5DSSB

Mp-4 contributes to snake venom neutralization by mucuna pruriens seeds through stimulation of cross-reactive antibodies
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
185
structure length
185
Chain Sequence
b'KNDAEPVIDTDGNPLLHRGKYYIMPSNWGPPGGGLRLGKTRNLNCPVTVLQDYNEAINGLPVKFNIREILPRTIFTDTELNIEFTEKPNCAENRAWSLFKGDDRGHKARVGIGGSNGHPGGEMLRGGFYGEQHGLRNGTYKLVFCRDGSSTCLDVGRYGNREGRRLGLSEAGELGVGFEKAGGGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MP-4
publication title MP-4 Contributes to Snake Venom Neutralization by Mucuna pruriens Seeds through an Indirect Antibody-mediated Mechanism.
pubmed doi rcsb
molecule tags Plant protein
total genus 16
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5dssB00
3R4SA 3AH1A 3CA3A 4DENA 1TOOA 5BOWA 3CAHA 4ZBVB 5FZZA 3BX1C 3AH2A 2DREA 3ZX7A 2WRYA 5BVPI 1TWMA 4I6IA 1DIWA 3O4AA 1MC9A 3BTAA 3VT2A 1BLAA 3IM6A 4R6UB 3FFZA 3UD7A 4F83A 4LO7B 4OUJA 3OJMA 1HIBA 4XFTA 3A21A 1FWUA 3IM7A 3HOMA 4HR6C 2HWAA 1FWVA 4I4VA 3UDAA 3CRHA 2NTDA 4GOYA 2Y9WC 5EC5A 4LO2A 4ZFYB 1ONKB 1ISXA 3FJ8A 5BQUA 4IYBA 2Z49A 4ZGRB 1NUNA 2NVHA 3CA1A 5GAQA 4OEEA 1DZCA 1Q03A 3R4UA 2D20A 4I4OA 1E0OA 1G9CA 1KNMA 4II0A 4P0KA 1MD6A 3ZC9A 1GGPB 2NM1A 2GZBA 2LIEA 3O4DA 1FGAA 1BLDA 1FN0A 3K1XA 4DCKC 4I2SA 3BAOA 2DRZA 3RTJB 1QXMA 3V0BB 4LO0C 1TFMB 2NYYA 3H6RA 4G1RA 3WINA 3CU1B 1RY7A 4H04A 1JQZA 2DS0A 4LO2C 4X39A 9ILBA 2VUAA 4I4QA 1AXMA 4I1EA 5BXPA 3BAUA 1FQ9A 2FFUA 3A07A 5F8YA 3D7WB 1XZZA 2Y9FA 5DVHA 2FFVA 4P0JA 4I4YA 2D44A 1J0SA 3WO2A 1IRAX 2XOAA 5B2HA 1T4QA 4EEEB 1FMZA 2DRYA 3NBEA 4I0YA 2MLLB 2X2TA 1ILR1 1BASA 1S0EA 1JT4A 2P23A 3PG0A 1CE7B 2J3PA 3I2AA 1FV3A 4D0TA 4ENDA 4J2XA 1WD4A 4QKSA 3S8KA 1TIEA 1AVUA 5EG6C 3Q7WA 1I1BA 1CVSA 1SR4A 3AKFA 3BRDA 4IZXA 4OWLA 3FJDA 3WMUA 4J2YA 4F34A 3TC2A 2I1BA 4ZFWB 4CJMA 1BFFA 1S0FA 4QD2C 3FJCA 2KI4A 3IM5A 1DLLA 3FGMA 5DSSB 4G9MA 1PUMB 1Q04A 3CA5A 4QBCA 3IAGC 4GOVA 3POKA 4JKQA 2ZQNA 2ET2A 4I37A 3A23A 4D0ZA 5FNXA 3A22A 2MC2A 1EV2A 3NBDA 3P6IA 4AN7B 1ITBA 3BAVA 1RG8A 3HSMA 4Q91A 3HALA 4I96A 4EFPA 1W3GA 3AKHA 4H9WA 5EHAA 3CA4A 4P6AA 4D8HA 1S0DA 3VEQA 1IRPA 1DQOA 4X37A 8I1BA 3V79C 1AF9A 1S0CA 4I1BA 1IHKA 3KMVA 3UD9A 4IQPA 4LO0A 3LTQA 1HWMB 3BAHA 3BB2A 3BAQA 4OW4A 2NZ9A 2AXMA 4WBCA 2K8RA 3VWCA 1V6VA 4L4IA 3NJ5A 4Q9PA 1BFBA 3N7KA 3PMEA 2AFGA 3ZC8A 5BP5C 5FZYA 3FJHA 4ISQA 3UJ4A 2Y9XE 2VXRA 5JLVA 1YTOA 4HA2A 5D61A 1ISZA 4JRAA 4A7ZA 2D24A 1WBCA 1QQKA 3JUTA 3H6RB 1ISWA 3OBRA 1AFCA 4JAWA 1G9DA 2D23A 4LO1A 4A7KA 1W3FA 1SZ6B 5BXTA 4I7IA 2IHOA 4GP3A 4GP0A 4KC3A 2P39A 1ISYA 1JLYA 2VSAA 1PC8B 5G00A 1IJTA 4Q9GA 3UD8A 3BRFA 3HBWA 3AJ6A 4P0LA 4QD2B 3FJKA 1NZKA 4EFRA 1HWOB 2E4MC 3FJAA 2WBCA 1IOBA 4USPA 4X3AA 1W3AA 1BFCA 3NBCA 5FZUA 2R9KB 4JP0A 4JPZA 3BAGA 3UJ0A 4LO1C 5F8WA 2D1ZA 1FMMS 4L4HA 1V6WA 3AKGA 4IY9A 4Z8SB 1G9AA 1A8DA 2RQ9A 2KH2A 1QQLA 3OGFA 4YOLA 3N7MA 1K5UA 4JQ0A 7I1BA 3VSFA 1HCDA 3V0AA 1HWNB 3QR5A 1JT7A 3VUOA 4KEIA 1VCLA 1M16A 3E8LC 3HMYA 3O4CA 3I29B 41BIA 1S0LA 5F90A 3MALA 31BIA 1AVAC 3H6QA 4KEJA 1V6UA 1DFCA 1RMLA 4LO8B 1HKNA 1PUUB 3O5WB 2VSEA 4QO3A 1BA7A 4HJJA 4ZLBB 1HWPB 3EF2A 1D0HA 1N4KA 4FVVA 1JY0A 4FGFA 3IIRA 1V6XA 4OWKA 4USOA 3B9UA 1P63A 5D63A 4LO3C 2HW9A 1BARA 3ZXDA 2QYIB 2K4AB 2Z48A 2AQZA 1Q1UA 2FO1A 4X38A 3FUQA 2M49A 3FJFA 5D62A 1UPSA 3OJ2A 4IONA 5BP5A 1JTCA 3QYDA 4XKIA 1XHBA 1S0GA 3N7LA 3O49A 1G9BA 4EKXB 2F2FC 2KKIA 4I4SA 2BEBA 3VSZA 4J23B 3AZWA 3H6SE 3W9TA 1WBAA 2VU9A 3RTIB 3AKIA 3O4OA 5FNWA 4ZFUB 4OEFA 1YF8B 2KLLA 21BIA 3ILAA 3WO3A 3AH4A 1Z4SA 2K43A 3O44A 3F62B 2F8XC 3MPPG 1EPWA 3FJBA 2ESUA 3AJ5A 1YBIA 4IHZA 4IZEA 4QC4A 4XFSA 4PC4A 1F31A 3PHZA 1YXWA 1DJSB 2MIBA 4XFUA 4I3NA 3FJEA 2D7RA 5DZUA 1DFQA 2ZR1B 1AVXB 4QALA 1ISVA 1TTUA 1JLXA 3PUBA 2E4MA 1TP0A 2HWMA 1II4A 2X2SA 4KEKA 5HPZA 2RSTA 2HZ9A 2D7IA 1IILA 1G82A 2FDBM 1EVTA 2BFHA 5I1BA 1AVWB 3F1RA 2RG9B 1M2TB 3BADA 3N7JA 4OEGA 4ZOTA 4EFQA 3I2XA 2Q9XA 4EB2B 4GAIA 3O4BA 4ISRA 3VT0A 1DQGA 5JMCA 1ABRB 1RZOB 1WD3A 2QN4A 4IY8A 3FJIA 3SNVA 4G9NA 4I4UA 5BXRA 3C9ZA 1L2HA 1BFGA 4I8MA 3P53A 3FUOA 2NP0A 1HCEA 1TWEA 3FJ9A 3S8JA 3BRGC 5BQUC 4JKXB 3OGGA 1XG6A 4LO7C 4QBVA 5E24E 3V0BA 4J2KA 4ZA3B 3V0AB 1YYNA 1I1EA 2Y9GA 3CRIA 2L5XA 4LO3A 4I4XA 6I1BA 3VT1A 1Z0HA 1R8NA 3CA6A 3RMXA 1K5VA 3O3QA 1JT5A 1EYLA 2VXTI 3Q7YA 1JT3A 3RMYA 2ZQOA 4TLPA 2F2FA 3OJVA 2Q3NB 3Q7XA 3P6JA 1DZDA 3WINC 3CQAA 5F8SA 2IWTB 4I4RA 2GO2A 3NBNA 3WO4A 3FJJA 1R8OA 3WA1A 4DEPA 1OQLB 3LLPA 3N0KA 4Z9WB 2VLCA 4AN6A 4G6JA 1FV2A 1T9FA 2FGFA 1Z2VA 2LIQA 3RSJA 3JRRA 3CRGA 3CA0A 2BEAA 2ERMA 2D22A 2KI6B 2AAIB 3BA4A 1PZZA 1S0BA 5DUYA 4A7YA 4ZKTB 5BXSA 4I4PA 4GAFA 3WMVA 3AZVA 3ZXGA 3T8SA 3OBTA 4OWJA 3BA7A 2D43A 4QKRA 4KBBA 3BA5A 2UUSA 2YUGA 4G6MA 1XYFA 3HN1A 1SR4C 1IT0A 1PWAA 4J2SA
chains in the Genus database with same CATH superfamily
3R4SA 3AH1A 3CA3A 4DENA 1TOOA 5BOWA 3CAHA 4ZBVB 5FZZA 3BX1C 3AH2A 2DREA 3ZX7A 2WRYA 5BVPI 1TWMA 4I6IA 1DIWA 3O4AA 1MC9A 3BTAA 3VT2A 1BLAA 3IM6A 4R6UB 3FFZA 3UD7A 4F83A 4LO7B 4OUJA 3OJMA 1HIBA 4XFTA 3A21A 1FWUA 3IM7A 3HOMA 4HR6C 2HWAA 1FWVA 4I4VA 3UDAA 3CRHA 2NTDA 4GOYA 2Y9WC 5EC5A 4LO2A 4ZFYB 1ONKB 1ISXA 3FJ8A 5BQUA 4IYBA 2Z49A 4ZGRB 1NUNA 2NVHA 3CA1A 5GAQA 4OEEA 1DZCA 1Q03A 3R4UA 2D20A 4I4OA 1E0OA 1G9CA 1KNMA 4II0A 4P0KA 1MD6A 3ZC9A 1GGPB 2NM1A 2GZBA 2LIEA 3O4DA 1FGAA 1BLDA 1FN0A 3K1XA 4DCKC 4I2SA 3BAOA 2DRZA 3RTJB 1QXMA 3V0BB 4LO0C 1TFMB 2NYYA 3H6RA 4G1RA 3WINA 3CU1B 1RY7A 4H04A 1JQZA 2DS0A 4LO2C 4X39A 9ILBA 2VUAA 4I4QA 1AXMA 4I1EA 5BXPA 3BAUA 1FQ9A 2FFUA 3A07A 5F8YA 3D7WB 1XZZA 2Y9FA 5DVHA 2FFVA 4P0JA 4I4YA 2D44A 1J0SA 3WO2A 1IRAX 2XOAA 5B2HA 1T4QA 4EEEB 1FMZA 2DRYA 3NBEA 4I0YA 2MLLB 2X2TA 1ILR1 1BASA 1S0EA 4MZHA 1JT4A 2P23A 3PG0A 1CE7B 2J3PA 3I2AA 1FV3A 4D0TA 4ENDA 4J2XA 1WD4A 4QKSA 3S8KA 1TIEA 1AVUA 5EG6C 3Q7WA 1I1BA 1CVSA 1SR4A 3AKFA 3BRDA 4H75A 4IZXA 4OWLA 3FJDA 3WMUA 4J2YA 4F34A 3TC2A 2I1BA 4ZFWB 4CJMA 1BFFA 1S0FA 4QD2C 3FJCA 2KI4A 3IM5A 1DLLA 3FGMA 5DSSB 4G9MA 1PUMB 1Q04A 4UY4A 3CA5A 4QBCA 3IAGC 4GOVA 3POKA 4JKQA 2ZQNA 2ET2A 4I37A 3A23A 4D0ZA 5FNXA 3A22A 2MC2A 1EV2A 3NBDA 3P6IA 4AN7B 1ITBA 3BAVA 1RG8A 3HSMA 4Q91A 3HALA 4I96A 4EFPA 1W3GA 3AKHA 4H9WA 5EHAA 3CA4A 4P6AA 4D8HA 1S0DA 3VEQA 1IRPA 1DQOA 4X37A 8I1BA 3V79C 1AF9A 1S0CA 4I1BA 1IHKA 3KMVA 3UD9A 4IQPA 4LO0A 3LTQA 1HWMB 3BAHA 3BB2A 3BAQA 4MZFB 4OW4A 2NZ9A 2AXMA 4WBCA 2K8RA 3VWCA 1V6VA 4L4IA 3NJ5A 4Q9PA 1BFBA 3N7KA 3PMEA 2AFGA 3ZC8A 5BP5C 5FZYA 3FJHA 4ISQA 3UJ4A 2Y9XE 2VXRA 5JLVA 1YTOA 4HA2A 5D61A 1ISZA 4JRAA 4A7ZA 2D24A 1WBCA 1QQKA 3JUTA 3H6RB 1ISWA 3OBRA 1AFCA 4JAWA 1G9DA 2D23A 4LO1A 4A7KA 1W3FA 1SZ6B 5BXTA 4I7IA 2IHOA 4GP3A 4GP0A 4KC3A 2P39A 1ISYA 1JLYA 2VSAA 1PC8B 5G00A 1IJTA 4Q9GA 3UD8A 3BRFA 3HBWA 3AJ6A 4P0LA 4QD2B 3FJKA 1NZKA 4EFRA 1HWOB 2E4MC 3FJAA 2WBCA 1IOBA 4USPA 4X3AA 1W3AA 1BFCA 3NBCA 5FZUA 2R9KB 4JP0A 4JPZA 3BAGA 3UJ0A 4LO1C 5F8WA 2D1ZA 1FMMS 4L4HA 1V6WA 3AKGA 4IY9A 4Z8SB 1G9AA 1A8DA 2RQ9A 2KH2A 1QQLA 3OGFA 4YOLA 3N7MA 1K5UA 4JQ0A 7I1BA 3VSFA 1HCDA 3V0AA 1HWNB 3QR5A 1JT7A 3VUOA 4KEIA 4MZGB 1VCLA 1M16A 3E8LC 3HMYA 3O4CA 3I29B 41BIA 1S0LA 5F90A 3MALA 31BIA 1AVAC 3H6QA 4KEJA 1V6UA 1DFCA 1RMLA 4LO8B 1HKNA 1PUUB 3O5WB 2VSEA 4QO3A 1BA7A 4HJJA 4ZLBB 1HWPB 3EF2A 1D0HA 1N4KA 4FVVA 1JY0A 4FGFA 3IIRA 1V6XA 4OWKA 4USOA 3B9UA 1P63A 5D63A 4LO3C 2HW9A 1BARA 3ZXDA 2QYIB 2K4AB 2Z48A 2AQZA 1Q1UA 2FO1A 4X38A 3FUQA 2M49A 3FJFA 5D62A 1UPSA 3OJ2A 4IONA 5BP5A 1JTCA 3QYDA 4XKIA 1XHBA 1S0GA 3N7LA 3O49A 1G9BA 4EKXB 2F2FC 2KKIA 4I4SA 2BEBA 3VSZA 4J23B 3AZWA 3H6SE 3W9TA 1WBAA 2VU9A 3RTIB 3AKIA 3O4OA 5FNWA 4ZFUB 4OEFA 1YF8B 2KLLA 21BIA 3ILAA 3WO3A 3AH4A 1Z4SA 2K43A 3O44A 3F62B 2F8XC 3MPPG 1EPWA 3FJBA 3AJ5A 2ESUA 1YBIA 4IHZA 4IZEA 4QC4A 4XFSA 4PC4A 1F31A 3PHZA 1YXWA 1DJSB 2MIBA 4XFUA 4I3NA 3FJEA 2D7RA 5DZUA 1DFQA 2ZR1B 1AVXB 4QALA 1ISVA 1TTUA 1JLXA 3PUBA 2E4MA 1TP0A 2HWMA 1II4A 2X2SA 4KEKA 5HPZA 2RSTA 2HZ9A 2D7IA 1IILA 1G82A 2FDBM 1EVTA 2BFHA 5I1BA 1AVWB 3F1RA 2RG9B 1M2TB 3BADA 3N7JA 4OEGA 4ZOTA 4EFQA 3I2XA 2Q9XA 4EB2B 4GAIA 3O4BA 4ISRA 3VT0A 1DQGA 5JMCA 1ABRB 1RZOB 1WD3A 2QN4A 4IY8A 3FJIA 3SNVA 4G9NA 4I4UA 5BXRA 3C9ZA 1L2HA 1BFGA 4I8MA 3P53A 3FUOA 2NP0A 1HCEA 1TWEA 3FJ9A 3S8JA 3BRGC 5BQUC 4JKXB 3OGGA 1XG6A 4LO7C 4QBVA 5E24E 3V0BA 4J2KA 4ZA3B 3V0AB 1YYNA 1I1EA 2Y9GA 3CRIA 2L5XA 4LO3A 4I4XA 6I1BA 3VT1A 1Z0HA 1R8NA 3CA6A 3RMXA 1K5VA 3O3QA 1JT5A 1EYLA 2VXTI 3Q7YA 1JT3A 3RMYA 2ZQOA 4TLPA 2F2FA 3OJVA 2Q3NB 3Q7XA 3P6JA 1DZDA 3WINC 3CQAA 5F8SA 2IWTB 4I4RA 2GO2A 3NBNA 3WO4A 3FJJA 1R8OA 3WA1A 4DEPA 1OQLB 3LLPA 3N0KA 4Z9WB 2VLCA 4AN6A 4G6JA 1FV2A 1T9FA 2FGFA 1Z2VA 2LIQA 3RSJA 3JRRA 3CRGA 3CA0A 2BEAA 2ERMA 2D22A 2NS2A 2KI6B 2AAIB 3BA4A 1PZZA 1S0BA 5DUYA 4A7YA 4ZKTB 5BXSA 4I4PA 4GAFA 3WMVA 3AZVA 3ZXGA 3T8SA 3OBTA 4OWJA 3BA7A 2D43A 4QKRA 4KBBA 3BA5A 2UUSA 2YUGA 4G6MA 1XYFA 3HN1A 1SR4C 1IT0A 1PWAA 4J2SA
chains in the Genus database with same CATH topology
3R4SA 3AH1A 3CA3A 4DENA 1TOOA 5BOWA 3CAHA 4ZBVB 5FZZA 3BX1C 3AH2A 2DREA 3ZX7A 2WRYA 5BVPI 1TWMA 4I6IA 1DIWA 3O4AA 1MC9A 3BTAA 3VT2A 1BLAA 3IM6A 4R6UB 3FFZA 3UD7A 4F83A 4LO7B 4OUJA 3OJMA 1HIBA 4XFTA 3A21A 1FWUA 3IM7A 3HOMA 4HR6C 2HWAA 1FWVA 4I4VA 3UDAA 3CRHA 2NTDA 4GOYA 2Y9WC 5EC5A 4LO2A 4ZFYB 1ONKB 1ISXA 3FJ8A 5BQUA 4IYBA 2Z49A 4ZGRB 1NUNA 2NVHA 3CA1A 5GAQA 4OEEA 1DZCA 1Q03A 3R4UA 2D20A 4I4OA 1E0OA 1G9CA 1KNMA 4II0A 4P0KA 1MD6A 3ZC9A 1GGPB 2NM1A 2GZBA 2LIEA 3O4DA 1FGAA 1BLDA 1FN0A 3K1XA 4DCKC 4I2SA 3BAOA 2DRZA 3RTJB 1QXMA 3V0BB 4LO0C 1TFMB 2NYYA 3H6RA 4G1RA 3WINA 3CU1B 1RY7A 4H04A 1JQZA 2DS0A 4LO2C 4X39A 9ILBA 2VUAA 4I4QA 1AXMA 4I1EA 5BXPA 3BAUA 1FQ9A 2FFUA 3A07A 5F8YA 3D7WB 1XZZA 2Y9FA 5DVHA 2FFVA 4P0JA 4I4YA 2D44A 1J0SA 3WO2A 1IRAX 2XOAA 5B2HA 1T4QA 4EEEB 1FMZA 2DRYA 3NBEA 4I0YA 2MLLB 2X2TA 1ILR1 1BASA 1S0EA 4MZHA 1JT4A 2P23A 3PG0A 1CE7B 2J3PA 3I2AA 1FV3A 4D0TA 4ENDA 4J2XA 1WD4A 4QKSA 3S8KA 1TIEA 1AVUA 5EG6C 3Q7WA 1I1BA 1CVSA 1SR4A 3AKFA 3BRDA 4H75A 4IZXA 4OWLA 3FJDA 3WMUA 4J2YA 4F34A 3TC2A 2I1BA 4ZFWB 4CJMA 1BFFA 1S0FA 4QD2C 3FJCA 2KI4A 3IM5A 1DLLA 3FGMA 5DSSB 4G9MA 1PUMB 1Q04A 4UY4A 3CA5A 4QBCA 3IAGC 4GOVA 3POKA 4JKQA 2ZQNA 2ET2A 4I37A 3A23A 4D0ZA 5FNXA 3A22A 2MC2A 1EV2A 3NBDA 3P6IA 4AN7B 1ITBA 3BAVA 1RG8A 3HSMA 4Q91A 3HALA 4I96A 4EFPA 1W3GA 3AKHA 4H9WA 5EHAA 3CA4A 4P6AA 4D8HA 1S0DA 3VEQA 1IRPA 1DQOA 4X37A 8I1BA 3V79C 1AF9A 1S0CA 4I1BA 1IHKA 3KMVA 3UD9A 4IQPA 4LO0A 3LTQA 1HWMB 3BAHA 3BB2A 3BAQA 4MZFB 4OW4A 2NZ9A 2AXMA 4WBCA 2K8RA 3VWCA 1V6VA 4L4IA 3NJ5A 4Q9PA 1BFBA 3N7KA 3PMEA 2AFGA 3ZC8A 5BP5C 5FZYA 3FJHA 4ISQA 3UJ4A 2Y9XE 2VXRA 5JLVA 1YTOA 4HA2A 5D61A 1ISZA 4JRAA 4A7ZA 2D24A 1WBCA 1QQKA 3JUTA 3H6RB 1ISWA 3OBRA 1AFCA 4JAWA 1G9DA 2D23A 4LO1A 4A7KA 1W3FA 1SZ6B 5BXTA 4I7IA 2IHOA 4GP3A 4GP0A 4KC3A 2P39A 1ISYA 1JLYA 2VSAA 1PC8B 5G00A 1IJTA 4Q9GA 3UD8A 3BRFA 3HBWA 3AJ6A 4P0LA 4QD2B 3FJKA 1NZKA 4EFRA 1HWOB 2E4MC 3FJAA 2WBCA 1IOBA 4USPA 4X3AA 1W3AA 1BFCA 3NBCA 5FZUA 2R9KB 4JP0A 4JPZA 3BAGA 3UJ0A 4LO1C 5F8WA 2D1ZA 1FMMS 4L4HA 1V6WA 3AKGA 4IY9A 4Z8SB 1G9AA 1A8DA 2RQ9A 2KH2A 1QQLA 3OGFA 4YOLA 3N7MA 1K5UA 4JQ0A 7I1BA 3VSFA 1HCDA 3V0AA 1HWNB 3QR5A 1JT7A 3VUOA 4KEIA 4MZGB 1VCLA 1M16A 3E8LC 3HMYA 3O4CA 3I29B 41BIA 1S0LA 5F90A 3MALA 31BIA 1AVAC 3H6QA 4KEJA 1V6UA 1DFCA 1RMLA 4LO8B 1HKNA 1PUUB 3O5WB 2VSEA 4QO3A 1BA7A 4HJJA 4ZLBB 1HWPB 3EF2A 1D0HA 1N4KA 4FVVA 1JY0A 4FGFA 3IIRA 1V6XA 4OWKA 4USOA 3B9UA 1P63A 5D63A 4LO3C 2HW9A 1BARA 3ZXDA 2QYIB 2K4AB 2Z48A 2AQZA 1Q1UA 2FO1A 4X38A 3FUQA 2M49A 3FJFA 5D62A 1UPSA 3OJ2A 4IONA 5BP5A 1JTCA 3QYDA 4XKIA 1XHBA 1S0GA 3N7LA 3O49A 1G9BA 4EKXB 2F2FC 2KKIA 4I4SA 2BEBA 3VSZA 4J23B 3AZWA 3H6SE 3W9TA 1WBAA 2VU9A 3RTIB 3AKIA 3O4OA 5FNWA 4ZFUB 4OEFA 1YF8B 2KLLA 21BIA 3ILAA 3WO3A 3AH4A 1Z4SA 2K43A 3O44A 3F62B 2F8XC 3MPPG 1EPWA 3FJBA 3AJ5A 2ESUA 1YBIA 4IHZA 4IZEA 4QC4A 4XFSA 4PC4A 1F31A 3PHZA 1YXWA 1DJSB 2MIBA 4XFUA 4I3NA 3FJEA 2D7RA 5DZUA 1DFQA 2ZR1B 1AVXB 4QALA 1ISVA 1TTUA 1JLXA 3PUBA 2E4MA 1TP0A 2HWMA 1II4A 2X2SA 4KEKA 5HPZA 2RSTA 2HZ9A 2D7IA 1IILA 1G82A 2FDBM 1EVTA 2BFHA 5I1BA 1AVWB 3F1RA 2RG9B 1M2TB 3BADA 3N7JA 4OEGA 4ZOTA 4EFQA 3I2XA 2Q9XA 4EB2B 4GAIA 3O4BA 4ISRA 3VT0A 1DQGA 5JMCA 1ABRB 1RZOB 1WD3A 2QN4A 4IY8A 3FJIA 3SNVA 4G9NA 4I4UA 5BXRA 3C9ZA 1L2HA 1BFGA 4I8MA 3P53A 3FUOA 2NP0A 1HCEA 1TWEA 3FJ9A 3S8JA 3BRGC 5BQUC 4JKXB 3OGGA 1XG6A 4LO7C 4QBVA 5E24E 3V0BA 4J2KA 4ZA3B 3V0AB 1YYNA 1I1EA 2Y9GA 3CRIA 2L5XA 4LO3A 4I4XA 6I1BA 3VT1A 1Z0HA 1R8NA 3CA6A 3RMXA 1K5VA 3O3QA 1JT5A 1EYLA 2VXTI 3Q7YA 1JT3A 3RMYA 2ZQOA 4TLPA 2F2FA 3OJVA 2Q3NB 3Q7XA 3P6JA 1DZDA 3WINC 3CQAA 5F8SA 2IWTB 4I4RA 2GO2A 3NBNA 3WO4A 3FJJA 1R8OA 3WA1A 4DEPA 1OQLB 3LLPA 3N0KA 4Z9WB 2VLCA 4AN6A 4G6JA 1FV2A 1T9FA 2FGFA 1Z2VA 2LIQA 3RSJA 3JRRA 3CRGA 3CA0A 2BEAA 2ERMA 2D22A 2NS2A 2KI6B 2AAIB 3BA4A 1PZZA 1S0BA 5DUYA 4A7YA 4ZKTB 5BXSA 4I4PA 4GAFA 3WMVA 3AZVA 3ZXGA 3T8SA 3OBTA 4OWJA 3BA7A 2D43A 4QKRA 4KBBA 3BA5A 2UUSA 2YUGA 4G6MA 1XYFA 3HN1A 1SR4C 1IT0A 1PWAA 4J2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4S A;  3AH1 A;  3CA3 A;  4DEN A;  1TOO A;  5BOW A;  3CAH A;  4ZBV B;  5FZZ A;  3BX1 C;  3AH2 A;  2DRE A;  3ZX7 A;  2WRY A;  5BVP I;  1TWM A;  4I6I A;  1DIW A;  3O4A A;  1MC9 A;  3BTA A;  3VT2 A;  1BLA A;  3IM6 A;  4R6U B;  3FFZ A;  3UD7 A;  4F83 A;  4LO7 B;  4OUJ A;  3OJM A;  1HIB A;  4XFT A;  3A21 A;  1FWU A;  3IM7 A;  3HOM A;  4HR6 C;  2HWA A;  1FWV A;  4I4V A;  3UDA A;  3CRH A;  2NTD A;  4GOY A;  2Y9W C;  5EC5 A;  4LO2 A;  4ZFY B;  1ONK B;  1ISX A;  3FJ8 A;  5BQU A;  4IYB A;  2Z49 A;  4ZGR B;  1NUN A;  2NVH A;  3CA1 A;  5GAQ A;  4OEE A;  1DZC A;  1Q03 A;  3R4U A;  2D20 A;  4I4O A;  1E0O A;  1G9C A;  1KNM A;  4II0 A;  4P0K A;  1MD6 A;  3ZC9 A;  1GGP B;  2NM1 A;  2GZB A;  2LIE A;  3O4D A;  1FGA A;  1BLD A;  1FN0 A;  3K1X A;  4DCK C;  4I2S A;  3BAO A;  2DRZ A;  3RTJ B;  1QXM A;  3V0B B;  4LO0 C;  1TFM B;  2NYY A;  3H6R A;  4G1R A;  3WIN A;  3CU1 B;  1RY7 A;  4H04 A;  1JQZ A;  2DS0 A;  4LO2 C;  4X39 A;  9ILB A;  2VUA A;  4I4Q A;  1AXM A;  4I1E A;  5BXP A;  3BAU A;  1FQ9 A;  2FFU A;  3A07 A;  5F8Y A;  3D7W B;  1XZZ A;  2Y9F A;  5DVH A;  2FFV A;  4P0J A;  4I4Y A;  2D44 A;  1J0S A;  3WO2 A;  1IRA X;  2XOA A;  5B2H A;  1T4Q A;  4EEE B;  1FMZ A;  2DRY A;  3NBE A;  4I0Y A;  2MLL B;  2X2T A;  1ILR 1;  1BAS A;  1S0E A;  1JT4 A;  2P23 A;  3PG0 A;  1CE7 B;  2J3P A;  3I2A A;  1FV3 A;  4D0T A;  4END A;  4J2X A;  1WD4 A;  4QKS A;  3S8K A;  1TIE A;  1AVU A;  5EG6 C;  3Q7W A;  1I1B A;  1CVS A;  1SR4 A;  3AKF A;  3BRD A;  4IZX A;  4OWL A;  3FJD A;  3WMU A;  4J2Y A;  4F34 A;  3TC2 A;  2I1B A;  4ZFW B;  4CJM A;  1BFF A;  1S0F A;  4QD2 C;  3FJC A;  2KI4 A;  3IM5 A;  1DLL A;  3FGM A;  5DSS B;  4G9M A;  1PUM B;  1Q04 A;  3CA5 A;  4QBC A;  3IAG C;  4GOV A;  3POK A;  4JKQ A;  2ZQN A;  2ET2 A;  4I37 A;  3A23 A;  4D0Z A;  5FNX A;  3A22 A;  2MC2 A;  1EV2 A;  3NBD A;  3P6I A;  4AN7 B;  1ITB A;  3BAV A;  1RG8 A;  3HSM A;  4Q91 A;  3HAL A;  4I96 A;  4EFP A;  1W3G A;  3AKH A;  4H9W A;  5EHA A;  3CA4 A;  4P6A A;  4D8H A;  1S0D A;  3VEQ A;  1IRP A;  1DQO A;  4X37 A;  8I1B A;  3V79 C;  1AF9 A;  1S0C A;  4I1B A;  1IHK A;  3KMV A;  3UD9 A;  4IQP A;  4LO0 A;  3LTQ A;  1HWM B;  3BAH A;  3BB2 A;  3BAQ A;  4OW4 A;  2NZ9 A;  2AXM A;  4WBC A;  2K8R A;  3VWC A;  1V6V A;  4L4I A;  3NJ5 A;  4Q9P A;  1BFB A;  3N7K A;  3PME A;  2AFG A;  3ZC8 A;  5BP5 C;  5FZY A;  3FJH A;  4ISQ A;  3UJ4 A;  2Y9X E;  2VXR A;  5JLV A;  1YTO A;  4HA2 A;  5D61 A;  1ISZ A;  4JRA A;  4A7Z A;  2D24 A;  1WBC A;  1QQK A;  3JUT A;  3H6R B;  1ISW A;  3OBR A;  1AFC A;  4JAW A;  1G9D A;  2D23 A;  4LO1 A;  4A7K A;  1W3F A;  1SZ6 B;  5BXT A;  4I7I A;  2IHO A;  4GP3 A;  4GP0 A;  4KC3 A;  2P39 A;  1ISY A;  1JLY A;  2VSA A;  1PC8 B;  5G00 A;  1IJT A;  4Q9G A;  3UD8 A;  3BRF A;  3HBW A;  3AJ6 A;  4P0L A;  4QD2 B;  3FJK A;  1NZK A;  4EFR A;  1HWO B;  2E4M C;  3FJA A;  2WBC A;  1IOB A;  4USP A;  4X3A A;  1W3A A;  1BFC A;  3NBC A;  5FZU A;  2R9K B;  4JP0 A;  4JPZ A;  3BAG A;  3UJ0 A;  4LO1 C;  5F8W A;  2D1Z A;  1FMM S;  4L4H A;  1V6W A;  3AKG A;  4IY9 A;  4Z8S B;  1G9A A;  1A8D A;  2RQ9 A;  2KH2 A;  1QQL A;  3OGF A;  4YOL A;  3N7M A;  1K5U A;  4JQ0 A;  7I1B A;  3VSF A;  1HCD A;  3V0A A;  1HWN B;  3QR5 A;  1JT7 A;  3VUO A;  4KEI A;  1VCL A;  1M16 A;  3E8L C;  3HMY A;  3O4C A;  3I29 B;  41BI A;  1S0L A;  5F90 A;  3MAL A;  31BI A;  1AVA C;  3H6Q A;  4KEJ A;  1V6U A;  1DFC A;  1RML A;  4LO8 B;  1HKN A;  1PUU B;  3O5W B;  2VSE A;  4QO3 A;  1BA7 A;  4HJJ A;  4ZLB B;  1HWP B;  3EF2 A;  1D0H A;  1N4K A;  4FVV A;  1JY0 A;  4FGF A;  3IIR A;  1V6X A;  4OWK A;  4USO A;  3B9U A;  1P63 A;  5D63 A;  4LO3 C;  2HW9 A;  1BAR A;  3ZXD A;  2QYI B;  2K4A B;  2Z48 A;  2AQZ A;  1Q1U A;  2FO1 A;  4X38 A;  3FUQ A;  2M49 A;  3FJF A;  5D62 A;  1UPS A;  3OJ2 A;  4ION A;  5BP5 A;  1JTC A;  3QYD A;  4XKI A;  1XHB A;  1S0G A;  3N7L A;  3O49 A;  1G9B A;  4EKX B;  2F2F C;  2KKI A;  4I4S A;  2BEB A;  3VSZ A;  4J23 B;  3AZW A;  3H6S E;  3W9T A;  1WBA A;  2VU9 A;  3RTI B;  3AKI A;  3O4O A;  5FNW A;  4ZFU B;  4OEF A;  1YF8 B;  2KLL A;  21BI A;  3ILA A;  3WO3 A;  3AH4 A;  1Z4S A;  2K43 A;  3O44 A;  3F62 B;  2F8X C;  3MPP G;  1EPW A;  3FJB A;  2ESU A;  3AJ5 A;  1YBI A;  4IHZ A;  4IZE A;  4QC4 A;  4XFS A;  4PC4 A;  1F31 A;  3PHZ A;  1YXW A;  1DJS B;  2MIB A;  4XFU A;  4I3N A;  3FJE A;  2D7R A;  5DZU A;  1DFQ A;  2ZR1 B;  1AVX B;  4QAL A;  1ISV A;  1TTU A;  1JLX A;  3PUB A;  2E4M A;  1TP0 A;  2HWM A;  1II4 A;  2X2S A;  4KEK A;  5HPZ A;  2RST A;  2HZ9 A;  2D7I A;  1IIL A;  1G82 A;  2FDB M;  1EVT A;  2BFH A;  5I1B A;  1AVW B;  3F1R A;  2RG9 B;  1M2T B;  3BAD A;  3N7J A;  4OEG A;  4ZOT A;  4EFQ A;  3I2X A;  2Q9X A;  4EB2 B;  4GAI A;  3O4B A;  4ISR A;  3VT0 A;  1DQG A;  5JMC A;  1ABR B;  1RZO B;  1WD3 A;  2QN4 A;  4IY8 A;  3FJI A;  3SNV A;  4G9N A;  4I4U A;  5BXR A;  3C9Z A;  1L2H A;  1BFG A;  4I8M A;  3P53 A;  3FUO A;  2NP0 A;  1HCE A;  1TWE A;  3FJ9 A;  3S8J A;  3BRG C;  5BQU C;  4JKX B;  3OGG A;  1XG6 A;  4LO7 C;  4QBV A;  5E24 E;  3V0B A;  4J2K A;  4ZA3 B;  3V0A B;  1YYN A;  1I1E A;  2Y9G A;  3CRI A;  2L5X A;  4LO3 A;  4I4X A;  6I1B A;  3VT1 A;  1Z0H A;  1R8N A;  3CA6 A;  3RMX A;  1K5V A;  3O3Q A;  1JT5 A;  1EYL A;  2VXT I;  3Q7Y A;  1JT3 A;  3RMY A;  2ZQO A;  4TLP A;  2F2F A;  3OJV A;  2Q3N B;  3Q7X A;  3P6J A;  1DZD A;  3WIN C;  3CQA A;  5F8S A;  2IWT B;  4I4R A;  2GO2 A;  3NBN A;  3WO4 A;  3FJJ A;  1R8O A;  3WA1 A;  4DEP A;  1OQL B;  3LLP A;  3N0K A;  4Z9W B;  2VLC A;  4AN6 A;  4G6J A;  1FV2 A;  1T9F A;  2FGF A;  1Z2V A;  2LIQ A;  3RSJ A;  3JRR A;  3CRG A;  3CA0 A;  2BEA A;  2ERM A;  2D22 A;  2KI6 B;  2AAI B;  3BA4 A;  1PZZ A;  1S0B A;  5DUY A;  4A7Y A;  4ZKT B;  5BXS A;  4I4P A;  4GAF A;  3WMV A;  3AZV A;  3ZXG A;  3T8S A;  3OBT A;  4OWJ A;  3BA7 A;  2D43 A;  4QKR A;  4KBB A;  3BA5 A;  2UUS A;  2YUG A;  4G6M A;  1XYF A;  3HN1 A;  1SR4 C;  1IT0 A;  1PWA A;  4J2S A; 
#chains in the Genus database with same CATH topology
 3R4S A;  3AH1 A;  3CA3 A;  4DEN A;  1TOO A;  5BOW A;  3CAH A;  4ZBV B;  5FZZ A;  3BX1 C;  3AH2 A;  2DRE A;  3ZX7 A;  2WRY A;  5BVP I;  1TWM A;  4I6I A;  1DIW A;  3O4A A;  1MC9 A;  3BTA A;  3VT2 A;  1BLA A;  3IM6 A;  4R6U B;  3FFZ A;  3UD7 A;  4F83 A;  4LO7 B;  4OUJ A;  3OJM A;  1HIB A;  4XFT A;  3A21 A;  1FWU A;  3IM7 A;  3HOM A;  4HR6 C;  2HWA A;  1FWV A;  4I4V A;  3UDA A;  3CRH A;  2NTD A;  4GOY A;  2Y9W C;  5EC5 A;  4LO2 A;  4ZFY B;  1ONK B;  1ISX A;  3FJ8 A;  5BQU A;  4IYB A;  2Z49 A;  4ZGR B;  1NUN A;  2NVH A;  3CA1 A;  5GAQ A;  4OEE A;  1DZC A;  1Q03 A;  3R4U A;  2D20 A;  4I4O A;  1E0O A;  1G9C A;  1KNM A;  4II0 A;  4P0K A;  1MD6 A;  3ZC9 A;  1GGP B;  2NM1 A;  2GZB A;  2LIE A;  3O4D A;  1FGA A;  1BLD A;  1FN0 A;  3K1X A;  4DCK C;  4I2S A;  3BAO A;  2DRZ A;  3RTJ B;  1QXM A;  3V0B B;  4LO0 C;  1TFM B;  2NYY A;  3H6R A;  4G1R A;  3WIN A;  3CU1 B;  1RY7 A;  4H04 A;  1JQZ A;  2DS0 A;  4LO2 C;  4X39 A;  9ILB A;  2VUA A;  4I4Q A;  1AXM A;  4I1E A;  5BXP A;  3BAU A;  1FQ9 A;  2FFU A;  3A07 A;  5F8Y A;  3D7W B;  1XZZ A;  2Y9F A;  5DVH A;  2FFV A;  4P0J A;  4I4Y A;  2D44 A;  1J0S A;  3WO2 A;  1IRA X;  2XOA A;  5B2H A;  1T4Q A;  4EEE B;  1FMZ A;  2DRY A;  3NBE A;  4I0Y A;  2MLL B;  2X2T A;  1ILR 1;  1BAS A;  1S0E A;  4MZH A;  1JT4 A;  2P23 A;  3PG0 A;  1CE7 B;  2J3P A;  3I2A A;  1FV3 A;  4D0T A;  4END A;  4J2X A;  1WD4 A;  4QKS A;  3S8K A;  1TIE A;  1AVU A;  5EG6 C;  3Q7W A;  1I1B A;  1CVS A;  1SR4 A;  3AKF A;  3BRD A;  4H75 A;  4IZX A;  4OWL A;  3FJD A;  3WMU A;  4J2Y A;  4F34 A;  3TC2 A;  2I1B A;  4ZFW B;  4CJM A;  1BFF A;  1S0F A;  4QD2 C;  3FJC A;  2KI4 A;  3IM5 A;  1DLL A;  3FGM A;  5DSS B;  4G9M A;  1PUM B;  1Q04 A;  4UY4 A;  3CA5 A;  4QBC A;  3IAG C;  4GOV A;  3POK A;  4JKQ A;  2ZQN A;  2ET2 A;  4I37 A;  3A23 A;  4D0Z A;  5FNX A;  3A22 A;  2MC2 A;  1EV2 A;  3NBD A;  3P6I A;  4AN7 B;  1ITB A;  3BAV A;  1RG8 A;  3HSM A;  4Q91 A;  3HAL A;  4I96 A;  4EFP A;  1W3G A;  3AKH A;  4H9W A;  5EHA A;  3CA4 A;  4P6A A;  4D8H A;  1S0D A;  3VEQ A;  1IRP A;  1DQO A;  4X37 A;  8I1B A;  3V79 C;  1AF9 A;  1S0C A;  4I1B A;  1IHK A;  3KMV A;  3UD9 A;  4IQP A;  4LO0 A;  3LTQ A;  1HWM B;  3BAH A;  3BB2 A;  3BAQ A;  4MZF B;  4OW4 A;  2NZ9 A;  2AXM A;  4WBC A;  2K8R A;  3VWC A;  1V6V A;  4L4I A;  3NJ5 A;  4Q9P A;  1BFB A;  3N7K A;  3PME A;  2AFG A;  3ZC8 A;  5BP5 C;  5FZY A;  3FJH A;  4ISQ A;  3UJ4 A;  2Y9X E;  2VXR A;  5JLV A;  1YTO A;  4HA2 A;  5D61 A;  1ISZ A;  4JRA A;  4A7Z A;  2D24 A;  1WBC A;  1QQK A;  3JUT A;  3H6R B;  1ISW A;  3OBR A;  1AFC A;  4JAW A;  1G9D A;  2D23 A;  4LO1 A;  4A7K A;  1W3F A;  1SZ6 B;  5BXT A;  4I7I A;  2IHO A;  4GP3 A;  4GP0 A;  4KC3 A;  2P39 A;  1ISY A;  1JLY A;  2VSA A;  1PC8 B;  5G00 A;  1IJT A;  4Q9G A;  3UD8 A;  3BRF A;  3HBW A;  3AJ6 A;  4P0L A;  4QD2 B;  3FJK A;  1NZK A;  4EFR A;  1HWO B;  2E4M C;  3FJA A;  2WBC A;  1IOB A;  4USP A;  4X3A A;  1W3A A;  1BFC A;  3NBC A;  5FZU A;  2R9K B;  4JP0 A;  4JPZ A;  3BAG A;  3UJ0 A;  4LO1 C;  5F8W A;  2D1Z A;  1FMM S;  4L4H A;  1V6W A;  3AKG A;  4IY9 A;  4Z8S B;  1G9A A;  1A8D A;  2RQ9 A;  2KH2 A;  1QQL A;  3OGF A;  4YOL A;  3N7M A;  1K5U A;  4JQ0 A;  7I1B A;  3VSF A;  1HCD A;  3V0A A;  1HWN B;  3QR5 A;  1JT7 A;  3VUO A;  4KEI A;  4MZG B;  1VCL A;  1M16 A;  3E8L C;  3HMY A;  3O4C A;  3I29 B;  41BI A;  1S0L A;  5F90 A;  3MAL A;  31BI A;  1AVA C;  3H6Q A;  4KEJ A;  1V6U A;  1DFC A;  1RML A;  4LO8 B;  1HKN A;  1PUU B;  3O5W B;  2VSE A;  4QO3 A;  1BA7 A;  4HJJ A;  4ZLB B;  1HWP B;  3EF2 A;  1D0H A;  1N4K A;  4FVV A;  1JY0 A;  4FGF A;  3IIR A;  1V6X A;  4OWK A;  4USO A;  3B9U A;  1P63 A;  5D63 A;  4LO3 C;  2HW9 A;  1BAR A;  3ZXD A;  2QYI B;  2K4A B;  2Z48 A;  2AQZ A;  1Q1U A;  2FO1 A;  4X38 A;  3FUQ A;  2M49 A;  3FJF A;  5D62 A;  1UPS A;  3OJ2 A;  4ION A;  5BP5 A;  1JTC A;  3QYD A;  4XKI A;  1XHB A;  1S0G A;  3N7L A;  3O49 A;  1G9B A;  4EKX B;  2F2F C;  2KKI A;  4I4S A;  2BEB A;  3VSZ A;  4J23 B;  3AZW A;  3H6S E;  3W9T A;  1WBA A;  2VU9 A;  3RTI B;  3AKI A;  3O4O A;  5FNW A;  4ZFU B;  4OEF A;  1YF8 B;  2KLL A;  21BI A;  3ILA A;  3WO3 A;  3AH4 A;  1Z4S A;  2K43 A;  3O44 A;  3F62 B;  2F8X C;  3MPP G;  1EPW A;  3FJB A;  3AJ5 A;  2ESU A;  1YBI A;  4IHZ A;  4IZE A;  4QC4 A;  4XFS A;  4PC4 A;  1F31 A;  3PHZ A;  1YXW A;  1DJS B;  2MIB A;  4XFU A;  4I3N A;  3FJE A;  2D7R A;  5DZU A;  1DFQ A;  2ZR1 B;  1AVX B;  4QAL A;  1ISV A;  1TTU A;  1JLX A;  3PUB A;  2E4M A;  1TP0 A;  2HWM A;  1II4 A;  2X2S A;  4KEK A;  5HPZ A;  2RST A;  2HZ9 A;  2D7I A;  1IIL A;  1G82 A;  2FDB M;  1EVT A;  2BFH A;  5I1B A;  1AVW B;  3F1R A;  2RG9 B;  1M2T B;  3BAD A;  3N7J A;  4OEG A;  4ZOT A;  4EFQ A;  3I2X A;  2Q9X A;  4EB2 B;  4GAI A;  3O4B A;  4ISR A;  3VT0 A;  1DQG A;  5JMC A;  1ABR B;  1RZO B;  1WD3 A;  2QN4 A;  4IY8 A;  3FJI A;  3SNV A;  4G9N A;  4I4U A;  5BXR A;  3C9Z A;  1L2H A;  1BFG A;  4I8M A;  3P53 A;  3FUO A;  2NP0 A;  1HCE A;  1TWE A;  3FJ9 A;  3S8J A;  3BRG C;  5BQU C;  4JKX B;  3OGG A;  1XG6 A;  4LO7 C;  4QBV A;  5E24 E;  3V0B A;  4J2K A;  4ZA3 B;  3V0A B;  1YYN A;  1I1E A;  2Y9G A;  3CRI A;  2L5X A;  4LO3 A;  4I4X A;  6I1B A;  3VT1 A;  1Z0H A;  1R8N A;  3CA6 A;  3RMX A;  1K5V A;  3O3Q A;  1JT5 A;  1EYL A;  2VXT I;  3Q7Y A;  1JT3 A;  3RMY A;  2ZQO A;  4TLP A;  2F2F A;  3OJV A;  2Q3N B;  3Q7X A;  3P6J A;  1DZD A;  3WIN C;  3CQA A;  5F8S A;  2IWT B;  4I4R A;  2GO2 A;  3NBN A;  3WO4 A;  3FJJ A;  1R8O A;  3WA1 A;  4DEP A;  1OQL B;  3LLP A;  3N0K A;  4Z9W B;  2VLC A;  4AN6 A;  4G6J A;  1FV2 A;  1T9F A;  2FGF A;  1Z2V A;  2LIQ A;  3RSJ A;  3JRR A;  3CRG A;  3CA0 A;  2BEA A;  2ERM A;  2D22 A;  2NS2 A;  2KI6 B;  2AAI B;  3BA4 A;  1PZZ A;  1S0B A;  5DUY A;  4A7Y A;  4ZKT B;  5BXS A;  4I4P A;  4GAF A;  3WMV A;  3AZV A;  3ZXG A;  3T8S A;  3OBT A;  4OWJ A;  3BA7 A;  2D43 A;  4QKR A;  4KBB A;  3BA5 A;  2UUS A;  2YUG A;  4G6M A;  1XYF A;  3HN1 A;  1SR4 C;  1IT0 A;  1PWA A;  4J2S A; 
#chains in the Genus database with same CATH homology
 3R4S A;  3AH1 A;  3CA3 A;  4DEN A;  1TOO A;  5BOW A;  3CAH A;  4ZBV B;  5FZZ A;  3BX1 C;  3AH2 A;  2DRE A;  3ZX7 A;  2WRY A;  5BVP I;  1TWM A;  4I6I A;  1DIW A;  3O4A A;  1MC9 A;  3BTA A;  3VT2 A;  1BLA A;  3IM6 A;  4R6U B;  3FFZ A;  3UD7 A;  4F83 A;  4LO7 B;  4OUJ A;  3OJM A;  1HIB A;  4XFT A;  3A21 A;  1FWU A;  3IM7 A;  3HOM A;  4HR6 C;  2HWA A;  1FWV A;  4I4V A;  3UDA A;  3CRH A;  2NTD A;  4GOY A;  2Y9W C;  5EC5 A;  4LO2 A;  4ZFY B;  1ONK B;  1ISX A;  3FJ8 A;  5BQU A;  4IYB A;  2Z49 A;  4ZGR B;  1NUN A;  2NVH A;  3CA1 A;  5GAQ A;  4OEE A;  1DZC A;  1Q03 A;  3R4U A;  2D20 A;  4I4O A;  1E0O A;  1G9C A;  1KNM A;  4II0 A;  4P0K A;  1MD6 A;  3ZC9 A;  1GGP B;  2NM1 A;  2GZB A;  2LIE A;  3O4D A;  1FGA A;  1BLD A;  1FN0 A;  3K1X A;  4DCK C;  4I2S A;  3BAO A;  2DRZ A;  3RTJ B;  1QXM A;  3V0B B;  4LO0 C;  1TFM B;  2NYY A;  3H6R A;  4G1R A;  3WIN A;  3CU1 B;  1RY7 A;  4H04 A;  1JQZ A;  2DS0 A;  4LO2 C;  4X39 A;  9ILB A;  2VUA A;  4I4Q A;  1AXM A;  4I1E A;  5BXP A;  3BAU A;  1FQ9 A;  2FFU A;  3A07 A;  5F8Y A;  3D7W B;  1XZZ A;  2Y9F A;  5DVH A;  2FFV A;  4P0J A;  4I4Y A;  2D44 A;  1J0S A;  3WO2 A;  1IRA X;  2XOA A;  5B2H A;  1T4Q A;  4EEE B;  1FMZ A;  2DRY A;  3NBE A;  4I0Y A;  2MLL B;  2X2T A;  1ILR 1;  1BAS A;  1S0E A;  4MZH A;  1JT4 A;  2P23 A;  3PG0 A;  1CE7 B;  2J3P A;  3I2A A;  1FV3 A;  4D0T A;  4END A;  4J2X A;  1WD4 A;  4QKS A;  3S8K A;  1TIE A;  1AVU A;  5EG6 C;  3Q7W A;  1I1B A;  1CVS A;  1SR4 A;  3AKF A;  3BRD A;  4H75 A;  4IZX A;  4OWL A;  3FJD A;  3WMU A;  4J2Y A;  4F34 A;  3TC2 A;  2I1B A;  4ZFW B;  4CJM A;  1BFF A;  1S0F A;  4QD2 C;  3FJC A;  2KI4 A;  3IM5 A;  1DLL A;  3FGM A;  5DSS B;  4G9M A;  1PUM B;  1Q04 A;  4UY4 A;  3CA5 A;  4QBC A;  3IAG C;  4GOV A;  3POK A;  4JKQ A;  2ZQN A;  2ET2 A;  4I37 A;  3A23 A;  4D0Z A;  5FNX A;  3A22 A;  2MC2 A;  1EV2 A;  3NBD A;  3P6I A;  4AN7 B;  1ITB A;  3BAV A;  1RG8 A;  3HSM A;  4Q91 A;  3HAL A;  4I96 A;  4EFP A;  1W3G A;  3AKH A;  4H9W A;  5EHA A;  3CA4 A;  4P6A A;  4D8H A;  1S0D A;  3VEQ A;  1IRP A;  1DQO A;  4X37 A;  8I1B A;  3V79 C;  1AF9 A;  1S0C A;  4I1B A;  1IHK A;  3KMV A;  3UD9 A;  4IQP A;  4LO0 A;  3LTQ A;  1HWM B;  3BAH A;  3BB2 A;  3BAQ A;  4MZF B;  4OW4 A;  2NZ9 A;  2AXM A;  4WBC A;  2K8R A;  3VWC A;  1V6V A;  4L4I A;  3NJ5 A;  4Q9P A;  1BFB A;  3N7K A;  3PME A;  2AFG A;  3ZC8 A;  5BP5 C;  5FZY A;  3FJH A;  4ISQ A;  3UJ4 A;  2Y9X E;  2VXR A;  5JLV A;  1YTO A;  4HA2 A;  5D61 A;  1ISZ A;  4JRA A;  4A7Z A;  2D24 A;  1WBC A;  1QQK A;  3JUT A;  3H6R B;  1ISW A;  3OBR A;  1AFC A;  4JAW A;  1G9D A;  2D23 A;  4LO1 A;  4A7K A;  1W3F A;  1SZ6 B;  5BXT A;  4I7I A;  2IHO A;  4GP3 A;  4GP0 A;  4KC3 A;  2P39 A;  1ISY A;  1JLY A;  2VSA A;  1PC8 B;  5G00 A;  1IJT A;  4Q9G A;  3UD8 A;  3BRF A;  3HBW A;  3AJ6 A;  4P0L A;  4QD2 B;  3FJK A;  1NZK A;  4EFR A;  1HWO B;  2E4M C;  3FJA A;  2WBC A;  1IOB A;  4USP A;  4X3A A;  1W3A A;  1BFC A;  3NBC A;  5FZU A;  2R9K B;  4JP0 A;  4JPZ A;  3BAG A;  3UJ0 A;  4LO1 C;  5F8W A;  2D1Z A;  1FMM S;  4L4H A;  1V6W A;  3AKG A;  4IY9 A;  4Z8S B;  1G9A A;  1A8D A;  2RQ9 A;  2KH2 A;  1QQL A;  3OGF A;  4YOL A;  3N7M A;  1K5U A;  4JQ0 A;  7I1B A;  3VSF A;  1HCD A;  3V0A A;  1HWN B;  3QR5 A;  1JT7 A;  3VUO A;  4KEI A;  4MZG B;  1VCL A;  1M16 A;  3E8L C;  3HMY A;  3O4C A;  3I29 B;  41BI A;  1S0L A;  5F90 A;  3MAL A;  31BI A;  1AVA C;  3H6Q A;  4KEJ A;  1V6U A;  1DFC A;  1RML A;  4LO8 B;  1HKN A;  1PUU B;  3O5W B;  2VSE A;  4QO3 A;  1BA7 A;  4HJJ A;  4ZLB B;  1HWP B;  3EF2 A;  1D0H A;  1N4K A;  4FVV A;  1JY0 A;  4FGF A;  3IIR A;  1V6X A;  4OWK A;  4USO A;  3B9U A;  1P63 A;  5D63 A;  4LO3 C;  2HW9 A;  1BAR A;  3ZXD A;  2QYI B;  2K4A B;  2Z48 A;  2AQZ A;  1Q1U A;  2FO1 A;  4X38 A;  3FUQ A;  2M49 A;  3FJF A;  5D62 A;  1UPS A;  3OJ2 A;  4ION A;  5BP5 A;  1JTC A;  3QYD A;  4XKI A;  1XHB A;  1S0G A;  3N7L A;  3O49 A;  1G9B A;  4EKX B;  2F2F C;  2KKI A;  4I4S A;  2BEB A;  3VSZ A;  4J23 B;  3AZW A;  3H6S E;  3W9T A;  1WBA A;  2VU9 A;  3RTI B;  3AKI A;  3O4O A;  5FNW A;  4ZFU B;  4OEF A;  1YF8 B;  2KLL A;  21BI A;  3ILA A;  3WO3 A;  3AH4 A;  1Z4S A;  2K43 A;  3O44 A;  3F62 B;  2F8X C;  3MPP G;  1EPW A;  3FJB A;  3AJ5 A;  2ESU A;  1YBI A;  4IHZ A;  4IZE A;  4QC4 A;  4XFS A;  4PC4 A;  1F31 A;  3PHZ A;  1YXW A;  1DJS B;  2MIB A;  4XFU A;  4I3N A;  3FJE A;  2D7R A;  5DZU A;  1DFQ A;  2ZR1 B;  1AVX B;  4QAL A;  1ISV A;  1TTU A;  1JLX A;  3PUB A;  2E4M A;  1TP0 A;  2HWM A;  1II4 A;  2X2S A;  4KEK A;  5HPZ A;  2RST A;  2HZ9 A;  2D7I A;  1IIL A;  1G82 A;  2FDB M;  1EVT A;  2BFH A;  5I1B A;  1AVW B;  3F1R A;  2RG9 B;  1M2T B;  3BAD A;  3N7J A;  4OEG A;  4ZOT A;  4EFQ A;  3I2X A;  2Q9X A;  4EB2 B;  4GAI A;  3O4B A;  4ISR A;  3VT0 A;  1DQG A;  5JMC A;  1ABR B;  1RZO B;  1WD3 A;  2QN4 A;  4IY8 A;  3FJI A;  3SNV A;  4G9N A;  4I4U A;  5BXR A;  3C9Z A;  1L2H A;  1BFG A;  4I8M A;  3P53 A;  3FUO A;  2NP0 A;  1HCE A;  1TWE A;  3FJ9 A;  3S8J A;  3BRG C;  5BQU C;  4JKX B;  3OGG A;  1XG6 A;  4LO7 C;  4QBV A;  5E24 E;  3V0B A;  4J2K A;  4ZA3 B;  3V0A B;  1YYN A;  1I1E A;  2Y9G A;  3CRI A;  2L5X A;  4LO3 A;  4I4X A;  6I1B A;  3VT1 A;  1Z0H A;  1R8N A;  3CA6 A;  3RMX A;  1K5V A;  3O3Q A;  1JT5 A;  1EYL A;  2VXT I;  3Q7Y A;  1JT3 A;  3RMY A;  2ZQO A;  4TLP A;  2F2F A;  3OJV A;  2Q3N B;  3Q7X A;  3P6J A;  1DZD A;  3WIN C;  3CQA A;  5F8S A;  2IWT B;  4I4R A;  2GO2 A;  3NBN A;  3WO4 A;  3FJJ A;  1R8O A;  3WA1 A;  4DEP A;  1OQL B;  3LLP A;  3N0K A;  4Z9W B;  2VLC A;  4AN6 A;  4G6J A;  1FV2 A;  1T9F A;  2FGF A;  1Z2V A;  2LIQ A;  3RSJ A;  3JRR A;  3CRG A;  3CA0 A;  2BEA A;  2ERM A;  2D22 A;  2NS2 A;  2KI6 B;  2AAI B;  3BA4 A;  1PZZ A;  1S0B A;  5DUY A;  4A7Y A;  4ZKT B;  5BXS A;  4I4P A;  4GAF A;  3WMV A;  3AZV A;  3ZXG A;  3T8S A;  3OBT A;  4OWJ A;  3BA7 A;  2D43 A;  4QKR A;  4KBB A;  3BA5 A;  2UUS A;  2YUG A;  4G6M A;  1XYF A;  3HN1 A;  1SR4 C;  1IT0 A;  1PWA A;  4J2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...