5DSZA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
408
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Gamma-subunit of the translation initiation factor 2 from S. solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 91
structure length 408
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dszA01
2ANBA 1W4CA 1OYWA 2J7PD 2VNKA 5GVSA 1VYUA 3BFXA 3CR8A 1KJYA 2GJSA 3QFTA 3CRW1 3P27A 2NOAA 1CJKC 5JZVA 2ZAOA 4KVGA 2BEKA 3I62A 3VR1A 4A0RA 4M21A 4TLAA 2IYRA 3VO2A 1IY1A 2FH5B 3Q72A 3NIBA 2FSHA 4I1UA 2ZR0A 1ZINA 1QHHB 2UZ3A 3FPAA 2QMUA 3AVWA 4B34A 1W0KA 4H1UA 4XD7A 2R6DA 3I73A 2BC9A 1AS3A 5JI3E 4MITA 5IHPA 2WZQA 4OQMA 2ZJYA 4U02A 3GLFA 1YR7A 3U3MA 4PQYA 5CK4A 3A4LA 1VQ9B 4Q18A 1U0LA 2ZRKA 4P4SB 4W9MC 3PCRB 2REXB 2DBYA 2WSSA 3MWKA 4NYJQ 5FOWA 121PA 2XX3A 1N6LA 1KDPA 4AKGA 5F98A 1FUUA 5L3QB 2ZYUX 3B85A 3MHPA 1PLKA 3AF1A 1AIPA 4LJ5A 3QF7A 2CXXA 4US1R 2ZE7A 4WA7A 2RCNA 4AKEA 4D82A 4RJLA 3GJ4A 3HP1A 2W0SA 3GJXC 5P21A 1RFLA 4TTPA 1IM2A 1EG7A 1FP6A 3QKRB 4Q7JB 1F2TB 1G4AE 5DIFA 1N6PA 2ZJ5A 1NJGA 1QBKC 1LV7A 2AD5A 1KZ7B 4JL5A 4L4UA 2BM1A 4QGHA 4YMWA 1G8YA 1II8A 1IN7A 2BPOA 3SBDA 2A5FA 4Q21A 1E32A 2ZSEA 4LHWA 2ZI9A 3QFRA 1PUIA 2R62A 3C15C 2VSOA 1KK0A 1ONBA 2E1RA 4PHTA 5CIWA 3AB3A 1Z0JA 1QHHA 3W8RA 5L3VA 2D2EA 4GZLA 3AKYA 5E3HA 3EX7C 1Z6XA 3PG5A 1N3BA 3EZ7A 2CL7X 3BWDD 1K5GA 4EQ6A 4R7ZA 4V0LA 3PEVA 1W4RA 2QP3A 1MO4A 4KBGA 4EPRA 1NG9A 1OH7A 5DISB 3BE4A 3VAAA 2WWYA 3C8UA 3ASYA 5JSZA 1OGJA 1VECA 2P6RA 3UG7A 5KUTA 3AF2A 3UK6A 3GLFE 1P6XA 4LJAA 4JLMA 5JECA 1FUKA 3OAAA 4HZIA 3EZ9A 1TADA 2ZRAA 1WBBA 1JNYA 1NN5A 2P2LA 2GCNA 3AVPA 3ZZ0A 1E1RA 2WJJA 1F2UB 3G0HA 3U6KA 3K70B 3AEZA 1NF3A 5HXBA 1VQNB 1TEXA 4ASUD 1XMIA 2BBSA 2RMKA 1G8HA 5AUQA 4O2RA 2VP2A 1ZYUA 1IJEA 4LJ4A 4Q47A 3REGA 2IK8A 1EK0A 2BM0A 3UMFA 2X3UA 3ADDA 2IS4A 4EPVA 3KQKA 4NKRA 4JJKA 4Q9HA 1JXOA 2IXEA 3EXAA 4OKSA 2D06A 4HZUB 3LDAA 3SHFA 1QGZA 4ZI3A 2JLYA 3ECCA 2OCPA 2ZRJA 4A92A 1E9FA 5BQ5A 4QFMA 1TF7A 4LC1A 5KOYA 4MDFA 3HR7A 4DDVA 4V0OA 1P2VA 3EZFA 3X2SA 2BN4A 3WYFA 4ZV4A 2PLRA 4M1TA 4PPGA 1TQ6A 3PENA 3A6PC 1E2LA 2ZSFA 4G1VA 2CLCX 3RSLA 2V8OA 3U61B 2FGKA 1QH0A 1KDOA 1ZRHA 2VSFA 4JLBA 2ZRHA 3AVTA 1R0WA 1SVIA 1Z0IA 2BMJA 2UVQA 2QM7A 4B2PA 1JJVA 1QUEA 3JVVA 2AWOA 4YALA 1J99A 4OHXA 2F1HA 2OTJB 3A1UA 3AGQA 4GP6A 5G53C 3BERA 2QAGC 3K0SA 2CMKA 4PAOA 4UAJA 3U7EB 1EWYA 2IT1A 2QU8A 2J9RA 5IT5A 4DB2A 2GCOB 4UNSA 2XNJA 1KSHA 1LB1B 4IFEA 3WNDA 1WBDA 1DTSA 4RKFA 1DEKA 3DOFA 2IHYA 4TSFD 1I2DA 1Z08A 4C0SA 2OCAA 2D74A 2QL6A 1F6BA 2W6JD 3DZ8A 4QJ3A 3OZVA 2E9SA 3F5FA 4H1VA 1E99A 1SVMA 1JA1A 2WHXA 1DVRA 3QFCA 3CZPA 1P60A 2PZGA 2VH5R 2OT3B 5G3YA 3VKHA 2ZYTX 1BX1A 2X2EA 3CX8A 1OFTA 3FFAA 5J4VA 3CZQA 1KOFA 3CNOA 3KTAB 3HU2A 1E0KA 2OG2A 4EFMA 1BOFA 3WMFA 4ARZB 1DAMA 4JL8A 1S1CA 3HPQA 4EJSB 4DCNA 2CDNA 1EP1B 1M7BA 1Z83A 2J7PA 2WICA 5SZKB 4IDHA 4CEHA 1K8AD 1DADA 2B8TA 4GOKA 3I5XA 4A15A 4LZZA 2ORVA 4MYCA 1Q20A 2VYQA 4CEIA 4HDQB 1DG3A 1KO1A 2CE7A 1A8PA 3AVYA 3UATA 1H85A 1GL7A 2VHUA 2ZS7A 5HCNA 1XF9A 2OBNA 1LW7A 2ZYWX 2GCOA 3AVUA 1HH4A 4QHSA 4Z8XA 4DBLC 1NIPA 4QBFA 1EGAA 5DN6D 2F9LA 5JHGB 2RHDA 5FUWA 2D7DA 3DM9B 1XEWX 2G9NA 2DEUA 3ZBTA 4P4TA 4AURA 5FOUA 1CR4A 1G9XA 3NEYA 2X19A 2EWWA 2ONKA 2EFCB 2ERXA 1W1WA 3HR8A 4BFUA 2V6JA 4B6FA 3U3RA 2IYWA 4UXHA 1DAHA 2UZIR 5EXTA 1U8YA 1CBUA 1AMOA 2PH1A 4LWZA 1D9ZA 5H1YA 3SBEA 1CKEA 4IVQA 3VNUA 3U7HB 1OT3A 1AKEA 3I32A 3CR7A 4LV8B 1LY1A 1IHUA 3PEYA 1XBTA 1T5IA 4XSHA 5TY0A 1E94E 3VU9A 4X8HA 3W3ZB 5TARA 4DEYA 3SQWA 2EFEB 1XMJA 2DR3A 2BMFA 4EAQA 3PEWA 1UKVY 4PQFA 4JSTA 2FDCA 4OHWA 4KLNA 4M9QA 4JLVA 4BEBA 3MMPA 2J46A 4OHYA 4Q9KA 3AGPA 1P75A 2IYLD 3ZD7A 3QXJA 1MT0A 3THWA 4PC3A 1BH2A 1RW4A 2EFHB 2H18A 2HXSA 5TB5A 4B6EA 4B3BA 5DYGA 3D6TB 1EX7A 1A2KC 1M7GA 2OESA 4QXAA 3FWYA 4LJ6A 5KNDA 2QPAA 4IVRA 4GT1A 2KE5A 2XSZD 3UIEA 2CBZA 1JB9A 4DDWA 1OIXA 1DS6A 1Z0AA 2GXUA 3RRNA 5BXQC 1TF2A 4LJ9A 3UMRA 4CW7A 2QNRA 2NZJA 2FOLA 5L3RA 4DT1B 2JLZA 2QI9C 3AQ4A 3QKSB 2W6ID 3THXB 5CITA 4K1XA 1IN8A 2OFWA 4AYXA 3BXZA 2GF0A 3TAHA 1VDZA 4WAUA 4R9UC 3TIFA 1EWRA 3KUDA 1UEJA 4NDZA 4KJZA 1VMAA 2C9YA 1W36B 5LD2B 5KSWB 1KI2A 1MH1A 3PFIA 4L9WA 4C3ZA 3KQLA 1E2EA 2WKPA 3ETLA 4B74A 5H8WA 3TSWA 1QUFA 5HCIA 3PQCA 1W44A 4ASUA 3B7GA 4TYPA 4LBYA 4S2EA 4EPXA 2QRZA 4JSYA 1W0JD 4PAMA 1N6HA 1VCIA 1LS6A 1TL7C 1ZUIA 3H1TA 4ITRC 3UWKA 3RSOA 3SFVA 3GD7A 2IF0A 4V0MA 5FTJA 3RVBA 2GRJA 2IA5A 2J0UA 1XMSA 4WZ6A 5HE8A 1A1VA 1MOZA 3BB1A 5AUNB 2DWOA 1L2TA 1XD8A 4K81B 1E9BA 2FPMA 5AK0A 3AP1A 1YQTA 2SHKA 5IF9A 4MRSA 1XTRA 2WTUA 3TW4A 4XWKA 2IL1A 3LH5A 2QMEA 4UJ5A 4OK6A 5EP3A 1TUEA 3T15A 2GJKA 2AD1A 3FKSD 4XSGA 3J81k 4KAXA 3IQWA 1E1QD 4AG6A 5FPTA 1G3RA 3P4XA 2XTZA 4HYYA 1HT1E 3U3JA 1XEFA 4DVGA 1X86B 4F4JA 1GJRA 4IDQA 3NHBA 3QXSA 1CS4C 2Y8EA 1Z22A 5EZ6B 4JS0A 4HI0E 2YNMA 3KQHA 2XITA 3QFSA 5FPKA 1AK2A 1N0WA 3F0TA 2I4IA 2GZDA 4CF7A 2CHGA 1T8UA 3RNLA 2C78A 4B48A 2DFTA 3GJ5A 1NMXA 4TSFA 4FINA 2X1VA 5E95A 4YAOA 3CC7B 5CLQA 2H17A 3BB4A 1ZBDA 5EP1A 3CRZA 2W6JA 2O8DA 5M04A 4XVRA 3K0CC 2R6AA 3K70C 2GK7A 1JB1A 1K8RA 4WW0A 1YR6A 3VHLB 4AD8A 2K5UA 2OXRA 2BKUA 5DI3B 3W90A 4URWR 3MSXA 5FPYA 4CIDA 1IY0A 4OHZA 2E87A 5BYKA 3PUXA 1VQ7B 1QDEA 1XTKA 2GETA 2ZI3A 1KC8D 5AJXA 5K8LA 1OFUX 2G0NA 4LRWA 3SS8A 4V0ME 2IUSA 2ZRNA 3CWZA 4O2LA 1CTQA 4LX0A 4R98A 3AF4A 3TSZA 4ZDIA 3IEUA 1TQ4A 4WQMA 3W2IA 4KV9A 2ZRGA 2HJGA 3NG1A 3NH6A 1CJUC 2WAXA 3E2IA 3WP0A 2GEDA 1TX4B 3JVUA 1FMJA 3QVVA 1IOZA 2EVWX 4FCWA 3B5JA 3D31A 4MRVA 1QFYA 4F38A 2OAP1 2QN6A 4HSEA 3DL0A 2JJ8A 1OH5A 1I4TD 1QG4A 2W2TA 1MRNA 2YC4C 3R9WA 3M1IA 4Q9JA 3GMTA 1GG2A 4RZXA 4NE2A 1D9XA 2TMKA 4OJKA 4WXPA 5DN6A 3C14C 1GP2A 5E7JA 2J0SA 1UAAA 1U81A 2EW1A 4C9BA 4PAQA 5GADl 1PVOA 1VQPB 1CIPA 4PSVA 1TEVA 5JCPA 2FFBA 1E0JA 5J4HA 4LYFA 4DLUA 3ZQ6A 4QGFA 3TGPA 1SVOA 1WF3A 1JAHA 1OPXA 4NCNA 1D5CA 1JALA 1A82A 5AJZA 4BFYA 1JEDA 1E64A 1U90A 4I81A 4TMKA 5KSOA 1LFDB 1ODFA 3H2YA 3AV0B 3WYGA 1W2HA 3W5JA 3MJHA 3ZZTA 3CCVB 2RGNA 4B32A 1N25A 4QBHA 5FUVA 3TAUA 4R2HA 4MGZR 5FTNA 1GKUB 2FFQA 2VP0A 4P0TA 3RRZA 5KSYA 1KDTA 2C8VA 1SXJC 4WBSA 1T9HA 1Q22A 4GZMA 2OXCA 4OQLA 4RD3A 1KKMA 2V1UA 1U94A 1KY2A 4ZCMA 3MGCA 1DAIA 1KO5A 5D3MB 1KO4A 2GNOA 4UXJA 4EJSC 5JI2E 1HY3A 3EW9A 1W4BA 4YMUA 1GTVA 4QRHA 4JBYA 1NJID 1XEXB 3GEIA 5B30A 1RC8A 4HB0A 1OV4A 2QE7D 4HE5A 2XSZA 1UKEA 4ZGQB 1NLZA 1LF0A 1XD2B 3CCEB 3KFXA 2IYXA 5AUPB 1XJ0A 3BS4A 3PJRA 4JLOA 1HT2E 2W6IA 5DNYB 5AJYA 2FEMA 3NBYC 1Y3AA 5DO9A 3V4RA 4RD0A 3QJYA 2D7CA 1Z8FA 4PHFA 2PEZA 1OHHD 1DAFA 2IXGA 1G7SA 1PJRA 2OLKA 3CF0A 1CJTC 4H9GA 4RKEA 3SYNA 4Y7CA 2IYUA 4DXAA 2GJAA 2GXSA 3I4LA 2ZSDA 1XJCA 3WXMA 4OQNA 3UWOA 2PEYA 5KTYA 1E9CA 3TBKA 4BLRA 1NMZA 3HYRA 5FH9A 4V02A 3VMFA 1XTIA 5DGXA 1VYVA 1CP2A 5JWHA 1G18A 3RS3A 1T0HB 1ZM4A 1ZCAA 3I92A 3Q9LA 4TTRA 1W0JA 5E7MA 2DY1A 1XTSA 4KXFB 1KK2A 5JBQA 2J0VA 3NDBB 2ZRCA 4MUAA 1SULA 2QTHA 3BH6A 2O8BB 4Q9IA 1M8PA 4ACBA 1IN4A 4I1VA 1XEWY 1DG1G 2ORIA 3QVUA 2GKSA 4F93B 2W0MA 1MR3F 3IQXA 1XEXA 1E79D 2WVJA 2ZUCA 2BVNA 3NC1C 3I56B 2YOFA 4QJ5A 3C16C 3D3QA 5FTMA 4D4LA 4M1MA 5JJIA 4V03A 1XP8A 3CCSB 1WB9A 4TL9A 1QHGA 2F1JA 1QZXA 2ZU6A 3UANA 3L0SA 3K1JA 2F3RA 3BIFA 2GVDC 3ND8A 4OYHA 1ETUA 3Q8XB 3FKSA 3CX7A 4IDPA 4X8LA 2YC2C 4BZXA 3W9YA 3THOA 2VRWA 1E1QA 1A7JA 2WIAA 3VTKA 2CL6X 5LDDC 4GMDA 3WYAA 1E9SA 1FRNA 4Z8YA 1FPMA 3RRMA 2WIBA 2JJ1D 3AH8A 1TTTA 2GESA 1H42A 4NZYA 4C0KA 1XMVA 4C0AC 2ZRBA 4MRPA 1G5RA 2C98A 1KMHB 4U7DA 2NMVA 2ZVQX 4BEJA 5LD2C 1BQEA 5C46F 3F3YA 3U60B 1Z47A 4PC7A 1OXSC 4N1AA 2RGDA 4A8JC 2AXPA 4NYIR 1FX0B 5K8TA 5ELXA 1QVRA 3U44B 2HCBA 1MKYA 2H16A 3QPUA 1RPZA 3W3AA 1IQPA 2QP9X 3EPKA 2IUUA 1XRJA 4LYAA 2B7BA 1BS1A 4G01B 3X1XA 3PUVA 4ACAA 3IIMA 2JDID 4IRUB 6Q21A 1KY3A 3MLEA 1A2BA 4LOAA 1G3IA 2J0QA 1NG1A 1J90A 3NXSA 4I4LA 2QROA 1C4OA 3LVBA 1G291 3B1WA 2WOJA 1K6MA 1UKYA 1P73A 2QM8A 5BN5A 2VEDA 4HAXA 4ZKDA 3CF2A 3W5UA 2F55A 4M1WA 1C1YA 4OI1A 1MABA 2EQBA 1P4SA 2XZPA 4MA4A 3FYHA 1B2RA 4B44A 2QTFA 3B9QA 4B2LA 2CHVA 1A5TA 2OV2A 3V4FA 1FFHA 1QRAA 2QT1A 5G40A 4C0BA 3U4QA 3WP1B 3EAQA 3CBQA 5ANRB 4LPSA 1G21E 4YAFA 1XZPA 3OJWA 2XTNA 3CUEF 5JEEA 2QBYA 1RE0A 5EUQB 2LWIA 1W48A 1WCV1 1Q3HA 1KI6A 1VTKA 4BPRA 3RS5A 1F60A 2REOA 3A1VA 4DHEA 5BYJA 1R0ZA 1G5TA 2V9PA 3OE7D 3KX2A 5C18A 1OXVA 1ZU4A 3A4MA 2Z5FA 2YOGA 5HKKD 2G1KA 5CYPA 5EE5B 4URVR 3AKCA 4Z51A 1N8RD 1SVWA 2OK7A 5H70A 3GJ6A 1W34A 1VHLA 3CCLB 2HEIA 2C9CA 3U5ZB 1KSGA 1YRBA 2EYUA 1WA5A 2JEOA 3S1AA 1HUQA 3M4YA 2FGJA 2IEZA 4LCBA 4LDJA 3KB2A 4D6PA 1AM4D 4DKXA 3SE0A 3D8BA 1SKQA 1II8B 3WMEA 1GKIA 2PJZA 3QPVA 5EZ5A 2VF7A 4DJTA 2IYSA 4C2TA 4OK3A 4EFNA 4RZ3A 2HT6A 3B8HA 1JR3D 2PCLA 3ZGXA 4IOLA 3AM1A 2IW3A 2OBLA 2QE7A 3W8NA 1R10A 1BYUA 2ZR7A 2DETA 4EQ6B 2NQ2C 2ERYA 3RYTC 4DDTA 3GLHA 1YU9A 1ZNXA 3FFBA 1AQUA 1ESMA 3QENA 5JSZB 1E6CA 4JLDA 5FI1B 3BOSA 3IO5A 1SZPA 4KBFA 2HLDD 3WHKA 4A2WA 2RAPA 4JLPA 1OHHA 4CZ2A 4ZPXA 5AJWA 3FHTA 3FVQA 3BK7A 3K8YA 1VQ5B 4BFXA 2GZAA 2IX3A 3DKPA 2FX3A 1G41A 1GAQA 1I4LD 4Q66C 3JZMA 4A36A 3LO8A 4GSYA 4MGKR 5DYIA 2R44A 2P67A 4Q02A 4TMTA 4GP7A 2LKDA 1Z0FA 1CXZA 1BMFD 2OBMA 1G8FA 2BIFA 5JEDA 4HLDA 3PITA 3CONA 2X8AA 4MRRA 1FNBA 1P5ZB 1R8QA 2C03A 1I7PA 4U9UA 1YRAA 2IWRA 1DDIA 4EKDA 4BRUA 4L5BA 3FPKA 2NO6A 1DBSA 2WWHA 1GAWA 1Z07A 1Q81D 4TMZA 1B23P 4CEJA 3GLIA 3VO1A 1SKYB 1SXJD 3LVQE 4TYYA 2V3CC 3CRQA 1QHYA 1E79A 3LY5A 3LVRE 1VQ4B 5A0FA 5SZIA 1W2GA 1WQ1R 1W5SA 3I5YA 4QOSA 3I61A 3LWNA 1PV4A 4K8OA 4Q4AA 2GBLC 2A7QA 1W2BB 2JLXA 1H65A 4DB4A 4BZQA 2H92A 3QE2A 4LHYA 1QHIA 1G4UR 3O8BA 2XTMA 3CCRB 5DLQC 3SFZA 2W83A 3TUIC 2QZ4A 4A0FA 2YWGA 3L82B 3EPLA 4NYMR 2JJ1A 1X8LA 2QMOA 2ODEA 2JATA 3GJ7A 1XPOA 2WWWA 2F9MA 3VFDA 4B3FX 4AYTA 4LV6A 1ZNZA 2X77A 2BKEA 2JLSA 3JZAA 1NLFA 3LXRA 3ZVNA 4DC9A 3L43A 5FTKA 1OXTA 4N3GA 2J59A 1GNRA 521PA 1QG2A 5FR1A 1KDRA 2YWEA 5KSZA 1FTSA 1CJMA 1LVGA 1WE2A 3EWAA 3KJHA 4G5OA 3ADKA 3OHMA 2NO1A 2ZJ8A 3A37A 3EA5A 1NN1A 3CLVA 4C4PA 2V55B 1YR8A 3X1ZA 4AIIA 4C0JA 3NEJA 1JA0A 1GUAA 5KHOC 3G5UA 3SHWA 1Z29A 1MV5A 2JDIA 3ZZUA 2PX3A 3BFKA 1F48A 1R7RA 3DM5A 2BV3A 5FBQB 4DCTA 2OHFA 1W4AA 3GLIE 4CEHB 1M34E 4I1OA 5B64A 3IEVA 2BHRA 4QGAA 1S72B 3A1WA 2Q9BA 1IBRA 3CRRA 4PX9A 4TMXA 1KYIA 1S0UA 1ZC4A 2JLRA 2PZEA 4Y0VA 1OH6A 4JLAA 4O3MA 2RHMA 2ZS8A 4CVNA 5H5JA 2RGBA 4PC6A 4B3XA 3FMPB 4LI0A 1J70A 2QEQA 4ZDJA 5TVKA 2IC5A 4PO9A 4YQFA 5HR5A 3WY9A 2AFHE 1Q1EA 4RFVA 2EFGA 1P2UA 4Q4HA 2RGAA 2ZQ5A 4DDUA 2N46A 2HT1A 5KDOA 1KK1A 3KB1A 5CB8A 1ZCBA 4BLQA 4YXWD 3WNCA 1NP6A 2D3WA 2ODNA 2QMHA 1OIWA 3PVSA 2FFAA 3ZYCA 1KQSB 2Q9CA 4PZYA 1AA9A 1YJNB 1ZU5A 2ZI6A 3OE7A 3NH9A 2GAOA 4MQBA 3AUYA 4Q4JA 621PA 1KMQA 2ZAMA 5HKKA 3K9GA 3ZVRA 3DMDA 2PX0A 1GL6A 3PR1A 3KKOA 4W7SA 3K0CA 2GPJA 1OXUA 4FW9A 2V54A 5KU1A 3CPEA 5FR2A 2NIPA 4LYHA 4PC2A 4L16A 2CVHA 3VU9B 1OE0A 3QEOA 2R6FA 5FUYA 1NMYA 1T8TA 1NKTA 4A9AA 4A0HA 1SKYE 3KXLA 1GSIA 1N0VC 3QXXA 4Q01A 3PUYA 1ZIPA 1OIVA 5FBVB 5J47A 4IDOA 5FI0B 3THWB 4PHHA 4KO8A 2C2HA 5KDLA 3SJAA 3VQTA 3ZDQA 3RS7A 2J5XA 4RVCA 3SZRA 4YMVA 1Z6GA 1JR3A 2B6HA 4B4DA 4LHXA 1H8HD 1CR1A 3QNUA 2HXYA 4CRWB 4II7A 4Q1FA 1KZGB 1NIJA 1AS0A 2QA4B 2WOOA 4HB4A 3NKVA 5J40A 3EPJA 3BRWD 2ZI5A 3C5CA 4UNPA 3TRFA 3T1QA 1SVLA 1G3QA 1KI1A 3G82C 4BFZA 2ZE8A 3MJRA 3OIVA 4MYHA 3CC4B 2ONJA 1CEEA 1LF5A 2YZ2A 2HLDA 2J1LA 2C9OA 3B2EA 4QNRA 4R2IA 3QUSA 4U00A 5F2EA 2VHTA 2QY9A 4YAUA 2GWHA 4N3NA 1O87A 4FI3C 2L0XA 1QVFB 1XE1A 2NPFA 2XJ4A 1NVVQ 2R6CA 5EE9A 2VNHA 2IXFA 2ZIAA 1AGRA 4Q00A 4UXIA 4NHOA 2QG6A 4Z1MD 1VCNA 1BMFA 4LV5B 4HLQB 4PZZA 5AR1A 1G17A 2WSMA 2J3EA 1J7KA 3GJ0A 1OFIA 2OLJA 4W5HA 2FZLA 3IILA 4DWJA 5GVRA 3SNHA 3TUZC 3OJXA 2J0UB 2Q21A 4ILEA 1CRPA 1FNCA 3GFPA 2X2FA 2Z4SA 3UG6A 4NCJA 3TK1A 3V76A 2O8FA 2OO7A 1SXJA 3QKTA 5TDHA 4QJ4A 3TQCA 1G3MA 3E1SA 2G3YA 3LQRA 1UFQA 4XIGS 1NBMD 2VTKA 2ZVPX 4KHZA 1UEIA 3IUYA 3NHAA 4GPTA 3AKEA 4PR0A 1N0UA 4A0GA 4CGZA 4TT3D 1IB0A 2H7VA 1VCMA 4FMBB 2FU5C 4HE6A 4M1KA 2ZE5A 3CPHA 2Z43A 2DWPA 2XB2A 4RD6A 1QGAA 1JR3E 1NI3A 4M1YA 4Q7LA 5DHAA 3Q5EA 5SZJA 4UNNA 1GO2A 3E20A 4G1BA 4POAA 4A6XA 1FNNA 4LBWA 1BKDR 1Q12A 1ZM7A 2IEYA 2GF9A 2A5DA 3T06B 3V00A 4JT2A 1NSTA 4OJQA 4D4MA 2O8DB 2VL7A 2CNWD 2VP6A 4JL6A 3U7FB 2MSDB 1U2RA 1P3JA 4ZKEA 1RRFA 4XVQA 3IKJA 2YWHA 3CPJB 5JWOA 2REBA 2WWGA 3RS4A 4D2IA 4BRWA 1ZJ6A 4JLKA 5DE3A 1HQCA 2GEUA 4XH9B 1VIYA 4G0NA 1Z06A 2A5GA 3JQQA 1N2CE 2CCJA 2D2FA 4HB3A 1Z28A 4TQ9A 3ES9A 4QG7A 3Q7PA 5EE1A 2B92A 2FE4A 1LNZA 5EXSA 2ZU0C 1MO3A 2B8WA 1HE8B 1VG8A 1I2MA 4CT5A 4QM7A 3K53A 3K0EA 1TUIA 4LK2A 2ZSAA 1DPFA 1EP2B 4F7DA 1II9A 4GFDA 4Y0AA 1Q0UA 3T35A 3QPWA 5EUMA 3B60A 1UADA 2WJVA 1E2MA 4M9SA 4BLOA 1OYYA 4PSKA 1JQJC 4BFWA 3BB3A 1VQKB 2YV5A 1Q7YD 3HWSA 4LC0A 1W87A 1Z5ZA 2R9VA 4FMCF 4E03A 3FJOA 2H8KA 1XXHA 1JPNA 1D6JA 4PSAA 2VP5A 3T12A 3OEED 3EG5A 2PBRA 2VIIA 1KTVA 1NVUQ 2VA8A 2C95A 3BJIC 4TQAA 2GEVA 5H68A 1EXMA 1FTNA 4Q03A 1M7HA 3AVVA 1VCOA 5GJCA 4DLXA 3QG1A 4RCYA 3B1ZA 2VP9A 5JLJA 5B58C 3W34A 3IO3A 2ODBA 4FN5A 4DQKA 2RH5A 3CNNA 4A6PA 1U99A 5LB2A 4LSGA 2BGJA 3RAPR 2D62A 1BIFA 3PV0A 1P9WA 4A8JA 1E9AA 1L8QA 3QBVA 1UBGA 1TVCA 4YDHB 5J5CA 3LXXA 1JR6A 5EXPA 1S8FA 2PLFA 3Q3JB 3X1DA 4AI6A 4QKQA 1XPRA 4EH1A 1E96A 3P4YA 2BJVA 3CF6R 2XNSA 2QQ0A 1G7RA 4Y9RA 2HCJB 4Q7KA 4W5WA 4V0NA 4PTLA 4NYJR 1VPLA 4L15A 5FOTA 5BN3A 4MGIR 2P5TB 2CEAA 3K9NA 5FOSA 1QHNA 1KD1D 1GL9B 5KDDA 1G7TA 1XZQA 4TZ6A 1E2NA 4RZ2A 4B76A 4KODA 1E2GA 2AK2A 1RJ9A 1KK3A 1S1MA 4BASA 1II0A 2RKOA 1H8HA 1ZUHA 3ZLJA 3A1TA 1GWNA 1G6OA 3BH0A 5KNCA 3O8DA 2QTLA 1I4DD 4MKIA 2ZYVX 5E7IA 2FN4A 2ZJOA 4TWZA 5CB6A 1G64A 5H59A 2ZSBA 2F1IA 2V6IA 1SGWA 4G1UC 3W6NA 1XPUA 4N0DA 1VG0B 2CCKA 1HURA 4D0GA 1G1MA 1IXSB 1DAGA 2VSXA 4FMDF 5FPSA 3T1OA 4TQUS 1OB2A 1EP3B 2AWNA 2WV9A 4QC2A 1MRSA 3LW8A 1EFUA 3LV8A 4X8MA 1G8GA 4B71A 5TXGA 2HUPA 5JRZA 1KHTA 4AKIA 1KO7A 1VKJA 1B0UA 5JFGA 2GAAA 4IVPA 3MCAA 1VQMB 2N1BA 1R4AA 4Z1MA 5J4YA 4JJZA 2R6GA 2GJ8A 1S3GA 2OAQ1 3K9HA 4BWYA 3B9PA 4HAVA 4OBEA 2P6NA 3I3SR 1T91A 4DLWA 2JGNA 5G41A 3U7GA 4AC9A 5THXA 1FL9A 5CM9C 3QG5A 3W5VA 1T3LA 1DELA 4PO8A 2IF2A 4CT4B 1SHZA 3EWSA 3P32A 1YZUA 3HPRA 5FBRB 1NBMA 2R6HA 3U6BA 4TL6A 4TT3A 5C4GB 3RWOA 2B5OA 3DMNA 1EFCA 3NC0C 1OGIA 1E63A 2V7QD 4YDSA 3M0EA 2J41A 3QXCA 2DCUA 2F43B 2QSYA 4DEXA 4ZIRA 4URXR 4DCSA 4UNQA 4PXAA 4TMVA 1M1KD 3ZS9A 2O8CA 4XJXA 2JIZD 3B6EA 2KWIA 3CNLA 4ESHA 1KNXA 2CJWA 4I99A 1AZSC 1PLLA 3BD9A 4I1SA 4AWXA 1UDWA 4JKIA 2IYYA 2H5EA 3BFVA 4GI7A 1NLYA 1G5PA 1UPTA 2G88A 2QENA 3IDQA 4WOPA 2IHBA 4BGDA 2J45A 1E62A 3CCMB 1WDTA 2CNWA 2FPKA 4BZPA 1D8TA 2JAQA 4JVMA 3N70A 1KKLA 3C4JA 4D4KA 2PZFA 4EFLA 2ZR9A 2RGCA 3DKVA 4N0EA 2GDJA 2CL0X 4DSOA 4TZ0A 2XNDD 1DDGA 4BLSA 1IXRC 4YMTA 4TLBA 3GJ3A 3IBYA 3SQXA 1C9KA 3VX3A 2ZXUA 5HTKA 2IS6A 1GVNB 2PCJA 1IXZA 5JMTA 1TU4A 3FKQA 2ATVA 1J9ZA 1UBFA 2WJGA 3NWJA 2XZLA 3DO6A 1GM5A 3CM0A 3H84A 1F5NA 3OF5A 2R2AA 2F43A 1MABB 4JBXA 4B2IA 3K0AA 1NBME 3QXHA 3KKQA 3CIOA 3RDPA 2A5JA 2GBLA 4NL4H 4P6VF 4F92B 2EYQA 1SM4A 1NN3A 3U4QB 4WIAA 5JS7A 1AZTA 1J8YF 4DLTA 2FMXA 3FMFA 3THYA 2QGNA 3N5CA 3CO5A 3L8YA 3TQFA 4PPFA 1W36C 2QBYB 1JEEA 1N6OA 5FPHA 3TR5A 1N6KA 2O8EB 1KI6B 3OEEA 2YYZA 2ZI7A 4TYQA 4URZR 2JLVA 4M8NE 1JECA 3QOFA 4LJ8A 2EU8A 1BJKA 4FD2A 4UQOA 2IUTA 3K0FA 3X1WA 2CLDX 5CK5A 1R5OA 4UJ3A 4RFSA 3CKLA 1E2DA 3AUXA 1DAEA 2WBLC 1J2JA 3E5HA 2IYZA 4MH0R 5L8VA 2DERA 2ORWA 1VQLB 1IONA 2PMDA 2R65A 4Q48A 2G0TA 3P20A 4AG5A 3S1AB 4HUQB 4IW3B 4Z54A 4LBVA 2ZI4A 3TJZA 2IYTA 2WAYA 1SVKA 2OM2A 3CB4A 2B7CA 2A9KA 1P2TA 2YINC 3IHWA 3MFYA 2Z6VA 4YHBA 1BO6A 3A8TA 4LJ7A 4PFSA 2HJVA 1GDDA 2YHSA 1ZD1A 4IXNA 1N6NA 4DLVA 3O8RA 2JLQA 4RD4A 3EC1A 1GILA 4G5RA 3L0PA 4IKEA 4UNRA 1VG9B 1VQ8B 3W2GA 5IRCD 3SYKA 3L0OA 3ZH9B 3BORA 3LBHA 2IYVA 3EC2A 2ZM5A 1FOEB 2LCFA 4FMCB 4F4CA 1EX6A 1YZKA 3T61A 3ZQJA 4OQFA 1QHSA 4OI4A 1JI0A 3CX6A 3DEFA 2AHOA 1XCGB 3KJEA 3PXGA 1KNQA 3WRYC 2WWXA 1N6IA 2QAGA 2FNAA 3GLHB 4QNMA 4C7OA 1U9IC 3W2HA 1YJ9B 1T6NA 3LFUA 2O8EA 1FNMA 2VLIA 5UKDA 2KJQA 3VKWA 3LBIA 3QIAA 3SC3A 2A2ZA 3K09C 2BEJA 3QSYA 3R7WA 4ZCLA 721PA 3JQRA 4HAYA 3BC1A 4TMWA 3X1YA 2QP4A 1XX6A 3GFTA 1XDBA 3KQNA 3K70D 4L8GA 4XVUA 1N5LA 2MMCA 2EIXA 1KI7A 1GITA 821PA 4HUQA 2QAJA 2N42A 5F9FA 4NU0A 1JAIA 3U3KA 2RB4A 2V1XA 2AKYA 3O47A 2Q9AA 3IPXA 1NSFA 4AYWA 1QFZA 2ZRDA 4G5SA 2AK3A 4X8OA 4CEJB 2PMKA 3GLIB 1XCPA 2LKCA 4C0QC 5CJ2A 1RYFA 1NN0A 5EE0A 1V5WA 2ZPTX 2J7KA 3KKNA 3AF0A 1Z0KA 4OL0A 2W2XA 1GZSA 3OZUA 1X6VA 3ZIAD 3I72A 1GR1A 1CR0A 3W2FA 2EFDB 3I8SA 4KYUA 4Q4AB 3WMGA 1ZD9A 4YMSA 5E4FA 1SHKA 421PA 1G7CA 4C0HA 2MMGA 4LHVA 4DSTA 1YZTA 4LHZA 1JXMA 1Q86D 2XOKD 3WHLA 1RRPA 4BLTA 3CH5A 2V7QA 1OKKD 1OF1A 4RZUA 2ZRIA 3SN6A 4JMPA 1GIAA 3R8CA 2OFXA 4FMDB 4QM6A 2ZRFA 3E70C 3HU3A 3EIQA 3DDCA 3IPYA 4JVSB 3GPLA 2F3TA 2JCSA 2JIZA 1P2SA 2D4HA 4JVLA 5L3SA 4F7WA 2XXAB 3T5GA 3O8CA 4TLDA 1Q1BA 2XNCA 1QVGB 2VNJA 1GAJA 2C99A 2C04A 3MUFA 4XTCS 2WM9B 3DOEA 1RRCA 1YIJB 5KSPA 1QX4A 4TL8A 4D0LB 3VX4A 2VF8A 3BH7A 2W58A 5C2JB 3KQUA 3H0KA 2VNIA 3CCJB 2FZ4A 4UKDA 5JRJA 4ZCIA 1GRRA 1X1RA 3ICQB 1P61B 1G3UA 4G5GA 1WRBA 4WVFA 3GLGA 1G20E 2QSZA 1US8B 3NBZC 1ZC3A 1ZM3A 1H8ED 1EFRD 2XNDA 3Q85A 1K9MD 1P62B 2FF7A 4DIDA 5HPYB 3B82A 1G16A 3FMIA 3OFND 2CVFA 4NBSA 1E98A 2A30A 4PGOA 3ZVMA 1ZM2A 2XGJA 4MKGA 4NONA 5FL7D 1T5LA 2CCGA 1R0XA 2QQEA 2HV8A 1D2EA 2GCPA 3QF4B 1UBEA 2FEOA 1M6NA 3CMEB 3GEEA 5KPDA 5F9HA 3DHWC 1KI4A 1P9NA 2KBEA 4XWOA 1YR9A 2C96A 3IGFA 1YZGA 1D2NA 4DUGD 4YLGA 2I1VB 1J8MF 2KBFA 3CPWB 2PL3A 4DLSA 1R8SA 1MO5A 1BYIA 2CK3D 2BCJQ 5LPNA 4CDGA 2ECKA 2Q6TA 3GLHE 1KI3A 5FOXA 4M4SA 1JQLB 1YZQA 2Q3HA 2GQFA 4RD2A 2I1QA 2WPDD 2ZUBA 5HE9A 3HDTA 3W6PA 2XXAA 4Q4HB 3CD6B 1LTQA 1X3SA 1YITB 1IAQA 1YE8A 2YJTD 1XTJA 2RGGA 3DVLA 4M1SA 1S3SA 4NP6A 3Q5DA 4OHVA 4QHTA 3VR4A 1KAOA 4P4SA 1NJFA 5CM8B 4URUR 4C0LA 4B43A 1L7VC 5FFMA 2Q3FA 5FA6A 4GRAA 1RVDA 2VHQA 2BWJA 5L3QA 3ZC3A 4Q4JB 1Z2AA 4OI2A 3ZS8A 4PPQA 3SJBA 3RC8A 4LPKA 2VHJA 3EIEA 3T5DA 3V9PA 1W35A 1US8A 2OILA 4HB2A 5AN9A 4HLUC 4DQLA 3C41J 4HAUA 1KIMA 1QF9A 2H1LA 2FA9A 4FCTA 4JLNA 5JHHB 4D80A 4TN1A 2CRVA 1OJLA 3QKRA 1Z6AA 1F2TA 1G8PA 4IXMA 2NO7A 4Q7MB 2KI5A 4B3GA 4MUBA 2IS2A 3GLGE 1VYTA 2PT5A 1NNEA 3QF4A 2QEXB 1UBCA 3I8XA 2FSGA 1E2QA 3VHXA 1QVAA 3UXMA 4NMMA 1YHQB 5B2ZA 1HQYE 3ADCA 2P3SA 1OB5A 5G3ZA 3W2EA 1COWD 2F7SA 2DB3A 3VKGA 1S9HA 4DSNA 3KKPA 4M9XA 3WRXC 1RIFA 3ASZA 4MYTA 4IOKA 4Q1BA 3ADBA 3ZBUA 1XB2A 5D3QA 1Z6TA 4IDNA 5FTLA 3ICEA 1Z2CA 1EWQA 1R2QA 3LD9A 4LJYA 3FOZA 4L9SA 2WKRA 1VHTA 4XTRA 4MDEA 2HYIC 4PO1A 1HV8A 2XZOA 1AS2A 2NTYC 3M6AA 3OESA 3DPUA 1W36D 4XWAA 3OW2B 3MWYW 2ZETA 4CYMA 4MGYR 1UDXA 3B1VA 4D25A 2ASEA 2ZJ2A 1F2UA 1IN6A 5EJEA 3AKDA 3MAAC 2RGXA 2Z4RA 4ZO4A 1A4RA 3T34A 5HZKA 4B33A 4MYUA 2WJIA 2GHIA 2ZJZA 3PIRA 1CU1A 3P1JA 3RLFA 3E1YE 4M0LA 3MRSA 1Q57A 4Q5IA 4F4IA 3SJCA 2OUKA 2J87A 3C7KA 2ANCA 1AGPA 3OZWA 1IN5A 1DE0A 4NCKA 2VHCA 5EMNA 221PA 2QPOA 4HZUA 1OLOA 2OK8A 5GV7A 2O8FB 1L4UA 1R5BA 2QDXA 2A5YB 4E22A 3U3OA 4A2QA 3GQBA 1SXJB 2WKQA 3AVQA 3H86A 1S4QA 1TF5A 5CJPA 1ZIOA 3UMSA 3NBFA 1NY5A 4QBIA 4LBZA 1U0HC 3B1YA 2CNDA 1KJWA 3ZIAA 2F6RA 5KNBA 2JJ2D 2I3BA 1E2PA 3IIJA 4NYIQ 5EE3A 2FSFA 1OW3B 5EQTA 3VNVA 5DHFA 2O52A 2XOKA 3BGWA 2P65A 1Q1ZA 5K8IA 5KO2A 2BBWA 1OKKA 4WXRA 4XOIA 1M90D 2FG5A 2GJ9A 4JVNA 1LS1A 4Q1DA 1F20A 1KSFX 4NCHA 2JLUA 1N5IA 5GJWC 3KFVA 5LB4A 2BF4A 4KYIB 3WBJA 1E3MA 5EXXA 3QKUA 4JBWA 4BFSA 1AQYA 4LYJA 3R9XA 1KI8A 4PPNA 1FDRA 3P26A 1GFIA 3EIHA 4P32A 5BW8A 4YAWA 2DYKA 3W6OA 3OIUA 1RRGA 2OSBA 3G71B 2BJWA 3CRMA 1NKSA 4B35A 1UMKA 5F3WB 2CE2X 2BCGY 1E4YA 1XTQA 3QQ5A 4HLCA 1ZUNB 1CJVC 4FK8A 5IDVA 4TLEA 1U8AA 1X1SA 1XD9A 4EPWA 1VIAA 1DOAA 2NO0A 3JQPA 1DARA 2KB0A 3KTAA 4JYBA 1Q1QA 3VR5A 5A5GA 4C2UA 1H8EA 1R6BX 1EFRA 4MRNA 4BUJA 4ARZA 3GEHA 3REFA 3OFNA 4EJSA 2XJ9A 2JASA 2GXQA 2GZHA 2QTVB 3KJGA 5FL7A 1U98A 2HDNB 1E0SA 4KFTA 2ZS9A 1ELOA 2GA8A 4E09A 2PJRA 1MO6A 1DO2A 1KI9A 1SVSA 2QRNA 2YOHA 3C5HA 3SDZA 2NGRA 3RS0A 4IHQA 4BECA 5FBWB 4F91B 4DSUA 3SR0A 4DUGA 1EFTA 2IYQA 4S35A 2CK3A 1GRNA 2YVUA 4OQXA 1E2HA 3TUJC 1XXHB 2WPDA 3EPHA 3N2EA 4BLPA 3CRVA 4KSCA 3D7MA 5BWMA 4RY2A 5TMPA 3IBGA 1AJEA 3GJ8A 2GILA 1CR2A 4IJMA 4GDFA 3LRPA 1E9RA 4J0QA 2V4ZA 3MWJA 3SOPA 2QPTA 2AN9A 4A2PA 2DWQA 1AN0A 4US0R 2AL7A 1ZW6A 3WNBA 2EWVA 1PUJA 3MD0A 4A8JB 4DZZA 2Q3MA 3SI7A 2BBTA 1WXQA 1FQJA 3H4MA 4IOMA 4V0KA 5DH9A 1CQXA 2WJYA 1Z63A 3ZJYA 2GVZC 4GOJA 4HAZA 4TL7A 2VZLA 4O0MA 5DSZA 4NCIA 4HUTA 1SXJE 1KGDA 2HF9A 1JPJA 3W5HA 1T3HA 1TQDA 3FE2A 4C43A 2ZRPA 3KKMA 1YI2B 2XAUA 1W47A 1RKBA 5FUXA 4YC7A 2MSEB 3F8TA 2RGEA 3CXCB 4P33A 3RANA 2NPIA 4P31A 2OTLB 1E2FA 2HF8A 4U5XA 1COWA 1NVXQ 4EDHA 2CHQA 4HAWA 1NVWQ 1RJ9B 4PC1A 4EPYA 2XEXA 4HDCA 5JJKA 2FFHA 1TPZA 4B75A 4AY2A 3QE0A 1HYQA 4PHGA 4BE7B 2VPPA 3NVAA 4DT1A 5AUOB 1N5KA 4ZGNB 5DI9A 5JJLA 3QKSA 1HTWA 1N6RA 4GNKA 3PUZA 4Q1CA 1Z3IX 3FB4A 2VQSA 4YXWA 3THXA 1FW6A 4B3CA 3FHCB 3AVOA 5FOVA 5HZHA 4BFVA 2RC6A 2BDTA 4IEEA 4OK5A 3QEJA 3CCQB 2AKAB 2ZREA 3ZVLA 3HJNA 5CIQA 1YZLA 3TMKA 3U2QA 1TLLA 4B47A 1PZNA 3AP2A 1M2OB 3GFOA 1E9DA 3LBNA 2BBOA 4E07A 2C77A 1EFHA 3NBXX 4M2LA 1KRHA 3R9IA 4DCUA 2VYFA 1GVHA 2FSIA 3OZXA 4YONB 3R20A 3R8FA 4NYMQ 1CF4A 2GK6A 1UKZA 1UJ2A 1S2MA 1CRQA 3KL4A 1TAGA 2R8RA 3KUCA 1ZNWA 1YHNA 3ZD6A 3WBKA 1KJZA 3RABA 3LW7A 4A4DA 1ZP6A 4KCGA 4JLJA 1FNDA 2ZE6A 5CDFA 2QGZA 2JJ2A 4DLRA 4AKHA 1ZAKA 2C5LA 2W00A 2BMWA 3CW2A 3I1FA 4FXPA 2WWFA 1AKYA 2FPLA 3TVDA 4ZIRB 1G19A 4D4JA 2UKDA 1HA3A 1XXHE 3VR2A 1RYHA 3ND9A 2PIAA 5IK2D 3TNFA 4URYR 1YJWB 2O8CB 5GV8A 2VBCA 1QG0A 5K8UA 2YKGA 4TYWA 2CJWB 4Q19A 1W7AA 2XB4A 1U9IA 1X8KA 3TW8B 4A1FA 5TV2A 2OEPA 4KFUA 5LBIA 1E4VA 3K09A 3I55B 2BSAA 1E2KA 4KI0A 1YKSA 1ZD8A 4KFSA 4HEJA 4DLYA 4CEIB 4QHYA 2OFOA 2QT0A 3SJZA 3NDPA 3OEHD 1GNPA 1XJQA 3QI2A 1L4YA 1U0JA 5AWFC 3VR3A 5DI3A 3L8ZA 1Z0DA 2P6UA 2FJUA 1T0JB 1OXXK 1Q44A 4KFRA 1E0AA 3W5IA 1KSJA 2MSCB 1JJ2B 4D81A 2WMNB 2RC5A 4PZLA 5CLLA 1GNQA 4IFBA 4US2R 2QTZA 1U8ZA 1M1YE 3PEUA 1VQ6B 2Z0MA 4NPHA 3LNCA 5A4JA 1HEIA 3EZ2A 4GMXA 4LY6A 3KJIA 1NDHA 1XNJA 4M1OA 2IBMA 3SYLA 2ZJBA 3VR6A 4AF6A 1DAKA 2DFLA 3K0AB 1NL3A 1QHXA 4KLZA 4RD1A 3GP8A 5CDFE 3RRYA 5CYOA 1GOTA 4FWTA 1W0KD 4XD7D 1W46A 5J4KA 2HMAA 1ZM9A 1RZ3A 3L0IB 4PANA 4P3YA 4RCZA 1NRJB 3THYB 2ODWA 3OIWA 2JLWA 4HATA 5EP4A 1W49A 3TLXA 2WSSD 3TKLA 5J4LA 3RC3A 4OI0A 3EZ6A 3EA0A 1Y63A 2KSQA 4HDOB 4KU4A 4O25A 3MG9A 3K0FB 1CNFA 2AXNA 4TTQA 3CC2B 4RFSB 2O5VA 4G3XA 2BOVA 2YWFA 1XWIA 3LO5A 4BFTA 2O0JA 2WWIA 3TSOA 3LLMA 5KYKA 3B13B 2A78A 4Q1EA 3OIYA 2B21A 1ZVQA 1FP7A 2GTPA 3L2OB 1JBKA 3LA6A 2FV8A 1Q21A 3KZ1E 3EASA 4Q9LA 5B57C 8OHMA 5TR9A 4KVAA 1Q82D 4JT4A 3CMAB 4JIMA 4ABYA 4ESVA 2DPXA 1TQ2A 2JA1A 2ZEJA 3KXIA 1FRQA 5D3MA 1SQ5A 2W2VA 3A1SA 1K73D 1E69A 2QUZA 3CWQA 1OH8A 2G6BA 4DIEA 4K46A 1CNEA 1KAGA 4AF7A 2Q0HA 4ON9A 2P0EA 1M74A 5SZHB 3A58B 3IIKA 1ESNA 2ATXA 1E2JA 1GRQA 2F1RA 3FTQA 2G1JA 3KDSE 4EPTA 1OFHA 1Q3TA 1XD2A 4LGMA 3IHLA 3NTUA 1TU3A 3HYTA 2ZUDA 5C4MA 2ZJAA 4DRZA 1IY2A 1WMSA 2QAGB 2A3RA 1XCMA 3BBPA 4ERNA 4NTZA 4C7OB 1PLJA 4FIDA 4EUNA 2OE2A 1F3OA 1P72A 1E2IA 5GJBA 2G77B 1YVDA 2H57A 2ZRLA 4FCVA 4KSBA 3R7WB 3RWMB 4BQSA 3A36A 3TE6A 1S96A 1FQKA 1JJ7A 3OAAD 5C1BA 2AX4A 4MKFA 1TNDA 1KO8A 3PUWA 4W5JA 3BAFA 4JKYA 3HU1A 1R0YA 1E1RD 2ZRMA 4AK9A 4D0NA 3UPUA 5AJVB 1P9RA 2DHRA 4P4UA 4QL3A 1D1NA 3Q7QA 3LX5A 1P7CA 2O0KA 2OZEA 1E9EA 2ZTSA 3A4NA 4GOXA 3TVTA 3AP3A 4C30A 3K9LA 4MKHA 4D26A 1O3YA 2VO1A 3MWLA 1QFJA 3FGNA 1BX0A 1S9DA 2BGIA 4R71A 1OSNA 4G5QA 2OCYC 2BMDA 3LLUA 3LQQA 1Z6YA 4HLUA 1IJFA 3CH4B 3RHFA 5JCZA 2AR7A 4NH0A 3LX8A 4IEIA 2O8BA 2ZANA 4M53A 4TLCA 2IS1A 4RSGA 2VP4A 4JYCA 4EIWA 4JZKA 1R5NA 4M9ZA 1T4GA 4QBGB 3EARA 2NO9A 3DZDA 1UF9A 2P5SA 3QBTA 3G4SB 2G83A 5GJVC 2QORA 4QGGA 4A82A 1W5TA 2QA5A 1VQOB 2FWRA 3ONWA 5JWRA 4GL2A 3RS2A 1V43A 4ZDWA 1NVVR 2IWHA 4GBMA 3SEAA 1XFAA 3T1VA 3QY0A 4DLZA 3FHOA 1WP9A 3CCUB 3UKDA 3G6EB 4KITB 1YJ5A 4PQRA 4LUCA 3SU8A 2DFNA 1K5DA 1ZNYA 3AVXA 3B78A 2CLSA 3FDIA 2BMEA 1CULC 3GCGA 3TR0A 3AF3A 1VG1A 1ANKA 1NY6A 2GXAA 1XU4A 2NZ8A 3LAWA 2HYDA 2DFKB 5IK2A 3TH5A 4Q4LA 4ZDKA 4M22A 4TYNA 2OCBA 4Q1AA 2ZITA 5L3SB 2ZROA 4E5UA 1GKYA 3GLFB 2WJHA 1G6HA 5FBLB 5KPJA 2WMOB 2PT7A 2Z83A 1DO0A 3T1TA 1KMHA 1HE1C 1UM8A 1FMLA 1QGYA 4WZBE 5EP2A 1ZMXA 4ZI2A 4Y9UA 4B3DA 2RGNC 4WZAE 1EESA 2NG1A 1FX0A 1X8JA 1TMKA 1YZNA 3OEHA 3U44A 1FZQA 3FMOB 4BPBA 1N5JA 1D2MA 4DCVA 2AFIE 5JS8A 3GLGB 5FL3A 5BN4A 3B1XA 1CLUA 4FWIB 3KXKA 3N2IA 4IOJA 4B73A 2O0HA 1T3SA
chains in the Genus database with same CATH superfamily
4F4FA 1QVWA 4RTNA 1T2UA 2HQBA 2J7PD 4KQ6A 1WKBA 3K4PA 1VYUA 2WF8A 3BFXA 5H9VA 1QRSA 2JARA 3DKRA 4OUKX 2R0QC 4F3CA 2GLXA 1TAHA 5C4IA 5MN6A 1CJKC 4DPKA 1IBCA 2ZAOA 5ITZA 1NB0A 3VR1A 1NPDA 1P4MA 3TEMA 3GAZA 3BCRA 5HIJA 2BTOA 4I1UA 1A71A 3HY4A 5IT9A 2CHFA 1L4LA 4GKVA 1JDTA 4N9QA 5EHGA 1TJ5A 2ZIFA 1EEXB 2FRDA 1JLLA 4OYYA 2BC9A 1AS3A 4YRRA 2LNDA 1WB5A 3HJFA 4U02A 1T8RA 2OAGA 4PQYA 4X3CA 4MUNA 1UD5A 1YDEA 4XIYA 3RTGA 1VPVA 1Q7TA 2XQGA 3R44A 1DX6A 3PNYA 4XLLA 3TPZA 3BQMB 3MS2A 1JG1A 4MLCA 4CKWA 2WSSA 3MWKA 2HSWA 4NYJQ 4B3SB 121PA 4GE0A 2XX3A 3VDXA 2NXWA 2X7JA 3DBRB 4EMBA 4W5OA 2X9VA 4N7MA 4XB6B 4YMIA 5L3QB 1YCGA 1RYBA 3B85A 1TKAA 1M0WA 1ONNA 3AF1A 3EODA 1AIPA 2JKVA 1F8FA 4H15A 4LJ5A 4IYRA 5CVCA 2E4VA 2PRZA 3F96A 5T5QA 3ZE7A 2FKAA 4EMUA 2VDWA 4R2WA 3GVCA 4Y1RB 4KDCA 5EJMA 2RCNA 3OLCX 2W48A 4AKEA 4RJLA 2NAFA 3GJ4A 3MRTA 2VAWA 4CLRB 3OOYA 4CMIA 5K3FB 3OI7A 1EG7A 4TTAA 2VYVD 1FP6A 4XYLA 1G4AE 5J63A 3T5TA 1Z15A 3R5FA 1CFZA 4HDNA 4JB8A 5DIFA 3ZDFA 1NJGA 1YFKA 3P45A 1C7ZA 4JL5A 1T24A 4NCXA 2BM1A 3BY1A 4IQ8A 3QVSA 4OXQA 4ENPA 1YUMA 1PNRA 3VHXB 4F2PA 3SBDA 2XW6A 1DRUA 3DDNA 3QU7A 2B9EA 5C8YB 3G79A 3QFRA 3T5MA 3HTXA 5CTJA 1HEUA 3ASQA 1KK0A 2BEVB 1EJ0A 2VSOA 3C15C 2VPIA 3NHWA 4GPEA 4C05A 1Z0SA 3L4SO 4CODB 3O4GA 4HWTA 1Z0JA 2UUOA 4JMLA 4OQPA 4P3XA 3D3NA 4M38A 1C29B 5E3HA 4GECA 1CV2A 1RP1A 3PG5A 4F4HA 3JWGA 1PGOA 3MA0A 5F5LA 4RZHA 5LWQA 3IDFA 1PJ6A 4R7ZA 4Y8VA 5I4IA 3QMVA 5I7OA 1IVNA 1MO4A 4HOYA 4KBGA 2CYCA 4RDHA 2BTQA 2GYYA 1YHYA 2CLFB 4OBXA 3BE4A 3MTJA 5DISB 3UJPA 3Q3AA 1OH7A 2AFHA 4AVZA 1PQUA 2EDCA 3MMNA 4QTUB 4DZRA 4OLHA 2WZPP 3OO0A 4PHCA 3RU7A 3S2YA 1MQSA 1WDMA 4CCAA 4RK7A 4C0WA 3AF2A 3MEQA 3JZDA 3UK6A 3CLTC 3IVMA 3HXQA 3GLFE 3X1MA 1C0IA 3FCOA 2GPSA 3FROA 4AU1A 4FHCA 1JDBB 4OM7A 2O1EA 3I04A 2X86A 4KWEA 2VQ3A 4LDQA 1FA9A 1O95A 1TADA 2LCIA 3FAZA 5EWLB 2O2YA 2I87A 1WBBA 1IUNA 2GCNA 3AVPA 4EG3A 4O1MA 5TQ0B 4XQ0A 4NZPA 1HTTA 4XR4A 1MVLA 2JD1A 1VQNB 1VKRA 4LXQA 4ASUD 2BBSA 4LJKA 1NXOA 4KEAA 4O2RA 1GU7A 3FY4A 3PNLA 3ZDXB 2QHXA 1QYWA 1EK0A 2H48A 2OQIA 3HWX1 1ORIA 4PF1A 2O2CA 3F2VA 4G23A 4J3NA 5F2OA 3Q3GE 1P80A 2GARA 2P9JA 3ADDA 1JU9A 4EPVA 1X1CA 5B3AA 1Z5OA 4XCXA 4A6DA 1JXOA 1C3XA 3LC1O 3EXAA 4WCDA 4O33A 4AXXA 4EUSA 4KMMA 2FB9A 1VJDA 2HDOA 3KJNA 2W2OA 2OCPA 2ZRJA 2DUUA 3IC5A 4A92A 4DUPA 1PG2A 2IU6A 3FGZA 3GQBB 3M3DA 2A9OA 4TYMA 1A9YA 5KOYA 1HYHA 3HR7A 3Q12A 3QVWA 2R5FA 4V0OA 2W71A 2YH2A 2C20A 5C7LO 3FSGA 3KKLA 4MYDA 2BN4A 3AJAA 2D2XA 4PR3A 3STHA 3WYFA 4PPGA 3DS8A 3OJEA 3M6LA 2ZSFA 3PUJA 2A4MA 4HNAB 4TS1A 4G1VA 2R751 5IMBA 4HNSA 5CFLA 1E2BA 1S2DA 1W8DA 1QH0A 1HYGA 1YB1A 2ZVDA 3E3MA 1ZRHA 4I3FA 4JB3A 2VSFA 5HTOA 4UBIA 1L9KA 1Z0IA 1RJWA 2UVQA 2HHLA 3CZRA 3M33A 4K2AA 4NFSA 2K6GA 3M83A 4BQOA 1JJVA 3HADA 2NXNA 1QUEA 4HXFB 4TUYA 2X53S 1XCJA 2F1HA 5A03A 2E18A 3A1UA 5LVAA 3KALA 3C7CB 5KC9A 3K0SA 2SNIE 4KXUA 4UAJA 3BWEA 5FLKA 2QU8A 5IT5A 2J9RA 2I6SA 4AJIA 3KT3A 2FR8A 3EULA 3UH1A 4CCYA 1LB1B 3FDZB 1YA6A 4OPVA 5HRAA 4DV6B 3G68A 1SXPA 4R83A 3W1VA 1SKAA 2P3QA 3ZW7A 4BGIA 5LLDA 4RV4A 3VPXA 2XUQA 1G38A 4HRAA 1I2DA 3W5CA 1HXHA 4ALIA 3FYTA 1Y81A 2I6XA 2OCAA 3JTMA 2W6JD 3QWIA 3KC2A 4FNMA 4NZZA 4XRRA 4Y2PA 4QJ3A 5JTUA 2ZL7A 3OZVA 2C9MA 2E9SA 2IEDA 3DC2A 3AX6A 3EIFA 3M82A 4H1VA 4K9RA 2IPNA 4XQ9A 4J90A 5AVKA 3AKZA 2CVZA 2A9FA 1JDNA 4KQIA 4XCQA 5GONB 2QQ5A 1EXNA 1BX1A 1JN0A 2J3HA 2OHHA 2UYOA 3M1YA 3SE7A 3WQHA 4HLNA 1KZHA 1MAAA 3CZQA 3H2HA 4YJ3F 5LQCA 1Y4SA 1O9HA 4ALMA 1KVRA 2R3SA 3HU2A 3TOCA 1WCIB 5JSUA 2C5AA 3TIFA 1ZW1A 3ZY6A 5BORA 3UTCA 1S1CA 4JR2A 2NV4A 3HPQA 4EJSB 4Y6RA 3E9QA 4PNPA 4NNPA 2XMBA 2PTGA 2RKBA 4UAUA 3ILSA 2HUNA 4YJ2B 2Z2YA 1PWXA 1DADA 4BMVA 4XB2A 4EY4A 3OCXA 1CQJB 4LZZA 3D64A 4PLYA 4A15A 2P6PA 1U1CA 1Q20A 1XP5A 3WTBA 2VYQA 3GLTA 1KO1A 1MXHA 1EVYA 1NF9A 3PFCA 1X9GA 4UUMA 3NHMA 3UATA 3HXLA 5FOQA 2JEZA 1W29A 3O74A 5BWLA 1XZFA 4YA6A 1U3CA 1XF9A 3FZYA 4RK4A 2ZYWX 3D2LA 1HH4A 4Z8XA 4DBLC 4P3OA 4PCAA 1EGAA 4BX0A 2F9LA 1VA4A 1Y7LA 3GRFA 1QOQB 5B1IA 1Q9SA 1FDVA 5A9TA 2ATEA 4JXJA 5B6JA 2Q9UA 3M6VA 2D7DA 4B45A 2DEUA 3ZBTA 1DUVG 5HM6A 2B2NA 4KIGA 3LS2A 4PYLA 5FOUA 2XVAA 3CT6A 3NEYA 1V95A 1FDWA 3Q0TA 4OM8A 3WK4A 2BSQA 2X19A 5F1KA 2BHTA 3E84A 1I6KA 4I9GA 4YJGA 1W1WA 2ILVA 1LSSA 1R4ZA 1IZ0A 3U3RA 5EXTA 4MPDA 2D5LA 3Q3IA 5FT9A 1SBIA 3ROZA 4CU5A 4EYSA 1P4JA 3DT6A 5H1YA 3E9EA 4B8YA 2FZKA 1C0LA 4PG4A 1A3CA 2I1WA 1GCIA 2UYCA 3AL2A 3P52A 1RVV1 1P9LA 2I4OA 4DVJA 2AE1A 1QIKA 1E6LA 2O0LA 2WD7A 4BWFB 5BVGA 3PEYA 4IUCS 2PSJA 4G67A 1VL5A 1E94E 2Z8ZA 2FW7A 2G5CA 2P0YA 3LC0A 3VU9A 3W3ZB 4DEYA 3CX3A 3BCUA 3Q6NA 3EOBI 5CEEA 4KLNA 2FLVA 1VMDA 4C4TA 4I1PA 4Q9KA 3ZD7A 1P75A 3C3MA 4G4JA 4KIFA 5ALIA 1R6AA 5LP6F 1CUEA 1JFLA 2EFHB 3GMDA 2BHLA 5DYGA 3A8JA 3D6TB 4XCVA 1X1TA 4OOVA 1EX7A 1A2KC 3UHAA 3JQ9A 2CNOA 4WBXC 1BFUA 2QPAA 2C2GA 3FUVA 5IC4A 5TQ2B 2RH8A 1RXWA 3NOOA 2J4DA 5GPBA 1QRUA 1ZCZA 3LT5A 2XQJA 5HYVA 4HNGA 3RRNA 2RHBA 2R79A 4AG3A 4BBJA 1WAMA 3GJSA 2QNRA 2NZJA 2FOLA 1FSZA 3INNA 1TKRA 4PRYA 4E2ZA 1NLUA 1ECGA 3ZU4A 3BCFA 4K1XA 1UPBA 2OFWA 4N8DA 3MCVA 3BXZA 4JI5B 3TAHA 4RTPA 3ESQA 3JPWA 3OPYB 1LD3A 3DHYA 4D3DA 4QYIA 1E3TA 1NBOA 4LRYA 5KSWB 4DMUB 4EA9A 1S8OA 3PC3A 4Y67A 5CDYA 1BRMA 2I7DA 1E7SA 1E2EA 4QQKA 2P27A 4F8EA 3I8OA 4Y18A 3TSWA 1POWA 3O4JA 3P8ZA 2G9ZA 4BN5A 1L5YA 2I7VA 3QPAA 4S0XA 4XFDA 5JI3E 1O8BA 4EPXA 2OBBA 4PAMA 4DJEC 4BMOB 3JAKA 4EA7A 1E7QA 3T7IA 1EZ4A 3RSOA 3SFVA 1HDCA 2VJBA 2XBUA 2IF0A 3GD7A 4IV0A 5E9QA 3ZG6A 4WZ6A 1DJPA 1OLUB 2IUEA 1A1VA 4MJLA 4N39A 4EYEA 5KREA 3LZCA 4RM3A 1IZ7A 1BGXT 4IV8A 5AK0A 1JMVA 1YQTA 1U1FA 3BIXA 4RH3A 5J5AA 5AW3A 3NHJA 3H7AA 2Y1EA 4G25A 2IL1A 5ALZA 2FQXA 2ID4A 1CT9A 3NGLA 3OPOA 3TN7A 5KZMB 4E15A 4R41A 2QMEA 4Y6GB 5E1BA 1P1BA 1SG6A 1UXOA 2GJKA 4II3A 3HCRA 4MV1A 4J2HA 3KSZO 5AK6A 3MPUA 4LVCA 1IWPB 3G8DA 4YAJA 4ZQCB 5DP1A 3U3JA 4PAWA 1FYVA 1XEFA 4M8SA 4DDHA 1QZ3A 1X86B 4ZFNA 3RYIA 2QW1A 3ZW9A 7MHTA 2H2GA 2OKCA 3QXSA 1HZJA 3ZOKA 3D3WA 3W8FA 3I04M 1U7DA 1F51E 4HI0E 4WDRA 1QP4A 4CCWA 2C94A 1AK2A 2WK1A 2OFFA 3SQMA 1EDBA 3PWKA 2PO7A 3F0TA 4MV6A 2I4IA 2DP4E 1ST3A 1TD1A 2BFNA 3L7OA 3GVJA 1N1GA 2CHGA 4B48A 1J8FA 1KR5A 3O8QB 4HVAA 5DVZA 3T9AA 3NIGB 1YQ9A 3AUJB 2WMYA 1ZBDA 3BB4A 5EP1A 5TPZD 5M04A 1GPDG 4W9NC 4JI4B 2PO5A 3K0CC 1JB1A 2ZW9A 3ITEA 2OD2A 4WW0A 5JU6A 3VTAA 5A4DA 5KW9A 2VHEA 2XTJA 4URWR 5IVHA 2EJBA 4CIDA 5KYTA 1T36A 3AZPA 3G9QA 3HBFA 3PE4A 4HJXA 4OHZA 3PUXA 1A7AA 1HBJA 4ZYTA 5AM2A 2NM0A 5U1PA 1OFUX 2G0NA 2XCIA 4D0RA 1SCUB 1P2DA 3WBFA 4H7EA 4V0ME 3VMMA 4DXHA 3EB9A 4FDTA 4NABA 2ZRNA 4ZDIA 3AF4A 4QPNA 5KWJA 3OTWA 1XZLA 1CDDA 1N1EA 1TQ4A 4PLGA 4WQMA 4H4CA 3FFTA 4FNGA 2HJGA 3NG1A 2WNSA 3HG7A 1CJUC 4IG4A 5DCYA 4ESEA 5I3CA 4JCOA 1TCCA 3QTBA 1IOZA 3T3HA 4OIMA 1A5BB 3D31A 1P3DA 4Y98A 3VYRB 1PCXA 4KH0A 1OAKA 2OAP1 3IBCA 2JJ8A 3PCTA 3RVQA 3VUEA 2IOHA 4C4ZA 3KETA 2AYXA 1QG4A 3EMDA 4J0CA 3DFFA 2ZT5A 3ZHQA 1M3SA 3R9WA 1VLOA 1UZLA 1SKUA 3AHCA 1GG2A 2GNPA 4M6WB 1L4HA 1D9XA 2D1RA 4OJKA 5DW0A 4DK0A 4N7JA 4UTOA 3C14C 3NC4A 2AG1A 2RIRA 3DTNA 3N07A 5L9AA 2Y68A 4OO3A 1Q15A 2IYAA 4Q82A 4Z9XA 1KH2A 4FXOA 5A6VA 3JQGB 4WKBA 3NBUA 4IJ6A 1CIPA 4PSVA 4WOBA 2C4MA 2NU9A 1ZH0A 3DUFA 1U7HA 3SSAA 5JCPA 1CZRA 2R1UA 3ZQ6A 1CS0A 2P3MA 3OZCA 3WL7A 1Z6ZA 1SVOA 3PJGA 3BGSA 3DFKA 1QIDA 4TMKA 3UMJA 1YR2A 3WL4A 1P9OA 1D2GA 1C1XA 4QUJA 1ODFA 4C5AA 3ITKA 4B32A 1RFGE 3T3OA 1NXWA 4YUAA 4JC5A 5L3ZA 4QTYA 4B9EA 1BEZA 2FFQA 3T4EA 1XZAA 2YXLA 1M2KA 3DEIA 4P80A 4XI9A 1SXJC 3RUAA 3SQNA 3TG2A 4GKKB 3PZBA 3LY8A 1N36B 3N8KA 1U94A 3L8MA 4MO9A 4J0GA 1KY2A 2IRWA 4ZCMA 4KLCA 3I12A 1KO5A 1E9VA 4UXJA 4EJSC 1JFRA 1HY3A 2VRCD 2V7EA 2NYAA 4GW3A 1JJIA 3T9CA 2POQX 2QJWA 3KLPX 4JBYA 4QRHA 5AOVA 4ZMSA 1XEXB 4XR6A 2VDPB 4KQXA 4J2TA 3EZGA 3HXKA 3ZXYA 4QGBA 4HE5A 5T4HA 4ZGQB 1DQSA 1XD2B 4XRGA 4KG7A 2I6UA 4QXOA 2ZIXA 3SXJA 4F3RA 1ADJA 3H9BA 3BS4A 4ZI5A 5KOHA 1JH9A 4B40A 4J0EA 4H27A 2W6IA 1WSBA 2Y3IA 4H3HB 4RC9A 5AJYA 4BTLA 2XYPA 4PYRA 5MN4A 3V4RA 4RD0A 3LC7O 3ON5A 4BNMA 4PHFA 1G21B 4F1KA 2PEZA 1OHHD 2A0WA 3FNQA 1LBSA 5KVAA 3QU4A 1CJTC 4Y7CA 1JS1X 3KOXA 4YROA 4WZAB 1ZZEA 4P8RA 4U2EA 1RQRA 1RM0A 1Z56C 2Q3LA 4NVRA 4POOA 3A0RB 5JASA 1U1DA 3UWOA 2IYPA 5KTYA 5DOZA 2P40A 3JTEA 1RQGA 4TSRA 4V39A 1QMPA 1AMUA 4WMLA 4HXEB 3OSUA 3JATB 4O59O 5FH9A 1XTIA 2BE9A 3NWBA 4O6VA 5M3BA 1YCDA 1CP2A 4FU0A 1G18A 2Q8PA 1UFKA 2VXBA 3O82A 3VBCA 4FS8A 5FIUA 4C01A 4IIYA 1HG0A 1IEVA 2Q41A 4GKJB 1KK2A 2ZDHA 3L1KA 3RNOA 1WPQA 2ZRCA 1UC8A 4MUAA 2BFBB 1T6YA 4DMGA 2QTHA 1ZD4A 4XPIA 4OQZA 1M8PA 3G7SA 3ZXUB 1FYFA 1QTRA 3EGIA 4DV1B 3QVUA 3H11A 2GKSA 4OVKA 3ZHZA 3TQIA 1M2VB 5HS6A 3PWTA 3UAYA 4F93B 4GZ6A 3FFXA 1LH0A 3CN9A 2IODA 2O06A 4QECA 4WACA 4RIEA 3QELB 3GYBA 3NUZA 5J3OA 1RXSA 1DRKA 1U3FA 3GNLA 2GREA 1C4XA 3CCSB 3TI7A 4TL9A 1QHGA 3NYQA 1QZXA 2ZU6A 3A7EA 2BGTA 3AIIA 3L0SA 1AU9A 3LP5A 3K1JA 5A3SA 4YMLA 4OYHA 3C3AA 2JL1A 4II2A 2V7BA 3S28A 1FJXA 3VPDA 2YC2C 3H2KA 3TLEA 3UJCA 3W9YA 3MS7A 1E1QA 2BY4A 1X9HA 5KKNB 1GPH1 1YVEI 3WLAA 3HZRA 1GQRA 1XNGA 4RTMA 2Q2NA 3KOOA 3O4IA 3WWEA 4BV2A 1TTTA 1E3SA 3KHKA 5J1SB 4NZYA 3V8QA 2B9VA 4IDAA 4ZK2A 2Q6OA 4C0AC 3ZGZA 2M1ZA 3DV0A 3F6EX 2GZSA 2NNLD 3L49A 4MRPA 5IJ0A 2ZCVA 2HWXA 3SJUA 4U7DA 2J3KA 2ZVQX 4ZVVA 3BULA 3I6ZA 5KAPA 4KKXB 3A1PA 4M3NA 4C76A 3ROEA 1EM6A 3F3YA 4IFIA 4JUIA 1JKFA 1Z47A 2OYSA 4N0QA 4N1AA 4BRZA 4NFLA 2IU4A 2AXPA 4EUKA 1AC5A 2X6YA 1NI4B 1QVRA 5K8TA 5CNMA 1MKYA 1CK4A 1Q0QA 1WHSA 3I6BA 5DNEA 4X95A 3SXUA 4F5EA 3A2MA 1U0TA 3LUHA 1IQPA 5A7GA 3MK31 3C45A 3B8EA 4XGQA 1ZDMA 3D3EA 3HCNA 3N28A 2IUUA 2K87A 3WYEA 4ZMRA 4G01B 5A9RA 5C1DA 4Z9BA 3DHNA 3TM4A 4D56A 5AKEA 1VP9A 2ZBQA 4O4JB 2JDID 5CDGA 4IRUB 1QE5A 1TAQA 3A4VA 4PX5A 6Q21A 3FPJA 4LOAA 1G3IA 3GNQA 4UCXA 1NG1A 3RVSA 2VDVE 4I4LA 2Z04A 1G291 1OD6A 5CYFA 2WOJA 1K6MA 4GAEA 4OL9A 3LL7A 1F4LA 3ACBA 2VEDA 4S1NA 3ZBPA 4ZKDA 5BN5A 2Q5LA 4B79A 1P4SA 2B69A 2XZPA 1EQAA 4UBOA 4JI0B 3DEZA 5LNK6 1SB8A 4P54A 3NGXA 1B2RA 4B44A 3QBDA 3P2EA 2Q6IA 1RLIA 5CDTA 1FFHA 1QRAA 1L7MA 5G40A 1DAPA 4M99A 4XWYA 3TZ6A 3P9XA 4DSAA 3U4QA 1VI2A 2A0FA 1RI5A 4AFNA 3H8VA 4UDOA 4X0EA 1G21E 5AW9A 1HG1A 5KQLA 2XTNA 3A8KA 2BGGA 5LA6B 2GI4A 2MINA 2LWIA 2O1XA 1WCV1 3E53A 3HBAA 2ZZQA 3QJGA 4UTZA 2YIMA 1XGKA 2CLKB 3K6RA 4RNCA 1V1JA 2WUEA 3CN7A 4EFDA 1B15A 4DHEA 1BE0A 1ISSA 3NT2A 1R0ZA 4KOAA 1VHDA 5HCUA 5BYJA 3L8FA 5DNCA 2JGDB 5IABA 4PU0A 1QU3A 3B70A 3A4MA 1MNAA 4JR1A 9ABPA 1D4AA 1W581 4URVR 2A6PA 4IJUA 4HTFA 5BUQA 1AGXA 4TTVA 1A9SA 2Q5HA 1N8RD 1U0BB 4LYYA 2FXIA 4GLLA 2CJFA 4J1NA 3ZWYA 3CCLB 2C2BA 3DE2X 2P90A 3KLBA 3P0HA 4LRQA 1KSGA 3UW3A 3S2FA 5I5EA 3U5ZB 1IBKB 3PQ6A 5CA0A 4CL2A 2O3UA 4RDIA 1E3QA 1EFPB 2LDXA 4JC0A 3SJ7A 2FGJA 3KU1A 5IVDA 1DPGA 1PGQA 5BT8A 1SOMA 3SE0A 3LPDA 5AM0A 4ER3A 5DLPA 4PN3A 3P2OA 2FUKA 1Q7BA 3LP6A 1EHIA 2KVOA 5EZ5A 2J08A 4DJTA 2GN9A 1UJMA 2VWQA 4QE3A 5AXAA 4BNXA 1NUSA 1G2OA 2L69A 3C8HA 1Y6RA 4AQDA 1E66A 3L9WA 1GZDA 2NQTA 2XT0A 1ECBA 5DLYA 3PXCX 1GUBA 1PP4A 2EQAA 2QE7A 2OBLA 2QRHA 2WSBA 3AM1A 1R10A 2WVAA 2HSEA 3H2BA 1BYUA 2ZR8A 1BNCA 2B4TO 4EQ6B 4X41A 3LUKA 2NQ2C 1F0KA 3NJRA 1EKXA 4DDTA 3IT3A 4UTNA 1ARZA 4AMVA 3GLHA 1A1SA 3ZUGA 1XL1A 1IZZA 1YU9A 3CXRA 3GCXA 1YDHA 3QA9A 1N08A 1AQUA 1ESMA 3QENA 4BQPA 2XI4A 2G25A 4E1VA 4CM8B 4KQHA 4UBMA 3GT3A 3JQEA 3BOSA 5JDIC 2HLDD 2RAPA 5FNZA 2PH3A 3AZQA 2WFZA 4FYKA 2Q5IA 4ZPXA 3K05A 3NMUF 1DJMA 3K8YA 5FNVA 4KO1S 1VQ5B 1NSYA 2GZAA 3W9BA 4BFXA 3EVEA 3ROFA 3DKPA 3QQPA 4DPMA 2FX3A 1G41A 4IKOA 1M6WA 3JZMA 1IRXA 4JUAA 1PG0A 4X1KB 5JAHA 1JHDA 1YIAA 4Q02A 4TMTA 5F33A 3WC4A 1BMFD 1GGVA 4C78A 2Z8YA 1RWVA 3CONA 3PITA 1G0NA 4PLVA 1P5ZB 3KB8A 3BPSA 4JV5B 1OC4A 4CLXA 1C8LA 2C03A 2OO5C 2IWRA 3UAGA 1H22A 1YTLA 2NSLA 3IHKA 3E9CA 3LKBA 4H16A 4L5BA 1AB6A 4UD2A 4AMGA 1Z07A 1Q81D 1KBZA 5H9WA 1O4VA 2P78A 3ZK8A 2PUFA 4CEJA 1SKYB 4I7EA 2A0UA 5DBOA 3BWCA 2WFAA 1FFBA 1C7JA 5LQUA 5K0GA 3AJ8A 1EUCA 2GH1A 3FYSA 1VQ4B 4BE9A 3C7DB 5MN5A 2SKCA 5CW1A 3S7ZA 3LNNA 3A9TA 1WQ1R 4BX9A 5LMCA 1ZCFA 3KHSA 3I5YA 5F1PA 2DCMA 1GYPA 2YMQA 1T35A 2CNNA 1K75A 3CF4G 1ZBQA 4A8TA 5H16A 5KVVA 2H2IA 4MS3B 3O9ZA 4J1SA 4IIDA 3IUBA 4M37A 1F8XA 4IFTA 3QE2A 4YRFA 4MRMB 4Y2XA 3WLKX 3ZOZA 1QHIA 3FPBA 3CCRB 1VHQA 5DLQC 4IVNA 2DTEA 2W83A 3OF2A 4PRZA 2G6TA 1R4NA 3EC7A 4GEGA 1R5JA 1RXYA 3D6JA 3DFZA 4GRIA 4EUFA 4AMUA 3EPLA 3Q9UA 1ENYA 1NJ8A 1DRWA 1C3EA 2QMOA 2PZBA 4L0CA 4DWOA 5EMLA 4B4KA 3KYCA 5L7WA 1T5OA 2HV9A 2YXDA 3OETA 4CCSA 1XQBA 2BFOA 1YH3A 2L2QA 3BJRA 2JLSA 1UOPA 2RK6A 5K0JA 5IAAA 3FCEA 4H18A 2Q8QA 5ED4A 4N3GA 2XKBA 3K71B 1GNRA 521PA 1QG2A 3G0IA 2YWEA 1FTSA 4G5OA 3ZV6A 3KJHA 3KKZA 4EGAA 3DZCA 2HGSA 2J9ZB 2NO1A 1MO2A 2ZJ8A 2PNFA 3ZV7A 4AJ4A 3CLVA 4C4PA 1YR8A 3ZJYA 3PDJA 4A6EA 3OCVA 3TGLA 3LQ4A 1XI2A 3PYMA 1Z2EA 3NEJA 3NTQA 4XUEA 3MWEA 3R0JA 1UD8A 2VJPA 5EJ4A 3U4MA 1YQXA 1NHGA 3OQ1A 3PNOA 3D7RA 4JXXA 1AUXA 4KDRA 3ZZUA 4JOSA 4DN6A 2GM4A 3ZHCA 1PZFA 4EY6A 3DM5A 4DCTA 2B6NA 2HI0A 1RCUA 1B6TA 3JQ8B 3LX6A 3U4DA 1L4MA 1A97A 4I1OA 5B64A 1VL8A 2BHRA 1EVEA 3E58A 1QV7A 4MW7A 4V0SA 2X3YA 2Q9BA 2EX1A 1SUCA 2C2OA 1UJCA 1S0UA 3UCEA 4RGQA 1O97D 4DNOA 4JLAA 4N76A 1YC2A 1SRRA 1ATIA 1PR2A 1J5PA 4BB0A 1DC5A 4LJLA 4BVBA 2AMVA 3OC6A 4CVNA 4LI0A 2R11A 4Y9TA 1J70A 4ZDJA 2BFEA 2LDBA 4RY9A 2F3SA 4R7TA 3G1TA 3WY9A 2GPTA 3IBTA 4RFVA 4U2DA 2EFGA 4F71A 1GT91 3EF0A 4W6QA 4I9FA 3QUBA 1S8NA 4BU0A 2B8EA 3G02A 1KK1A 3IPAA 4JB0A 3KB1A 2Y1KA 3MINB 3O8LA 4H6WA 4U7TB 5CH8A 4YJKA 1UMCB 1PD1A 4ZAFA 2G9UA 3PNQA 4BLQA 1U28C 2ODNA 3FWZA 1DJNA 5CG1A 1QAMA 2H1HA 4ZO8A 4BQEA 2FFAA 4YT5A 1SRQA 1FS6A 2QXUA 3PK0A 3HUFA 4HN4B 5D1NA 5DYTA 2XZTA 3NVMB 4BOYA 3OE7A 1DQNA 4S1TA 3RFVA 1Q7CA 2XHZA 2ZTNA 2MIIA 3AUYA 1HZZC 3E18A 2JBHA 1KMQA 4GX5A 4M36A 5HKKA 3JV7A 4DANA 1R12A 4FFSA 4L8YA 4YWJA 4F5YA 3A31A 4U7FA 1H4TA 2FSPA 3K9GA 3BJMA 1KZ9A 1DWUA 1GL6A 2PFSA 3QX3A 4W9NA 3J7TA 3IVXA 4W7SA 3K0CA 4BVEA 3GR6A 4MV8A 4R5MA 1N8TA 4HBGA 2WFLB 1VLVA 2GPBA 2V54A 2WSIA 1ULHA 3CPEA 4FDVA 2NIPA 4K6HA 5EINA 3WK9A 4PC2A 4L16A 5ALXA 3O91A 3QEOA 1YRLA 5FUYA 3H8JA 2VTEA 4A9AA 2EGUA 1SKYE 3FZEA 4QDTA 2WILA 3TCKA 2JC3A 1LX7A 1N2CB 3UKJA 3RVRA 2XVZA 3DQQA 2X8LA 3ANXA 3E8MA 3M9LA 3QXXA 1EVIA 4Q01A 3AFHA 1ZIPA 1OIVA 2BFDB 5DM0A 4D46A 5FI0B 3X2EA 4N40A 1D4OA 3LSYA 2HF7A 4BDTA 4PHHA 1Z4KA 5DM2A 4LKRA 3R5XA 4V2IA 3LTEA 2ADFA 4RVCA 3SZRA 2R87A 3IP9A 1JR3A 3LPMA 2OKGA 2DAPA 4Q7QA 1KR2A 4OP1A 3RVDA 3BD6A 4II7A 4Q1FA 3A04A 1NIJA 1VL2A 4BJHB 1LLCA 3NKVA 2ZI5A 2Q6KA 2I3ZA 5EQJB 5GIOE 1GT6A 2VK8A 3NVKI 4HH3C 4N5HX 4BDSA 1TUBA 5LZ8A 1KDZA 3P9SA 2ORYA 4PY2A 4EHLA 5JTTA 4EHKA 1UR5A 1BX3A 4KTVE 3G0OA 1T5BA 3JSXA 4F1JA 1TT7A 2HDHA 4R2IA 1N2ZA 3OT5A 1ZFNA 4ZAWA 4XAQA 2ZBUA 2NNWB 4EG6A 3H0EA 3MTAA 4AY3A 1XE1A 3VSCA 2XJ4A 2EWMA 2ZIAA 4L51A 1VYHA 2QG6A 4Z1MD 4G86A 2P2YA 5L4SA 1GSAA 1G17A 4RKWA 4ZEWA 4EAAA 1K3TA 3TF5A 4AQYB 3IOBA 1QR2A 2AXEA 4ZOLF 1XN1A 4W5HA 1RM3A 1J8QA 4BJ6A 3SNHA 4UE2A 4X5OA 3NASA 3OJXA 3HKDB 4CF6A 4ILEA 2IYEA 4DJDC 4QBTA 1FNCA 3N8GA 1L6IA 2Z4SA 4C1NA 1M8JA 3C3CA 2WF7A 4J3JA 4QUKA 4Y30A 3SEZA 2RHLA 1SXJA 1C8VB 1LBQA 2BFFB 4XM1A 3WL6A 5HMMA 1EJBA 1G3MA 2IDJA 4MWZA 3RVMA 3TQCA 2G3YA 2PQMA 1WWKA 4A91A 1UFQA 1QKIA 5BRJA 5C8XA 1Q6ZA 4CIYA 1NBMD 3K5PA 4UUQA 4AX4A 1MMFB 1UOEA 4PR0A 5DBEX 3PA2A 3MLBA 5LYJA 2F8TA 1NFFA 4TT3D 1IB0A 1Z35A 3OIGA 4RCVA 1VCMA 2NUTB 4HCJA 3ZHTA 2O54A 1N7IA 3WIDA 2Z43A 4IGAA 2DWPA 2VFAA 3A9VA 3GAAA 1QGAA 1HI9A 2YS7A 3S0JA 1NI3A 3Q3EA 4CG3A 1IG0A 4AJ1A 2ECOA 2FP3A 3MMZA 2IIQA 4JFRA 3QY9A 3RE1A 1D3AA 2QB5A 2YRFA 5SZJA 1DSSG 3ZCVA 4EKYA 2ZUUA 3GEPA 4POAA 1ETHA 3NTXA 3IQEA 3BSYA 3L5OA 4R1QA 3MT7A 3HKEA 4KE9A 4UVDA 4Y9DA 4G81A 2O20A 1SD1A 2VUSA 2YV3A 3V1KA 1ST2A 3EGDA 2IEYA 3CURA 4IIEA 5HGXA 4LMBA 1LI5A 4OGGA 2OZLB 4KE7A 2W8ZA 4JL6A 2Z8YM 1JNXX 3U7FB 1DINA 3ELYA 4J0FA 4KPUB 1T2DA 2WUGA 2JZOA 4D1YA 2YWHA 1DX4A 5IULC 5JSYA 1ZUNA 2HREA 3LOPA 3WIUA 3AEUB 1P81A 1JEYA 2JBAB 3E3AA 4LOLA 4TS3A 3DWGA 1ZONA 1MOSA 3ONEA 3AC0A 1UPFA 4Z9AA 2EKLA 1HQCA 2AN4A 4XH9B 1VZ3A 3B12A 3MJTA 2K7ZA 3LL4A 2A5GA 1N2CE 4JJ6A 3V3KA 3TTWA 2QUJA 3GRRA 2K4MA 4JY7A 5FEUA 4IZIA 2D6FA 1NF2A 3ES9A 3DZJA 4TQ9A 1U9YA 4WLUA 4J0IA 1U2SA 2FP4B 4AT1A 4GUAA 5G02A 1IN1A 1LNZA 3BXHA 3VOAA 5EXSA 4ZT3A 5DM70 1YDMA 2ZIVB 1BDMA 1DFHA 3L7CA 3PHCA 1P44A 3K53A 1XZGA 1HEYA 3K0EA 1Q7GA 4K87A 3R3HA 2W22A 3JWPA 3ONNA 4B4VA 2XRZA 3AESA 1F4VA 3T35A