5DSZA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
408
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gamma-subunit of the translation initiation factor 2 from S. solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 91
structure length 408
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dszA01
1N8RD 2ZRMA 3KQLA 4JLOA 4V0OA 2ZVQX 2AHOA 4GP7A 3LVRE 3HP1A 4ZCMA 2PT7A 4QBIA 3THYB 2N46A 4M2LA 3W8NA 2IUTA 2YJTD 1IB0A 1RKBA 4F91B 2AK2A 1K5GA 4A2PA 5HXBA 2C03A 3AH8A 1XNJA 3RSLA 2OEPA 3PFIA 2J0UA 3KKOA 1NKSA 3ADDA 2FFQA 2BBWA 3RRZA 1GZSA 1GM5A 1ODFA 1JPNA 3SYNA 3PUWA 3EC1A 1IN6A 1OFIA 3W8RA 4M8NE 4DCTA 5FH9A 2G83A 2GETA 2ZPTX 5JI2E 2FPMA 1YHNA 3OEHA 3K9NA 3QEOA 3RRNA 2GEUA 3K1JA 1VQ7B 3OHMA 3WMFA 2XGJA 2B5OA 4CVNA 1N6RA 1OLOA 1UKVY 4GNKA 1MRSA 4JVSB 2PIAA 3O8CA 5AUOB 2DFKB 1G3QA 1VCOA 5HR5A 3CPEA 1JR3E 1JR3D 3KUDA 3U7HB 1Z06A 3BS4A 4PC2A 4RD0A 2VHTA 4C0AC 1Q86D 3OEEA 3OFNA 1YZNA 1G5PA 4P4UA 3RS3A 1ZNZA 4Q48A 3K0EA 5J4KA 3SDZA 2PX0A 4JJKA 1EX7A 2ZE6A 3OIYA 4HSEA 4KV9A 3ADBA 1GILA 1A1VA 4URWR 2W2XA 2EU8A 3LY5A 1OKKD 3AVOA 4TLAA 1CULC 1TVCA 2A30A 2J1LA 1C1YA 2J3EA 3WP0A 1EP2B 1OXUA 4I99A 1A4RA 1NLYA 1DAGA 3R7WB 3Q5EA 3TR5A 1UADA 2IYSA 2DFNA 4BZXA 4B75A 2JATA 121PA 1UJ2A 4FCVA 1PV4A 4Z54A 4BLTA 1O87A 2YOGA 4MUAA 4B33A 1Q44A 1Z63A 2H16A 1KMQA 1Z3IX 3CIOA 3NHAA 4YMVA 2ZM5A 4QBHA 4NCJA 4UQOA 2QENA 5KO2A 1E9RA 2BWJA 3EWSA 5TVKA 1WBDA 5DIFA 3ZD6A 3CCEB 1YIJB 1CNFA 1SVSA 2A5GA 2WSMA 4TWZA 3VAAA 3LX8A 1QGZA 4IOKA 1Z2CA 3AGPA 3NHBA 4FN5A 2R9VA 2ATVA 3U6KA 3U3KA 2W2TA 2VNKA 2RAPA 3GJ7A 2EFDB 1KK3A 1Q57A 4JLMA 1ZJ6A 4OK5A 5DNYB 4ESVA 2EFCB 3KL4A 1E2GA 4OQLA 3EA5A 4PTLA 4UXHA 2OV2A 3M0EA 5FUWA 1J7KA 4CRWB 5D3MA 3D7MA 1WE2A 3IUYA 2DFTA 2ZRCA 5TARA 3W2FA 3EIEA 2ZRIA 4XOIA 4DEYA 1JI0A 4A8JB 2R6AA 1Q1EA 3EZFA 3U2QA 1EFRA 3C5HA 4LBWA 3RABA 3T1OA 1RJ9A 3R9XA 2P65A 1E64A 4YAFA 2Q3MA 4TQAA 2C9YA 1M1YE 1P2TA 4U02A 1U9IC 3ZDQA 1OE0A 2FH5B 2XNDD 3A4MA 4B76A 4HE5A 4WW0A 3K9HA 1XPUA 4DDUA 2NO7A 2CJWB 1NIJA 1I4DD 4C0JA 1TQ6A 1KSJA 4B32A 5K8IA 2KE5A 1ZM4A 1KHTA 3KFVA 1QFZA 4NYJQ 2P6NA 2GNOA 5EZ6B 4CEHB 3AKCA 1Z0JA 3VR5A 1E2KA 3BD9A 3QOFA 5KTYA 1W46A 1SVWA 3LDAA 3KTAB 1ZNWA 2NPIA 4TN1A 1GITA 1CR0A 4FI3C 5G3ZA 4UNRA 1E2JA 3D31A 2OTJB 1J99A 1S3GA 4OL0A 1FNCA 2O0JA 1Z5ZA 2FZLA 4V0LA 3WP1B 1VDZA 1T0JB 5FPTA 1LS6A 3K09C 4WZ6A 1OFTA 2I4IA 3DKPA 4HLDA 2ZJ8A 1AJEA 1FMJA 4E09A 3CRQA 4M1KA 2WAXA 1GL7A 3HYTA 2QGNA 4YDSA 4S2EA 4LX0A 3HJNA 4KFRA 1JR3A 4PHTA 1VQPB 4WZAE 4PANA 4HZUA 4ZIRB 3QVUA 3AVYA 3I55B 4B3FX 3QG5A 2VSFA 2ZUCA 2NG1A 4TZ0A 2R62A 4AF6A 6Q21A 4JIMA 3JQRA 3RDPA 4B4DA 4JL8A 3SBEA 5P21A 4GL2A 5TDHA 2Q3FA 1U0JA 4KJZA 1M1KD 1HYQA 1JXOA 4EPXA 3GJ6A 3VKHA 3B1ZA 2VSOA 2HYDA 3N2EA 2IUSA 4PAOA 2ZRJA 5AWFC 1M2OB 4HAXA 5JS8A 3O8BA 3OJWA 3OIWA 2JLVA 5AJWA 1DE0A 3KZ1E 3B7GA 1G5TA 2ZSAA 3IEUA 3IQXA 3L8ZA 5KSYA 3IKJA 2HYIC 3I56B 4B44A 3FDIA 4BASA 1YKSA 1NLZA 1P6XA 3LW8A 4JKYA 2FGKA 4C0KA 1F5NA 2V6JA 1LF5A 3KXKA 4S35A 1G7CA 1MO4A 4LDJA 4IRUB 4TTQA 2QZ4A 1E6CA 3H2YA 4WXPA 4KCGA 4RCZA 4EJSC 2EW1A 4URZR 5JWHA 1DDGA 2X3UA 1KKLA 4DVGA 1OF1A 3AP3A 4CW7A 3BH6A 3SFVA 3ZZUA 2IYTA 4AK9A 1P2SA 5FOTA 1E2EA 4RVCA 1G7SA 3T12A 4GFDA 1KSHA 3W3ZB 2RC6A 1R6BX 4JLAA 2ORVA 2C95A 1XXHA 4D26A 4BFSA 1KGDA 2Q3HA 1S0UA 1AGPA 3BB1A 5IRCD 3FOZA 2BJVA 2ZSBA 5UKDA 3PEWA 1VQ4B 2JLYA 1Y3AA 4PO9A 3T61A 3WYFA 2X1VA 1S9HA 2ZYUX 3X1XA 3B1VA 5IDVA 4PQRA 1Q3HA 3WYGA 4EFLA 2NZJA 1NIPA 4ZCLA 1TF5A 3ADKA 4A4DA 1XPRA 2ZSEA 3CBQA 5JCPA 2ODEA 4JLNA 1E9AA 4NU0A 4BEJA 2FNAA 2WPDD 1Q1ZA 3DL0A 3ZS8A 3LBIA 1CTQA 1D9ZA 4KVAA 2OAP1 2GJKA 4OHXA 1KYIA 5GJWC 1J2JA 2FU5C 1ZUNB 4KYIB 5G41A 4HB0A 3KDSE 1IY1A 4AYTA 2P67A 1W34A 4ACBA 3UMRA 4JBYA 3AUXA 4LSGA 1CRPA 2J7PA 5FBLB 4DJTA 3RC8A 3S1AA 2JIZD 2JJ2A 4RY2A 5FUYA 2HCBA 2XNDA 3MWLA 4EIWA 4IVQA 3GLGB 2ZI9A 1HT1E 2OAQ1 3KJHA 1FRNA 4WA7A 4P0TA 2D3WA 3QXHA 5C1BA 3W5IA 3GLGE 3SOPA 2WWHA 4EQ6A 4JL5A 4Q9JA 1GAQA 1I4TD 2IYZA 3SEAA 3B5JA 821PA 3GJ5A 1W36C 5JFGA 1H8ED 2VEDA 1D2NA 1NN3A 3P27A 4TMZA 1IHUA 4CT5A 3R7WA 4A2QA 2OLJA 2QA4B 2NOAA 2QA5A 3Q8XB 5IT5A 4ZI2A 1ZIOA 3RRMA 3RS0A 2MMCA 2CEAA 3TW4A 3ES9A 2RHMA 1J8MF 3QPVA 1W47A 3GLGA 1P75A 1A82A 1OSNA 1G16A 3T06B 1VQ6B 2JJ1D 4X8LA 3RWOA 3MHPA 2IHBA 2RGEA 1A5TA 1E94E 1NN5A 1NNEA 2XOKD 2OM2A 2OG2A 3G5UA 3ND9A 4JT2A 3HWSA 5KUTA 5BW8A 2JA1A 1U90A 2IF2A 3BH7A 1MO3A 3C7KA 3KFXA 4KYUA 4LYJA 4BLOA 5B64A 1MT0A 4JVMA 1ZNYA 1QVAA 1YRBA 4A82A 2WWFA 3AVWA 3V76A 2IYYA 4B48A 2BMEA 3THWA 2PZFA 3GFTA 1H65A 2HMAA 3FGNA 1CF4A 3LBNA 4IDPA 1FRQA 5DE3A 4OYHA 5FBWB 3FVQA 4KBFA 2ZS8A 1KO5A 2XZOA 1WCV1 4HAVA 1GNRA 3TE6A 3HYRA 2ZITA 1GL9B 1ZM9A 1LS1A 1XTJA 3B13B 3CLVA 2ZJYA 3PJRA 1G21E 2OXRA 1DAFA 2PH1A 3K09A 3V00A 3CW2A 4NYIQ 1TX4B 3PUYA 2IS1A 2G0TA 2WIAA 1G18A 2ZANA 4G5QA 1VQ9B 4U7DA 1U0LA 4PC7A 4BFVA 3GLFA 1NY5A 4OHWA 4ZKDA 3LWNA 3OFND 1BMFA 1CR1A 2OXCA 3EG5A 4L5BA 4LPSA 4QG7A 3ZQJA 3ZLJA 1XFAA 4RFSA 4R71A 1XMVA 5HPYB 1N25A 5HTKA 5JSZB 1VHTA 1H85A 2JLUA 2YVUA 2QUZA 2PCLA 3LQQA 2B21A 1PUIA 4FMDF 4C2UA 2O8DB 5B2ZA 4HAWA 2Q9CA 1P9WA 4BEBA 4BFZA 1YR6A 2OHFA 2OCAA 4ZIRA 2VP5A 4UNQA 2WKQA 3U60B 2VHJA 4DLZA 1OT3A 3OZWA 3NEYA 3THXA 2ZRGA 4AKGA 3I8SA 5FTLA 1KDOA 2GXAA 5E7JA 2YV5A 2B8TA 3B82A 5SZKB 4ZI3A 2FFBA 3Q85A 1VECA 1ZD9A 3PG5A 4POAA 3VU9B 2ZAMA 2PMDA 1AS3A 3EW9A 1TNDA 5IF9A 2OLKA 5CYPA 1VYUA 4MRPA 3W6NA 5BN5A 5F98A 4M1YA 2V3CC 2H17A 1BYUA 1BYIA 4NCKA 1BIFA 1RE0A 4B71A 3NDBB 3E2IA 1T3LA 2O8BB 3AGQA 2O8CB 3U7FB 2C9OA 4IDNA 1E4VA 4YAWA 2O52A 2A7QA 2FPLA 1U8AA 3RLFA 5L3VA 4CEJB 2F1JA 5L3SA 1GWNA 4XTRA 2GWHA 3OIUA 4AC9A 1FNDA 3PV0A 5H59A 5DI3B 4WBSA 3BFVA 5GJVC 3QFTA 5J4YA 2EVWX 4DSTA 3AB3A 3ZBTA 2MSDB 4GDFA 3LFUA 1TMKA 4II7A 1CS4C 3KXIA 2X8AA 3N2IA 3CCLB 2XZLA 3V4RA 1X8JA 2ZS9A 3EAQA 1DOAA 3DO6A 1SVKA 1N5KA 3GLHB 4LV8B 5EP3A 3TUIC 3KQNA 1EK0A 2O5VA 3ZJYA 2DEUA 1DBSA 4RSGA 5KSWB 5FI1B 1Z28A 4DB2A 4FWTA 1GVHA 2RHDA 5KNBA 2IA5A 1M8PA 4Z8YA 3T1VA 3EPLA 3NXSA 1FUUA 1ELOA 3FMOB 3CX6A 4GOKA 1XCMA 4M9ZA 3U3MA 2F3TA 1WA5A 3VX3A 1SKYE 2G1KA 2CE7A 1R5BA 4DSOA 4L4UA 4Q66C 5DHFA 4KAXA 2P6RA 4H1UA 4TMVA 2F55A 4I1VA 4LGMA 1QVRA 1S1MA 3ND8A 1EFCA 1QH0A 3LX5A 2ZI5A 2JJ2D 4TMTA 1VQ8B 2YC4C 4PPQA 1EGAA 1KO4A 2GF0A 4Y7CA 1XEWX 4LZZA 2CLSA 4M4SA 3CZPA 3GMTA 4P6VF 1DAMA 1SHKA 1F3OA 1KK0A 1K5DA 2FMXA 4LHWA 4C9BA 2GCOB 3LV8A 3CCQB 3FMPB 3IQWA 3G4SB 2JDIA 2OSBA 3TQCA 4YAUA 1KTVA 1JALA 1E4YA 1QHIA 2ODNA 3G6EB 4K1XA 2ODBA 2OT3B 4GBMA 4Q1CA 1P7CA 2QP3A 4K8OA 5IK2D 1R0WA 1N2CE 4DQKA 2DBYA 1UBFA 1ZUIA 5A0FA 4V03A 2KB0A 1FUKA 3G71B 5HCIA 1MR3F 1UFQA 2HXYA 4JLVA 2ZSDA 1GKYA 5KPDA 3MSXA 4D81A 1XJQA 1COWA 2QAGB 3BFKA 3JQPA 4JZKA 1FTNA 2FV8A 3NC0C 4TTRA 3T35A 2XAUA 1P9RA 4DIEA 2XTNA 3FPAA 2QAGA 2QMEA 1OXXK 2BCJQ 5CJPA 2WVJA 3W2GA 1H42A 4AF7A 1NDHA 1VG0B 2ZR0A 1FNBA 3I32A 4LPKA 4ON9A 3EC2A 4RZ2A 5CM9C 2GXUA 5KYKA 4BLPA 1P4SA 1YHQB 3UMSA 3WBKA 1FP6A 3MFYA 2FOLA 4RD4A 4DLUA 2QDXA 1A2KC 2B7BA 1WQ1R 3SI7A 4EPTA 2VIIA 3AUYA 3SR0A 2JLZA 4PGOA 4DCSA 4WZBE 1VYTA 1UEJA 3EIHA 1LVGA 2GEVA 3WBJA 3Q7PA 2BMDA 2CVFA 5JI3E 4KI0A 4QGHA 3ZVLA 4CDGA 1FDRA 3TH5A 2QN6A 3KJIA 1DO2A 2RGGA 1NBMD 3RWMB 1XEXA 2YOFA 2PLRA 4ZDKA 1K8RA 3AF3A 2H92A 3IIKA 2GDJA 5DGXA 4B74A 4BLQA 4G5GA 2PBRA 4CGZA 2UZIR 1AMOA 1ZU4A 5EJEA 4U9UA 2ZI6A 4PPGA 3HU3A 1A7JA 1KI6B 4TT3D 5G3YA 3QEJA 1EFRD 3CZQA 1KJYA 2BBOA 1ZW6A 3OESA 1J9ZA 4Y0AA 1UDXA 5DHAA 1E2IA 3FWYA 2OBNA 1E2LA 3I62A 4Z51A 3E20A 2QNRA 1W0JD 2QQEA 3L43A 5H1YA 1E2QA 2V4ZA 1W4RA 1XJ0A 1T5IA 1G3RA 2NO0A 4C0LA 2DPXA 3LAWA 1EFUA 2GAOA 3K0FA 3QE2A 5L8VA 1NVWQ 1IBRA 3GPLA 5LDDC 2WOOA 3FFBA 3R9WA 3M4YA 3W3AA 3NBZC 2H1LA 1NLFA 3CC7B 4OI1A 3NIBA 1G41A 4Q4HA 1X8LA 2BBTA 4QHTA 1UBCA 3MWJA 4C7OA 3ZGXA 3NC1C 2EYUA 3TAHA 5FR2A 3FMFA 3QE0A 2CNWA 1TADA 3AKDA 1NJGA 4IHQA 1DARA 1GAWA 2R65A 1E1RA 5H68A 2VP2A 4B3BA 4D82A 4QRHA 2RGNA 1Q3TA 4AKHA 1Q82D 1W1WA 3ZIAD 3ICQB 3GEEA 4W5WA 1OPXA 4XJXA 3ZVNA 3X1YA 3NH6A 1U94A 5AR1A 4AURA 2BM0A 4TSFA 5DH9A 3SS8A 1KSFX 5DYIA 5FL7A 4QM6A 1TEXA 4BZQA 3D8BA 3NH9A 3GFPA 2QM8A 5C2JB 2GCPA 2IBMA 2ZRDA 1UBEA 2Q0HA 4JMPA 1OHHA 4NBSA 2Z6VA 4JYBA 4FMBB 2FSFA 4URUR 1OIVA 4LY6A 2QTFA 3V9PA 1R4AA 4MGYR 4XTCS 3GJ0A 2F1IA 4JLJA 4NZYA 4JYCA 4C0SA 2FPKA 2WMOB 2J41A 2VPPA 2K5UA 1CQXA 4I1UA 2NMVA 2VYFA 4FK8A 1DVRA 3I72A 1ZU5A 2BV3A 2Q6TA 4LK2A 3R20A 3UK6A 3KUCA 2RKOA 3A1SA 3RVBA 1NF3A 2I1QA 3K0CC 4XVUA 2GXSA 3KQUA 1TQ2A 1XF9A 1EP1B 3R8FA 1EX6A 5JBQA 5HKKD 1GNQA 4HUQA 4YALA 3G82C 4D6PA 1G17A 2WHXA 4PHHA 4AKEA 4YMUA 4PC3A 1BJKA 3Q5DA 2OILA 1R2QA 4KXFB 3SHWA 2VNJA 4KODA 4TL6A 1XZQA 2B6HA 5EXPA 4DLTA 3WMEA 3U44A 1JAHA 1XEFA 2YKGA 4M0LA 4GZLA 2IS6A 1Z22A 4JVLA 2QMOA 2IW3A 4KFTA 3CCJB 4OQMA 4QC2A 3T1QA 2A3RA 1P60A 2H7VA 2HLDA 4Q4AB 1L7VC 5EUQB 3R9IA 3BGWA 1K8AD 3WNCA 4D4KA 4OHZA 4TYYA 3GJ3A 3GLIE 1IY2A 3CRRA 1KMHA 4FWIB 1I4LD 2I1VB 3MUFA 1BMFD 3PIRA 3EZ9A 3DKVA 1U99A 1N6HA 4HZUB 5F3WB 3KKQA 1G1MA 1LF0A 1YZUA 3B9PA 2CBZA 1II8B 1ZINA 2D2EA 2YOHA 3QF4A 4M1TA 2VSXA 4TMWA 5HZHA 1YZQA 3UXMA 2XEXA 1P2UA 4QL3A 4Q9IA 4B6FA 1GIAA 1NN1A 2ZI4A 5A4JA 2F7SA 1DTSA 2ZE8A 4LJAA 4TYQA 1NBMA 1OFUX 1XXHE 3CC2B 1O3YA 5J4VA 5BXQC 2IXFA 2PX3A 5L3QB 1XXHB 1BH2A 1VQKB 4RFVA 2KSQA 1NMXA 2R6FA 4Q19A 1N6KA 1M7HA 3CPWB 3ZQ6A 3TK1A 1HEIA 2O0KA 1R5NA 1L2TA 3P4XA 4A0FA 3AM1A 1IM2A 1IN7A 2G6BA 2O0HA 4PZLA 4TLEA 3CCUB 5H5JA 2CHQA 2VZLA 3GEHA 3QG1A 4LHVA 1Z8FA 4ARZB 5K8TA 1AK2A 3DZDA 3FTQA 5CK5A 1ZBDA 2W6JA 4DBLC 1OH8A 2ANBA 2CNWD 4C7OB 3GCGA 3OAAD 3ECCA 2FGJA 2HT6A 1T8UA 2ZRAA 4LC1A 4LJ7A 3OZXA 3WNDA 1HT2E 4H9GA 3CH5A 3CNNA 4OI4A 1EESA 1U0HC 5BWMA 1KZ7B 2BF4A 3L0OA 3RYTC 2ZAOA 1FNMA 4OI2A 4PHFA 4FMDB 3BK7A 5DISB 1ESNA 1HUQA 1DEKA 1T5LA 1YU9A 1LB1B 2VH5R 5BN4A 4OHYA 4TZ6A 3LXRA 3CRVA 1E0KA 4IDHA 5GVSA 2BMWA 4DLXA 3PEYA 1T9HA 3P1JA 3EASA 4C4PA 2PLFA 4DT1A 5GJCA 3TIFA 1HE8B 2XSZD 2NTYC 3SNHA 3JVVA 2PEYA 1QDEA 1VCNA 4DT1B 2F43A 3CR7A 5DLQC 2XTMA 5LPNA 1U2RA 4LC0A 4B3CA 2QBYA 3EWAA 1W36B 4BFXA 2E1RA 1JQJC 3VQTA 2AXPA 2CCJA 1Q22A 2WSSA 2XITA 2BPOA 1CR4A 5FTJA 4F4IA 1IAQA 1TTTA 4CEIA 4Q7KA 3LRPA 1E63A 4LYHA 5FPSA 2L0XA 3IIMA 3QI2A 2Q21A 1XCGB 5FL7D 5LD2B 3TW8B 3A1VA 3BH0A 4RJLA 3CRZA 5THXA 3VR2A 1IN5A 3CCRB 1GAJA 1QBKC 2LWIA 2ORIA 3BBPA 3PITA 2HEIA 3CRW1 4P31A 4U5XA 3ZIAA 4EJSB 3VR4A 2VL7A 4EPWA 4Z1MD 3DMDA 4QJ3A 3BRWD 5CIWA 5EE5B 4NE2A 1T91A 2CRVA 2WIBA 5KSOA 3OIVA 2GF9A 3H1TA 4GSYA 1EFTA 3GLIA 4X8HA 3TJZA 4Q47A 2PEZA 2XOKA 3K0AB 4GP6A 4R7ZA 4PR0A 3AF1A 2HDNB 1JXMA 3VR6A 4FD2A 2WWWA 1G6OA 2HUPA 1N3BA 5KOYA 5CDFE 2B92A 2W6ID 1GUAA 1P5ZB 3OE7D 4Q21A 1E9EA 5K8UA 4M1SA 1SVLA 1SXJE 1T4GA 4N3NA 2KWIA 1YJ9B 2C77A 3CCSB 1GNPA 3QFSA 1LFDB 1QHYA 1QX4A 1OV4A 5DO9A 4TL8A 4NKRA 4I4LA 4IDOA 3RNLA 3I5YA 1MV5A 1NRJB 3MAAC 2C5LA 2H5EA 2WJIA 3ZVRA 3L82B 1KO7A 1XBTA 4HAZA 4BECA 1R0YA 1G3IA 3F0TA 3PVSA 4JBXA 4LOAA 1P61B 3JZMA 2HF9A 4QHSA 2VA8A 1DAEA 2C04A 2FSIA 2ZR7A 1QHSA 4IKEA 4MGIR 1IN4A 4RD6A 3CM0A 2ZRFA 1S3SA 4G3XA 4KBGA 5BQ5A 3U44B 3NEJA 1PUJA 1CJUC 1SXJB 3AVQA 1W4BA 5C18A 5BYJA 2HT1A 4G01B 4AYWA 2YINC 2CVHA 2WV9A 3QFCA 1XMIA 1UMKA 2D4HA 2AX4A 4NP6A 2LKDA 3H0KA 4D2IA 1OIWA 4QKQA 2KI5A 3QENA 3JQQA 2LCFA 2JLXA 4FW9A 4DSNA 1OIXA 3L8YA 4MYCA 2ZR9A 3KKPA 2JLWA 2YWGA 3H4MA 1CBUA 2OBMA 4ASUA 3CWQA 2H8KA 5C4GB 3U5ZB 1KJZA 4MYTA 4LV6A 1DADA 4C0QC 4GT1A 1QFYA 1IOZA 3SYKA 1HQYE 5KDLA 1F2TB 5J40A 1GSIA 1ETUA 1W2BB 1N6NA 4Q01A 1CXZA 5FBRB 4DUGD 3EZ7A 1W36D 1W0KA 2WM9B 3FB4A 4AD8A 5FBVB 1Z6XA 3FMIA 2F9LA 4NH0A 3AVXA 4LUCA 3LO5A 1ZC3A 3EPKA 2XNCA 1XD9A 2QTVB 2QU8A 4P32A 4C2TA 2BHRA 2JGNA 2RGXA 1DAHA 3F3YA 521PA 3REFA 3EZ6A 2DR3A 1QFJA 4URYR 3T34A 1F60A 3QNUA 5FOXA 2N1BA 2C96A 1ZUHA 2V9PA 1CP2A 2ANCA 3HPRA 4EPYA 4HZIA 1G64A 1NVVQ 2G3YA 1ZRHA 2BCGY 1HV8A 3MJHA 4E07A 2WICA 1HE1C 3REGA 2YZ2A 1OXTA 2AKAB 1ZD8A 3PCRB 3SJZA 1WF3A 1K73D 2PMKA 1XJCA 1E1RD 4PSVA 4ACAA 3W2HA 4TL7A 4URXR 4QHYA 5HE9A 5CITA 2J0VA 2UKDA 5CB6A 2RGNC 4PZYA 1XTQA 2O8FB 4R2IA 1BX0A 1Z6GA 4Q4HB 4PZZA 4PXAA 1M74A 1ZP6A 2AD5A 3CUEF 4YHBA 3B85A 2EFEB 4K81B 5TXGA 3UIEA 1II0A 3RSOA 4E03A 4YQFA 3VTKA 3QF4B 3L0IB 3K53A 1II8A 1NVUQ 5JHGB 4QGFA 1H8HD 1UKYA 2GCNA 1XCPA 3NKVA 3RHFA 5AUNB 1NY6A 3EXAA 5KSPA 2PZGA 4KFSA 4HI0E 2F1RA 2ZIAA 4B35A 4QM7A 5KNCA 1E0AA 3KB2A 2OESA 4Q4AA 4UJ5A 4MKHA 2CK3A 4OJQA 4XH9B 4DQLA 2AL7A 2GVZC 3C16C 1CR2A 5C4MA 2WMNB 1KQSB 3WXMA 4KFUA 1KI9A 3GLFB 4O0MA 1S1CA 2QY9A 4A9AA 2Z83A 2AWNA 3PEVA 3TSOA 3U3OA 2OCPA 1KI4A 2G88A 1ZCAA 1UKEA 2ZROA 4XIGS 5CJ2A 3EZ2A 5TV2A 4Q9LA 4LYAA 1N5LA 1YZKA 1HURA 2QORA 4RZUA 4DCVA 1X1SA 3WY9A 3VFDA 4NL4H 3MCAA 1DS6A 4NTZA 1G3UA 2ONKA 4JLDA 1GDDA 1QF9A 1QGAA 3ADCA 4WQMA 2W0SA 4D80A 1IXZA 4PFSA 2DB3A 3QY0A 2IK8A 3KTAA 3TR0A 1AM4D 4HUTA 4LHYA 4NPHA 1E2MA 4XWAA 3W90A 1KKMA 3TRFA 2BN4A 4TTPA 2DFLA 2IYQA 3CCVB 2ZU0C 1IXRC 2ZYTX 2ASEA 3W2IA 2F1HA 1XP8A 4E22A 3U3JA 1V5WA 1GVNB 1AQUA 1VTKA 1Z0KA 3ZVMA 4JSYA 1E99A 1FL9A 2Z5FA 4AYXA 1R10A 2REOA 1QG2A 2ZJAA 2A2ZA 1TUIA 2J45A 3DM5A 4DUGA 1NMYA 2GVDC 1NP6A 2GA8A 4LJ4A 2B7CA 1E2NA 2R44A 2XB2A 2ZSFA 1N6LA 4F7DA 1T6NA 1MKYA 1W0JA 3QJYA 4MKGA 1U81A 1D8TA 1QHGA 5CYOA 3LW7A 3MWYW 4PSKA 4DRZA 3RAPR 4XD7D 2VRWA 2QT1A 2IX3A 1G3MA 1RRGA 2AD1A 2ZJ2A 2R8RA 1LNZA 4HDQB 5JCZA 4JLBA 3QBVA 5D3MB 1G6HA 2QGZA 3U3RA 1PVOA 1AS2A 1YE8A 2REXB 3E5HA 3B78A 1GOTA 2GJSA 2C98A 3KXLA 4BZPA 4D0NA 2WJYA 4Q1AA 1RZ3A 1T3HA 1WXQA 1QHHA 2BMJA 4CEIB 3DDCA 5EE0A 4C0BA 1BX1A 4CIDA 4F4JA 3DHWC 1Q7YD 5J4LA 5DI9A 2SHKA 4DLSA 2XNJA 2XZPA 4DLVA 2E9SA 1YVDA 1GKUB 4R9UC 1OB2A 3FHOA 1Q0UA 2ZJBA 3EPJA 2QE7D 2FA9A 4LI0A 4US1R 3SJAA 1PZNA 3LVQE 4AIIA 2MSEB 3TUZC 3CMEB 3LXXA 1MABB 3EARA 1JJ7A 3SQWA 2V7QA 2YYZA 1XD2A 1YRAA 3WHLA 1ZNXA 1DG3A 4BLRA 1E79A 3VHXA 5FA6A 1KDPA 3UWOA 1JA0A 1IONA 2D62A 2G77B 4QNMA 2QAGC 4JKIA 4E5UA 3KKMA 4ZGQB 4TYNA 4LHXA 3W5UA 1XTSA 1AQYA 4QGAA 4MDEA 1RJ9B 2GTPA 1RC8A 5ELXA 2O8EA 3TGPA 2V1XA 3DVLA 4B3DA 1JEDA 2WWIA 4DIDA 2YC2C 2D06A 1VQ5B 1Z08A 4N1AA 4ESHA 5GADl 3I1FA 2AK3A 1KI3A 1TUEA 5L3SB 3IPXA 1KO1A 2X2FA 1X8KA 4IFEA 5AJYA 2O8BA 3P4YA 4C0HA 1OYWA 1KD1D 4GRAA 4URVR 1T8TA 3UG6A 5KU1A 1NG1A 3O8RA 1W48A 4Q1BA 1TU4A 1GJRA 2C2HA 3UWKA 4ZV4A 4DDWA 5L3QA 3BXZA 2P5SA 1R8SA 1XTKA 3DMNA 5KDOA 2QROA 4MKFA 2H18A 3JZAA 3EX7C 1VIAA 4BUJA 4Q1DA 1ZIPA 4WXRA 5FPHA 3CF6R 1RYFA 1NVXQ 4IOLA 5EXSA 2ZRKA 1YR9A 3ASZA 2IWHA 1EWQA 4CT4B 4LBZA 4EKDA 1F2UB 3RANA 5C46F 4IW3B 4GMDA 5JECA 1OGJA 1B23P 3PUXA 2BBSA 4TQUS 1BOFA 3QFRA 2ZETA 1OW3B 2GBLA 5EE1A 8OHMA 1MOZA 3IHWA 2O8DA 2IS2A 1G4AE 4YDHB 4YONB 2ZS7A 1KRHA 4MITA 4NDZA 4NMMA 3R8CA 4EPVA 4KO8A 4KHZA 5EE3A 2MSCB 4Y0VA 1Q20A 1AGRA 3I5XA 5FFMA 4YXWD 2G0NA 2ERYA 3W5HA 2NO9A 2V55B 4JL6A 3AQ4A 4A8JC 4MQBA 1DAKA 3A1UA 1AZSC 4US0R 4ERNA 3AKYA 5SZIA 3TAUA 2OBLA 1SXJD 2EWVA 4B2LA 2QP9X 2ZREA 4L16A 4A1FA 4BPBA 1UDWA 2ECKA 3QKRA 3PQCA 4OJKA 4A92A 3VO1A 3QSYA 1E1QD 1KO8A 4D0GA 4EPRA 1D9XA 4RKFA 1HY3A 1W4CA 1E98A 4B73A 2WWXA 3W5VA 1E32A 4DZZA 3IILA 2ONJA 2ZJ5A 5BYKA 2F3RA 2NIPA 1JJ2B 2QMHA 3A4LA 3K9LA 4HEJA 4DLRA 3O47A 4UNSA 3QUSA 4UNPA 3I61A 2FEMA 1XU4A 4G0NA 4QJ5A 1G7TA 2ZUBA 3FE2A 2BIFA 2ZYWX 2ZE7A 1N0UA 2IL1A 4X8MA 4OQFA 5EQTA 1FTSA 2X77A 5JZVA 1Z0IA 5DYGA 2OFWA 3IBGA 3CWZA 1RIFA 2Z43A 1G9XA 1IN8A 2DERA 1JQLB 1I2DA 1GRNA 1Q21A 4TQ9A 4D4MA 4KLZA 5JLJA 4YMTA 1CJVC 1OYYA 2QG6A 2VBCA 3K0AA 4M1WA 3OZVA 1N5IA 1CJTC 5HCNA 4D4LA 2A5FA 4RD1A 1M7GA 1R7RA 2C99A 3T5GA 2D2FA 2C8VA 1JEEA 3FFAA 2AR7A 4A8JA 3QIAA 3U4QB 1OB5A 4F38A 2J59A 4LV5B 2P2LA 2B8WA 3TMKA 3ZYCA 4EDHA 4ABYA 4D4JA 4FCTA 5J4HA 1QVGB 2CCGA 4OQXA 1FX0B 1VKJA 2QT0A 1DDIA 1B0UA 4RKEA 5B58C 3NWJA 5DSZA 4M1MA 2OFOA 3WHKA 1WDTA 3GLFE 3KJEA 2W58A 4JVNA 2IUUA 3K0SA 1HH4A 1XRJA 2HXSA 3PUZA 4Q7JB 1FMLA 5BN3A 4HLCA 1XB2A 4I81A 2CLDX 1VCMA 1US8A 3S1AB 2WWYA 3QPWA 2QPAA 3VKGA 1KK2A 2BJWA 3K0FB 4V0MA 4LBVA 4AI6A 4HDCA 3VO2A 1G8GA 1ONBA 2MMGA 4OQNA 1G8HA 5CLLA 4TLCA 3X2SA 2FN4A 4BFYA 2AFHE 3CR8A 2OK8A 5H8WA 1UPTA 2VP9A 4MRVA 2WTUA 3OZUA 1D2EA 2P3SA 3A8TA 3BE4A 5FOVA 2YWFA 1UBGA 3WNBA 2J87A 1N0VC 1NL3A 5KHOC 3BB4A 1TAGA 1VMAA 1KJWA 1OJLA 3IGFA 5CLQA 3VX4A 3ZZ0A 5JJKA 4QXAA 4QGGA 3AVVA 3QF7A 3UPUA 1L4YA 2P6UA 3VKWA 3QKSA 2DETA 3A4NA 5K8LA 3CMAB 2XB4A 2JAQA 1PLJA 1GRRA 1TQDA 5KSZA 2J7KA 2DYKA 4GPTA 3AF4A 4CF7A 2QTHA 3BERA 3HR7A 2J0SA 5EP2A 1QRAA 4UNNA 2PCJA 4RCYA 2QQ0A 3TVTA 1JB9A 2W00A 3LLMA 2XJ4A 1KI8A 3GJXC 3ZD7A 2VO1A 3PENA 1KIMA 2O8CA 1SHZA 1RVDA 4QBGB 2G9NA 1Q12A 4HLUC 5H70A 5GV7A 1LV7A 1VQOB 3AKEA 1QGYA 4JLPA 3ZH9B 3U6BA 2IXEA 4ZO4A 2RB4A 2AXNA 1U8YA 2VP6A 1LY1A 4BFTA 2Z0MA 1SXJC 1NJFA 4TT3A 1P72A 4TLBA 1KAGA 4PAQA 5GVRA 3VR3A 2IEYA 4DB4A 1E0JA 1G8FA 2RCNA 2JEOA 4M9XA 2ZRBA 1KSGA 3GD7A 3ZC3A 1W49A 3THXB 1TPZA 4EH1A 2JIZA 1KI2A 1Z47A 4D25A 1N6OA 4B2IA 1VQMB 3I8XA 4MYUA 3K0CA 1MH1A 2FFAA 3A36A 2IYXA 4ARZA 4F92B 1EG7A 2OO7A 2XNSA 3RRYA 3C15C 4I1SA 1OFHA 3ONWA 2CHGA 5JSZA 1XMJA 3DEFA 4G5OA 3X1WA 1Q81D 2HV8A 3NVAA 1GG2A 2CL6X 2FFHA 2VNHA 3CNLA 3QXJA 4GMXA 4OBEA 4V0NA 5E7IA 5SZJA 1JAIA 3ZS9A 2D7DA 3H86A 2A5DA 2ZI3A 3NBFA 3AF2A 3P26A 1Z83A 1RFLA 3FKSD 4Y9UA 4NYIR 4R98A 2ZXUA 5F2EA 2NPFA 3CCMB 1I7PA 2GK6A 2V1UA 3GLHE 4DDTA 3SU8A 3KKNA 2OE2A 2GAAA 1NKTA 4IDQA 3DM9B 2RH5A 5GV8A 3PEUA 1C9KA 2VYQA 4G1VA 4WIAA 1GP2A 5F9HA 2HCJB 2Z4RA 3TLXA 2CNDA 1TL7C 1ZYUA 3KJGA 4TYPA 2ZJZA 5AK0A 3KQKA 2GK7A 4JLKA 4U00A 1SVOA 2W2VA 4KSBA 5LB4A 2OCYC 3CNOA 1A2BA 4A0RA 4QFMA 1G291 4EJSA 5JS7A 2GZHA 4Q1FA 1NJID 3NBYC 1T0HB 3BFXA 4L8GA 4OHVA 1KAOA 3LD9A 5KNDA 2XXAB 4IOJA 2WAYA 2J0QA 3FHCB 1VG9B 1E9BA 3QKRB 4HUQB 3T1TA 1S4QA 3GP8A 4BPRA 1P73A 1R0XA 3B1WA 4B47A 3IIJA 5ANRB 4EUNA 2BM1A 1UKZA 4YC7A 4L9SA 5B57C 2FSHA 1AS0A 4JBWA 1P62B 4A15A 2KBFA 2DWQA 3CH4B 1JECA 1TLLA 2NO1A 1ZD1A 2OZEA 2ZVPX 4Q7MB 4UXIA 5EE9A 2AN9A 4MH0R 1VCIA 4ZDIA 1TU3A 4Z1MA 1U9IA 3T15A 2ORWA 3RS2A 1JBKA 2QTLA 5CIQA 5DN6A 2ZEJA 1YJWB 4P4TA 1NVVR 4WOPA 1XTIA 4OK6A 2VTKA 5G53C 1I2MA 2PT5A 5EP4A 4C30A 1OH7A 4ZKEA 4I1OA 4B3GA 4HATA 2A78A 3OE7A 5J47A 1A8PA 1XD8A 1DAIA 4R2HA 3SJCA 2YHSA 3VU9A 4MRRA 3SQXA 1Z0FA 3CC4B 2VHCA 1W5TA 3MD0A 4TYWA 4KVGA 4N0DA 1TF2A 1PLLA 2GKSA 2WOJA 3SE0A 4G5SA 3BORA 1DPFA 2FX3A 4YXWA 1RRFA 1MO5A 5EMNA 2N42A 3BOSA 3UATA 3VR1A 4AG5A 4BE7B 3CB4A 4TLDA 5JWOA 1P2VA 4PC6A 2VHUA 1IJFA 2FWRA 4O3MA 4IEIA 2RGAA 3U4QA 4UAJA 3LBHA 2JASA 4KLNA 3IO5A 4JT4A 4BGDA 2JLRA 1M90D 4A0HA 3W6OA 2W0MA 5E95A 4Q18A 3K70D 1XDBA 4NONA 4H1VA 3N70A 1KY2A 1QG4A 2QSYA 1G20E 3MG9A 1QVFB 2A9KA 2BOVA 2ZE5A 4O2LA 3C41J 3FKSA 4PO8A 5EXTA 2WKRA 1PJRA 3B1XA 3LA6A 4CYMA 1F2TA 1P9NA 1KK1A 2QAJA 4FINA 4PX9A 3M1IA 2PJRA 3HR8A 3SN6A 2A5JA 1SKQA 3SFZA 4Q9KA 1NG9A 3MMPA 1YR8A 4FIDA 4IVRA 4OKSA 3W6PA 2E87A 3WRYC 1IXSB 5TMPA 1ZVQA 4K46A 1RPZA 1FW6A 4X8OA 2J0UB 2R6HA 3AVPA 4DCUA 4A6XA 3AV0B 2WKPA 4Q4LA 5JWRA 4UXJA 3B60A 1L4UA 4BRUA 4J0QA 3L0PA 3RC3A 2QPOA 2XJ9A 2F6RA 3LLUA 3UANA 2J7PD 4IOMA 1HA3A 3G0HA 2GHIA 4GOXA 5LBIA 1SZPA 5JEDA 4BLSA 1QUEA 1XX6A 3MRSA 1GRQA 3OW2B 4KU4A 4Q4JA 3N5CA 3BB3A 4AWXA 1P3JA 3U7EB 3NDPA 1R0ZA 4HYYA 4Q03A 3MGCA 4B6EA 2DY1A 2BEKA 4HE6A 1XPOA 2JJ8A 2DCUA 2QEQA 4DC9A 4OI0A 4Q7LA 2P5TB 1YITB 1E2DA 3FHTA 2HF8A 3IPYA 3RS5A 3WRXC 3B9QA 2BVNA 4D0LB 3ICEA 3WYAA 2ZRPA 1SKYB 3QXSA 4XVQA 2NO6A 1CEEA 2BKEA 3UG7A 2QI9C 3LO8A 2DWPA 2WWGA 1ESMA 1S96A 4TL9A 2QM7A 4Y9RA 3CF2A 1XWIA 1OHHD 2Q9BA 2QL6A 2J9RA 1GO2A 4XWOA 3B2EA 3QXXA 2GPJA 1QUFA 3QPUA 1XE1A 4BRWA 5EZ5A 2UVQA 1W35A 2D7CA 2BSAA 4TSFD 1RYHA 1E79D 1OXSC 3W2EA 1RW4A 3X1DA 4LJ9A 3DOEA 4F93B 2BGIA 1HQCA 5IK2A 1FX0A 2VHQA 3GLIB 1B2RA 1E2PA 2H57A 5FPKA 3DPUA 1K9MD 1JNYA 5CB8A 4CEHA 3CF0A 1BQEA 1KI1A 2R6CA 4HB3A 3SJBA 4O25A 2PZEA 1L8QA 1W87A 2OUKA 1MABA 3OEHD 2XX3A 1M7BA 3E70C 5E3HA 3C8UA 5AJVB 1WP9A 4DLWA 4XWKA 4G5RA 5FR1A 3CPHA 3SYLA 1FZQA 3U61B 3W9YA 4ZCIA 2VP0A 2ZUDA 3B1YA 4PQFA 4FMCF 4Q9HA 2W6IA 1CLUA 1PLKA 3L0SA 5TR9A 1AZTA 1SQ5A 1Q1QA 4Q1EA 5HZKA 1JR6A 1CJKC 4LBYA 1NN0A 3QQ5A 4ITRC 5E4FA 2GBLC 1JPJA 4LJYA 4LWZA 3HPQA 3CD6B 2J46A 1X3SA 4ILEA 2FJUA 2YNMA 3I92A 5FBQB 5D3QA 2JCSA 1KNXA 3KX2A 4B2PA 2CDNA 3Q72A 4RD3A 3GJ4A 421PA 1ZM7A 2VF7A 5AUPB 1Z0AA 4HLUA 1OGIA 5JRJA 5HKKA 1VG8A 1GR1A 2IXGA 1D6JA 621PA 3QBTA 2CL0X 4ZGNB 1UM8A 2GEDA 2HJGA 4L15A 5EXXA 1S72B 4Q4JB 1VQNB 4W7SA 1W7AA 4JJZA 3TKLA 3C5CA 5L3RA 3E1YE 1QG0A 5CM8B 5CDFA 1QHXA 5JEEA 5JMTA 2KJQA 1Z29A 2I3BA 4RFSB 3KB1A 1IJEA 2FG5A 1RRCA 1R5OA 1Q1BA 4XD7A 3THWB 2DHRA 4IJMA 2OK7A 721PA 1J8YF 2F9MA 2CMKA 3K8YA 1DO0A 4NYMQ 2IYLD 1C4OA 1E9DA 2EFGA 1XEWY 4ZDJA 2YWEA 2CXXA 4GOJA 3Q9LA 1LTQA 1YR7A 3QXCA 1W2HA 3NTUA 2W83A 5KDDA 2FEOA 3PUVA 3A6PC 1S9DA 1K6MA 3BC1A 4XVRA 3AVUA 3BJIC 4M22A 4AG6A 1UAAA 3ETLA 2OTLB 3OAAA 1W44A 2GZAA 3HU1A 4HLQB 1U8ZA 1U98A 1Z0DA 3UMFA 2RMKA 4YLGA 1EWYA 3IO3A 4MUBA 4F4CA 2C78A 5CK4A 5JHHB 1F6BA 2V7QD 1AIPA 2FE4A 3CX8A 2VLIA 3GEIA 1ZC4A 4DWJA 5JJLA 4DLYA 4QNRA 4JS0A 4B34A 2AKYA 2FZ4A 1WMSA 4W9MC 2O8EB 3EIQA 1G8YA 4PPNA 3IDQA 2EYQA 1ZM3A 1F2UA 3W5JA 1JA1A 3LQRA 3I73A 4N0EA 1VIYA 4EFNA 4F7WA 5IHPA 1EWRA 1SGWA 3D3QA 2P0EA 1XZPA 2V8OA 3TQFA 1J70A 4W5JA 5FPYA 3BIFA 4XSGA 3IHLA 2REBA 5EP1A 2QBYB 5TY0A 2GESA 4IVPA 2OCBA 3P20A 4DHEA 4HAYA 2RC5A 3VMFA 1XD2B 1BKDR 1FQKA 1TEVA 3RS7A 3FJOA 1N0WA 3THOA 2KBEA 2X19A 5F9FA 3CPJB 4LYFA 1X86B 1S8FA 2XTZA 1YQTA 1E3MA 2DWOA 3OF5A 2R6DA 2JJ1A 1SVIA 3K9GA 2CJWA 1G4UR 1ANKA 1II9A 1ZAKA 4N3GA 1G19A 2ZTSA 2ZI7A 3IBYA 3NBXX 3Q7QA 1GFIA 3TUJC 3W34A 2IHYA 3FYHA 4DKXA 2JLQA 1QHHB 5FTKA 2C9CA 2CCKA 3T5DA 1VQLB 2AFIE 1ZM2A 3E1SA 1SXJA 5FL3A 4DEXA 2Z4SA 2QPTA 1EXMA 4LRWA 1E9FA 1KOFA 4Z8XA 2A5YB 1GTVA 1Z07A 3MJRA 4BQSA 4CEJA 2IF0A 1F20A 1VPLA 4DDVA 2R2AA 4HDOB 2GJ8A 3GQBA 1E2FA 3QKTA 2IYUA 2GILA 1CIPA 4FCWA 3TVDA 2RGBA 2ZYVX 3LVBA 1QHNA 2GJ9A 1FNNA 1JJVA 1YJ5A 2YWHA 1WRBA 3AVTA 3V4FA 4XSHA 2VP4A 4HB2A 3OJXA 2EFHB 1D2MA 4IXMA 3FPKA 1T3SA 4MRSA 2QP4A 1E1QA 3F5FA 1KDRA 4W5HA 2FF7A 3GJ8A 2AWOA 4QBFA 3SBDA 4TMKA 2R6GA 5G40A 3IEVA 4YMWA 1X6VA 4BFWA 1FP7A 1KI7A 1OXVA 1M34E 4A0GA 3GFOA 4MYHA 1E9SA 1F48A 4ZPXA 1Z2AA 5TB5A 1QZXA 4V02A 4G1BA 2W6JD 4Q02A 4GZMA 1J90A 1W5SA 1YZTA 2HJVA 1KDTA 2ZJOA 2HLDD 2ERXA 1N6IA 1KI6A 5FI0B 4A6PA 1G8PA 5KPJA 4IFBA 4Q5IA 1E9CA 5M04A 2ZRNA 2VF8A 3TSZA 1NSTA 1GKIA 4ASUD 1D1NA 2VQSA 3P32A 3A58B 5AN9A 1Y63A 2IYVA 3K70C 3KQHA 4AKIA 1TQ4A 4NHOA 1SVMA 2CHVA 4IXNA 4NCIA 1GL6A 1ZMXA 3CKLA 1SM4A 1CKEA 4PC1A 3L2OB 1E96A 1E69A 3MLEA 2EIXA 4WAUA 2QEXB 3DZ8A 4BFUA 4MGKR 2XXAA 4LJ5A 1R8QA 1OH6A 3CONA 4O2RA 1E0SA 4B3XA 2GRJA 1NI3A 3SC3A 1Z6TA 2ZRLA 4EFMA 2WBLC 1NMZA 4DSUA 2CE2X 4KSCA 3EPHA 4AY2A 2D74A 4UJ3A 3MWKA 1Z6AA 4ZDWA 3BWDD 1G5RA 3F8TA 5DN6D 1AKYA 1H8HA 2G1JA 3A1WA 2JDID 1YZGA 1TF7A 5FTNA 4NYMR 2NZ8A 2WJGA 1E62A 5E7MA 3C4JA 2QRNA 2J5XA 2NQ2C 3I3SR 4NCHA 4UKDA 3OEED 4A2WA 4QJ4A 5B30A 1N6PA 2PJZA 3THYA 2O8FA 3J81k 2ATXA 2FDCA 1E2HA 2FSGA 1VG1A 4P3YA 1AN0A 1YJNB 2ZU6A 4MGZR 3SZRA 3ZBUA 3I4LA 2CK3D 1JB1A 1COWD 2X2EA 2IC5A 4M21A 5SZHB 1KMHB 4LJ6A 1FPMA 1D5CA 4CZ2A 3B6EA 4RD2A 1CU1A 3Q3JB 5AJXA 3AP1A 5HE8A 2XSZA 4C3ZA 4MRNA 1AA9A 4JSTA 2Q9AA 4A36A 4G1UC 2GCOA 2GJAA 4EQ6B 5FTMA 1CRQA 4DXAA 1FOEB 1AKEA 3DOFA 4PAMA 3O8DA 1MO6A 4NCNA 1OH5A 1NBME 1WB9A 1W4AA 1EP3B 4PQYA 4QOSA 3AEZA 1FFHA 2Y8EA 1SULA 4MA4A 5GJBA 4RZXA 1OKKA 5JJIA 1Z6YA 1UF9A 3H84A 3WMGA 4B43A 4WVFA 2LKCA 1LW7A 4M53A 2PL3A 4PO1A 3TNFA 4LHZA 1IY0A 2BEJA 3CXCB 2QMUA 4M1OA 4P4SB 5A5GA 1CNEA 4V0KA 2V6IA 2CLCX 1VHLA 3AP2A 1KNQA 1N5JA 5LD2C 4US2R 3BAFA 2UZ3A 1IQPA 2F43B 2BDTA 2WJHA 1S2MA 1VYVA 4FXPA 3EA0A 2QTZA 4IEEA 4RZ3A 3U7GA 1X1RA 4GI7A 4LJ8A 5AUQA 1XTRA 2BGJA 2ODWA 4YAOA 2RGCA 3PXGA 2WZQA 4OK3A 5J5CA 4PSAA 3C14C 5EUMA 4P4SA 1BO6A 2GZDA 2TMKA 4L9WA 2IYRA 2IEZA 3GLHA 3PR1A 3TBKA 1KY3A 2IS4A 5JRZA 2OFXA 1ZCBA 1YI2B 1XEXB 2RGDA 5FOWA 3QKSB 2GXQA 3HDTA 2GQFA 3SHFA 3TSWA 4PHGA 1YZLA 3QKUA 5DI3A 2WPDA 1G7RA 4FMCB 2WJVA 3HU2A 1HTWA 5FOUA 3B8HA 3A1TA 1CJMA 1NSFA 4TMXA 1FQJA 2BMFA 1H8EA 2ZQ5A 3CRMA 3LH5A 3QVVA 3CX7A 3LNCA 5FOSA 1W2GA 3A37A 2BC9A 2EWWA 2QE7A 4HB4A 2NGRA 3VNUA 1US8B 4P33A 3VHLB 2QSZA 4DCNA 3NG1A 3K70B 4Q00A 4V0ME 3ASYA 2VNIA 2JLSA 2WSSD 2CL7X 1DG1G 2IT1A 2ZRHA 4HAUA 1MRNA 1V43A 5FUXA 4BWYA 3UKDA 2QRZA 3RS4A 5LB2A 2WJJA 3X1ZA 3VNVA 221PA 1UEIA 1KZGB 1W0KD 3AF0A 4MKIA 3D6TB 4PPFA 2V54A 2IYWA 3ZZTA 1EFHA 1M6NA 1XMSA 3CO5A 4YMSA 2BKUA 5FUVA 4NYJR 4C43A 4EAQA 1WBBA 3FKQA 2IWRA 1RRPA 4M9SA 1DELA 4M9QA 2EQBA 3M6AA 1KC8D 4LCBA 3JVUA 1BS1A 5AJZA 4MDFA 4KITB
chains in the Genus database with same CATH superfamily
2JAXA 5LYJF 3VPCA 1PQWA 3PGLA 3ROMA 2GM9A 4HADA 1L4EA 2AHOA 1T2EA 4IHJA 3LVRE 4ZYZA 2G6TA 1VPDA 2FSPA 2Q1XA 4IH1A 3V9AA 1YZVA 2EZ8A 4RDIA 2W6CX 1UKBA 3ZUPA 3X43A 2IUTA 1YMVA 1YQQA 2EL7A 2YJTD 3ABSB 2AK2A 3O1LA 5FCDA 4KO1S 2C03A 4FNOA 1XNJA 3HB7A 5C0OE 3AINA 1T0IA 4F4HA 4G7WA 2AN1A 1NBIA 2OEPA 3JYPA 4WGFA 1O0BA 3RRZA 1EIWA 4FDAA 3WB1A 2E18A 4JC4A 1OFIA 1OAOA 1QH8B 2IKSA 3DHEA 3OQIB 4N0PA 4YS6A 5TS3A 1TUGA 4HHEA 2AR9A 1YHNA 2WU1A 2Q0SA 2DG2A 1RWVA 3K1JA 1JEQB 1UODA 2XGJA 3WMFA 1N6RA 4MR8A 2ZSIA 4MW9A 3TG8A 2D8AA 3LF1A 1ONSA 2FWIA 3QLVA 1VCOA 3OPYB 4AMBA 4G23A 4GI1A 3VPAA 3NJ8A 4PC2A 3CT4A 3D5EA 3PUJA 2VHTA 4M7OA 5KNDH 3JD4A 3OEEA 1BG6A 3BSSA 1M0WA 4P4UA 1IXKA 1LA2A 3K0EA 4WESA 4U6SA 3CIFA 4OGWA 4TKVB 4UHBA 2VSNA 4JJKA 1EX7A 2D2VA 2JNWA 3H7IA 4HSEA 3Q3EA 4KV9A 4TV9B 4FZRA 3PA1A 3DA8A 4NBUA 5HYVA 2JFYA 2EU8A 5DYWA 5E38A 3KOXA 1PQYA 4TLAA 1XAGA 4EHLA 1CULC 1TVCA 2A30A 2J3EA 3EXIA 2Y6VA 3DV0A 5G0SA 1MJHA 3ZWAA 3MERA 2HRCA 9MHTA 3HEMA 1DAGA 4U9HS 1Z26A 5DVZA 3R74A 2AMFA 2QZJA 4H16A 2PMEA 2A1UB 3RBAA 3AU9A 1LPSA 3RC9A 5BSGA 5HM6A 4NBTA 4BLTA 4CL2A 4PSUA 2DFDA 4PIPA 5CLIA 1U7OA 5A2GA 4D9NA 3IBSA 3GIRA 1RXCA 4OXXA 3NHAA 3UM9A 4JJFA 4B45A 4NCJA 1C3EA 2QENA 3OTIA 4KQHA 4GX2A 5K8VA 4PFJA 1E9RA 1MW9X 1P5RA 2B35A 1FTGA 2BWJA 3PFBA 4MJXA 5TVKA 4R40A 2HX1A 3GB9A 4BB9A 5CBPA 4MVJF 2XMCA 3LX8A 2EC5A 4D45A 1GU7A 1Z2CA 2WSLA 3JQBC 4X9XA 4HQOA 4GYYA 1JU9A 5BN3B 4IX1A 1N5RA 2ATVA 3U6KA 4PFKA 2VF5X 4V1CI 2VNKA 3NCHA 3T3HA 2R00A 3JQEA 2AG5A 2JFWA 5C51B 2EFDB 1M6YA 1Q57A 1RWOA 2GMWA 1I33A 3H5NA 3KL4A 4ID9A 4OK5A 3VHQA 3A6GA 1ISPA 3I52A 4OQLA 1FS5A 1QCCA 5JNTA 3KPJA 5FUWA 2IDJA 1CHDA 1PWEA 4HX5A 3GP3A 4MIEA 4INAA 5IEJA 3K8OE 1KQGA 2H1SA 3RS8A 4ZAXA 5BW6B 3PQ6A 2DFTA 1Q7CA 2ZRCA 3DP7A 3PTLA 1GNLA 3AU8A 1LX6A 1E4EA 4H08A 3TZBA 3BRQA 3ORHA 4DEYA 4EOGA 5I9IA 3FYUC 3SVLA 1EFRA 3U2QA 3C5HA 4LBWA 2BKLA 1U3GA 2B4AA 3EK2A 5K6TA 2PMBA 3OFSA 1E64A 2R8BA 1TW3A 5EJ9A 3K9WA 4U02A 3ZDQA 3PHHA 3Q9UA 2FH5B 2FJPA 2FRXA 2VDWB 4ATNA 3H9QA 1ZLYA 4MW4A 2IXTA 2OBRA 1Y6RA 2HMUA 2WVAA 2X2OA 3OCWA 4HE5A 4TROA 3SMVA 3I01M 1TYEB 2R1VA 2HRBA 3D02A 3OPYI 4YV2A 3O4GA 4WN9A 2FWAA 1I4DD 4ZAVA 4XASA 4D8XA 1Q0QA 1KSJA 1TQ6A 4B32A 1ZM4A 1KHTA 3KFVA 4X90A 1RIIA 5E8RA 2B99A 1PGOA 3L4EA 3QE4A 3U13A 3KALA 4E1VA 5JCOC 3BD9A 2ZTVA 5TPZD 1W46A 1Y8RB 1SVWA 3BL5A 3LDAA 4QDXA 1NV8A 3UV6A 4DRXA 2FHPA 3OICA 5JMPA 4B0OA 2W98A 4BU1A 5G3ZA 3R0ZA 3QZUA 4ND7A 4RPGA 1U0NA 4UNRA 1YRQA 3LCCA 1HLGA 2LZJA 2OTJB 2PTGA 4OL0A 4AZVA 2PPLA 1Z5ZA 5DW3A 1KYWA 1VDZA 4RF4A 5EQJB 3HRHA 3RU2A 4V0SA 5KVSA 2IEAA 4WN3A 5DCLA 4WXYB 2O7NA 4TMFA 1OFTA 4HLDA 1CEXA 3RYHA 3SKXA 2ZJ8A 3KLBA 3RAEC 4TGLA 5J59A 4JMQA 5JSFA 5CPBA 3CRQA 1UBLS 4KR2A 4M1KA 2WAXA 1DBIA 2BF7A 2GNPA 1G60A 1KOJA 1O94A 1VBMA 2B4RO 2GYWA 4S2EA 2RH9B 2W6NA 2PRKA 3HJNA 4KFRA 2FPIA 2V31A 4WZAE 4PANA 1CZNA 4DM7A 1M66A 4JIGA 3PFCA 2IY8A 1LJLA 3N74A 1C9JA 2X9GA 2CLKB 3I2JA 3LVFO 4D57A 3QG5A 5T8KA 3UV3A 4H3SA 4C29A 4TZ0A 1E4EB 1PQPA 2R62A 3E4DA 4G65A 5LQDA 2H2IA 1WW3A 2PGOA 2DRIA 4JIMA 3G0BA 3OE5A 1PL8A 2ZSHA 1XTVA 2JBWA 5TDHA 3ULKA 3Q39A 1OWPA 4ZVLA 2A4MA 1WW2A 3GJ6A 2PUAA 3T9AA 2VSOA 2HYDA 1Q9SA 2D0OB 3LLVA 4U6QA 4HAXA 4JI8B 1AX9A 3O8BA 3OJWA 1JDBB 2HMSA 4GX0A 5ESDA 3OM8A 4LXIA 3IEPA 2HRZA 3PGVA 4Q3CA 1N2JA 1DE0A 3O31A 5AJWA 3R6KA 2ZSAA 4CM6A 4TLMB 4KWEA 2XUAA 3F71A 5ILOA 1ULBA 3ISJA 5CHEA 3OKXA 3GCZA 1NVEA 3QJGA 5ICEA 3B51X 2EDCA 3ZY5A 2B94A 3AFIA 2ZTLA 3CLTD 2IYFA 1GRCA 2DPLA 2O7VA 2XT6A 1OWLA 2H31A 4BMXA 2O8VA 1E6CA 4WXPA 4RCZA 2OA0A 3DZKA 4EJSC 4BV3A 4IV8A 1IQ0A 1K97A 5GINE 4ZJPA 1KKLA 2X3UA 2O2IA 4DVGA 2H2AA 4CW7A 2Q0QA 3IE0A 4LEIA 4UBMA 1KS2A 4CM4B 5FOTA 5KAPA 1E2EA 2VK1A 4POOA 1MTZA 4GFDA 5DMXA 1KSHA 1PR0A 3QOWA 5BSXA 4JLAA 4OB8A 2C2BA 2ORVA 1GXSA 1TAQA 3FZYA 3G0GA 4FHEA 1OLXA 3TX6A 4D26A 1QGOA 3U4MA 3T5MA 2BL4A 5BNZA 1S0UA 1AGPA 3U4DA 3IR6A 3DFUA 4WK4B 3FOZA 4AZ3B 2D1QA 4ADSG 2ZSBA 5IM4F 4ENWA 3H1AA 4CHGA 3WYFA 1UC4B 2VAPA 3YASA 2DWCA 3ZX5A 2YXPX 1MB4A 2QXYA 1Q3HA 3Q6QA 3W7BA 2ZG6A 4FONA 4ETMA 4MV6A 3ZWDA 2WAOA 2IHNA 1JEQA 3PD7A 4A4DA 1XPRA 1IG3A 4MHOA 3BY1A 1E9AA 1R8JA 4J0KA 2HSWA 3ZCUA 1YQEA 3G7NA 3L0YA 2FPPA 3ZS8A 3LBIA 3E61A 3KV1A 3KV3O 2D5IA 2VJKA 5GJWC 1ECLA 4WKCA 1WUKS 1ISJA 4KXNA 5AVSA 2WJ3A 4M46A 4EGCB 3QRWA 4JBYA 4JC0A 2F64A 4B31A 2DSTA 2HNKA 1BFDA 4P08A 2J7PA 3TXAA 2KX7A 4JJ4A 3CUVA 5C3MA 2JIZD 2JJ2A 2WFAA 4KO2S 4YIHA 3A06A 5CU7A 1OAOC 1B3RA 2HCBA 3VZCA 4KQWA 1W581 1KAQA 3ML1A 4MB0A 4OFBA 4MGHA 3V55A 4C2AA 4GVXA 5SYNA 4C3OB 1HT1E 5FWDA 5A2QA 4WA7A 4PYOA 3QXHA 5CB4F 1FDIA 1U9JA 2NLOA 4WBNB 4JL5A 4Q9JA 1GAQA 3D6HA 2IYZA 1C7JA 5EMMA 3N8KA 4LIPD 821PA 3GJ5A 3LGXA 2CMFA 2BGGA 5JFGA 2OBBA 1GUYA 2PSDA 1NOJA 4DWWA 2C1XA 3HCNA 3P27A 5IYQA 2I6SA 1Q83A 2CJPA 1CDOA 2RAFA 2QA4B 4L7VA 3Q8XB 1KORA 2RIPA 3DE5X 4ZI2A 1TTQB 4WKNA 1T25A 2A0KA 3FPSA 4ZC8A 4DNXA 5KNLA 1J8MF 1U3FA 1UOOA 4CLEA 1W47A 2RI6A 1P75A 1NUAA 5E4JA 3SF8A 4BXOB 2GJ4A 4XPIA 4WESB 4R9NA 1T10A 3EXG2 2BI8A 2ZSJA 1G16A 1T8YA 1SHJA 4E6EA 5BV7A 4JQCA 4X8LA 4YGYA 4B7UA 2RGEA 1MW8X 3LP5A 1A5TA 4J1QA 1NNEA 1XLUA 4UHFA 2OG2A 3DAYA 3G5UA 5JO9A 4PZUA 4KDCA 4JWKA 3T7JA 1M2VB 1YL6A 1ULHA 2Y68A 3C7KA 3KFXA 3AJAA 1YZYA 2OBXA 1MT0A 2OD7A 1DEOA 3OE4A 4R3NA 1YRBA 1GSOA 1E5LA 2EOAA 3AVWA 2FUEA 1VMDA 4A82A 4B9EA 5ALZA 4EA8A 9ABPA 1N1DA 4BO1A 4N0MA 2PZFA 3EXFA 3GFTA 3NRCA 2HMAA 4FTWA 5TVGA 1E3LA 4AP9A 2F48A 2ZS8A 1CPYA 3MB8A 4YJ3B 4HAVA 1GNRA 1PJ8A 2ZITA 2AQHA 4P81A 5AW8A 3HYLA 5LP1A 1BCSA 2YL2A 2C5AA 3VPFA 1N0HA 3JVDA 2FVGA 2DKFA 4Q3AA 1DAFA 2PH1A 3CW2A 4JUAA 1TK3A 1U3DA 3LDUA 2ST1A 3F2IA 5IASA 4MK4A 1G18A 4G5QA 1WUHS 1VQ9B 4UHHA 2X22A 4JR2A 5JVDF 3GLFA 4BAZA 1WDLA 2IEDA 4OHWA 3BSFA 2GHTA 3FOCA 5JAZA 4LPSA 3ZQJA 3WC4A 1XZMA 1R16A 1F06A 3ED5A 1L1FA 5MDHA 3AR3A 1LSOA 2HWKA 5HPYB 1FP4A 1VHTA 1H85A 3C5EA 2YVUA 1A7KA 2QUZA 3W7VA 1PUIA 4FMDF 3ORRA 5EKSA 1VMKA 4ZA2A 2Q9CA 2OHFA 4ZIRA 1T6YA 1Z15A 2RGYA 1MOPA 6ABPA 3OWHA 5G4LA 1AKNA 4DLZA 3T7EA 3PWTA 3D3WB 4QFCA 2V7VA 2ZRGA 3RFTA 4A03A 1C7RA 4EHAA 5BNWA 3THXA 3TRJA 2C3MA 1IIBA 4MV0A 5GONF 3USZA 1Z25A 2VWQA 3VU9B 3Q3VA 3Q3IA 1C1XA 3KWFA 3N0TA 4QPPA 5HQJA 3NHYA 1A4UA 1PWZA 4H0FA 4I19A 4M7PA 3EEYA 2Z09A 4RV4A 5IF9A 2CD7A 2LXNA 1QQ6A 2P0YA 4FDTA 4R81A 5EJFA 2CFOA 4YT5A 1QG6A 1WX1A 2Q5LA 3LYLA 1N08A 1EQAA 4QUKA 4M88A 2QVGA 2B0JA 1NF9A 2C0CA 1F4VA 3D26A 1WM1A 2VUHB 4OEHA 1T3LA 1Y6JA 5EZYA 3FETA 2O8BB 3RQSA 4E2ZA 2NXCA 3CLSC 3HB1A 4RK6A 4IX9A 2O8CB 1SBIA 3I01A 4XW2A 2FYTA 2Z3VA 1Y8CA 1IBKB 2A7QA 3RLFA 5CA0F 2F1JA 4KQKA 5FULA 2RGRA 5KTNA 1QLHA 4AC9A 3AIMA 1BWPA 4U7TB 3BFVA 5GJVC 4IUCS 1M67A 3B5IA 3EFOA 3Q6NA 4HJRA 1DJQA 1GV0A 1P2FA 1EP9A 3FPPA 1TMKA 4MUIA 3D4PA 3P2EA 3TIXB 4F45A 3ZHSA 3N2IA 1W93A 1RI1A 3LPMA 1MQ9A 1FLAA 3OMXA 4F0JA 3V4RA 1NZFA 1SQ6A 1K63A 2ZS9A 1M72A 1G8SA 2QLTA 4JQYA 5GWXA 4QLBA 1FSPA 3M1YA 2O5VA 2E2WA 2DEUA 1DBSA 3KS9A 5LIPA 3R0VA 4BAGA 4TTAA 4E2WA 4CIYA 1X77A 4DB2A 4FWTA 2AMVA 2C7BA 2RHDA 4N8DA 2BGTA 1LQ2A 1NWHA 2BUCA 1QOZA 2O4CA 1BHQ1 2H1CA 3CX6A 1K5HA 3BL8A 3GLQA 2VJDA 2F3TA 3KYCA 4GUAA 1NYQA 1SKYE 1P2BA 1WCWA 1YTLA 1GQRA 3Q88A 4KC0A 4L4UA 4Q66C 1C3VA 5TSDA 4KAXA 4X3PA 3RC7A 4H1UA 4TMVA 3WWYA 3VR5D 1QVRA 2G80A 3LBYA 2B4TO 3L8GA 2UYHA 3V6LA 1D2HA 4GRDA 5JXWA 2JJ2D 4RM3A 3HBNA 4TMTA 1VQ8B 3I8OA 4PCAA 4PPQA 4AQDA 3VJMA 4WXHA 2ENUA 3PGXA 2FJ0A 3IR5A 4M4SA 3CZPA 5FEUA 1SKAA 1U4NA 1XCBA 3HZZA 5DNUA 1DAMA 1U65A 5BSEA 2H2FA 1A8HA 1XNGA 1Z33A 3GOQA 4I9UA 1U3WA 5KAMA 1MJFA 1NVFA 1EVJA 1KJNA 3FYSA 3BHJA 2JZNA 5DRYA 2GQ0A 3IKVA 3CN7A 3VR5H 4JP1A 4PYJA 3G6EB 2FLVA 2NTNA 2A6PA 2ODBA 5JCJA 4ZEOA 1JF8A 1P7CA 4WI1A 4AFNA 3ZKAA 4HGRA 3AI7A 2VWGA 3RTAA 3S6JA 1ZJWA 1N2CE 2FF5A 3ZHVA 4UM8B 5A0FA 2Q5HA 3WYCA 1PG0A 4ERXA 4UUNA 5HZGA 2UV8A 1MR3F 2FR0A 2HXYA 4JLVA 4MLDA 4S1TA 5D51S 1SELA 1GKYA 5D84A 4EG5A 1XAJA 5F9MA 5BSMA 2DPGA 1DKPA 4D81A 1EE1A 3BFKA 3VYUB 3TFOA 3RAFC 3A10A 1FTNA 2NU8B 3L9XA 4GLBA 3B3GA 1P9RA 4EF6A 1OYOA 5G0WA 4DIEA 3PJFA 3OCCA 3AR5A 2CWWA 1VBNA 3FPAA 2UDPA 2ZR0A 3W2GA 4AF7A 1FDOA 1FNBA 1D4ZA 3OCUA 2BEUA 1Z5UA 2GXUA 4BLPA 1JNXX 3WTBA 1PDWA 1YMUA 3UMSA 1FP6A 5BN1A 2XOEA 5EHZA 4EI2A 3ZGZA 1B8OA 4RD4A 3SYTA 4MAFA 1WQ1R 5IYRA 3LCUA 1G38A 3X1MA 4OP2A 3JZFA 3OW7A 3R5KA 1V96A 1YZFA 4RMHA 3VDXA 1ODLA 1N0IA 4CLDA 3TCKA 1UBHS 3HCOA 5LKRA 3EIHA 1IZYA 2X4LA 3VU1A 3CNQS 5JI3E 2B4YA 4YV1A 1QC5A 1FDRA 4P6YA 2PXCA 3KJIA 4YRTA 3IUBA 1VLOA 3UEOA 5DASA 5GM2A 1U28A 3KE8A 3CG4A 4E5MA 2Q3EA 1K8RA 1O7JA 2H92A 3AF3A 2Z8YA 4B74A 4WA8A 3UHFA 4CMAA 5IH3A 2UZIR 1AMOA 1ZU4A 1JH9A 3FLBA 3N58A 3M6FA 2JGMA 2VHVA 3B9BA 3I9FA 4OHKA 4X1IB 4JGIA 3PKIA 3UMVA 4AUMA 1JIXA 4PBRA 5CVVA 3TRKA 4Q4CA 4HG2A 2FZVA 3G9UA 1ORDA 3L7NA 1CG6A 3E22A 4BX3A 3OESA 1UDXA 2Y0PA 4MVCA 5DHAA 4W1QA 6ADHA 4JX8A 4MWZA 4UM7A 1E2LA 1KA9H 2IQIA 3E20A 1K4MA 2QNRA 2QQEA 3WIDA 3QX9A 5IJWA 3IP8A 1N5DA 2V4ZA 4OFWA 1XJ0A 3DKIA 1T5IA 3H4IA 4GS5A 2CXHA 1EA7A 1UDAA 4ARIA 4XLHA 1IBRA 2X4DA 3AJDA 4GX1A 5EIHA 4D5EA 1SOVA 1F1BA 3LL7A 1T5DX 2C88A 2GO1A 5LDDC 1NE7A 3B3QA 1A97A 1NLFA 4RHEA 4UNPA 4ZREA 1MC1A 1XUOA 5FHRA 5EIFA 3QWFA 2ADOA 4Q4HA 5EI5A 2BBTA 3TM5A 3BUSA 3GGJA 2HU7A 2OQVA 2AQ8A 3USES 4CIXA 2CF5A 3MWJA 4NMLA 1DTWA 3FMFA 3NHPA 5EN4A 4IHJB 2VT2A 1F14A 1MC5A 1YBFA 3GZTB 1FRZA 3FWHA 1DARA 1GAWA 1GGVA 2R65A 2VP2A 3OA0A 5ER6A 2RGNA 3BF8A 4AKHA 2VJAA 4XE5A 2A9RA 2WE8A 2Q5FA 3D3NA 4P3KA 4Z9XA 3RBZA 2Q1UA 3RJMA 2VP3A 3ZWWA 1T1EA 1PT6A 1ZJYA 1LPPA 1KVSA 1SWWA 3MSCA 1JIIA 3UJ3X 1TAUA 1ZJ5A 4CKBB 1E5XA 2C84A 4MHSA 4YP1A 2E4ZA 3K8ZA 4AY4A 1GPAA 2X4GA 4EZBA 3NH6A 1VPTA 4P5EA 2J6HA 4ZU3A 4COOA 3UBTA 3H9BA 4RHUA 4WNAB 3CMCO 2BM0A 4TSFA 3PXXA 4FX2A 4PGFA 5AR1A 1KSFX 5FL7A 3ESBA 3SS8A 5COQA 3EFEA 3QE9Y 4QARA 1B6TA 2YR0A 1AGNA 3GLUA 2VBSA 3GFPA 1SY7A 1PEKE 5DM4A 5FKJA 5SICE 1GPBA 5C2JB 5KWSA 5YASA 4M3NA 2GUWA 1ZVKA 1UBEA 1YI8A 2Q0HA 2ZRDA 4JMPA 1OHHA 4PX3A 5T4EA 1NASA 1BSVA 2Z6VA 3IEIA 2N3ZA 4JJ6A 4CMEC 2ECFA 4ES6A 2WD7B 4JDUA 3MWDA 2D2XA 1CIJA 2GOYA 4XTCS 3GJ0A 1JSCA 3ZWCA 3I6ZA 3OF2A 1DWUA 1T5BA 2LDBA 2OV8A 3KLOA 4UUPA 3QPCA 1PYOA 3O74A 2VPPA 4D8VA 4AICA 3OLXA 5IJZA 5BSUA 1HL3A 3GRPA 3JSXA 3TMYA 4FUQA 4D3YA 4QOHA 1F0NA 5AI6A 5E6SB 3KUCA 3N76A 2X5OA 2H08A 4AG3A 3GVKA 4INJA 3RVBA 4E4YA 2B25A 2GXSA 1NHGA 4KUEA 4XKJA 3ZCTA 3R8FA 1EX6A 2IX9A 4NBWA 5HKKD 2OKGA 1YR1A 1M2JA 2UVPB 3G82C 2WHXA 1EB8A 2XZTA 3PVCA 2TYSB 4PHHA 2XCTB 3HSKA 4AECA 1JFLA 2GKGA 4KXFB 4TL6A 1XZQA 3OUZA 1DC8A 3OPVA 3HN7A 4LZLA 3WMEA 3KQPA 2IS6A 1M5TA 1PJLA 1IUNA 4N8SA 5CA0A 2JIPA 4LHSA 4KFTA 4RLFA 4EX6A 3K1TA 4Q3OA 2WTNA 3DBVO 3T1QA 2A3RA 2HLDA 4XLFA 1TFRA 4Q4AB 4XXHA 1K8AD 3L18A 4DJEC 3S1SA 3DW3X 3FGOA 4TYYA 4QFBA 2OY0A 4BGUA 5A7FA 1L5MA 1KMHA 1A98A 4WXEA 1BMFD 1OX6A 1GGKA 2NXEA 1R5JA 2PANA 2P9FA 3RSHA 4HZUB 3D2BA 5F3WB 3H9JA 1MAVA 4CTMA 2BKVA 2CDAA 3B38A 1G1MA 1YZUA 2J5QA 2CBZA 3HV2A 1L9KA 2YOHA 3DBRA 3QF4A 4IG4A 1V8BA 2WUVA 4TWRA 2XEXA 4Q9IA 4O4IB 1W5EA 4H60A 4LY9A 1BHO1 2Q28A 4FBMA 1DTSA 4DJ5X 3CQ9A 3OT5A 4J43A 3TLCA 2NTVA 1B42A 4DJJA 1L5LA 1MDFA 1I9GA 1V16A 2I7VA 4XJTA 3KK0A 4RFVA 3WOVA 1NMXA 1TE2A 2P9EA 2PS3A 2R6FA 3MYYA 4EUSA 3GNLA 2VT3A 2ZDHA 1PTJA 3B6MA 1L2TA 3OLQA 3S44A 1KZYC 1T6BY 3WB0A 2JANA 1GG9A 2O0HA 4FZ5A 4TLEA 5L3ZA 3AM1A 3CCUB 1XA4A 3LXMA 3QG1A 2CHQA 2VZLA 4C5BA 5C34B 1EJ0A 1Z8FA 2PRYA 1OZFA 1I4OA 5E2AA 2DZDA 1QDUA 4ARZB 3E9NA 2OGUA 2JFXA 1AK2A 3DZDA 3NHLA 5GPBA 3ZWYA 2DF8A 4OYLA 2RBKA 4R8KA 4DBLC 2YN2A 5EVJA 3ZEIA 3ONUA 2Q3CA 2C57A 2P4HX 4LC1A 5KVAA 1CYEA 2ZRAA 4LISA 3WNDA 1HFKA 1HT2E 1XZKA 2Q5IA 3CH5A 3CNNA 3IQFA 3NHUA 4D44A 1EESA 3LC2O 2I6GA 1DJOA 2ETVA 4YNBA 2QI9F 3WLRA 4MEAA 2OR3A 1BGXT 2ZAOA 4OI2A 4PHFA 4NOKA 4FMDB 4LNUB 4P82A 2OXTA 1ESNA 1SRQA 2FB9A 4LVNA 1FDVA 3UKJA 2BGUA 5D7NA 4AZ0A 4TZ6A 1GZUA 1D09A 1SEVA 4EHKA 5KQRA 3BTSA 5TEWA 3BH4A 1E0KA 3BHIA 3NTXA 4ZVOA 5JFOA 4JC8A 3KNZA 4H6VA 1NM5A 5HX7A 1X0VA 1HE8B 4ZTBA 3HKCB 4ZV7A 1EVLA 3C3BA 5MN4A 1NA5A 4O29A 5HFNA 3LUFA 3EUAA 3QBEA 5HOEA 1GTL1 1YI0A 3OHPA 1M3SA 2XTMA 4PBSA 2DHEA 2H4XA 4GR9A 4B40A 3REQB 4KMOA 4KSYA 3A6KA 5IEBA 3UN1A 4RIEA 5CD1A 1VLJA 4I1IA 1BJRE 4MARA 4BNKA 4OPOA 2WSSA 3IMEA 3VUFA 4CDRA 2BPOA 1KAEA 1CR4A 1OTYA 1LH0A 1R3UA 4KX5A 4NPCA 4MEJA 3AM3A 3L7BA 5ALGA 1FP1D 4RVNA 1TTTA 2Q4EA 4N3BA 4F4IA 1ABBA 1V7PC 1XDUA 2WT9A 1GQ2A 1G21A 1E63A 1OWNA 3LRPA 4JXJA 4XSVA 3C4QA 3IIMA 3QI2A 4JQOA 3ZE6A 5BMOA 1XCGB 5LD2B 3STVA 1KJQA 3TW8B 1CY8A 3A1VA 5EHGA 1T2UA 3HS3A 3VR2A 3L0CA 1LVHA 2DFVA 3P2IA 3F96A 3CCRB 3NT2A 3PITA 2LWIA 4LI3X 3BBPA 4QASA 4U5XA 3Q38A 4D9HA 5LU8A 3COZA 4WOKA 1G55A 5IT4A 4YR7A 2CY0A 2PRIA 1G9SA 2WIBA 2PVCA 4D74A 4E21A 5E3JA 5KSOA 1KC1A 3K73O 2GF9A 2P77A 4NDAA 2POCA 4GSYA 1UPAA 5DGIA 3WLLA 3LT2A 4X8HA 4CMIB 5ILGA 4GE0A 3RYFA 5JDIC 5LNK1 2WQ7A 2BW0A 1LV8A 3IKTA 1XPJA 1ZOOA 4GP6A 4L73A 3RK1A 1PIWA 2E6KA 2BRUC 2WWWA 3IP9A 1ZSYA 4FD2A 4LE2A 5IF3A 2HUPA 2PPVA 5TT1A 4BMVA 3IEXA 5KOYA 1U9CA 2EP8A 1K2VN 4QREA 2B92A 3UCEA 1OB0A 3LYAA 2CUNA 4HXYA 1CCWA 3DH0A 5BVHB 1SVLA 3GFGA 2XUDA 3SIXA 4N3NA 5CM2Z 3AHEA 3G8BA 5FD8A 5BURA 5MN6A 3CCSB 1QHYA 3HJGA 3DOIA 4KNVA 3TTXA 3FWNA 3DYIA 4IDOA 3RNLA 4U0KA 1MV5A 4ALJA 3A27A 1TO1E 2H5EA 1C3LA 3CBGA 4IG9A 3I5YA 3R9KA 3ZVRA 3L82B 1HXHA 4QVJA 1KO7A 2M1XA 2ORYA 1A2QA 3DOOA 3QBDA 4HAZA 2HV9A 3IQZA 3PI6A 3DOHA 4YT4A 1P61B 2F9FA 8ABPA 4QHSA 4W82A 4EI8A 1F7VA 4IKEA 2ZR7A 5ER9A 4RDJA 3WLJA 2V6MA 3ZNQA 3ASPA 1S3SA 4PPYA 4G3XA 1Q95A 4KBGA 5BQ5A 3RBVA 3CVWA 1DKLA 1PUJA 1SXJB 3EMVA 4HFRA 3SZUA 4G01B 2HT1A 1A2OA 5GM1A 4UE3S 1J21A 2CVHA 2X15A 4B6GA 3V80A 1WOOA 2IHTA 2OMKA 4YV7A 2AX4A 4MQ6A 2XCUA 4NP6A 1A9RA 4KQ6A 4F9TA 5JNLA 5TMEA 2KI5A 4QKQA 1HDOA 4E3WA 5BV8A 2M6SA 2JLXA 1OZHA 2AFIB 1F0PA 1X2BA 3KQTA 3L8YA 3O26A 1SURA 2ZR9A 2V7UA 4JUCA 4KEAA 4GC9A 4OY3A 3SQOA 4BCDA 3R77A 1CVIA 4ZT7A 2PFSA 3CP8A 5BNIA 3MJFA 3KQOA 4GPZA 2H8KA 2C4TA 1GN8A 1T1GA 4XD2A 4D46A 4XEHA 3E8MA 3SKYA 1REQA 4C0QC 1L4HA 1M2WA 2AS0A 4FYJA 1RAHA 1P7WA 5AOVA 4J3FA 3T7IA 1RMTA 1IOZA 1Y4SA 1YCGA 5AHKA 4MWSA 4OJTA 5CCBA 3IUJA 1HQYE 3P8ZA 4HMOA 4L6AA 1CK4A 2ZXEA 4I66A 3T4XA 6AT1A 3RVRA 3LUPA 2AXEA 3OCVA 1N6NA 4Q01A 3WFIA 4ESOA 4R0MA 2DLNA 4ZZ2A 4KR0A 4AD8A 2ZBVA 1THMA 1X7XB 1Z6XA 1NX6A 2QL5A 2WUDA 4NH0A 3AVXA 5DMHA 1GZ3A 1PJTA 3B2QA 4I3FA 4Z9AA 2XNCA 5LBTA 4DW8A 4ENTA 3HM9A 1X1QA 4P32A 2QN7A 4C2TA 5CYFA 2BHRA 3REFA 3ROQA 3SNKA 2R8EA 4DA0A 4EJ6A 4AX8A 4TKVA 3OZAA 1QFJA 5IH7A 2ZSUA 1OTHA 2DIEA 4OMFG 1B1CA 3QNUA 3H4TA 5FOXA 1ZUHA 2YW2A 2NO5A 1Z74A 1HKUA 1U9ZA 3IDSA 3K94A 2JCBA 1XYYA 4TZKA 2ZT8A 2ZTGA 3HRIA 3IJEB 1ODSA 2NWQA 4ZOEA 3KLPX 2XV1A 1DCTA 1W88A 3UJCA 3U5TA 3NS7A 4Y2GA 4QXPA 3O75A 1L5GB 1OXTA 1KVQA 5CFNA 3ST7A 2VT7A 4PSVA 4ACAA 2WG2A 2G7MC 5AW7A 5ITVA 5B5SA 4QHYA 5HE9A 4LZOA 2NSYA 5J2TB 1QZZA 1CUXA 4ZVUA 5K3BA 5CB6A 4PZYA 1XTQA 4XKWA 3CINA 1KQ3A 1X7ZB 2BFFA 2VPQA 4O4HA 4PXAA 4PZZA 4YHBA 1WOSA 5JNWA 2D3TA 1A7AA 3BXXA 3H9NA 1UFKA 4HPXB 4NMHA 4E03A 3JAKA 1M76A 3VTKA 3CURA 1II8A 1GZ4A 3EBOA 2BFEB 5IAJA 3DAFA 3D4IA 4AMVA 2P79A 4FJ0A 3BY2A 2JH3A 3LTEA 1KYYA 3NDJA 2H9AA 4GWGA 1J0EA 1UKYA 4JUFA 1AVTA 5B1EA 1M6HA 4RZHA 3RHFA 3HB0A 3LOQA 1HLDA 4G4SO 3ZR4B 2Z08A 3MUNA 1V5FA 5TPWA 1ZVMA 3DHVA 2Z57A 2F1RA 2AN3A 1ST3A 5REQA 3DLHA 1CWUA 2V5VA 5D1NA 4LZWA 1E0AA 2DGDA 2NUTA 4BATA 4GAEA 4EO7A 2Z5GA 5JXJA 4YROA 4UHEA 4CN8A 4DQLA 4P35A 1AQLA 5C4MA 1KQSB 1GADO 3D7LA 3MOGA 3RK4A 2PBZA 2PL5A 4HKTA 4O0MA 1IEQA 2OBSA 1H0HA 5FQOA 1R9JA 1ZH2A 3DHNA 4D96A 2Y99A 3LCMA 4UZSA 3SC4A 1WCIB 3ZDBA 1SZJG 1ID8A 2OCPA 3QGMA 3ENZA 1GU1A 1UKEA 3BJRA 3EZ2A 4LYAA 4XWTA 2W2LA 5ARDA 1RBZA 2B4QA 5HQTA 2JRLA 2R1UA 1TB4A 3MCAA 1C50A 1T3GA 3JU3A 1V4VA 2GLUA 2X6RA 2ONKA 3GLVA 4GOOD 4UEOA 4G0XA 4UDOA 4RDXA 4IP0A 3LQEA 1N8TA 1QGAA 1V5IA 2BD0A 2I1WA 4DG9A 1OZGA 1QWSA 5EIBD 3GT0A 3JCZA 5JCXA 5G1PA 3UH1A 1UBSB 2J9FB 3WJ2A 2VQ3A 3KZCA 2RHRA 4L8YA 1C5KA 1JBQA 2B30A 1RKXA 3OIDA 4BJHB 2C8LA 3KCNA 2BN4A 3SEQA 1QYWA 2IYQA 2ZCVA 3CCVB 1TI7A 2ZAIA 2ZU0C 2ASEA 3W2IA 3E2MA 1XP8A 2I9PA 3I6YA 4BTLA 1VKNA 1BKYA 3ANSA 4JU8A 3U3JA 2O0LA 3M4JA 3EAFA 1RC0A 5LA6F 1GVNB 1NONA 1VTKA 2HU5A 2GCEA 4JSYA 2Z5FA 3QU2A 1A9OA 3HLTA 1Y1TA 1Z4MA 3N39C 3TLKA 2B9VA 1D3AA 2AMJA 1RI3A 2YFQA 1TUIA 5TQ2B 3L7AA 3I6MA 5F1OA 1NOIA 2FP3A 2FPXA 3DM5A 4M0KA 3UHAA 5IJ0A 2GASA 2NADA 1DIAA 3JQCA 1FMFA 2YHUA 4YVFA 2HF2A