 1UTMA 1MQ5A 1Y59T 2XW9A 3SYJA 1YKTA 3BTME 1VJ9U 2Z94A 2W6ID 2P3FH 2P8OB 3GY6A 1S6HA 2BXTH 5GWZA 3BIUH 3VXEH 1SGTA 2ANWA 4MPVA 4I31A 4XRNA 1QRWA 2RDLA 4ZAEA 1P0SH 2ZP0H 1NZQH 2FS9A 1UJ1A 1EZXC 2BMGB 1WBGB 1G2LA 5DP9A 4X2YA 3S0NA 4F49A 1P3CA 1XM1A 3VB7A 1AE5A 2FDAA 4ZXYH 2OBQA 1HJAB 1SC8U 1OWKA 4AC9A 1P11E 1QL8A 1TGBA 1ZLRA 1WV7H 1FQ3A 1Y3WA 1CHOG 5F53A 2P16A 4HG6A 4ABIA 1PPEE 3GY2A 1EXFA 2ZHWH 1HAZB 1YBWA 1C1TA 1DY9A 1EPTC 4OS2A 1WDIA 4IGDA 2WV4A 4UONA 3RXHA 3BN9A 3SJKA 4DW2U 5CDFE 4OS1A 5F8TA 1K1OA 1FI8A 2OINA 1S0QA 2ZECA 3MNSA 1AGJA 4Q4LA 2SGEE 3C1KA 4AYVB 4TYDA 5EQSA 1GJBB 3P6ZB 4Y11E 1DM4B 1C5RA 4XOJA 1GG6B 4ASHA 1TGTA 4X6MA 4H42U 1ESAA 2AMQA 3MTYA 3V12A 1ZTKA 3SZNA 4AFSA 1EB1H 1EB2A 7LPRA 4B1TA 1FUJA 1GJ7B 1ZTLA 3KGPA 1C2HA 3F9EA 4K8BA 1L2EA 2HLCA 3A80A 4DG4A 1VCPA 1N6XA 1TGNA 1LVYA 2VVUA 5FCRA 3ZZCA 2TGPZ 1UVSH 1C5PA 1O2VA 3O8DA 3VEQB 3H5CB 1J16A 3IG6B 3OYPA 2ZG0H 2STAE 2GCTC 8KME2 4ZUHA 3ZVDA 1SGRE 1CGJE 1YF4A 3EE0B 3MHWU 1TNLA 1SR5C 3RXFA 3UUZA 1DXPA 2CHAC 3RXMA 5FL7D 4DT7B 1D9IA 5EW1H 1V2OT 2YOLA 2KZ4A 1FZZA 2HALA 4D7GA 4FU9A 4NWKA 1J15A 1BIOA 1Z1IA 1HAVB 4XBBA 1C1PA 3CENA 3H7OA 2A31A 4AFQA 1O3IA 5EJ1A 1ZHRA 1MKWK 2TPIZ 2GVFA 1P2IA 1BT7A 3S69A 1HAVA 4JMYA 1PQAA 5KEDA 1W3CA 1ZOMA 2QIQA 3F0PA 3QTVH 3UQVA 4B73A 1O3FA 4U2WA 3URDA 4KGAA 5H4IB 1A46H 1YCPK 3ZVBA 1XX9A 3WY8A 1KXEA 2V35A 1J14A 3RU4E 2FPZA 2W3KA 5AVDA 3PMHB 2FOAA 3F9HA 3N7OA 1GWAA 1Y3UA 1SLUB 2VWOA 3RXPA 3M7UA 3V0XA 1JRSA 4THNH 3ZZ7A 1ELFA 3SNDA 2K1QA 2EEKA 1N6YA 1E38B 2XNIA 3O8BA 3KL6A 1PQ7A 2PP6A 4Y8XA 4RSPA 4INKA 1AZ8A 1DPOA 4Q7XA 4RKJB 4CRAA 4GAWA 2D2DA 4OM9A 5HYOA 7ESTE 1EZQA 1IHSH 1A4WH 3A7WA 3E3TA 3RM2H 2OD3B 1EUFA 4BAMB 2V0BA 3RXCA 1M9UA 2BDBA 1RD3B 2HRVA 4B75A 3M61U 2J95A 4ACAA 1BB0B 2TGTA 2Y5GA 2W5EA 3SGBE 5C67A 2A0QB 4YTAA 1WTGH 1PPFE 2CF8H 1MMJN 3SUGA 3RU4D 4KELA 3A88A 2C8XB 2H9TH 1PQ5A 1S6FA 3KQDA 1TNIA 1C5VA 3TNSA 2HNTF 3CS7A 4ZCNA 2AERH 1C5UA 3LGIA 4DOQA 1N8OC 5B6OA 3F3BA 6GCHG 1SGPE 2ZU4A 1YC0A 5DO4H 2G55A 4B6FA 4LXBH 3SI3H 5GCHF 2YMSB 2BDHA 1FJSA 1UVOA 3SU2A 2BLWA 1OWJA 1GPZA 2P95A 1PPZA 6CHAC 1GCDA 2BLQA 2CJIA 5DP8A 1C9TA 3TGIE 1B7XB 2QCYA 1TRYA 2ANYA 2W26A 1A3EH 2ZFTA 3NXPA 5F8XA 1AN1E 3ZZ4A 4Q7YA 2ODPA 2TRMA 1W11U 1SGDE 4R0IA 1IHTH 5IDKA 5HKKD 1V2JT 1WYKA 2A5AA 4UE7H 1AQ7A 3SJ9A 2I6SA 1YPJH 2R0KA 2ZFPH 3KQ5A 1C2JA 1C9PA 4X6NA 1G30B 1PPGE 5C1XA 1C2KA 4CRCA 5EQQA 2HOBA 1TQ0B 3TVJB 5LPEA 4B2BA 2ZGCA 3Q76A 1W12U 2WPLS 3T2NA 3UWJH 4YM9A 5E2OA 2ZFFH 4Y79A 2EI7A 1DICA 1Y5AT 1H9HE 3RC6A 3P70B 3SU3A 2FESH 4FUHA 5HIYA 3UNRA 3RMMH 2A4OA 2OC0A 3K6ZA 4KTCA 2FLRH 1MH0A 1K1JA 1O2JA 1TPAE 3U9AH 4D9QA 4U30A 5IK2D 1BITA 2A7CA 2XBVA 3A81A 4P00A 2BY5X 1OYTH 1YLDA 5DN6D 2ILNA 3M35A 2EI6A 3ZVAA 1GMCF 1V2MT 1BRUP 4FUJA 4Y6DA 1MTNC 2WYJA 1MBQA 4B71A 1BHXB 1LVMA 1T8OA 2DUCA 1VGCB 3MI4A 4I86A 4DGJA 3QZRA 1XXFA 4LZ4B 4FVDA 1H4WA 1JOUB 1UVTH 4B6EA 1WQVH 4D9RA 5IYTA 5AF9H 5A8YA 3DSGA 5EPYA 4FXGH 3A87A 3A82A 1VCQA 3U1JB 3GCHC 4DVAU 1FLEE 2ZHQH 2XWBI 4Q80A 5HXFA 5BRRE 1O3LA 2M2AA 2ZQ2A 3ATKA 1Y3VA 3BTDE 4E06H 1BBRK 3UR6A 1ZSLA 2HWLB 3RXGA 5DK1A 2PGQB 2NU2E 3FZZA 3RXJA 6ESTA 4ABJA 5DG6A 4GHQA 1IQFA 1IQKA 1YPGH 1TYNA 1DWBH 1DANH 1TE0A 2ZI2H 4O3TA 1KXFA 4XD7D 1VITF 1DLKB 1GJAB 2ZGBH 2JDID 4E7RG 1HXEH 4NA7A 3EGKH 2VGCC 3BTQE 4TPYA 3RUOA 3SW2B 4ZHLU 1C5WB 2KFWA 3NKKA 1PJPA 2KR7A 1K1PA 3E0PB 2XWAA 1GVLA 3MYWA 1GI9B 3M3SA 3AK5A 4NZLA 5FXLA 4TT3D 2FX6A 1CU1A 2Y82A 4I8GA 1SGQE 4NA9H 4I7YH 2WUBA 1AZZA 2Z9JA 1DWCH 3SI4H 1TOMH 1TX6A 5E0HA 1THSH 4AB8A 1BMMH 2GGVB 3EA7A 1B5GH 2WZQA 3GCTF 1GCTC 1GJ6A 2SFAA 3BSQA 4BOHA 1VCWA 3TH3H 2HGTH 2JH6D 3F2FA 4HI3A 1XUHA 3PM3A 2ANMH 2AGEX 1Z8RA 5DP7A 1RFNA 5F6MA 4AYYB 1NRRH 1SOTA 2A1DB 3AASA 2ZGJA 5E0JA 5LPFA 1ZHMA 1O3CA 1TABE 1GJ9B 2O8TA 1Y3YA 3BTEE 2ALPA 2C93B 2JETC 1OP8A 3UIRA 1F0RA 1BBRE 2GV6A 3TJOA 1HGTH 2ZFQH 3UOUA 1QJ6B 1BBRH 4HZHA 2BDCA 2ZHFH 4KTSA 1C2IA 4I8KA 1W7GH 3BTHE 4YT7H 3STIA 2BVRH 2J94A 1HAYB 4KTUA 2H9EH 2VIPA 2WPDD 3NWUA 4YT6H 2J2UA 1A5IA 1OPHB 1UTQA 2IJD1 1TOCB 1O2QA 4FUIA 1UTNA 3A8CA 3FP8E 1VR1H 3U98H 4IMQA 1QR3E 1HAHH 1EQ9A 3M5OA 2BVSH 1QFKH 1NFWA 1FY3A 1AO5A 2PHBA 3FKSD 2EQNA 3MO9A 2F91A 4CR9A 1C1QA 2VVVA 2BX4A 2B8OH 2W3IA 5A2MH 2G4TA 3LJJA 4NIVA 1ETRH 2A2XH 2ZDAH 3DUXH 2BZAA 1AFQC 1V2QT 4WJG2 1C1MA 4O03A 1BRAA 4WH6A 1V2RT 1LKBA 2PSXA 1SB1H 1O38A 1SBWA 2BD8A 3EYDA 2UUKB 5J4QA 3E0NB 2VH6A 2ZPQA 4JZIA 3FN8A 2LPRA 2YNBA 5CHBA 1HFDA 3ODDA 4X1QU 2FOMB 3VXFH 2BOKA 2F83A 2F9BH 1DSUA 4I33A 1W0KD 1MU8B 4AX9H 4JK5A 4LK4A 3SZEA 1IQHA 3A7VA 3T26A 1OYQA 1MD7A 2AMDA 4WMDA 1WOFA 1CQQA 2LELA 2XNDD 2QXJA 1ABJH 3SJIA 3SUFA 2WV5A 5GCHG 1TRNA 1Z71A 4FUFA 4D8NA 1D3QB 1NTPA 2THFB 2PWXA 5C1YA 5A8XA 1ZPCA 4GHTA 5EOKA 1GMDF 2KCAA 1O32A 1QL9A 1O3HA 2R3YA 3ZV9A 1GBHA 1QURH 2H2ZA 3BTFE 4BTUB 3FOAA 2CK3D 5HIZA 1C4V2 1D4PB 1JMOH 1LHCH 2J38A 3TIUA 3NCLA 3UTUH 3HPTB 3E90B 1AB9C 4ISNA 2FI4E 3ZYEA 2GCHG 5JBTA 1W14U 2ZU1A 3SV2H 1MTUA 1AU8A 3PWCA 1W13U 3L3TA 4CHAC 7GCHF 3SV9A 1Y5BT 3SHAH 1BTXA 1BCUH 4WMEA 3U1IB 3NK8A 1E79D 1SG8B 1GBDA 1RS0A 4NA8A 1QQUA 1ZRKA 2GMTC 2ZDLA 2BDAA 1CBWC 2Z3DA 1L4ZA 5A0AE 2G51A 4M9FA 1KTTB 1KXBA 3KIDU 1O39A 5EIYA 3QTOH 5KECA 2VIVA 4ZKSU 2BD9A 1XUJA 4JCNA 1BTUA 4WVPE 3U8TH 5CHAB 1GMCG 4IW4E 1CT0E 2ZNKH 2CMYA 1ELVA 4CRFA 1VITH 1TMUH 4VGCC 3BTGE 1F5KU 3SGAE 1CT4E 1D3PB 2BZ6H 1P09A 4GSOA
chains in the Genus database with same CATH topology
2YMSC 5ETXA 3EYDA 2XCNA 2KFWA 1E1QD 1E1RD 2OK5A 3SUEA 3FN8A 4F55A 3SU1A 2OBQA 2OC1A 2KR7A 3KNXA 1EFRD 2GVFA 3DSPA 5CHBA 5C0TA 1BT7A 4B76A 1NBME 3F2GA 2KM0A 3AK5A 4TT3D 2FOMB 1CU1A 3OE7D 5DSFA 3UB0A 1OHHD 5C17A 5HKKD 4JMYA 1A1RA 3N7EA 5IDKA 1W3CA 2L6OA 2OC8A 3F0PA 5F53A 4I33A 4I32A 1W0KD 1RGQA 1N1LA 4B73A 2GGVB 4FETA 1MABB 3SZEA 2IJOB 4A1XA 4A1VA 2WZQA 2WV9A 5EQQA 5H4IB 4TSFD 2KCYA 3DCLA 4ASUD 2KCPA 2LELA 3SV6A 3O8CA 2OBOA 2XNDD 3OEHD 4U01A 1DXWA 3ZIAD 3P8OA 3SU0A 3M5LA 2HLDD 1H8HD 3F2FA 2KCOA 1DY9A 3SUFA 1RTLA 3WWFA 3WWBA 1NBMD 2A4RA 5EQRA 2QF4A 3F0OA 3PV2A 3RC6A 5CDFE 2K8IA 2OINA 3SU3A 2QE7D 1SKYE 2J5UA 1FX0B 3N99A 4Q4LA 3RC5A 2OC0A 2KCAA 2QF5A 2WHXA 3P8NA 2K1QA 4KTCA 2XNIA 2QV1A 4TYDA 5EQSA 5FPTA 5B6LA 1WXRA 5IK2D 3O8BA 3KEEA 4WH8A 4A1TA 4RI0A 4R8TB 3FOAA 2CK3D 5DN6D 3FO8D 2XOKD 3L6PA 4YXWD 1COWD 3LOXA 4OM9A 3NRLA 3SV7A 3WW7A 1JXPA 3PV5A 4B71A 2AHME 2F4LA 3E90B 2F9VA 3DSOA 3H09A 3OFND 5GJ4B 3LKWA 2A4GA 1DY8A 1W0JD 2JJ2D 4K8BA 3SUDA 2WPDD 5GNDA 3SV9A 2VBCA 3GS9A 4B75A 4Z1MD 1KMHB 2IJD1 3LONA 5FPYA 2FP7B 3SU5A 1S6LA 3U1IB 5ESBA 2P59A 1E79D 3OEED 3SU6A 5T1VA 4B6EA 1NS3A 2YMSD 4A92A 2A4QA 4NWLA 3F2HA 5EPYA 3O8DA 5FPSA 3SUGA 3U1JB 3M5OA 3N7DA 4WF8A 3OYPA 2W6JD 4M9FA 5GPIB 2O8MA 2M2AA 3FKSD 3M5MA 3SYJA 2OC7A 3SV8A 2V7QD 2XCFA 3SU4A 2W6ID 2FM2A 2F43B 1H8ED 4ZCNA 1BMFD 3O8RA 1DXPA 2JIZD 3OAAD 5C0UA 3F3BA 2WSSD 4Q63A 4B74A 4DT4A 3OTPA 3PRBA 4I31A 5FL7D 2F9UA 3KF2A 3RC4A 4B6FA 3M5NA 3VG8A 5EPNA 2YMSB 2YOLA 2KZ4A 2JJ1D 3KN2A 3PRDA 3SU2A 4XD7D 2K0QA 4WH6A 4NWKA 2JDID 3W1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FN8 A;  5C17 A;  3F0P A;  3F2F A;  5C0T A;  3F0O A;  3F2G A;  3F2H A;  5DSF A;  5C0U A; 
#chains in the Genus database with same CATH topology
 1HPG A;  4IMZ A;  3E91 A;  2JH5 D;  4TWW A;  2XCN A;  1ZJK A;  4ZXX H;  4NFE A;  1O5C B;  1UK2 A;  1BQY A;  2BY9 X;  1H1B A;  2ZZU H;  4X8U H;  4EST E;  3T5F H;  4IBL H;  3PTN A;  1KLI H;  1TPP A;  4YZU A;  1JWT A;  1V6D A;  1A1R A;  2L6O A;  2OC8 A;  2J9N A;  2WIN I;  1U6Q A;  3TJN A;  2C8W B;  3RP2 A;  2J92 A;  1GVK B;  4ZHM U;  4TY6 A;  1FY5 A;  1MAB B;  2IJO B;  4WWY A;  5SGA E;  1LHE H;  4TSF D;  2HPP H;  3RXV A;  1W0Z U;  2SGP E;  3RLY H;  1ZGI A;  4TPI Z;  3MH7 A;  5K0H A;  4AG2 A;  3R0F A;  2R0L A;  1HAO H;  2BM2 A;  5JB8 S;  3BEU A;  2Q6G A;  1HBT H;  4F48 B;  1TNH A;  1VIT G;  3U69 H;  3UY9 A;  4ABE A;  3PV2 A;  1PFX C;  3MU1 A;  1Z8J B;  2Y5F A;  1O5G H;  2ZFS A;  1EAS A;  1XKA C;  3DFL A;  4YLU A;  1H8D H;  4UFF H;  1H9L B;  5AFZ H;  3LC3 A;  3SNA A;  1VJA U;  3A86 A;  4X2V A;  2FWW A;  3LOX A;  1HXF H;  1Q3X A;  5AFY H;  1FPH H;  4J1Y A;  3HAT H;  4YOI A;  3PMB B;  1S83 A;  1V2L T;  3LGV A;  3I29 A;  2A4G A;  1TMT H;  1Y5U T;  5EXN A;  2UUY A;  2VBC A;  1J9C H;  2XBY A;  1K0H A;  4H6S B;  1FIW A;  3RXK A;  3TH2 H;  3F2H A;  4E05 H;  4BXS A;  3K2U A;  1GMH F;  1KY9 A;  2FIR H;  4BTI B;  1P2K A;  3M7Q A;  4CRG A;  1IQL A;  2BY8 X;  5L2Z H;  2FTL E;  4UFD H;  1BA8 B;  4JYV H;  2PW8 H;  1EAI A;  3SQH E;  1SMF E;  1K9O E;  4OS6 A;  5C0U A;  4BNR A;  3LT3 A;  2H1U A;  3VG8 A;  1ESB A;  2FMJ A;  3UWI A;  3T62 A;  1O36 A;  1YWU A;  2Q6F A;  3P95 A;  4ZH8 A;  3AW1 A;  1O2K A;  4TY7 A;  3SNE A;  3ZZA A;  4JYT A;  1O5B B;  1GBI A;  2QYI A;  1SGF A;  1AWH B;  4Y71 A;  4F55 A;  3GDV A;  1ELC A;  1QIX B;  1NRQ H;  2GT8 A;  1P04 A;  2PLX A;  3OE7 D;  4FUG A;  5C17 A;  2IOT A;  1GHZ A;  2ZHE H;  1FON A;  2ZGX H;  1O2M A;  3A89 A;  4A1X A;  1UCY H;  4XBD A;  5F03 A;  3GCO A;  1NFU A;  2O8U A;  1AHT H;  1EST A;  4FUC A;  3QDZ B;  5GIB A;  3SU0 A;  1UW7 A;  1OXG A;  1IQM A;  3BIV H;  1FN8 A;  1FPC H;  4Q7Z A;  2Z7F E;  1W0Y H;  2G5N A;  1ETT H;  2ZU3 A;  1ZPZ A;  3KQE A;  4ACB A;  1NBM D;  4YO9 A;  2FOD A;  3PRO A;  1NT1 A;  1O5D H;  2FOE A;  2NU4 E;  1LPZ B;  3Q3K A;  4WXI A;  4F4O C;  2UUJ B;  4XSK U;  1SQA A;  2YNA A;  5FCK A;  4P02 A;  3ATI A;  2Z6B D;  3DHK H;  1KLJ H;  5EST E;  2ZDV H;  2TIO A;  1J17 T;  2Y7Z A;  3ZVG A;  2AH4 X;  5EJL A;  1C5Y B;  1LHD H;  4OS5 A;  1NRP H;  4X2X A;  5GJ4 B;  2FOC A;  3SOR A;  4AB9 A;  5T3H A;  4GVU A;  1EZU C;  2OTV A;  2DE8 A;  1C2E A;  1O2P A;  4GPG A;  2GT7 A;  3LU9 B;  2Z3E A;  2XTT B;  5FPS A;  2NU3 E;  1C1R A;  2W6J D;  4CRE A;  1T7C A;  1WCZ A;  4CH8 B;  3UFA A;  1PQ8 A;  3QGN B;  1EKB B;  2V7Q D;  1ELG A;  3SU4 A;  3MH4 A;  1BMF D;  1FXY A;  5HMA A;  1XKB C;  1NES E;  4Y10 E;  2ZA5 A;  3A85 A;  3RMN H;  3RXO A;  1ELT A;  4UDW H;  3RXI A;  1LVB A;  3M36 A;  2FI3 E;  3OSY A;  3PRD A;  3ZZ6 A;  2QXG A;  2Y6T A;  1C1W H;  2Z9I A;  3K9X B;  1C5Q A;  1AUJ A;  4K69 A;  1ANE A;  1P9S A;  1O5F H;  4NSV A;  1BRC E;  1T4U H;  2WYG A;  3MO6 A;  3DT0 H;  1F92 A;  3PO1 B;  1UK3 A;  4IC5 A;  4JK6 A;  5DP3 A;  2G8T A;  1GBL A;  1AMH A;  3F2G A;  4YOG A;  2EST E;  5TJX A;  1QBO A;  1SQR A;  2O9Q A;  4X2W A;  2UWL A;  1V2T T;  2KCY A;  3GYM A;  3SV6 A;  2GV7 A;  1UTK A;  1XVO A;  3U8O H;  1O2U A;  1D3T B;  2KAI B;  3A7T A;  2ZF0 H;  1NU7 B;  1P05 A;  1TA6 A;  2P3T B;  2V3H H;  4CRB A;  1RTL A;  3WWB A;  1GI6 A;  1TON A;  2H5C A;  4X0W U;  3GIS B;  2QF4 A;  2UWO A;  2FYQ A;  4IC6 A;  3TNT A;  1QZ8 A;  3FZD A;  2KAI A;  4MNX A;  1LQE A;  3N99 A;  3CS0 A;  3MOC A;  3S9B A;  2WHX A;  1DIT H;  1ORF A;  2FOB A;  1OS8 A;  1MKX H;  3D49 H;  3VGC C;  4WH8 A;  3KYF A;  3A7Z A;  1O2G H;  4MQA A;  2WPM S;  9EST A;  1WQS A;  3L6P A;  2NWN A;  3TK6 A;  5FX6 A;  1HJ8 A;  1SQO A;  3SV7 A;  3VB4 A;  4IN2 A;  1IAU A;  3RXE A;  3RDZ A;  4O9V A;  1TX8 A;  1TA2 A;  1P3E A;  2AIQ A;  4BAN B;  2IN2 A;  4HTC H;  1MZA A;  2A7H A;  5DKM A;  1O3G A;  2FEQ H;  5GND A;  1KMH B;  3OX7 U;  2EC9 H;  3OEE D;  1VKY A;  1NS3 A;  2SGF E;  1L0Z A;  3TPI Z;  1O5E H;  3LH1 A;  4Z6A H;  5JDU B;  1EAT A;  1J8A A;  2SGQ E;  2XRC A;  5DGJ A;  2OLG A;  2ZFR H;  3MMG A;  4SGA E;  3BF6 H;  1TB6 H;  1AKS B;  1MTW A;  3ODF A;  1WTH D;  3O8R A;  1OOK B;  1GCT B;  1ZSJ A;  4LZ1 H;  1GHA F;  4YES B;  3ZZ8 A;  1CA0 C;  4OGY A;  1ELA A;  2W7U A;  3MWI U;  4FOU C;  2F9U A;  1C2F A;  3TU7 H;  5EPN A;  1V2V T;  1Y8T A;  3F68 H;  3Q3X A;  1WU1 A;  2QAA A;  1OSS A;  1AKS A;  3E1X B;  4KKD A;  3ATW A;  1V2K T;  3FP6 E;  4ABH A;  3PMJ A;  1O3E A;  1GL0 E;  5A0B A;  2YMS C;  5ETX A;  1G3C A;  1EOJ A;  1GJ8 B;  3AW0 A;  2STB E;  1G3D A;  4X6P A;  1IOE A;  8GCH F;  1L1N A;  1SLV B;  2VWM A;  4ABD A;  3A7X A;  1LO6 A;  1S85 A;  1P01 A;  1ABI H;  1OHH D;  1HRT H;  2FOF A;  2D1J A;  1P02 A;  1T8N A;  1C5X B;  1N1L A;  4Y8Z A;  2QC2 A;  2O8L A;  1TAL A;  5A8Z A;  2P3U B;  3PV4 A;  1H9I E;  1C5M D;  3OEH D;  2XC4 A;  1YLN A;  3FAN A;  4NFF A;  1FY4 A;  1KXA A;  2TGD A;  1FN6 A;  3WWF A;  1KXD A;  1HJ9 A;  1XMN B;  2ZCK P;  3HGP A;  4MPW A;  1BTP A;  4AOQ A;  3S9C A;  4DCD A;  3EQ0 H;  1DDJ A;  3P8N A;  5FPT A;  1AUT C;  1UO6 A;  1C4Y 2;  1D6R A;  3E6P H;  3KCG H;  3QWC H;  3EE7 A;  2FX4 A;  1GI2 A;  3RU4 T;  2ZO3 H;  3RM0 H;  2ASU B;  3PTB A;  1HCG A;  5JBB S;  1W8B H;  4D7F A;  1JXP A;  2PKS B;  1QQ4 A;  4AN7 A;  1SL3 A;  2AHM E;  3BEF B;  1IQG A;  4AFU A;  5CMX H;  1GBK A;  2PKA B;  8LPR A;  1C1N A;  1AD8 H;  1ETS H;  1ZMJ A;  2BYA X;  1A2C H;  1W0J D;  5DP5 A;  1YCP M;  1YPK H;  1RXP A;  1LCY A;  3VFE A;  4Z1M D;  3OU0 A;  3SU6 A;  5DP6 A;  1HUT H;  1EX3 A;  1RTK A;  3LGU A;  4NWL A;  2PKA A;  3P8G A;  3B9F H;  1QL7 A;  1FV9 A;  1C1V H;  1Q2W A;  3OY6 U;  1L4D A;  2GTB A;  3TLO A;  1LDT T;  4D76 A;  1H8I H;  2VIO A;  1GBC A;  1O3M A;  4UD9 H;  5DP4 A;  3MNB A;  1YPM H;  4MNW A;  2L74 A;  3A8D A;  2RCE A;  1P57 B;  3AVZ A;  3F9F A;  3RXU A;  4XE4 A;  1UTJ A;  1BHX F;  2BX3 A;  4MPU A;  4AZ2 B;  1O33 A;  1ZHP A;  1DT2 A;  3RXD A;  2AGG X;  1C2D A;  1NRO H;  2W7S A;  1PPB H;  2FS8 A;  3GY7 A;  1O3K A;  4QT8 C;  3GY5 A;  5E2P A;  2SGD E;  3GYL B;  1QA0 A;  3BTT E;  3SGQ E;  2B7D H;  2ZU5 A;  1MCT A;  3DFJ A;  2OK5 A;  3KNX A;  3LJO A;  3LPR A;  1EFR D;  3M3T A;  4INL A;  2FTM A;  1C5S A;  1EP6 A;  4YOJ A;  5C0T A;  1SLW B;  2V3O H;  1XUG A;  5EG4 A;  4B76 A;  1F5L A;  2FO9 A;  1NC6 A;  3BG4 B;  4I8J A;  3N7E A;  3LH3 A;  1CA8 B;  1S81 A;  3MH5 A;  1BZX E;  1P2O A;  3T28 A;  4K60 A;  1SGC A;  2VB0 A;  1RIW B;  1TGC A;  1DS2 E;  3QZQ A;  4ASU D;  2RFK C;  4KP0 A;  4U01 A;  4Y8Y A;  3SN8 A;  1TQ7 B;  1EJM A;  5JBA S;  1C2G A;  1WUN H;  3PB1 E;  4O3U A;  3ZYD A;  2Y5H A;  3UR9 A;  2QA9 E;  2G81 E;  4DJZ B;  3VB6 A;  1INC A;  4DY7 B;  2HVX A;  3F0O A;  3W95 A;  1EJN A;  2PUQ H;  3C27 B;  5E0G A;  1GBF A;  5JPM H;  3Q3Y A;  3IIT A;  1MU6 B;  3SNC A;  3ZZ9 A;  1SHH B;  2BY6 X;  1A5G H;  5C94 A;  4R8T B;  1ELD E;  3PLP A;  2V3M A;  3EAJ A;  3MH6 A;  4YXW D;  1SI5 H;  2RDE A;  3NUM A;  1RRK A;  2QF3 A;  1QJ7 B;  2EY4 C;  2TBS A;  1XUF A;  2P94 A;  1BTW A;  3HK6 B;  4FUD A;  1GGD C;  3GCN A;  3MU8 A;  4BXW A;  2F4L A;  4DUR A;  3H09 A;  1TGS Z;  5JYI A;  1O2W A;  2B0F A;  2WPI S;  2BLO A;  2LNC A;  1DWD H;  3SUD A;  2XBW A;  3GS9 A;  1OWD A;  4E7N A;  1KXC A;  3GDS A;  2Z9G A;  3IWM A;  3RXL A;  2GZ7 A;  5TCC A;  1TNK A;  1SLX B;  2SNW A;  1SOZ A;  1GJ5 H;  1P2J A;  2OQ5 A;  3M7T A;  3N7D A;  2XBX A;  1UTL M;  1MAX A;  1DUA A;  1O2O A;  4RKO B;  2BD5 A;  3T27 A;  3A8B A;  2ZDN A;  3HKJ B;  1S84 A;  2PSY A;  1O3N A;  1B0E A;  2Y81 A;  5I46 H;  3A83 A;  2FM2 A;  2QN5 T;  1O0D H;  3A8A A;  1P03 A;  1TPS A;  1HNE E;  4GCH F;  1LPK B;  1ZYO A;  1NRN H;  2AYW A;  1SFI A;  3V13 A;  4WXV A;  1JRT A;  2IPH A;  4AG1 A;  1KDQ B;  1OWI A;  5E8E H;  3GOV B;  3ZVE A;  1E1Q D;  1E1R D;  1HAI H;  3F1S B;  1P06 A;  1YPL H;  2VID A;  1FNI A;  2BHG A;  2ZEB A;  3AAV A;  1KDQ A;  1SFQ B;  1T8M A;  1EJA A;  1GBA A;  4DIH H;  4A6L A;  3ZVF A;  1EPT B;  2PGB B;  1O37 A;  1MD8 A;  3O8C A;  3TK5 A;  2OBO A;  1ZPB A;  4X8S H;  3S7K B;  2GJG A;  3DD2 H;  1E34 B;  3ZZ3 A;  4CBO A;  3S7H B;  3LIW A;  1GJ4 H;  1MCV A;  1TNJ A;  4WMF A;  2AS9 A;  4B2A A;  2VNT A;  5EQR A;  1EPT A;  3GDU A;  3RMO H;  1SPJ A;  3QK1 A;  4MG3 A;  1G3B A;  1G9I E;  3QO6 A;  5C5O A;  1HYL A;  3TGK E;  3TGJ E;  1FX0 B;  3TK9 A;  2DE9 A;  3HK3 B;  4MTB A;  1ACB E;  2QXI A;  2PTC E;  4CR5 A;  3LGW A;  1GHB F;  2Q1J A;  5A09 A;  1CE5 A;  1FY1 A;  2A7J A;  3NRL A;  5HGG A;  2H6M A;  3JZ1 B;  3V3M A;  1OX1 A;  1UK4 A;  1CT2 E;  3JZ2 B;  1SGY E;  2ZTZ A;  2FI5 E;  1K1M A;  1QBN A;  1EOL A;  2ZCL P;  3RXS A;  3U28 C;  1O5A B;  1NFY A;  1MBM A;  2CGA A;  4FU8 A;  1GBT A;  1NU9 A;  1O2R A;  2GZ9 A;  3MNC A;  1K22 H;  5FPY A;  3SQE E;  1O3D A;  2GCT B;  3SNB A;  2FYR A;  3VB3 A;  2YMS D;  3PYH A;  1JIR A;  4UFE H;  2A4Q A;  4ABF A;  2BDG A;  1UCY K;  2HPQ H;  1BUI A;  2AEI H;  1O30 A;  1ZTJ A;  1DVA H;  2CHA B;  1A5H A;  1SGE E;  3PLK A;  1Z6J H;  2ZDK A;  1GVZ A;  3GCT G;  4YLQ H;  5T6D A;  1UMA H;  4FU7 A;  4DT4 A;  1L1G A;  2C90 B;  2V6N A;  1QB9 A;  1NY2 2;  2ZPS A;  3KF2 A;  1CVW H;  1F7Z A;  1GHY H;  1RTF B;  2QXH A;  3B8J A;  4INH A;  2K0Q A;  5CHA C;  4Y0Y E;  5FX5 A;  3HKI B;  1GI5 A;  1TX7 A;  5JBC S;  1NM6 A;  1TBQ H;  1BML A;  3CP7 A;  3ZZD A;  1QA7 A;  1V3X A;  1A0L A;  2OUA A;  2VWL A;  4M7G A;  3SO3 A;  1SSX A;  3I77 A;  1TFX A;  1AE8 H;  1NBM E;  3UB0 A;  2VIQ A;  1YLC A;  2P93 A;  2RA3 A;  4Y0Z E;  2BQW B;  1GJC B;  3RML H;  1AI8 H;  2BD7 A;  2CXV A;  2P8O C;  3P8F A;  3DCL A;  1O2T A;  4UFG H;  1JBU H;  1GDN A;  1RJX B;  2D26 C;  2ALV A;  2KX4 A;  1DLE A;  3R3G B;  1T31 A;  3M37 A;  4MDS A;  1UTO A;  2XC5 A;  4K1E A;  4BAQ B;  2ZQ1 A;  2BVX H;  1KYN A;  1L1J A;  2K8I A;  1GHX H;  5L6N H;  2VH0 A;  1TBR H;  2O8W A;  3ZZB A;  1HJA C;  2QF5 A;  3PWB A;  1UCY E;  1GI7 B;  4I8H A;  1TIO A;  4ABB A;  1CO7 E;  1Z8G A;  1BOQ A;  4FVB A;  4OS4 A;  4UEH H;  3MU4 A;  3ZZ5 A;  4RT1 A;  1GBM A;  1O2N A;  2WPJ S;  2ULL A;  3RXB A;  2QF0 A;  1F0T A;  3AAU A;  4K8Y A;  1GI4 A;  2GD4 B;  5LGO A;  3DSO A;  1QNJ A;  5C5N A;  3FP7 E;  3Q77 A;  3UNQ A;  1C1U H;  3LDX H;  1NFX A;  2RG3 A;  1GDQ A;  2C4F H;  4NSY A;  3E16 B;  4NIW A;  4K3J A;  1TNG A;  3D23 A;  3UOP A;  2GZ8 A;  1BMN H;  2XC0 A;  5ESB A;  2P59 A;  1GI1 A;  1LPG B;  1YPH C;  3RXQ A;  3URE A;  2J97 A;  4A92 A;  5L2Y H;  2C8Z B;  3KHV A;  1EZS C;  1OKX A;  4A5T S;  1TLD A;  2F9P A;  1N8O B;  2OP9 A;  1UHB B;  3P92 A;  5F8Z A;  3UAI C;  3M5M A;  1C1S A;  4H4F A;  1GG6 C;  3SV8 A;  2WPK S;  2HVY B;  2FOH A;  1NRS H;  1H8E D;  4ZMA H;  2A5K A;  5TCA A;  2JIZ D;  3OAA D;  2G00 A;  2BQ7 B;  1C5Z B;  1QCP A;  2BQ6 B;  2ZPR A;  6CHA B;  1UHB A;  2AMP A;  1K1L A;  4MNV A;  3T29 A;  1MKX K;  2VIW A;  1MZD A;  1ELB A;  1O2Y A;  1W2K H;  2UWP A;  3RXT A;  3SBK A;  8EST E;  1GMD G;  1G37 A;  1HAG E;  1SGN E;  1GI3 A;  1P8V C;  5PTP A;  3SUE A;  4JZ1 A;  2HNT C;  1ARC A;  1PPH E;  1A0J A;  2F9N A;  3VGC B;  2VIN A;  3I78 A;  1QB1 A;  4WY3 A;  4Y7A A;  4I32 A;  1LVO A;  4CH2 B;  1ZGV A;  1GHV H;  1OP0 A;  1CHG A;  1DFP A;  1F2S E;  1JIM A;  1V2S T;  2BDI A;  3ZIA D;  7KME H;  1H8H D;  4GCH G;  2VWN A;  4X6O A;  7GCH G;  4MPX A;  3K65 B;  3FVF B;  1V2W T;  1YM0 A;  1A61 H;  1O3A A;  1QGF A;  4Y76 A;  1Z7K A;  2XXL A;  1YP9 A;  4K1T A;  1ANC A;  4AFZ A;  1QB6 A;  1MTN B;  4BAO B;  3ZVC A;  4ISH H;  1MKW H;  4FUB A;  1DX5 M;  1CA0 B;  1E37 B;  4O97 A;  2H9H A;  3PV5 A;  1DST A;  2Y7X A;  3GY8 A;  2SGA A;  4NGA H;  3ATM A;  1QRZ A;  2PV9 B;  6LPR A;  1O2S A;  2OXS A;  3RLW H;  3U8R H;  4Q2K A;  1BJU A;  3STJ A;  3CNR A;  3GY4 A;  1G32 B;  1B0F A;  1O34 A;  2FP7 B;  3GCH B;  4OS7 A;  1YCP H;  5C1U A;  5T1V A;  3VB5 A;  4ZKN U;  1O2Z A;  3BTK E;  4OGX A;  3D65 E;  3EA8 A;  1K28 D;  3GY3 A;  2CF9 H;  3TJU A;  2GKV E;  4X1S U;  1PYT C;  5GXP A;  2BY7 X;  4H6T A;  1D3D B;  3KYG A;  4ISO A;  4SGB E;  1HB0 B;  2XCF A;  1ID5 H;  5AHG H;  2F43 B;  3LC5 A;  4MLF B;  1GHB G;  4X8V H;  1AIX H;  4MNY A;  4X1R U;  1LQD B;  1GI0 A;  3UPE A;  1TWX B;  5I25 A;  3D62 A;  3ENS B;  4NG9 H;  3RC4 A;  3QUM P;  1T4V H;  1O2H A;  1EAW A;  5GDS H;  1XUI A;  2A5I A;  2GDD A;  2VGC B;  1C1O A;  2BB4 A;  2JJ1 D;  4NCY A;  2GCH F;  1DE7 H;  2ODY B;  1YPE H;  2RA0 A;  2BXU H;  1C5N H;  3BEI B;  3MFJ A;  5FAH A;  3DA9 B;  1YY3 A;  2FXR A;  1ZML A;  1UTP A;  5C3N A;  3QLP H;  3BV9 B;  2NU0 E;  3SU1 A;  1C4U 2;  2OC1 A;  1WSS H;  3EST A;  1A0H B;  2A45 B;  2KM0 A;  2FOG A;  4PRO A;  1K21 H;  3ATL A;  2B5T B;  2WUC A;  2EI8 A;  3RXR A;  3PO1 C;  2G52 A;  2NU1 E;  2GX4 A;  2BOH B;  1RGQ A;  3KQC A;  1S82 A;  1ARB A;  1V2N T;  1NO9 H;  4FET A;  1GHW H;  1F0U A;  2BD3 A;  3MU5 A;  3SHC H;  1SQT A;  1GL1 A;  1DWE H;  1E36 B;  3M5L A;  2J34 A;  3QGJ A;  1FY8 E;  2Z9K A;  1ZSK A;  4BTT B;  3PLB A;  2VU8 E;  5EU8 A;  1WAY B;  4K5Z A;  1P10 A;  1GMH G;  2QE7 D;  4FUE A;  1C2L A;  2ZTY A;  1Z6E A;  1A3B H;  3NZI A;  2JET B;  3RC5 A;  4J2Y B;  3P17 H;  2J98 B;  5B6L A;  4AGK A;  3KEE A;  5G4B A;  2SNV A;  5EXL A;  1Q31 A;  1FAX A;  2M5T A;  4JZF H;  1COW D;  5LH8 A;  1HAP H;  1K1N A;  3WW7 A;  1SVP A;  3H7T A;  1G2M A;  2J98 A;  2A2Q H;  4AOR A;  1O35 A;  1Z1J A;  3TJV A;  2J4I A;  4GUX A;  5FHT A;  3LKW A;  1UVU H;  4ZKR U;  1QY6 A;  1AVX A;  1THR H;  5EJZ A;  1O2L A;  1AY6 H;  1LTO A;  3SU5 A;  5DPA A;  5ABW A;  9LPR A;  1LKA A;  1AFE H;  3E8L A;  1C5T A;  2CV3 A;  4X8T H;  1S0R A;  1CHO F;  1HV7 A;  5EXM A;  1V2P T;  2O8M A;  1F5R A;  4ISI H;  1EAX A;  1AFQ B;  1DUE A;  4NZQ A;  1THP B;  2R9P A;  3MO3 A;  1TRM A;  1BTY A;  2WSS D;  4Q63 A;  2BLV A;  4B74 A;  1AVW A;  4MVN A;  2Q6D A;  1IQJ A;  1QBV H;  1YPH E;  4CRD A;  4I8L A;  3UQO A;  1O3J A;  1VGC C;  1XVM A;  2R2M B;  4B2C A;  3MNX A;  3W1E A;  4JZE H;  1XXD A;  3F6U H;  1C5O H;  1ZR0 A;  1QHR B;  4RN6 A;  3RXA A;  1Z8I B;  3A84 A;  1NPM A;  3ITI A;  3DSP A;  1PPC E;  2PUX B;  2H5D A;  1TPO A;  1IQE A;  1KTS B;  2CN0 H;  3OY5 U;  2XYA A;  4IN1 A;  3GIC B;  4AGJ A;  2ZDM A;  1A7S A;  1E0F D;  1X7A C;  5DJ7 A;  4A1V A;  2WV9 A;  1K1I A;  1GGD B;  1QJ1 B;  5FBE A;  1LMW B;  4ABG A;  4CBN A;  3TH4 H;  1O3P B;  2HLD D;  2GDE H;  1E35 B;  2KCO A;  2QGR A;  3S9A A;  2AFQ B;  1FDP A;  1O2X A;  2HNT E;  4X1P U;  1SHY A;  5JB9 S;  4NIX A;  3MQK C;  2A4R A;  2ZU2 A;  3K6Y A;  4ZRO A;  1G3E A;  4Y7B A;  2TGA A;  2VVC A;  3FAO A;  1CSO E;  3NPS A;  3VPK A;  1SKY E;  2J5U A;  3A7Y A;  1TBZ H;  1BMA A;  1HLT H;  1MQ6 A;  1LHG H;  2JKH A;  3B23 B;  1S5S A;  2PR3 A;  1GJD B;  1MUE B;  1O3B A;  2ZCH P;  4RI0 A;  4LOY H;  2G5V A;  1GBE A;  1AB9 B;  3FO8 D;  2XOK D;  1F0S A;  2ZC9 H;  1YGC H;  2F9O A;  1OP2 A;  3PMA B;  4CHA B;  3ELA H;  1IQI A;  2F9V A;  1ANB A;  2D8W A;  2ANK H;  2C8Y B;  2OQU A;  5K7R A;  1SGF G;  2GMT B;  2PKS C;  2BD2 A;  1DY8 A;  2JJ2 D;  1YYY 1;  4GLY A;  4JYU H;  1T32 A;  2R2W U;  2LP6 A;  5HM9 A;  1CBW B;  1S6L A;  2IPQ X;  4HGC A;  1BDA A;  5T6G A;  1EAU A;  2WPH S;  2FLB H;  1W10 U;  1ZMN A;  2OCV B;  4WF8 A;  3SJO A;  3URC A;  2QY0 B;  3Q00 A;  2ZHD A;  5GPI B;  2OC7 A;  1GI8 B;  1HDT H;  1SGI B;  3HGN A;  1P2M A;  4VGC B;  2ODQ A;  2UUF B;  3EDX B;  3TIT A;  1BTZ A;  2VJ1 A;  4A7I B;  5T6F A;  4ISL A;  5CE1 A;  3OTP A;  3PRB A;  3W94 A;  3M5N A;  1FAK H;  5KGO A;  4BAK B;  1QRX A;  1MAY A;  4HFP B;  3KN2 A;  1OWH A;  4RT0 A;  2ZIQ H;  4X1N U;  1MTV A;  5EGM A;  3QX5 H;  4DII H;  2AIP A;  5L30 H;  3QN7 A;  1FIZ A;  4Z0K A;  5LPR A;  1KIG H;  2F3C E;  3FFG A;  5A0C A;  5C20 A;  1O3O A;  1BTH H;  2PTN A;  5DSF A;  4U32 A;  4ABA A;  1TMB H;  2AGI X;  1XUK A;  1P2Q A;  3T25 A;  1HAX B;  1HIA B;  5BPE A;  1O2I A;  1ZJD A;  1KLT A;  4BAH B;  1AVG H;  3UNS A;  2ZKS A;  1O31 A;  1AND A;  3BG4 C;  3V7T A;  1V2U T;  2A32 A;  2KCP A;  4K1S A;  1DXW A;  3P8O A;  3BG8 A;  1HIA A;  2R3U A;  1GBB A;  2GP9 B;  1RIW C;  1BJV A;  3LGT A;  5EOD A;  1OWE A;  1ZZZ A;  1CGH A;  1BRB E;  1AWF H;  1FMG A;  5C2Z A;  1ZRB A;  2ZTX A;  2Z3C A;  1D6W A;  1QTF A;  2PFE A;  3M3V A;  2Y80 A;  4XBC A;  1UVP A;  1C5L H;  1GBJ A;  1Y3X A;  2BDY A;  4JZD H;  5J4S A;  2QV1 A;  1WXR A;  4ZKO U;  1MTS A;  5EW2 H;  3ZV8 A;  1NN6 A;  5HM2 A;  4A1T A;  1IQN A;  1P12 E;  1PYT D;  1GHA G;  2JH0 D;  4TWY A;  4ZHA A;  6GCH F;  1KSN A;  2ZGH A;  4IS5 A;  5FBI A;  2EA3 A;  2G4U A;  1ELE E;  1K2I 1;  4XDE A;  1TAW A;  1GDU A;  3OTJ E;  1P2N A;  3OFN D;  1P9U A;  3F9G A;  3BTW E;  3G01 A;  2Z9L A;  4XFQ A;  1G36 A;  3L33 A;  3KQB A;  1W7X H;  4NIY A;  1CGI E;  3LON A;  8GCH G;  2FZZ A;  2BTC E;  3EA9 A;  3LGY A;  3SOS A;  2I6Q A;  2BD4 A;  2C3S A;  3SJ8 A;  1EP5 A;  2B9L A;  1DOJ A;  1LHF H;  2ZWL H;  4K2Y A;  3MU0 A;  1VZQ H;  1C2M A;  1T8L A;  1UTM A;  1MQ5 A;  1Y59 T;  2XW9 A;  3SYJ A;  1YKT A;  3BTM E;  1VJ9 U;  2Z94 A;  2W6I D;  2P3F H;  2P8O B;  3GY6 A;  1S6H A;  2BXT H;  5GWZ A;  3BIU H;  3VXE H;  1SGT A;  2ANW A;  4MPV A;  4I31 A;  4XRN A;  1QRW A;  2RDL A;  4ZAE A;  1P0S H;  2ZP0 H;  1NZQ H;  2FS9 A;  1UJ1 A;  1EZX C;  2BMG B;  1WBG B;  1G2L A;  5DP9 A;  4X2Y A;  3S0N A;  4F49 A;  1P3C A;  1XM1 A;  3VB7 A;  1AE5 A;  2FDA A;  4ZXY H;  2OBQ A;  1HJA B;  1SC8 U;  1OWK A;  4AC9 A;  1P11 E;  1QL8 A;  1TGB A;  1ZLR A;  1WV7 H;  1FQ3 A;  1Y3W A;  1CHO G;  5F53 A;  2P16 A;  4HG6 A;  4ABI A;  1PPE E;  3GY2 A;  1EXF A;  2ZHW H;  1HAZ B;  1YBW A;  1C1T A;  1DY9 A;  1EPT C;  4OS2 A;  1WDI A;  4IGD A;  2WV4 A;  4UON A;  3RXH A;  3BN9 A;  3SJK A;  4DW2 U;  5CDF E;  4OS1 A;  5F8T A;  1K1O A;  1FI8 A;  2OIN A;  1S0Q A;  2ZEC A;  3MNS A;  1AGJ A;  4Q4L A;  2SGE E;  3C1K A;  4AYV B;  4TYD A;  5EQS A;  1GJB B;  3P6Z B;  4Y11 E;  1DM4 B;  1C5R A;  4XOJ A;  1GG6 B;  4ASH A;  1TGT A;  4X6M A;  4H42 U;  1ESA A;  2AMQ A;  3MTY A;  3V12 A;  1ZTK A;  3SZN A;  4AFS A;  1EB1 H;  1EB2 A;  7LPR A;  4B1T A;  1FUJ A;  1GJ7 B;  1ZTL A;  3KGP A;  1C2H A;  3F9E A;  4K8B A;  1L2E A;  2HLC A;  3A80 A;  4DG4 A;  1VCP A;  1N6X A;  1TGN A;  1LVY A;  2VVU A;  5FCR A;  3ZZC A;  2TGP Z;  1UVS H;  1C5P A;  1O2V A;  3O8D A;  3VEQ B;  3H5C B;  1J16 A;  3IG6 B;  3OYP A;  2ZG0 H;  2STA E;  2GCT C;  8KME 2;  4ZUH A;  3ZVD A;  1SGR E;  1CGJ E;  1YF4 A;  3EE0 B;  3MHW U;  1TNL A;  1SR5 C;  3RXF A;  3UUZ A;  1DXP A;  2CHA C;  3RXM A;  5FL7 D;  4DT7 B;  1D9I A;  5EW1 H;  1V2O T;  2YOL A;  2KZ4 A;  1FZZ A;  2HAL A;  4D7G A;  4FU9 A;  4NWK A;  1J15 A;  1BIO A;  1Z1I A;  1HAV B;  4XBB A;  1C1P A;  3CEN A;  3H7O A;  2A31 A;  4AFQ A;  1O3I A;  5EJ1 A;  1ZHR A;  1MKW K;  2TPI Z;  2GVF A;  1P2I A;  1BT7 A;  3S69 A;  1HAV A;  4JMY A;  1PQA A;  5KED A;  1W3C A;  1ZOM A;  2QIQ A;  3F0P A;  3QTV H;  3UQV A;  4B73 A;  1O3F A;  4U2W A;  3URD A;  4KGA A;  5H4I B;  1A46 H;  1YCP K;  3ZVB A;  1XX9 A;  3WY8 A;  1KXE A;  2V35 A;  1J14 A;  3RU4 E;  2FPZ A;  2W3K A;  5AVD A;  3PMH B;  2FOA A;  3F9H A;  3N7O A;  1GWA A;  1Y3U A;  1SLU B;  2VWO A;  3RXP A;  3M7U A;  3V0X A;  1JRS A;  4THN H;  3ZZ7 A;  1ELF A;  3SND A;  2K1Q A;  2EEK A;  1N6Y A;  1E38 B;  2XNI A;  3O8B A;  3KL6 A;  1PQ7 A;  2PP6 A;  4Y8X A;  4RSP A;  4INK A;  1AZ8 A;  1DPO A;  4Q7X A;  4RKJ B;  4CRA A;  4GAW A;  2D2D A;  4OM9 A;  5HYO A;  7EST E;  1EZQ A;  1IHS H;  1A4W H;  3A7W A;  3E3T A;  3RM2 H;  2OD3 B;  1EUF A;  4BAM B;  2V0B A;  3RXC A;  1M9U A;  2BDB A;  1RD3 B;  2HRV A;  4B75 A;  3M61 U;  2J95 A;  4ACA A;  1BB0 B;  2TGT A;  2Y5G A;  2W5E A;  3SGB E;  5C67 A;  2A0Q B;  4YTA A;  1WTG H;  1PPF E;  2CF8 H;  1MMJ N;  3SUG A;  3RU4 D;  4KEL A;  3A88 A;  2C8X B;  2H9T H;  1PQ5 A;  1S6F A;  3KQD A;  1TNI A;  1C5V A;  3TNS A;  2HNT F;  3CS7 A;  4ZCN A;  2AER H;  1C5U A;  3LGI A;  4DOQ A;  1N8O C;  5B6O A;  3F3B A;  6GCH G;  1SGP E;  2ZU4 A;  1YC0 A;  5DO4 H;  2G55 A;  4B6F A;  4LXB H;  3SI3 H;  5GCH F;  2YMS B;  2BDH A;  1FJS A;  1UVO A;  3SU2 A;  2BLW A;  1OWJ A;  1GPZ A;  2P95 A;  1PPZ A;  6CHA C;  1GCD A;  2BLQ A;  2CJI A;  5DP8 A;  1C9T A;  3TGI E;  1B7X B;  2QCY A;  1TRY A;  2ANY A;  2W26 A;  1A3E H;  2ZFT A;  3NXP A;  5F8X A;  1AN1 E;  3ZZ4 A;  4Q7Y A;  2ODP A;  2TRM A;  1W11 U;  1SGD E;  4R0I A;  1IHT H;  5IDK A;  5HKK D;  1V2J T;  1WYK A;  2A5A A;  4UE7 H;  1AQ7 A;  3SJ9 A;  2I6S A;  1YPJ H;  2R0K A;  2ZFP H;  3KQ5 A;  1C2J A;  1C9P A;  4X6N A;  1G30 B;  1PPG E;  5C1X A;  1C2K A;  4CRC A;  5EQQ A;  2HOB A;  1TQ0 B;  3TVJ B;  5LPE A;  4B2B A;  2ZGC A;  3Q76 A;  1W12 U;  2WPL S;  3T2N A;  3UWJ H;  4YM9 A;  5E2O A;  2ZFF H;  4Y79 A;  2EI7 A;  1DIC A;  1Y5A T;  1H9H E;  3RC6 A;  3P70 B;  3SU3 A;  2FES H;  4FUH A;  5HIY A;  3UNR A;  3RMM H;  2A4O A;  2OC0 A;  3K6Z A;  4KTC A;  2FLR H;  1MH0 A;  1K1J A;  1O2J A;  1TPA E;  3U9A H;  4D9Q A;  4U30 A;  5IK2 D;  1BIT A;  2A7C A;  2XBV A;  3A81 A;  4P00 A;  2BY5 X;  1OYT H;  1YLD A;  5DN6 D;  2ILN A;  3M35 A;  2EI6 A;  3ZVA A;  1GMC F;  1V2M T;  1BRU P;  4FUJ A;  4Y6D A;  1MTN C;  2WYJ A;  1MBQ A;  4B71 A;  1BHX B;  1LVM A;  1T8O A;  2DUC A;  1VGC B;  3MI4 A;  4I86 A;  4DGJ A;  3QZR A;  1XXF A;  4LZ4 B;  4FVD A;  1H4W A;  1JOU B;  1UVT H;  4B6E A;  1WQV H;  4D9R A;  5IYT A;  5AF9 H;  5A8Y A;  3DSG A;  5EPY A;  4FXG H;  3A87 A;  3A82 A;  1VCQ A;  3U1J B;  3GCH C;  4DVA U;  1FLE E;  2ZHQ H;  2XWB I;  4Q80 A;  5HXF A;  5BRR E;  1O3L A;  2M2A A;  2ZQ2 A;  3ATK A;  1Y3V A;  3BTD E;  4E06 H;  1BBR K;  3UR6 A;  1ZSL A;  2HWL B;  3RXG A;  5DK1 A;  2PGQ B;  2NU2 E;  3FZZ A;  3RXJ A;  6EST A;  4ABJ A;  5DG6 A;  4GHQ A;  1IQF A;  1IQK A;  1YPG H;  1TYN A;  1DWB H;  1DAN H;  1TE0 A;  2ZI2 H;  4O3T A;  1KXF A;  4XD7 D;  1VIT F;  1DLK B;  1GJA B;  2ZGB H;  2JDI D;  4E7R G;  1HXE H;  4NA7 A;  3EGK H;  2VGC C;  3BTQ E;  4TPY A;  3RUO A;  3SW2 B;  4ZHL U;  1C5W B;  2KFW A;  3NKK A;  1PJP A;  2KR7 A;  1K1P A;  3E0P B;  2XWA A;  1GVL A;  3MYW A;  1GI9 B;  3M3S A;  3AK5 A;  4NZL A;  5FXL A;  4TT3 D;  2FX6 A;  1CU1 A;  2Y82 A;  4I8G A;  1SGQ E;  4NA9 H;  4I7Y H;  2WUB A;  1AZZ A;  2Z9J A;  1DWC H;  3SI4 H;  1TOM H;  1TX6 A;  5E0H A;  1THS H;  4AB8 A;  1BMM H;  2GGV B;  3EA7 A;  1B5G H;  2WZQ A;  3GCT F;  1GCT C;  1GJ6 A;  2SFA A;  3BSQ A;  4BOH A;  1VCW A;  3TH3 H;  2HGT H;  2JH6 D;  3F2F A;  4HI3 A;  1XUH A;  3PM3 A;  2ANM H;  2AGE X;  1Z8R A;  5DP7 A;  1RFN A;  5F6M A;  4AYY B;  1NRR H;  1SOT A;  2A1D B;  3AAS A;  2ZGJ A;  5E0J A;  5LPF A;  1ZHM A;  1O3C A;  1TAB E;  1GJ9 B;  2O8T A;  1Y3Y A;  3BTE E;  2ALP A;  2C93 B;  2JET C;  1OP8 A;  3UIR A;  1F0R A;  1BBR E;  2GV6 A;  3TJO A;  1HGT H;  2ZFQ H;  3UOU A;  1QJ6 B;  1BBR H;  4HZH A;  2BDC A;  2ZHF H;  4KTS A;  1C2I A;  4I8K A;  1W7G H;  3BTH E;  4YT7 H;  3STI A;  2BVR H;  2J94 A;  1HAY B;  4KTU A;  2H9E H;  2VIP A;  2WPD D;  3NWU A;  4YT6 H;  2J2U A;  1A5I A;  1OPH B;  1UTQ A;  2IJD 1;  1TOC B;  1O2Q A;  4FUI A;  1UTN A;  3A8C A;  3FP8 E;  1VR1 H;  3U98 H;  4IMQ A;  1QR3 E;  1HAH H;  1EQ9 A;  3M5O A;  2BVS H;  1QFK H;  1NFW A;  1FY3 A;  1AO5 A;  2PHB A;  3FKS D;  2EQN A;  3MO9 A;  2F91 A;  4CR9 A;  1C1Q A;  2VVV A;  2BX4 A;  2B8O H;  2W3I A;  5A2M H;  2G4T A;  3LJJ A;  4NIV A;  1ETR H;  2A2X H;  2ZDA H;  3DUX H;  2BZA A;  1AFQ C;  1V2Q T;  4WJG 2;  1C1M A;  4O03 A;  1BRA A;  4WH6 A;  1V2R T;  1LKB A;  2PSX A;  1SB1 H;  1O38 A;  1SBW A;  2BD8 A;  3EYD A;  2UUK B;  5J4Q A;  3E0N B;  2VH6 A;  2ZPQ A;  4JZI A;  3FN8 A;  2LPR A;  2YNB A;  5CHB A;  1HFD A;  3ODD A;  4X1Q U;  2FOM B;  3VXF H;  2BOK A;  2F83 A;  2F9B H;  1DSU A;  4I33 A;  1W0K D;  1MU8 B;  4AX9 H;  4JK5 A;  4LK4 A;  3SZE A;  1IQH A;  3A7V A;  3T26 A;  1OYQ A;  1MD7 A;  2AMD A;  4WMD A;  1WOF A;  1CQQ A;  2LEL A;  2XND D;  2QXJ A;  1ABJ H;  3SJI A;  3SUF A;  2WV5 A;  5GCH G;  1TRN A;  1Z71 A;  4FUF A;  4D8N A;  1D3Q B;  1NTP A;  2THF B;  2PWX A;  5C1Y A;  5A8X A;  1ZPC A;  4GHT A;  5EOK A;  1GMD F;  2KCA A;  1O32 A;  1QL9 A;  1O3H A;  2R3Y A;  3ZV9 A;  1GBH A;  1QUR H;  2H2Z A;  3BTF E;  4BTU B;  3FOA A;  2CK3 D;  5HIZ A;  1C4V 2;  1D4P B;  1JMO H;  1LHC H;  2J38 A;  3TIU A;  3NCL A;  3UTU H;  3HPT B;  3E90 B;  1AB9 C;  4ISN A;  2FI4 E;  3ZYE A;  2GCH G;  5JBT A;  1W14 U;  2ZU1 A;  3SV2 H;  1MTU A;  1AU8 A;  3PWC A;  1W13 U;  3L3T A;  4CHA C;  7GCH F;  3SV9 A;  1Y5B T;  3SHA H;  1BTX A;  1BCU H;  4WME A;  3U1I B;  3NK8 A;  1E79 D;  1SG8 B;  1GBD A;  1RS0 A;  4NA8 A;  1QQU A;  1ZRK A;  2GMT C;  2ZDL A;  2BDA A;  1CBW C;  2Z3D A;  1L4Z A;  5A0A E;  2G51 A;  4M9F A;  1KTT B;  1KXB A;  3KID U;  1O39 A;  5EIY A;  3QTO H;  5KEC A;  2VIV A;  4ZKS U;  2BD9 A;  1XUJ A;  4JCN A;  1BTU A;  4WVP E;  3U8T H;  5CHA B;  1GMC G;  4IW4 E;  1CT0 E;  2ZNK H;  2CMY A;  1ELV A;  4CRF A;  1VIT H;  1TMU H;  4VGC C;  3BTG E;  1F5K U;  3SGA E;  1CT4 E;  1D3P B;  2BZ6 H;  1P09 A;  4GSO A; 
#chains in the Genus database with same CATH homology
 2YMS C;  5ETX A;  3EYD A;  2XCN A;  2KFW A;  1E1Q D;  1E1R D;  2OK5 A;  3SUE A;  3FN8 A;  4F55 A;  3SU1 A;  2OBQ A;  2OC1 A;  2KR7 A;  3KNX A;  1EFR D;  2GVF A;  3DSP A;  5CHB A;  5C0T A;  1BT7 A;  4B76 A;  1NBM E;  3F2G A;  2KM0 A;  3AK5 A;  4TT3 D;  2FOM B;  1CU1 A;  3OE7 D;  5DSF A;  3UB0 A;  1OHH D;  5C17 A;  5HKK D;  4JMY A;  1A1R A;  3N7E A;  5IDK A;  1W3C A;  2L6O A;  2OC8 A;  3F0P A;  5F53 A;  4I33 A;  4I32 A;  1W0K D;  1RGQ A;  1N1L A;  4B73 A;  2GGV B;  4FET A;  1MAB B;  3SZE A;  2IJO B;  4A1X A;  4A1V A;  2WZQ A;  2WV9 A;  5EQQ A;  5H4I B;  4TSF D;  2KCY A;  3DCL A;  4ASU D;  2KCP A;  2LEL A;  3SV6 A;  3O8C A;  2OBO A;  2XND D;  3OEH D;  4U01 A;  1DXW A;  3ZIA D;  3P8O A;  3SU0 A;  3M5L A;  2HLD D;  1H8H D;  3F2F A;  2KCO A;  1DY9 A;  3SUF A;  1RTL A;  3WWF A;  3WWB A;  1NBM D;  2A4R A;  5EQR A;  2QF4 A;  3F0O A;  3PV2 A;  3RC6 A;  5CDF E;  2K8I A;  2OIN A;  3SU3 A;  2QE7 D;  1SKY E;  2J5U A;  1FX0 B;  3N99 A;  4Q4L A;  3RC5 A;  2OC0 A;  2KCA A;  2QF5 A;  2WHX A;  3P8N A;  2K1Q A;  4KTC A;  2XNI A;  2QV1 A;  4TYD A;  5EQS A;  5FPT A;  5B6L A;  1WXR A;  5IK2 D;  3O8B A;  3KEE A;  4WH8 A;  4A1T A;  4RI0 A;  4R8T B;  3FOA A;  2CK3 D;  5DN6 D;  3FO8 D;  2XOK D;  3L6P A;  4YXW D;  1COW D;  3LOX A;  4OM9 A;  3NRL A;  3SV7 A;  3WW7 A;  1JXP A;  3PV5 A;  4B71 A;  2AHM E;  2F4L A;  3E90 B;  2F9V A;  3DSO A;  3H09 A;  3OFN D;  5GJ4 B;  3LKW A;  2A4G A;  1DY8 A;  1W0J D;  2JJ2 D;  4K8B A;  3SUD A;  2WPD D;  5GND A;  3SV9 A;  2VBC A;  3GS9 A;  4B75 A;  4Z1M D;  1KMH B;  2IJD 1;  3LON A;  5FPY A;  2FP7 B;  3SU5 A;  1S6L A;  3U1I B;  5ESB A;  2P59 A;  1E79 D;  3OEE D;  3SU6 A;  5T1V A;  4B6E A;  1NS3 A;  2YMS D;  4A92 A;  2A4Q A;  4NWL A;  3F2H A;  5EPY A;  3O8D A;  5FPS A;  3SUG A;  3U1J B;  3M5O A;  3N7D A;  4WF8 A;  3OYP A;  2W6J D;  4M9F A;  5GPI B;  2O8M A;  2M2A A;  3FKS D;  3M5M A;  3SYJ A;  2OC7 A;  3SV8 A;  2V7Q D;  2XCF A;  3SU4 A;  2W6I D;  2FM2 A;  2F43 B;  1H8E D;  4ZCN A;  1BMF D;  3O8R A;  1DXP A;  2JIZ D;  3OAA D;  5C0U A;  3F3B A;  2WSS D;  4Q63 A;  4B74 A;  4DT4 A;  3OTP A;  3PRB A;  4I31 A;  5FL7 D;  2F9U A;  3KF2 A;  3RC4 A;  4B6F A;  3M5N A;  3VG8 A;  5EPN A;  2YMS B;  2YOL A;  2KZ4 A;  2JJ1 D;  3KN2 A;  3PRD A;  3SU2 A;  4XD7 D;  2K0Q A;  4WH6 A;  4NWK A;  2JDI D;  3W1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...