5DSZA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
414
structure length
408
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Gamma-subunit of the translation initiation factor 2 from S. solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 91
structure length 408
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5dszA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5dszA01
4DT1B 1TMKA 4XSGA 3REFA 4OI4A 1G3MA 4O3MA 2O0KA 4V03A 3V00A 5J4LA 2A7QA 3X2SA 3X1DA 4TYNA 1FRQA 2QNRA 2WM9B 1M90D 3WMEA 1TL7C 4X8MA 3U44A 1V43A 2O8CB 2DFTA 4LHZA 4Q03A 3LX5A 4Z8XA 1SHKA 4DSUA 1IHUA 3GLHA 1E3MA 3N5CA 1HA3A 3B6EA 4RZXA 1M74A 1AGRA 4E07A 2ODWA 1N5KA 4HAVA 3OIYA 2WJYA 1XMJA 3IIKA 1IXSB 1J9ZA 2ORVA 4NCHA 3B7GA 3WY9A 1O87A 3Q72A 2QBYB 2R62A 4NZYA 4Q48A 5CB8A 3ZD6A 1P3JA 4C0LA 5H59A 1E0SA 3H2YA 1OB5A 3ADKA 2O8BB 2XXAB 1N6KA 3OHMA 3R7WB 3NWJA 2ZRPA 3T34A 5IT5A 2HXSA 3CX7A 1YZUA 2VNJA 1DO0A 3QPWA 1KK1A 1KMQA 4TLBA 4BPBA 3ADDA 2ZU6A 1QHHB 2Y8EA 3ND9A 5TY0A 1Q3HA 3G0HA 3QE0A 4AK9A 2OFOA 3P4XA 3DZ8A 2NOAA 5C4MA 4TQ9A 1V5WA 3CM0A 1ZM4A 2IYZA 4IHQA 1TX4B 2BCGY 4Q21A 4PPFA 2Z83A 3P27A 3NHBA 4BZXA 1DVRA 3NG1A 3V4FA 2GXUA 4JYCA 1LB1B 1CU1A 3GJ7A 2IUTA 3W2GA 2FSHA 4ESHA 3KB2A 5K8TA 1G7SA 2ZI3A 5GVSA 1P2SA 3KX2A 1Q1ZA 3FMOB 3ZS9A 3HP1A 4KITB 2FZ4A 3AF0A 3RDPA 2OT3B 1G4UR 3L8YA 3QVUA 5JI2E 4JVSB 2BJWA 2RGNA 1RKBA 3B85A 1RVDA 5HE9A 3GJ8A 1W36D 3MCAA 3AKEA 1NG9A 1SM4A 2GAAA 3SBEA 4C0KA 3QFTA 1H65A 2QEQA 3VAAA 3O47A 4NYIR 3OJXA 4IEEA 1SVKA 5DE3A 4CT5A 1RW4A 3MRSA 3GFOA 1Y63A 2ZUCA 4KHZA 2B8WA 2AKYA 3UATA 4EFLA 2QAGC 2HUPA 4WXRA 4BEJA 4HLQB 3K8YA 4P4TA 1VQLB 2F9MA 4MKFA 1ZD1A 3PEVA 3QKRA 4KLNA 2OZEA 1BYIA 5FOTA 3DL0A 1J70A 4AF6A 1ONBA 4QM6A 1A8PA 1Q1QA 1UFQA 3M4YA 4RY2A 5DN6A 4N3GA 1OFUX 2C77A 1E1QA 3FB4A 5JECA 3RS3A 2KSQA 4TYPA 2V1XA 1HTWA 5G53C 5FA6A 2DFNA 4ARZB 2DY1A 3OESA 1P6XA 3FFBA 2QGNA 3BWDD 2J87A 4NP6A 3MAAC 2EYQA 3CPJB 2W83A 2LWIA 4Q1DA 4PC6A 2EIXA 2G0TA 3VR6A 3KZ1E 3T1VA 3PUWA 4MITA 1NN1A 3H86A 3RS0A 1AIPA 3KDSE 1KI7A 4X8OA 4F4IA 1GZSA 2AK3A 3A37A 5G3ZA 4PZZA 2O5VA 1E0JA 3LNCA 2OTLB 3CRMA 3EZ6A 4TN1A 4LRWA 3A1SA 1SVOA 5EZ5A 3M6AA 3IQWA 3FMFA 4US2R 2A5GA 3RS7A 4B2IA 3VKHA 1IY0A 1GKIA 3TJZA 3FPKA 3W8RA 4ZI3A 5CYOA 3FHTA 4Q02A 1E9AA 4KI0A 1JA0A 1RJ9A 4G5OA 3UMRA 2FF7A 3TVTA 4PZLA 4GI7A 4Z8YA 4ACAA 1W5SA 1BIFA 4CEJB 1GR1A 1G8PA 3KQLA 2F3TA 1SXJB 2FEMA 3BOSA 5FBWB 4DWJA 2YWHA 3WRYC 1KJYA 3EAQA 4ZGNB 2DR3A 3AKDA 2O0JA 4MQBA 2JJ2D 4MYCA 5FTJA 2BM1A 3LBIA 5HTKA 4BRUA 4TZ0A 1VDZA 4QJ4A 4D6PA 2G6BA 2IW3A 1DELA 1IAQA 3KJEA 2BGJA 1G5TA 2OCYC 3MMPA 1JEDA 3LFUA 4QBFA 2W58A 1GOTA 4DUGD 2EWVA 1N2CE 4XWKA 2CVFA 1VG9B 1LY1A 1RRCA 2IS1A 2CHGA 5F3WB 2J0UA 3OZUA 3QEOA 4HLUC 1E2DA 1YZGA 2L0XA 5E7IA 4OI1A 4F38A 4Q00A 3AP1A 4Q19A 4K1XA 3I32A 3FDIA 3RWOA 3R9IA 3VR4A 4OHYA 4UXJA 4AD8A 1IONA 1E2JA 1N6OA 2SHKA 3KXLA 4QL3A 1CBUA 5DISB 1SKYE 4IVQA 1HT2E 1W48A 3B5JA 5BYJA 2WJHA 3MUFA 2OEPA 5EMNA 2ZI4A 1E2KA 1AN0A 1OIXA 2A2ZA 3C5CA 3QUSA 2JIZD 2IF2A 2OAP1 2IXFA 2VP0A 1R5NA 1GAWA 1GAJA 1X8JA 2V6JA 4ZKDA 1G17A 4JBYA 1XTQA 1LF5A 2VHTA 4YAUA 3QVVA 1TPZA 2MMGA 3NIBA 3E1SA 1XB2A 5KSWB 4MRPA 4JLKA 3ICQB 3M0EA 4MGZR 5L3RA 3SHWA 4LJ5A 1IM2A 1XEFA 2ZYWX 2QQ0A 2WJIA 3HPQA 4URVR 3WYAA 2BBSA 4BWYA 2ORIA 4C7OA 2VP6A 5FUVA 1DPFA 2JLXA 1K5DA 1M1YE 4JLDA 3G82C 2IT1A 3THOA 2JA1A 2QAJA 4Z54A 4B3GA 1U0JA 3MWYW 4JLOA 3SNHA 2CE2X 2PMKA 1NBME 1VQ5B 3KKNA 2JGNA 2ODBA 5EQTA 1WB9A 5EXPA 2RGBA 1UF9A 1II9A 1IN7A 3G4SB 1Z0AA 3UIEA 3I62A 3CCJB 2P5TB 1KI1A 3GJ5A 4U5XA 3WYFA 1ZU4A 3R8FA 1KAGA 2ATVA 3LBHA 1J2JA 3D3QA 1Z6TA 1JXMA 5KHOC 2WKRA 4A15A 5GJBA 1W47A 2IL1A 1NKSA 2WHXA 4HUQB 3L82B 4O2RA 5AJWA 1IJFA 3ZZUA 2FSFA 3W90A 1RE0A 3QBTA 2QDXA 3CRW1 2QE7A 1OYWA 3U7EB 4PHGA 3LVQE 2YWEA 4ILEA 2JLRA 2KWIA 3K9NA 4NH0A 1NBMA 2MSEB 3CCEB 1E9CA 1G1MA 1G9XA 1OFTA 2GCNA 3WRXC 4BEBA 3O8DA 3K0CA 4WXPA 3U3OA 1FL9A 1II8A 3DKVA 1XP8A 3C14C 5BXQC 3RWMB 2FU5C 1YVDA 3W2HA 1T8TA 2AWOA 2J3EA 2J46A 2JJ2A 4WAUA 3RS5A 4II7A 4A36A 4ZDKA 2BVNA 2YZ2A 4OK3A 1DBSA 1EWRA 4GT1A 3QNUA 1TUIA 1QUFA 2ODEA 2FFHA 2VO1A 1U8AA 1R4AA 1GG2A 3BS4A 3Q7PA 2YOGA 1JJ7A 2JLQA 1N6RA 3BFKA 2ZRFA 4FMDF 4DUGA 2FFAA 4RD1A 4TMTA 1TQDA 4IVPA 4KFSA 2ZRGA 2OLKA 3AVUA 1Q12A 4Q1CA 4LHYA 3U60B 3THXB 4LBVA 4RZUA 2D06A 3NH6A 2XAUA 2XZPA 3UPUA 1RPZA 4ZCIA 4TLEA 4B76A 2W2TA 3B78A 5JCPA 1UPTA 5KNBA 2GK6A 1OE0A 2RAPA 2LKDA 5AN9A 3JZAA 3EX7C 4HUQA 4JVMA 3B2EA 4HZIA 3LVRE 2ONJA 4BLQA 1II0A 2HV8A 2JIZA 3OIVA 2CLDX 2QRNA 2C9OA 3GD7A 4FCWA 3K0FB 3DZDA 1OFHA 1G4AE 1UKVY 1SGWA 2ZRDA 1VYTA 3B9QA 1JB1A 1S2MA 3DM9B 2XTZA 4GZMA 5HCNA 4D4JA 4EPTA 4KFUA 1Z6YA 1QGZA 1ZUHA 2GRJA 5KNCA 3DKPA 5LBIA 4Q66C 4H9GA 3FVQA 3RRNA 3PEYA 5SZHB 1OLOA 1CJTC 3GQBA 4ZCMA 1JXOA 1GILA 1EP3B 1ZIOA 1F48A 3IUYA 4H1VA 3NC0C 521PA 1ZVQA 4P6VF 1OJLA 2ZS8A 4XIGS 1GNRA 4DSTA 4HYYA 1YZNA 1K5GA 1N6NA 2V4ZA 1W2BB 4Q4JB 3T5DA 3U61B 2BMDA 3UG7A 3GFTA 2V55B 3QSYA 2PT7A 1CJKC 1HQYE 3KB1A 4XTCS 3UWOA 4PXAA 4D26A 2F1RA 3X1ZA 3W9YA 1Y3AA 1JPNA 2ECKA 2GVZC 1VHLA 2ZJYA 1E2LA 1XE1A 4NCNA 1X86B 1UAAA 1SXJC 2EW1A 1R5BA 5B64A 4QKQA 4NBSA 4A8JA 4RD4A 4PAMA 1WDTA 5FPSA 4EPVA 5H1YA 4ZIRA 5IK2D 5EP4A 4EPWA 4C9BA 1VQ6B 4OHXA 1M1KD 1KZGB 3AF4A 3TSOA 4HAYA 1QFYA 1XMVA 4BFYA 2UVQA 2VYQA 4CT4B 1JEEA 1DEKA 4Q01A 3GMTA 2WOOA 2NIPA 1IN8A 3S1AA 2R2AA 3ZS8A 3PITA 3PG5A 1MABB 4M1KA 2VP2A 3HU3A 3OIWA 3VU9A 4PC1A 1IY2A 1UKZA 4BZPA 2ZRHA 4MRSA 3CC2B 5EE1A 3ZQ6A 4YQFA 5JMTA 3QE2A 2WMOB 5JWHA 3BH0A 4DC9A 4DEXA 1NJGA 2Q6TA 1ESMA 4ZDWA 2DBYA 2ZJ5A 1KY2A 4GPTA 2J7KA 1EWYA 4DKXA 3LVBA 1OH7A 5JWOA 4G5QA 2A30A 3GJ6A 4HZUB 1YZQA 4WZAE 5IHPA 1R5OA 1T0HB 5DI3A 1JR3D 1BYUA 2I4IA 2Q9AA 4PPGA 5FUYA 1EXMA 3BGWA 2VQSA 4NPHA 2KBEA 4MDFA 4R9UC 2NG1A 5KDLA 2ZQ5A 4DB4A 1YR6A 4KSCA 3ES9A 5HXBA 1MH1A 4ZDIA 4Q9KA 2ZJOA 3A1UA 4QGAA 4G1BA 2B21A 5J47A 4DQLA 4EH1A 2ZR7A 1FP7A 2IYSA 4A6XA 5GJCA 8OHMA 3IDQA 5JS7A 1KDTA 1XWIA 1NN0A 4V0ME 3T61A 4EPRA 2QN6A 4EAQA 1G8GA 2GXAA 4DJTA 1MRSA 3IEUA 4BFXA 4PANA 1X8KA 1WE2A 5EE0A 3GLFE 3AF1A 4G3XA 3A4MA 3OZXA 2ZE7A 3W6OA 4P31A 1R7RA 2WAYA 3QF4B 3BD9A 5LB2A 4RFSA 1QDEA 3AGQA 4NYMR 1NIJA 3HWSA 1S4QA 3PIRA 2PEZA 2AK2A 2OM2A 4LYFA 2C98A 2N1BA 2WKQA 2XZOA 1TNDA 2O52A 1DAFA 3H4MA 4LOAA 5J4VA 3R9XA 3D7MA 4M1OA 1P2VA 3ZDQA 4V0MA 5FOUA 2P65A 3EIQA 4QHTA 4RCZA 2C78A 1NF3A 3VX4A 2QMUA 2FH5B 2P67A 1E9RA 3KKQA 4JLNA 4YAOA 2BC9A 2BF4A 1ZW6A 2ZRIA 3GLFA 4C2TA 2OFXA 1FNMA 1J99A 1OXXK 4ITRC 5JSZA 5DI9A 2CL7X 4EPXA 2GF0A 1NN5A 2JEOA 3SN6A 1G7RA 1FMJA 2QP9X 2NO9A 1YR8A 3HU2A 4TMWA 1ZM3A 2BGIA 3RRZA 3FOZA 3F8TA 2WIAA 5AK0A 4DLZA 2BWJA 4TT3D 4TZ6A 4B3DA 2ONKA 4XH9B 1YRBA 2OUKA 5CLLA 1CRQA 2ZVQX 4B71A 3I5YA 2NPFA 1F20A 3B60A 2GDJA 4XVRA 2WPDD 3TW8B 1GUAA 5AUOB 4Q9HA 2ZSBA 4B43A 1QG4A 3KJGA 1LS6A 1E2NA 1KO1A 2FZLA 1KI6B 2QT0A 3BIFA 5K8IA 2G9NA 1J90A 1ZRHA 5G40A 1ZCBA 1CXZA 5LB4A 2QA4B 2FSIA 3TH5A 5BN3A 4F4CA 2JLUA 4PAQA 4JSTA 1VG0B 4HB4A 1S1MA 3PR1A 2IWRA 2ZRMA 1D9XA 3LO8A 4Q5IA 1KIMA 1VQMB 4IOMA 2X2EA 2ZYVX 1HH4A 1IB0A 1NMYA 1XCMA 2QROA 2IYTA 4R7ZA 4EQ6B 5J4KA 2BKEA 3AP3A 4ON9A 3DPUA 4NYJR 1F2TB 4TL8A 3BB3A 1AQYA 2J7PD 4LYJA 3SJAA 4C0QC 3W3AA 2H92A 4M0LA 4AKGA 5E4FA 3THWA 4QHSA 1FX0A 5KSYA 2YYZA 1SVSA 2BMWA 5D3MB 2ANBA 1YQTA 4AKIA 1Z47A 2CLSA 2XTMA 4WVFA 5JHGB 3TKLA 1H8EA 1M6NA 1XTJA 2BJVA 1R6BX 2GCOB 2VP4A 3MWJA 4LHWA 4M1YA 3TQCA 3AUYA 2HYIC 4L8GA 1ZD8A 4NCKA 3WMGA 3IKJA 1S9DA 1MKYA 1M8PA 4DLWA 3MFYA 3QEJA 4P0TA 3TSWA 4F91B 3GEIA 3KUDA 4LJAA 5D3QA 2C04A 3IPXA 1SKQA 4KYUA 2RC5A 3ZC3A 1VQPB 3Q85A 4ZI2A 1GTVA 3CKLA 5FFMA 2BPOA 1S3SA 1GAQA 2IXGA 4RVCA 2GVDC 1MRNA 2R6GA 4TL9A 4PC2A 4PTLA 3ZH9B 3U44B 3I4LA 3V4RA 3CNNA 4OI0A 4GP6A 4UJ5A 4RFVA 5LD2B 1QGYA 2C96A 2ZAMA 3OEHD 1EFTA 1JJVA 1G3QA 3GLHB 5HPYB 2GJAA 3CC4B 4YC7A 5DHAA 5SZJA 4E22A 3JVUA 1NRJB 1YJWB 4HLDA 2QA5A 4FMBB 4QM7A 2QAGA 2EU8A 1CULC 4E09A 1ZM2A 1UADA 3EPLA 1F2TA 5C2JB 3QY0A 2EVWX 4PSKA 1QRAA 3LLUA 4US1R 1E2IA 2FOLA 4EUNA 3PUYA 4GDFA 3U6BA 1DAEA 2WJVA 3T12A 1Z0IA 4A2WA 1CTQA 1TADA 3K0AA 1NP6A 4R2HA 2W0MA 5D3MA 2FFBA 721PA 3TGPA 1IN5A 2HT6A 2OHFA 4TYYA 2YHSA 4DDVA 2WWXA 3EZ9A 4GZLA 1G5PA 4HAWA 3MD0A 4QBIA 1SVIA 2ZS7A 3RVBA 3CW2A 1ZM7A 4US0R 3B1YA 3WYGA 4B3CA 2B92A 2IX3A 4TT3A 3K0SA 4BFSA 2XNCA 1KMHA 1RRGA 2HF9A 4IXMA 2WPDA 2WSSD 5TVKA 3AF2A 4DIEA 3OF5A 3TE6A 3CPWB 1BS1A 1Z8FA 2GEUA 4JIMA 3QOFA 1W49A 5CK4A 1D2NA 3SJCA 3WNCA 3CIOA 3FTQA 1ZC3A 4M21A 1EX7A 1TEXA 4KCGA 3NDBB 1SVLA 2IS6A 3BERA 1RC8A 5JLJA 2IUSA 3QXHA 4TTQA 5C18A 1E6CA 4TL7A 1E4YA 4TL6A 1M7HA 2QM8A 5J4HA 1HUQA 1S1CA 2VZLA 4MKHA 3FPAA 1COWD 1S72B 4K8OA 5G41A 1KYIA 2HCBA 1LF0A 1XPOA 3A4LA 1P60A 1ZD9A 1FNDA 4B6FA 3GCGA 1Z6XA 1Q21A 1E9DA 1JJ2B 2PCLA 4NYMQ 2YOHA 3A4NA 4DDUA 5BYKA 5K8UA 2PLRA 5DSZA 2J7PA 3BB1A 4LYHA 4N0DA 3CRQA 4BLPA 2ERXA 5FI1B 3U3KA 1BMFD 1TAGA 1E32A 3W5JA 2D2EA 3GEHA 2H5EA 1EG7A 5EJEA 4I1UA 1NVXQ 1Q22A 4LJ6A 4MKGA 3EZFA 3RC3A 4QG7A 1XX6A 4JMPA 3TVDA 1LV7A 1RRFA 2ANCA 3QKRB 1A1VA 4ESVA 4LV6A 4AG6A 4BLOA 2G1KA 1E94E 3CCUB 2XSZA 4JJKA 4M9QA 3PEWA 3RABA 1LVGA 5HE8A 1G3IA 3TMKA 2C2HA 4HLUA 4LHVA 1P4SA 1PUIA 3U3JA 3T15A 1E2FA 2XOKD 4BPRA 1AS2A 2QENA 1G6HA 2QMEA 4FN5A 4BFUA 4PX9A 2A3RA 1XPRA 3IO5A 4HB0A 1G3RA 1M2OB 2X8AA 1CEEA 2ZVPX 1OV4A 3TW4A 3IHWA 5FOVA 3AVQA 1FTSA 5GJVC 2YVUA 3VR5A 3AKYA 2EWWA 3DMNA 3OEHA 4DCVA 2WVJA 1KSHA 2HLDD 4DCUA 2AKAB 4D0GA 3B8HA 2PZEA 4NL4H 2H18A 4OQFA 3X1XA 2QI9C 5L3SA 2G0NA 3A1WA 3EWSA 1RJ9B 2CK3D 2FGJA 2FE4A 5A4JA 1J8MF 2P0EA 4CF7A 1LS1A 2GEDA 3TNFA 4PQFA 1MV5A 3KFXA 3LWNA 1NLZA 1F2UA 1M7GA 3KFVA 4N0EA 2GZDA 4Q7MB 5AR1A 4ASUD 2WJJA 1YJ5A 2VSXA 1P5ZB 1B23P 2NZ8A 4LCBA 1Z5ZA 4DLUA 2GESA 2W2XA 1VHTA 3V76A 2B8TA 1U2RA 5BQ5A 3L0IB 3CH5A 5FBLB 3PJRA 5KUTA 3LO5A 2GJ9A 4OJKA 4K81B 4LJ8A 1NMXA 1QGAA 1E2EA 2J0QA 3RHFA 5AUNB 1C1YA 2Q0HA 1SVWA 5DYGA 1VQ4B 3BFVA 4N1AA 5GV8A 4B35A 5EP2A 1EP1B 2WSSA 1UKYA 2EQBA 4W7SA 2X19A 2J1LA 3N70A 3N2IA 3JQRA 2QPAA 1Z29A 3TSZA 1QUEA 1B0UA 5F9HA 2GBLC 3NTUA 3TAUA 3MSXA 4IOLA 2FX3A 2FPLA 1WP9A 2ZITA 3WMFA 4W5JA 1CJMA 3EA0A 2GZAA 2J0UB 1IXZA 4XSHA 3Q7QA 1ZJ6A 2ZANA 1J7KA 3LLMA 1IN6A 1FRNA 1CR2A 1KTVA 4UNNA 3X1YA 1U0LA 2FPKA 4IFEA 4IDOA 3VNUA 1COWA 3CC7B 2CL6X 2DYKA 2G77B 2XTNA 4FXPA 3WBJA 1NJFA 1Z6GA 2QG6A 4HLCA 1K6MA 5EXSA 1N5JA 4A0RA 1VQNB 1G20E 1GIAA 3CPHA 3UXMA 3C15C 1W36B 1BOFA 1OKKD 4LC1A 2G83A 3A58B 5EE5B 1KZ7B 1NLFA 1BMFA 2Z0MA 4IOKA 2JCSA 2P6NA 5FR1A 1XFAA 3PEUA 4V0KA 1OB2A 3LV8A 4TLAA 3CZQA 1NY5A 3AVXA 4PHFA 4HAXA 3U4QA 4RD3A 2VHJA 2JJ8A 2PL3A 4HI0E 3QG1A 3K70C 4F92B 2BIFA 4DVGA 1SKYB 1E1RD 3I61A 1E0KA 3A8TA 4C7OB 1ELOA 4PSAA 3B1VA 1DOAA 1NVVR 2GJKA 4AYWA 2J9RA 1SZPA 4FINA 5LD2C 2XOKA 2WTUA 2OESA 4S35A 3TR5A 1J8YF 1KDRA 1KOFA 4OQXA 1XMIA 1G291 3CR8A 1NNEA 4QJ5A 5HZKA 4LGMA 4L4UA 1MO5A 1T3HA 1ZNYA 2GZHA 4D4LA 5TB5A 1FUKA 4LJ4A 3FMIA 2HLDA 1K8RA 2ZAOA 4NHOA 5C1BA 2BCJQ 4XJXA 1UEJA 1OXSC 1OH8A 3K09A 5FBQB 1HV8A 2OCAA 2O0HA 2PZGA 1W7AA 1Q81D 4H1UA 4RZ3A 1P7CA 1OXUA 3CPEA 1TQ4A 2RGEA 3ASYA 1D6JA 1SULA 2CK3A 2VA8A 3HYRA 3IIJA 3K1JA 2DPXA 1XRJA 1ZC4A 2D2FA 4ASUA 1A2KC 2PEYA 3MGCA 4A2PA 3NXSA 2VNKA 2QZ4A 1Z2AA 4TQUS 4FCTA 2IUUA 4XVQA 2F1HA 1II8B 4KBFA 2R9VA 4TTPA 2WKPA 1KO7A 4AF7A 2FGKA 3W5IA 4DHEA 4F7WA 3PENA 3SQWA 3ONWA 1FOEB 4PQRA 1JNYA 1PJRA 5JHHB 3NBYC 4KU4A 4QNRA 1ZIPA 4HAUA 3QXJA 4AURA 3F0TA 1E2MA 1D9ZA 2DFLA 1RFLA 1ZMXA 4BLTA 5HKKD 1W2GA 2QMHA 3KQUA 4JL6A 3W6PA 1Q20A 5L3QA 4CGZA 3UKDA 3C4JA 3JZMA 4HDCA 5J4YA 4EJSA 4WBSA 3SJBA 1N0UA 2ZTSA 4N3NA 2BEKA 1YZTA 3CXCB 1M34E 5KU1A 1M7BA 3EIEA 2QP3A 3KQHA 2O8DA 1DADA 2IA5A 3CF6R 2RC6A 1S0UA 3U6KA 4PFSA 1UMKA 4KXFB 4JKIA 2R65A 2IYXA 2B6HA 4YXWD 2GA8A 2ZJZA 1R8QA 3TAHA 3MHPA 1NL3A 3Q5EA 1VYUA 1U8ZA 3LAWA 1OKKA 1VCNA 1KNQA 1DS6A 1L8QA 1OSNA 3P32A 1KI3A 1QF9A 3EPKA 2DWOA 1OF1A 3W5VA 1Z0JA 3T06B 5H8WA 3AVTA 4G5RA 2WAXA 4PGOA 3LH5A 1L2TA 3CCLB 5AJVB 1JA1A 4AC9A 2ZS9A 1N6PA 1P75A 3E20A 2VP9A 2IS4A 1GWNA 2CMKA 4WOPA 2IYQA 1DE0A 2J45A 3WHLA 2CDNA 1RZ3A 3KL4A 4NYIQ 2ZE8A 4FD2A 2D7CA 3A36A 3CMAB 4JL8A 1E1RA 1YU9A 2H57A 3BB4A 3QENA 2I1VB 2Z5FA 2RGAA 1Q44A 3RAPR 2YWGA 3WNDA 1G7CA 2BV3A 3VHLB 5KO2A 1WBDA 1IXRC 2GQFA 2J0VA 3QFSA 2D62A 4UJ3A 5F2EA 3JQQA 4PO8A 3P4YA 4QOSA 2ZRNA 4DSOA 3THYA 1Z83A 1XD2A 2GF9A 4JLAA 4ZKEA 1EWQA 1TF7A 1Q1BA 3FHOA 1EFRD 3E5HA 3CX8A 1E2QA 3F3YA 2XNJA 3SYKA 2ZRCA 5EZ6B 3CZPA 2F3RA 4URWR 4A0GA 2CCGA 2QORA 4B3FX 3O8RA 4B4DA 2Q9BA 4A8JB 2NTYC 1FP6A 4AWXA 3WNBA 3B1WA 4KV9A 4ZIRB 2F7SA 3FJOA 1GVHA 3U3MA 2ZUBA 4A0HA 3TK1A 1UM8A 3OAAD 4PO1A 4DCSA 2R6DA 5JEDA 4DBLC 1HE8B 2VHQA 4L15A 3CCQB 1X1RA 2PBRA 4M53A 3HU1A 3ZD7A 3CRRA 2O8EB 5KOYA 3O8CA 1BH2A 4I81A 3S1AB 5FL7D 4MRRA 2ZSDA 3EC2A 3KJIA 3R8CA 1QX4A 3SQXA 4A1FA 4UNQA 3VU9B 4OQLA 3OZWA 4M1MA 4MUBA 4F7DA 5B30A 4E5UA 1LNZA 2BOVA 2OAQ1 2QRZA 1OYYA 4V02A 4B3XA 3CBQA 4U00A 2HMAA 5HKKA 1LFDB 2RB4A 4M1SA 1DAKA 4Z51A 3CF0A 1TUEA 2ZJBA 2TMKA 1JQLB 4AKHA 1XZQA 1VQ7B 3I8XA 5AJXA 1E99A 3I8SA 1X1SA 5DI3B 5F98A 4V0LA 3SHFA 1OT3A 4YMVA 3ZZ0A 4QGHA 2VF7A 1T4GA 2LCFA 5IDVA 421PA 1E63A 4HDQB 2E87A 4GOKA 3VKWA 1R0ZA 3FHCB 2CBZA 1JPJA 4JLJA 2OE2A 4TSFD 5TXGA 1UDXA 2CE7A 5JBQA 1FUUA 4GMDA 5DYIA 5ELXA 3GLGE 2QU8A 2YC2C 2Z6VA 4UXHA 3DHWC 2IHBA 3R20A 2HEIA 4O25A 3U7HB 1E2GA 3BC1A 2O8EA 1E98A 1X8LA 5FPTA 1CR4A 1JB9A 2V3CC 1E9SA 3PUZA 2IHYA 2ZETA 1Z22A 2JJ1D 1ETUA 3NBXX 4RFSB 2CXXA 1YRAA 4P3YA 1E9BA 4D2IA 2RGGA 3I92A 2DWQA 4UAJA 3QKSA 5GV7A 5K8LA 2DCUA 4KLZA 1E9EA 2ATXA 1KY3A 3GLGA 3SE0A 5DGXA 4KBGA 1W44A 4IOJA 2A5FA 4GL2A 4Q9JA 1XJQA 4LYAA 1EFUA 1VECA 4NCIA 1A5TA 4IVRA 4MRNA 5FTLA 1FFHA 4KJZA 4DIDA 3GLFB 2FN4A 1FNBA 2PX3A 3T1TA 2CVHA 4ERNA 2H17A 2PCJA 3CUEF 5JSZB 1P9WA 1TEVA 4ACBA 1EFRA 5CLQA 4AI6A 2O8FA 1B2RA 2VP5A 3KQKA 5EUQB 2OG2A 1YHQB 4GMXA 1R10A 5JZVA 1E4VA 1K73D 5KDOA 1N0WA 2OK8A 3K0CC 3W3ZB 1E79D 1KI8A 2OCBA 5FI0B 4DB2A 3QXSA 4UNRA 3Q5DA 1XF9A 4IJMA 1T91A 4BFTA 3A6PC 2PMDA 2IBMA 2ZSEA 3ZVNA 3EC1A 4CRWB 2YOFA 4C30A 3VR3A 2X77A 3MJRA 1MO4A 2CCKA 1KI9A 2AL7A 2ZR9A 3IGFA 1UEIA 4U7DA 2JLWA 4YALA 1DAGA 1AZSC 5FL7A 3I56B 3EPJA 1K8AD 1ZAKA 2VYFA 5TR9A 1UBGA 4U02A 1DG3A 5DIFA 1HEIA 3D6TB 1DG1G 1F3OA 2P3SA 1YR7A 2ZRBA 1OH6A 3B1XA 3EWAA 1GKUB 3WXMA 2CCJA 3BH6A 2CL0X 2R6CA 4JBXA 2AHOA 1TLLA 3RS4A 2NZJA 121PA 1D2MA 3AVVA 3ZBTA 2Q3HA 3TUJC 1GRNA 3THWB 1OH5A 2RGCA 2QTVB 1FX0B 4EKDA 2XB4A 4IFBA 1XZPA 3TUZC 3KKOA 1AQUA 2HJGA 4GSYA 4MH0R 1R2QA 4UQOA 2ZSFA 4G0NA 2WWYA 1GL7A 2D74A 4C4PA 5JFGA 2IYVA 3AVYA 2A5JA 4UKDA 2CHVA 1TTTA 3AVOA 5H5JA 3C8UA 5CK5A 4LI0A 1U9IC 1XEWX 1P61B 1QFJA 4FWIB 3PXGA 2IS2A 1D5CA 1YZLA 4CEHA 1DARA 1R0YA 3CCMB 2FV8A 3KTAA 5IK2A 3BJIC 4LJ9A 221PA 2E9SA 1P72A 2B5OA 4Y7CA 2VTKA 2ZROA 4PSVA 4PZYA 4DLXA 1ANKA 4KODA 1EESA 4PO9A 1KD1D 2NGRA 2F1IA 2DB3A 1W46A 3AEZA 1JR3E 3T35A 5KYKA 4I1OA 1D8TA 3ADCA 1KSFX 4KO8A 1JALA 4FI3C 2JJ1A 2ZXUA 1CP2A 1G3UA 1VG1A 2C8VA 2JDID 2WZQA 2REBA 3FE2A 1JECA 3RRMA 5FPKA 2VSOA 5AJZA 5KTYA 5SZKB 4TTRA 1QHGA 2NO7A 1VIYA 4O2LA 4CEIA 4AY2A 3IO3A 3W8NA 1T5LA 1PUJA 2GCPA 2ZR0A 1G8FA 2C9YA 2FNAA 3SEAA 1E9FA 4B73A 2BBOA 1XNJA 2V7QD 1T6NA 1EK0A 2MMCA 5TARA 1U81A 2GEVA 1RRPA 2CHQA 3MJHA 2QAGB 4URYR 3O8BA 2RMKA 1TQ6A 4RKEA 1GNPA 1YKSA 3NEJA 4Q1AA 4A8JC 1JR3A 4I1SA 4B2LA 4POAA 3K70D 4AIIA 4Y9UA 1GP2A 3K0AB 1KC8D 2CLCX 5GJWC 1A4RA 2JLZA 2YINC 1D2EA 4X8HA 3VX3A 3PFIA 1ZUIA 1E79A 1UBFA 3JVVA 4JVLA 1KNXA 1LW7A 4QFMA 4LZZA 5JCZA 1KK0A 1VG8A 2FFQA 3TR0A 4IKEA 4MA4A 5DO9A 3G5UA 1JAIA 1F5NA 2OLJA 2ERYA 3C16C 1CJUC 1FTNA 3H84A 3RANA 1KMHB 2H16A 4Y0VA 4A82A 4BZQA 3I5XA 4RKFA 4HE5A 2F43A 3SU8A 3CF2A 1W4AA 3L0SA 1FQJA 3FKSD 2AR7A 2Z4SA 3KKMA 5CJ2A 3CONA 2AXPA 2OSBA 4C0HA 2PX0A 1CNFA 1QH0A 4I1VA 1CKEA 3W2IA 3WHKA 4CZ2A 1AMOA 1BJKA 1PLKA 1U0HC 4Y9RA 2KI5A 4Q4HA 1ZNWA 1DO2A 4A0FA 4D80A 1PV4A 3TRFA 1OXVA 2W0SA 1E64A 3QI2A 4DLTA 1NVWQ 2G3YA 5UKDA 1OXTA 4ZPXA 2RCNA 5B58C 4JT2A 4IW3B 1NIPA 1KQSB 1T5IA 2IYUA 2EFGA 4LV5B 4MGYR 5JRJA 1QHXA 4YDSA 5KPJA 4ABYA 1DDGA 1XXHE 6Q21A 4C43A 1GRQA 1XTRA 3IEVA 3L8ZA 3EIHA 1G8YA 1CS4C 1VIAA 1AKEA 5FTNA 4PPQA 3VKGA 2YV5A 1I4TD 2Q9CA 5FUWA 1EFHA 1S96A 3DDCA 4RD6A 4FWTA 5CM8B 2VL7A 2PJRA 4A2QA 5C4GB 1L7VC 1G18A 2REOA 1QHIA 5JI3E 3DVLA 2Z4RA 3EA5A 3KUCA 4HUTA 2GBLA 3L2OB 3IIMA 3IBGA 1U90A 5FPHA 3E1YE 4G1VA 3GLIB 4BFWA 3HR7A 2GETA 4Q1FA 1KJZA 2OBMA 4YDHB 4LK2A 3BAFA 2EFCB 2HF8A 2OXRA 3SOPA 1NLYA 1G41A 4MYUA 2VEDA 1XXHA 3OIUA 1KHTA 2W6JD 2V6IA 4D4KA 4A9AA 4ZO4A 1SQ5A 4Q7JB 1AZTA 1BQEA 2PZFA 3EPHA 2K5UA 1I2MA 5C46F 1TF2A 3RSOA 1QHSA 2JDIA 3QJYA 1DAMA 4BQSA 3J81k 1TU3A 2WICA 1OGJA 3UK6A 4G1UC 2IEZA 1U98A 4GOXA 1KKMA 1N25A 2HDNB 1RYFA 2QP4A 5DN6D 4TMXA 3QPVA 2ZRLA 3GLIE 2BM0A 5L3SB 1HT1E 3RNLA 1XEXA 3EW9A 3VO2A 3OEED 5FPYA 4LJYA 1XCPA 1US8B 4YLGA 4XOIA 1U99A 4DCNA 1F2UB 2CJWA 4C0SA 1T3SA 3FMPB 4PAOA 3SC3A 3LXRA 4IXNA 2HT1A 1HY3A 1R8SA 4QRHA 2DHRA 3AV0B 3SBDA 1N0VC 3SI7A 4W5WA 4X8LA 3R9WA 1FQKA 1Z28A 1ZNXA 4JVNA 2IC5A 1G6OA 3NBZC 2VH5R 1JI0A 4IDNA 4Z1MD 2DEUA 3CD6B 5E7MA 5EE3A 4DZZA 3UANA 5LDDC 2GILA 3GLIA 1WBBA 3IPYA 5FBVB 4OQMA 5HR5A 1ODFA 3H1TA 3C5HA 1XD8A 3AP2A 4Q4AA 2P2LA 3NEYA 3FKSA 2XZLA 1N5IA 4IDPA 1XTIA 2PT5A 4TMKA 3X1WA 1GDDA 2QSYA 5GADl 4B44A 4C3ZA 2BDTA 4XD7D 2WWFA 1VPLA 4RCYA 1MT0A 2R6FA 3CB4A 1K9MD 2ZRKA 4D25A 1XEWY 1XBTA 621PA 3NKVA 1KK2A 4FK8A 2X1VA 3W6NA 4TMVA 1W5TA 1PLLA 2GPJA 1WMSA 2A78A 1LTQA 2GXSA 3FKQA 3IQXA 1CQXA 4RZ2A 4WA7A 2AD1A 3UWKA 4D82A 1KO5A 5JRZA 4DT1A 2V54A 3T1QA 5JJLA 2B7BA 2AX4A 3VR2A 4XTRA 1US8A 1CR1A 1S9HA 4Y0AA 4BECA 1WCV1 2C99A 3B13B 4TLDA 5JJIA 4OI2A 1YITB 2JLVA 3H0KA 3I1FA 4HE6A 4URUR 2O8CA 2N42A 3KQNA 2BBTA 2G88A 2ZJAA 4LPKA 4NYJQ 3ZLJA 1XJ0A 1P2UA 3HR8A 4MRVA 3U4QB 1OFIA 2QL6A 4KAXA 4QC2A 4R2IA 4G5GA 4JZKA 2QTLA 4DQKA 1TF5A 3CNLA 5CYPA 4BFZA 3VHXA 2NMVA 4LBYA 4YHBA 4PR0A 1E96A 1IN4A 4FMCB 4WW0A 5FTKA 1KGDA 1RIFA 2H7VA 4E03A 4R71A 2W6JA 3LBNA 3CRZA 1ZCAA 2W6ID 3B82A 4OHZA 2QBYA 2XNDD 2OV2A 2ZPTX 1NY6A 2G1JA 3C7KA 2IWHA 4TYQA 4ZGQB 2O8BA 2XJ9A 2XXAA 3R7WA 3F5FA 4P32A 5F9FA 1SXJD 4UXIA 3BFXA 3G71B 4CW7A 3K9HA 2JLYA 1NSTA 1QHHA 4LBWA 3W2FA 2WV9A 1JR6A 3PUXA 3OFND 821PA 1I4LD 1WF3A 2RKOA 5H70A 1GNQA 1Z0KA 2WWGA 2AWNA 3LA6A 4GP7A 1MO3A 3A1TA 4IDQA 4M22A 4OL0A 4V0NA 5TDHA 4DLVA 5KDDA 1DDIA 2W2VA 2Q3MA 2R6AA 4D0NA 3CCVB 3OEEA 3LW7A 1HQCA 1NMZA 3AKCA 4DSNA 1KI2A 1T0JB 4JS0A 4Q9IA 4D81A 1TU4A 1XJCA 3RRYA 3CH4B 2BN4A 5CJPA 4EPYA 4DCTA 3TIFA 1WA5A 3E70C 4B3BA 4RJLA 1SHZA 3B1ZA 3LRPA 3RLFA 2D7DA 2ZI7A 4QBHA 2FWRA 4A92A 5CB6A 4Z1MA 1Q86D 1BX0A 2OXCA 3ZYCA 3SDZA 2ZYUX 3ZVMA 1W2HA 2GWHA 1NSFA 3QQ5A 3FFAA 2JATA 2GK7A 1BKDR 2H8KA 2XJ4A 1IY1A 1W34A 2NPIA 2W00A 1XTSA 4LY6A 2QE7D 4XWAA 4BGDA 5L3QB 1I4DD 1FW6A 3MG9A 5EP3A 3LQRA 3L0OA 3CX6A 4JLVA 4EJSB 1NBMD 1W0JD 3DMDA 2J41A 2J5XA 4NONA 4XD7A 3IILA 1CIPA 3DO6A 3KXKA 1WXQA 1VQ9B 1PVOA 5B57C 1GL9B 2O8DB 5ANRB 4URXR 3QFCA 4M9ZA 4EDHA 3AUXA 2IEYA 1F60A 4TMZA 3W5UA 2IYWA 1Z0FA 1C9KA 3U3RA 3WP0A 2BSAA 4B6EA 2PIAA 1EGAA 4XWOA 4NMMA 1CJVC 4WZBE 2R44A 1UKEA 4OHWA 2VBCA 1I7PA 4Q4LA 3VMFA 2DFKB 4ARZA 4B48A 4OHVA 3ZJYA 2ZI9A 5FL3A 1YI2B 2ZJ8A 2BMJA 5AUPB 5A5GA 2B7CA 2QPOA 4QHYA 4OBEA 2F9LA 1GFIA 1SXJE 2WWIA 2AXNA 4CYMA 3HYTA 1ZINA 1A7JA 5M04A 3SYLA 1CNEA 3BE4A 4GNKA 1C4OA 3PUVA 3SS8A 2IYLD 3DEFA 4HATA 5KSOA 3ICEA 1G19A 4JKYA 5LPNA 3ZVRA 1AM4D 3NVAA 5KNDA 2R6HA 3ZVLA 4OJQA 2UKDA 2ZI6A 2IXEA 1OIWA 1Z08A 1Z3IX 3NH9A 4YMTA 2YKGA 1G8HA 1GSIA 2W6IA 3BXZA 4MKIA 1PZNA 2XNDA 4DLSA 4OKSA 2I3BA 2R8RA 2IF0A 3AVWA 2ZJ2A 5AUQA 4C0JA 4FW9A 4CEJA 3EG5A 1FNCA 3EZ2A 5FOWA 2RGNC 3UMSA 1SXJA 3ZQJA 1VCIA 4HEJA 2C9CA 3U5ZB 1U94A 3U7GA 3THYB 1XD2B 4IEIA 4O0MA 3BBPA 1AK2A 2NO1A 3CR7A 5SZIA 3QF7A 3OFNA 3W34A 4ZCLA 4BRWA 1WRBA 4BUJA 3KKPA 1OHHD 2GXQA 1ZM9A 2GAOA 2RHMA 5HCIA 2F55A 1FZQA 2ASEA 5AJYA 4DRZA 4LPSA 3GJ4A 1CRPA 3K9GA 5CITA 2I1QA 2EYUA 4FIDA 2NO0A 2OO7A 2PJZA 4RD2A 4JBWA 5L8VA 3LX8A 1JAHA 3NHAA 4P33A 2YWFA 2WSMA 3CO5A 2HCJB 4IRUB 4KFTA 1X6VA 2ZIAA 5KSPA 1XPUA 4NCJA 5CDFE 1XMSA 1AS0A 2P6RA 4AYXA 2BEJA 2P5SA 3VFDA 2ZUDA 4TQAA 1CR0A 1P62B 1VCMA 3RC8A 5FOSA 3VQTA 1XCGB 1ZYUA 3AVPA 1Q0UA 1UJ2A 4TLCA 1AJEA 1HYQA 5JEEA 3LXXA 2VHCA 2ZRAA 3DOFA 3I72A 2ZE5A 3AB3A 3QKTA 5E3HA 4DEYA 2GKSA 2YNMA 2N46A 2XNSA 5H68A 2XB2A 2CEAA 2YC4C 5E95A 1Z07A 1W0JA 2GJSA 2GHIA 2ZYTX 2IYRA 2AN9A 4MGKR 1T9HA 1AKYA 3OE7D 1GL6A 1QVGB 4URZR 1Q7YD 4FCVA 5CDFA 3LDAA 2C5LA 4NE2A 3A1VA 4WZ6A 2H1LA 1I2DA 3CCRB 1T3LA 1AGPA 1FMLA 2D3WA 3SZRA 2V9PA 1GKYA 3ECCA 1ZBDA 4AKEA 2REXB 2CRVA 4DLYA 4BASA 1BX1A 1ESNA 5FR2A 4L9WA 1MR3F 4GFDA 5CM9C 3W2EA 3P26A 3VTKA 5FTMA 1NI3A 4YAFA 1QVAA 2BMFA 2WMNB 2JAQA 2DERA 3Q3JB 2MSDB 3EARA 5KSZA 3QXCA 5AWFC 5L3VA 1QG0A 2QGZA 4PHHA 4YONB 3ZGXA 1DAIA 2LKCA 1H85A 4QGGA 1YE8A 1AS3A 4LC0A 3GJ0A 1E2HA 3QKSB 4Q7KA 3E2IA 5B2ZA 2X3UA 3RYTC 2E1RA 3U2QA 3EXAA 1GVNB 2XITA 4UNSA 1KK3A 2QY9A 1JQJC 2XEXA 1PLJA 3BORA 3GLGB 2GJ8A 5THXA 2ZI5A 4P4UA 3TUIC 3K09C 2OTJB 4R98A 1UBCA 3GJXC 3IHLA 2VPPA 2X2FA 3N2EA 2NQ2C 1YJ9B 1U9IA 4PQYA 1CF4A 1KDOA 1W36C 2EFHB 1NVVQ 1VQOB 2VSFA 1X3SA 4DXAA 2FMXA 3UG6A 2O8FB 3U7FB 1Z06A 4YXWA 3CCSB 3QFRA 2FEOA 3NBFA 3EZ7A 2J0SA 2A5DA 2ZEJA 1OHHA 2UZIR 3HPRA 3CWQA 3ND8A 1P9RA 3BRWD 2KB0A 2ZE6A 2UZ3A 1H8HD 5J5CA 2CNWD 1MOZA 2VIIA 5FUXA 5DNYB 5EXXA 1N8RD 1Z6AA 1R0WA 4MGIR 2RGDA 3FGNA 4A6PA 4L16A 5CIQA 2C03A 1E2PA 4Q1EA 1S8FA 2ZU0C 3P1JA 2OBNA 3RS2A 5BN5A 3THXA 2KE5A 4YMWA 4M8NE 1GO2A 1FPMA 1UDWA 4EJSC 5EUMA 3TQFA 4D4MA 3AM1A 1XU4A 1QG2A 3QG5A 1KSJA 3SR0A 4NDZA 1N6IA 1KO4A 1S3GA 2FSGA 2OFWA 3K0EA 4S2EA 2GTPA 4YMSA 2FJUA 2JLSA 2OCPA 1YHNA 4CVNA 5TV2A 2VLIA 3OW2B 1ZU5A 1W4CA 1W0KD 3V9PA 4QJ3A 3PVSA 4ZDJA 2QM7A 2ODNA 3QXXA 4Q47A 2QT1A 5J40A 3K0FA 4GRAA 4B32A 1Z63A 3B9PA 1Q82D 4LX0A 4Q9LA 1E62A 1G5RA 2WWWA 1HE1C 3MWKA 4B33A 1MO6A 4DDTA 4C2UA 1KI4A 2QSZA 1FNNA 2BKUA 4AG5A 3OE7A 5DHFA 2QPTA 1VCOA 4OK6A 2KJQA 1KSGA 4DLRA 2FDCA 1QZXA 3GP8A 2KBFA 2WBLC 1NG1A 3GFPA 2Q3FA 4OK5A 2IK8A 4QGFA 1NKTA 2RHDA 4JLBA 3PQCA 3PV0A 5G3YA 2IYYA 4B75A 4L5BA 1WQ1R 1GITA 3I73A 4CEHB 1VQ8B 1A82A 3KTAB 4L9SA 1QHYA 1YIJB 1DTSA 3OAAA 1TQ2A 2VNHA 4Q4JA 2BMEA 2WIBA 5FOXA 1NDHA 2ZREA 5P21A 3TBKA 2QTHA 4KVAA 5EP1A 1VKJA 2AFIE 5E7JA 5DH9A 1IQPA 1KO8A 4UNPA 3L0PA 1BO6A 1H8ED 4JSYA 2AFHE 1EP2B 1Z2CA 2BHRA 4CEIB 4M1WA 3ZIAD 1W4BA 2VHUA 4HSEA 3ETLA 1SVMA 4PHTA 1AA9A 4OQNA 2WWHA 1QBKC 2DETA 3P20A 5KPDA 4LV8B 2WOJA 3LW8A 4I99A 4EFMA 4LDJA 2RGXA 3T5GA 4P4SB 2A9KA 2QTFA 4LHXA 3REGA 3K9LA 4KSBA 4BLRA 3JQPA 1VYVA 3D31A 4ZV4A 1MABA 4M1TA 1NJID 1Q1EA 3G6EB 4NKRA 5EXTA 2QMOA 1QVRA 4YMUA 5FH9A 4TYWA 3AGPA 4NU0A 1N6LA 1H8HA 4PPNA 1Z0DA 2CNWA 4TSFA 4W5HA 4B2PA 3OZVA 1XDBA 1P9NA 3EASA 4BLSA 1GM5A 1ZNZA 4HZUA 4JLMA 3T1OA 2AD5A 2D4HA 2J59A 2ZSAA 3K53A 2F43B 1KKLA 3D8BA 3GJ3A 4W9MC 5EE9A 4D0LB 5HZHA 5IF9A 1QVFB 1NN3A 2P6UA 3ASZA 1G21E 3AF3A 4RD0A 3ADBA 4GOJA 2ZM5A 4KVGA 4JJZA 2HXYA 4KFRA 4IDHA 1XTKA 2YJTD 3FWYA 4KYIB 4Q4HB 1P2TA 1YR9A 2VF8A 1OPXA 4PC7A 3W5HA 1DAHA 1W0KA 4FMDB 3DM5A 4GBMA 2HYDA 4A4DA 4M9XA 3HDTA 4U9UA 1W1WA 3FYHA 2XX3A 3CMEB 3RSLA 3CNOA 3MWLA 3QBVA 4Q1BA 4YAWA 3ZZTA 1W4RA 2QUZA 5TMPA 2PH1A 1G16A 3MLEA 4V0OA 3I55B 3IBYA 3SYNA 3GEEA 4CIDA 4P4SA 4FMCF 4C0BA 1L4YA 1T8UA 1Q57A 3PCRB 3AQ4A 3QF4A 3ZBUA 1IJEA 1YZKA 1CLUA 5IRCD 3OJWA 3SFVA 2NO6A 3C41J 4G5SA 5BN4A 4F93B 4K46A 4MYHA 3SFZA 2GNOA 4NTZA 4MUAA 2EFEB 4EFNA 4JL5A 1N5LA 2VRWA 2XGJA 1JBKA 3QIAA 3BH7A 3CWZA 4MDEA 2RH5A 4BFVA 2A5YB 4AYTA 4JLPA 1Q3TA 3BK7A 1XXHB 1YJNB 1RYHA 2Q21A 2C95A 3TLXA 5GVRA 5BWMA 2WJGA 1GJRA 4LJ7A 1IBRA 1EX6A 2QTZA 2BBWA 1OW3B 2ORWA 4C0AC 4CDGA 3CLVA 4LBZA 1N3BA 1UBEA 5FBRB 5CIWA 1QFZA 1VTKA 1OGIA 3GPLA 4Q7LA 4BE7B 4LUCA 3NC1C 4HB2A 1G7TA 1N6HA 1IOZA 3LQQA 3ZIAA 2QQEA 3VO1A 2XSZD 2OBLA 3KJHA 4HAZA 1R0XA 1A2BA 2FG5A 5A0FA 5BW8A 4WIAA 5JWRA 1TVCA 3UMFA 1XEXB 2CNDA 4LSGA 2V1UA 3WBKA 1NVUQ 4B74A 3LD9A 4QBGB 1KI6A 1U8YA 4LWZA 1ZUNB 2CJWB 1D1NA 2QEXB 4QNMA 5JS8A 4HDOB 3K70B 2FA9A 2OILA 4G01B 4I4LA 1L4UA 3I3SR 2VNIA 1FDRA 4JT4A 3VR1A 2EFDB 3NDPA 4JYBA 3SJZA 4F4JA 5DLQC 1W35A 3CRVA 1OIVA 3Q8XB 1F6BA 3LY5A 2DWPA 1O3YA 4TWZA 3DOEA 3HJNA 4J0QA 3AH8A 4EQ6A 2FPMA 1VQKB 4WQMA 1G64A 3VNVA 4HB3A 2OK7A 4Q4AB 1W87A 1EFCA 2F6RA 2Z43A 1VMAA 4OYHA 1KJWA 2V8OA 1H42A 3KXIA 3QKUA 2PLFA 4B34A 3L43A 4Q18A 3Q9LA 1GRRA 1HURA 2GCOA 4MYTA 1QHNA 4B47A 1E69A 2F1JA 4M9SA 1XD9A 1E0AA 2JASA 3GLHE 4M4SA 3WP1B 2V7QA 4PC3A 2ZRJA 1ZP6A 3QPUA 4RSGA 4XVUA 1E1QD 3M1IA 4EIWA 4DDWA 5JJKA 4M2LA 4QXAA 2MSCB 1KRHA 1P73A 1KDPA 2HJVA 1KAOA
chains in the Genus database with same CATH superfamily
4KKTA 1A1SA 2NUAB 1H05A 2VBFA 3AR3A 2B1IA 3AUFA 3KJXA 3REFA 4ZRDA 4XMYA 1V47A 3FDFA 5KMGB 2RJ3A 1R6XA 4LVOA 3X1DA 2WT9A 4LKOA 2WM9B 3G8AA 4QLAA 2XT9A 1EHIA 1X8XA 2ZTMA 3HBNA 4OQZA 4X8MA 3MB8A 2W11A 5F5XA 4WNYA 3ASRA 2IDMA 4M38A 4Q3BA 4EB0A 4EX7A 5BR1A 2ZJ6A 1YI1A 2XD4A 4HMQA 4P82A 4WY2A 4F5DA 4U39A 5GQSA 5LYYA 3RFCA 2O2EA 5EIWA 1ILEA 4MV0A 5ESWA 1AGRA 4E07A 1N5KA 2QG4A 3PC8A 2GPNA 3BGOS 4HAVA 2WJYA 2O9JA 1XMJA 3ZCTA 1DKUA 1T8PA 4NDNE 3VPFA 3KUXA 1IK6A 1YTLA 3EJ6A 4W6ZA 4Q48A 4JB8A 1P3JA 4Y9DA 5IWCA 5JVDB 5H59A 2VDKB 4H3SA 2YJ4A 3L0ZA 3TX2A 1VGVA 5IF3A 3PL5A 3WADA 4G5HA 2PT9A 5IJ9B 2VQFB 2VNJA 3QPWA 1L5NA 4FFDA 1KMQA 3NUZA 4N54A 1IQ0A 1S5PA 2EGGA 2R8PA 4RM0A 2ZSJA 3BL5A 3P2YA 5IZ4A 4O1HA 1QHHB 1WPGA 2WKSA 3N2NA 5TY0A 2DSTA 2OYSA 4AK9A 5LFAA 2XCSB 1EFKA 4OAPA 1Y9DA 4JQSA 4A0SA 1V5WA 1V26A 3GXOA 4UD2A 5CNMA 1ZM4A 1V8FA 2IYZA 2YY6A 3I9JA 4QICA 3P4UA 1TX4B 1IH8A 3O9VA 1XVLA 5LMNB 1KY4A 4XCXA 5JSKA 1M67A 1YZFA 2E3JA 1S7CA 2Q2QA 5IYWA 3JWEA 2Y4NA 3O1IC 5I9BA 3V8MA 4IILA 3V46A 4JYCA 1N4DA 4EYEA 3ABIA 4WA8A 1NRWA 1IPEA 1ZQ1A 2PXCA 3BWEA 3FW1A 2DBRA 3GJ7A 3LBFA 4REOA 3VBEA 1YBMA 4O0LA 1PR9A 3AUKA 3KB2A 3G0CA 1XL0A 4I14A 4DKJA 1G7SA 1XZKA 1T6BY 1SJ9A 2ZLBA 3EUEA 2H0AA 3HDHA 5CLHA 2OFFA 3REQA 1YUMA 3SCZA 5A7FA 3KOXA 2HSEA 4Z0TA 2GPBA 4UW9A 1G4UR 1V3VA 2VLBA 2BJWA 2Y76A 3PZRA 2J09A 5LXTF 2HWYA 2HRDA 3EGEA 3GJ8A 3QITA 3HXPA 2F1LA 1NG9A 4YX9A 4QQRA 4I2NA 1BROA 2Q5JA 3O47A 5SYAA 4IEEA 3TTUA 1B4DA 2P4SA 4FOOA 2JARA 4M60A 3MINB 3TG2A 2ZWAA 2P9HA 5AVWA 3PLAE 2FG7C 3E7PA 3HVKA 4X45A 5JH7F 1VRVA 1Y8QA 2HUPA 4WXRA 2GAJA 2PRZA 4ROTA 2F9MA 1ONOA 3GRZA 3I1JA 3QKRA 4GLLA 4UOQA 4KLNA 4IS2A 5EWJB 3AESA 5CHEA 3RQSA 4AF6A 1ONBA 3GFGA 1A8PA 4RY2A 4XR9A 4BV8A 1W8IA 4N3GA 5F4OA 1OFUX 2B25A 1KY5A 1WTAA 3LCMA 4TYPA 1P4MA 4RQUA 1JWAB 1HTWA 2J3DA 4RNDB 1DB3A 1G5IA 8AT1A 2DFNA 2N9UA 4IRXA 1I32A 1F6WA 4XWGA 5FWNA 1TKAA 2J9GA 3VDMA 3UJHA 2ZTNA 2ACWA 1SRQA 1IEQA 2HDHA 1YC5A 2J87A 2EYQA 3CPJB 2XMPA 3H1EA 3DEYX 4YJKA 4PC6A 5REQB 1HDXA 1M2OA 5B55A 3QUTA 2RONA 3NE5B 2X2PA 4MITA 4CQJA 4O02B 1YONA 3H86A 3WDSA 1AIPA 4DVJA 2P27A 5C35A 3OC0A 3QQPA 1XRRA 2AK3A 5G3ZA 4PZZA 1SVOA 2WVGA 1O4VA 4AWAA 3I58A 2RD2A 3LE8A 1A5ZA 3UM9A 1ULHA 2A5GA 3KCNA 1AUQA 4W4TA 5F7JA 3T3DA 1SKBA 3CESA 3TJZA 5I5EA 2HK9A 4TM8A 5JXJA 4Q02A 3DR5A 4KPYA 3VYRB 2YTZA 4EHDA 2VJIA 5HF5A 1T34A 3TVTA 4RK4A 3O7WA 1BMTA 2DHDA 4ZYUA 5CH5A 3DD5A 5LMZA 4EHNA 2EAUA 3HLKA 1GR1A 1DX4A 4MWGA 2FEMA 2YX1A 3BOSA 4DWJA 4YCBA 4KTTE 5FBWB 1DWPA 3JYNA 1MNAA 1RYNA 3RD5A 1NXVA 2YWHA 3E48A 2F8SA 4M55A 1LNQA 1YVUA 5HR5A 3AKDA 2JJ2D 5FTJA 3N0RA 3LBIA 3NQ41 3TVYA 2EGUA 4BGEA 5HTKA 1RWPA 1XU9A 4A5OA 4J76A 1M1NA 3EXEA 1ML4A 5FWDA 1TM3E 4D6PA 5CEEA 1A96A 3AM4A 2G6BA 1Y7PA 3OX3A 2W90A 1NV9A 3RG8A 2PMCA 5AJHA 4ZI7B 1V4NA 3FYSA 2ERCA 4PIPA 3GDWA 3MMPA 4LDQA 3RG2A 3TM5A 4EYOA 1Y6JA 1P45A 1N2CE 2EWVA 2W93A 4MV1A 1DQRA 1SC4A 2CVFA 4XWKA 5I01A 3BBLA 1L7NA 4RK6A 3UB2A 1VI5A 4F38A 5C53B 1GDTA 2L0XA 5E7IA 5JAMA 4Q00A 4NZNA 4Q19A 4C22A 3IV6A 5FDFA 3JQ8A 3R9IA 4OHYA 1Q1NA 4GLJA 4JJ4A 1M1ZA 4UXJA 2MR5A 5EEHA 1BSVA 4HVLA 3SMVA 2WIDA 2SHKA 3FAZA 2CUKA 5KNBD 2PTHA 5DISB 3UJ9A 3B5JA 4L07A 5BYJA 3S55A 1P33A 3MUFA 2OEPA 3MBKA 2ZI4A 1E2KA 1AN0A 3R1IA 1P2FA 1YA6A 2IF2A 1SKMA 1D1SA 3B1FA 3T5AA 1NQAO 1OFUA 2LGJA 2V6JA 1X8JA 1I0LA 3A7DA 1G17A 1UMCA 3F7MA 4QT4A 2X5XA 4Y1RB 4YAUA 2A59A 2K7ZA 3QVVA 1RZUA 1TPZA 2JD1A 4G7XA 3EVDA 1F8FA 4PBTA 3ICQB 4F9TA 2C29D 2DHCA 1L3IA 2OAEA 4L6AA 4LJ5A 5AH0A 2G80A 3C4VA 1KHHA 1XEFA 1N2SA 3R0VA 3RU3A 3BWYA 5JCOC 1PJ3A 3HPQA 4URVR 4L7QA 2BKAA 1Y4UA 3ZU6A 1DIRA 4BN5A 2Q9UA 3NEAA 4O59O 1W5FA 1DPFA 2A35A 4M0PA 3G05A 3BYZA 4HX2A 2P2GA 4FOPA 4JLDA 4M0EA 3X1KA 4MWSA 3THOA 4J90A 3VZBA 3HJBA 4UTOA 4AJ9A 1QHFA 2PJUA 2YHBA 4OYYA 1EWQA 2VWQA 2ZIZA 4C07A 1N4AA 2PMKA 4NWIA 4EHLA 1A9RA 1L4FA 1GQYA 3KKNA 1FU4A 3QYPA 4BGVA 3CH7A 4EKNB 3DZHA 3EYAA 5T4BA 4EA7A 5I4KA 1VSUA 3G4SB 1MHPA 3IAUA 3B3FA 3WYFA 1KI1A 4MB0A 3ROTA 4HO1X 4ZO6A 1KAGA 4NAHA 2B69A 1Z6TA 1UBRS 1Y3FE 4IWXA 3ZWAA 5ERYA 4A15A 1IWOA 3L04A 2IL1A 5AVZA 2WHXA 5JYDA 3WGVA 3GRVA 3QMPA 2FSFA 4R40A 1KZYC 2QDXA 2QE7A 4GE0A 3IPRA 2PMBA 4P5EA 2A9VA 3G9TA 3QX8A 3T95A 2DF8A 4PHGA 3IKVA 4ILEA 1TDJA 2KWIA 2GLUA 2DZDA 4L02A 4U2GA 3S6JA 1NBMA 4E13A 3DZCA 2L69A 4C2AA 1FE8A 1E9CA 1T9DA 3DZFA 5ALPA 3O8DA 1X74A 4GUAA 5E0KB 5KYTA 5A4FS 2FN8A 2P2YA 3DKVA 1XP8A 5J59A 2HBYA 1D4OA 1KZ6A 3F9RA 3PQ3A 1HLPA 1HDCA 2J08A 2WG2A 3D4BA 4J0HA 1UK9A 3W2HA 3EPRA 3NBAA 2Y1DA 3QXGA 4JUFA 5ESDA 5BQPA 4II7A 1VLQA 2NO5A 1E6WA 5CW2A 1CY0A 3ET5A 3GN2A 3ZY4A 1UXIA 3VDRA 1RM0A 2VUIB 5KX5A 2P91A 1AHHA 5LQDA 1DBSA 1NPYA 2AR9A 3OA2A 1E61A 2CUNA 3OLYA 1MENA 1B14A 1DJLA 1RXUA 4HTFA 3GIDA 3VRHA 2RH4A 1PFYA 2PX2A 1RQXA 1GPBA 3BS4A 5MDHA 2D13A 4IDFA 1FDUA 4MUKA 1Q16A 4AUNA 2Q5HA 2ZRFA 1PR5A 4LYEA 5ALZA 1SUCA 3L4EA 4ZI5A 1U5CA 1Z15A 4D3XA 4LHYA 5JFTA 2X6WA 4LX8A 3U60B 1JR4A 2Y1GA 5I7HA 3HKEB 1NYRA 3U4MA 3B3QA 3NH6A 4P92A 1XHLA 1RPZA 3T7EA 4DMKA 2O5CA 4JOQA 4ZCIA 2PXHA 3ITEA 2W2TA 4I6JA 1ZN9A 2QIOA 4JI4B 1DNPA 4F2HA 1T9GR 1OE0A 2RAPA 4MW9A 5JZ9A 4XLCA 4JJ6A 5AM3A 3DJYA 3JZAA 2ZBQA 4HUQA 4JVMA 3A35A 2EZ9A 4Z2YA 1UPAA 1Z88A 2GO1A 1A69A 1VHOA 3OIVA 4DMCA 2CLDX 3GD7A 3LPNA 3K0FB 4YRNA 4LVUA 3T94A 3S99A 2BUAA 1MLDA 2BAGA 3VSEA 4EG1A 5LP6B 3OVMA 4KFUA 1PS0A 5LBIA 2WLSA 4Q66C 5JFOA 1T36A 2QJWA 4YEDA 5FO1A 1XRPA 4RE5A 1H9AA 1KF0A 3S1LA 3PEYA 1TA0A 3FHLA 3DOCA 1CIVA 1D8AA 1ES9A 1PL0A 1V95A 1OLOA 4LZPA 4ZCMA 1JXOA 3ZY3A 3LHSA 4ECEA 4V24A 4WWVA 2P9CA 3CVYA 4GNRA 521PA 5K0NA 3U3ZA 1BFKA 1ZDMA 4P6VF 2WVAA 1G6Q1 4L8WB 4CMHA 1NPDA 2VPYA 1U8EA 3CV3A 1TO2E 4XIGS 1PEKE 1YBAA 5D87A 1YZNA 4KHPB 1K5GA 1T9ZA 5LQAA 3T5DA 4DIMA 2BGUA 2RH8A 3OQMA 1OLXB 2W8BA 1YL7A 3GFTA 2V55B 1XTTA 2K4MA 1DKPA 2ZJ7A 2PT7A 3ICCA 3C5WP 3SMQA 4R1UA 3IQHX 1RQRA 4PXAA 5E2IA 3UWOA 3KSAC 4EGQA 3W9YA 2UYYA 2ZIXA 4GDMA 5EWMA 1NW6A 1JPNA 1Y3AA 4ML3A 2YXPX 3WLIA 5A6SA 1BXRB 1Z68A 3IRVA 4MEJA 4R6WA 4P6YA 1X86B 3UTDA 5B3JA 3V3KA 3UJ6A 2FN3A 2G9UA 5AXBA 1S8OA 2GFHA 3ZWMA 3BMXA 2I1LA 5EP4A 3LJKA 4EPWA 1VQ6B 1VJ0A 4UU0A 1QP4A 1KAMA 5A7GA 3AF4A 1I4OA 2VDMB 1VFNA 3O38A 4Q6WA 1BWPA 1E5XA 4RIEA 3GFFA 3G17A 1RAHA 3E5NA 3ZS8A 1J0BA 2C3UA 3PITA 3PG5A 3GGDA 4JY7A 2A0UA 4M1KA 1T3ZA 5JDCA 3SNKA 1GN9A 3A04A 2RHGB 1OX5A 3CC2B 3ETGA 4YQFA 2GCIA 1NR7A 1SOMA 4DC9A 4DEXA 4M9RA 1JLLA 5CFMA 4HR7A 1XCOA 4NBNA 2ZJ5A 4L3VA 4R3NA 2JCXA 3RVOA 3ZWVA 2M6SA 3PTAA 4TN5A 1PWHA 5JWOA 2QLLA 3GJ6A 4JD5A 3PVCA 4OFXA 3STXA 3INRA 5SYNA 3DE1X 3QE9Y 2JLBA 4NG5A 2IOHA 1VFPA 4G4IA 3V8QA 3DB1A 3H5IA 1XZAA 4PPGA 1J8QA 3BGWA 3RVMA 3JARB 4PLFA 4Z7NB 5JNRA 3E9DA 1UWCA 3RBXA 3BRCA 3WZ2A 1YR6A 4F9EA 1MH1A 3JY6A 5LWHA 1YNSA 4ZDIA 3EUWA 2ZJOA 3A1UA 1WU8A 1EZ1A 1Y6QA 1JEJA 5BSUA 2VQ6A 4KE6A 4DQLA 4EH1A 2LNDA 4DUPA 6REQA 1PK7A 3NJRA 3D8RA 4PR3A 8OHMA 4XDHA 1IZYA 5L4NA 4GI5A 1GR0A 2XQKA 5JS7A 4HYQA 1KDTA 2WWVD 1CJCA 3IP3A 4REQA 1H1LA 4TWBA 3VOSA 1V11A 1DTWB 3KEMA 4YMLA 2ZIVB 3GPBA 3OKPA 1SBHA 4K6MA 2PNJA 1NVTA 2JS7A 5DBHX 4I6EA 2Z08A 5EE0A 1G21B 2Y27A 4G3XA 3OOYA 3H99A 5IX8A 5DBEX 3W6OA 3VU1A 1EZ4A 3QF4B 4LSZA 1CS0A 4ZOCA 4M76B 1XVIA 1O6GA 2EWMA 3M6UA 3AGQA 3C7CB 3H9NA 3NC4A 1NOKA 4WOJA 1E5VA 3NHMA 2PSJA 4TS4A 2OM2A 4MQ5A 4S1TA 1LSOA 1MTOA 1B73A 1QYWA 1ZN7A 2N1BA 2WD9A 2WKQA 4NQZA 3V1LA 2E1PA 3H4MA 4G56A 2IXTA 4AZWA 2NU9B 4CL0A 4LOAA 4CQLA 3R9XA 4M1OA 4N12A 3LP5A 3ZDQA 4V0MA 4IGAA 3EIQA 3B1JA 4RCZA 3VTZA 1KAHA 3NM4A 1DIBA 1SWWA 1YE3A 4UPDA 2DUJA 4D74A 3ILVA 2YJGA 1E9RA 1LH0A 3I6MA 4JLNA 3K92A 1QTQA 1DRVA 1ZW6A 2AUMA 2NTNA 2QRKA 2OFXA 2ZRIA 3P9RA 4ITRC 4ZT6A 3DYIA 1J5EB 1XPJA 2CL7X 3D4OA 5DP1A 4TV9F 1G7RA 1HMPA 1NJ6A 3JRNA 2YN2A 3WIVA 4XLFA 2BGIA 1UAYA 3KAKA 3FOZA 3F8TA 1SCAA 3UC5A 2JI8A 4BGIA 5AK0A 1U7HA 3HCAA 3N8KA 4RF4A 3NT2A 2H07A 4DLZA 3OQVA 4NOMA 2W4MA 3X44A 2BWJA 5MGNA 4B71A 2O14A 5CLLA 1IQRA 5DM70 1YVPA 1ZCFA 2BEWA 3MEQA 4M0MA 3SDSA 1TM5E 1NBHA 1GUAA 2QUBA 1DV2A 3AUAA 1EK2A 3OX4A 1USGA 1LS6A 3U1VA 2NUTA 5IS2A 1T26A 4CODB 1VC2A 4Q7EA 4X05A 2O6LA 4HDNA 4MWTA 1AUPA 1ZCBA 2F3SA 1CXZA 2FSIA 2JLUA 3ZWWA 1SOWA 2X40A 2NZYA 1JYSA 2CFOA 1PQPA 1C7JA 1S1MA 4HB4A 3LO8A 2A6PA 3M9LA 4H77A 4MDHA 3RTAA 1J8DA 3VYUB 4LWOA 4NR0A 3ISTA 3FTPA 3FDZB 1IB0A 1E9VA 4BAGA 3ESYA 16PKA 3G2KA 2EF1A 3PA8A 3P2KA 3OCWA 1USKA 2DFVA 5F4ZA 3MZ0A 3MF4A 2XVYA 3DTVB 4ON9A 1P4RA 4HVCA 2J7PD 1ISRA 4MAAA 4Y2JA 5DOZA 1J0AA 1ADCA 3I2HA 5E4FA 4X1KA 3VZPA 1UPFA 1UPUA 2DP4E 1I1NA 3V7UA 4D57A 1TMOA 5KSYA 2B99A 1G2IA 3RTBA 4P80A 4JBHA 4WVFA 5CYGA 1H8EA 1XTJA 3TCXB 3KSZO 4O5AA 1Q50A 1GUBA 3TQCA 4D82A 1T5BA 1SU8A 4BNWA 4C89A 3ESDA 3I4FA 3FPLA 3WLHA 2JEYA 4FSXA 3ZVKA 4DY4A 2KPOA 3WMGA 3IKJA 1PSZA 3Q3IA 4X6LA 3DP7A 2CLMB 5EG5A 4JP1A 4DLLA 4DV3B 3U56A 4P0TA 3WBBA 4F91B 4LJAA 2C04A 5LDHA 2C20A 5I9SA 2N47A 3H6KA 5LCXA 1Q0PA 2V5VA 2YWXA 3PE6A 4ZI2A 2I71A 1MIOB 3IDSA 5HBRA 3SD7A 1LDMA 4AZVA 3CKLA 5FFMA 5L9AA 3BFPA 1R0LA 1JDVA 2IXGA 4HDKA 4RVCA 4TL9A 4YGYA 1QANA 4XAQA 1V16A 3EIWA 4PTLA 3ZH9B 4CMGA 1VPVA 4GWLA 2D2IA 2OXEA 4R2WA 4Y6SA 4NABA 1YCDA 5BRNA 1K9SA 5COQA 4GP6A 4OI0A 4UJ5A 2P69A 1EGHA 3OEHD 1LTHR 4L51A 1EFTA 3RM3A 1YFLA 1JJVA 3T1YB 3BA1A 5HPYB 4EX6A 3CC4B 5HZGA 3D6AA 3H2GA 1QQAA 2H2HA 3BD6A 2PA3A 4HLDA 4Y67A 5DWDA 3U62A 4C2BA 1GTZA 3VSAA 3MHTA 2W43A 1FVOA 2O57A 2OCXA 1ZM2A 1UADA 4QASA 1PR0A 2VRCD 4C3UA 3DS8A 4PSKA 1NXWA 2XIJA 1PJ8A 3LLUA 4J75A 2YJ3A 4PZ9A 4IDEA 1YS7A 5JAHA 4KZKA 1NQXA 1C7ZA 3H75A 4V0QA 3PHGA 3K0AA 5TEWA 2W0MA 3TGPA 5J2TF 1X7WB 5DYWA 3PNVA 2YHSA 1B0ZA 3ZGLA 5AVTA 4DDVA 3JQ9A 1OAOC 4P1VA 4GZLA 4CKBA 1ISPA 3GUCA 3IDZA 1MQAA 1SVIA 4QBIA 4RXTA 2ZS7A 3MS4A 4P4GA 1E7RA 4DGQA 3WYGA 4TZ0A 1XJWA 2B92A 2H4XA 4DJ5X 3KE9A 2IX3A 4S0XA 1PWEA 2A14A 4X84A 1KMHA 1XELA 4M0CA 4X3OA 1UXKA 3Q8KA 2WPDA 2Q3JA 1E43A 3TIXB 3AF2A 3C8DA 4DIEA 5LR6A 1C1HA 3ELDA 3TE6A 1C9DB 2V0GA 1BS1A 1FZTA 1CY4A 1TZKA 1CDZA 1WKCA 5IBRA 3NHSA 2NACA 1SIWA 3JV7A 5CK4A 1A5AB 3SJCA 4UAVA 1UJNA 1YK1A 2R1TB 1ZH4A 1I6KA 1N8TA 2XVZA 4M21A 2VUTA 4KCGA 3M2TA 5FWYB 3X2EA 2D2XA 2X4LA 3JZDA 5FLXA 2E5LB 4UUOA 2JIOA 3MMNA 4ND7A 2IDZA 2XECA 2WYHA 4FUQA 4HIZA 1NYLA 1S1CA 4MLPA 4TXMA 2VZLA 3HFSA 4DM7A 5G41A 1T10A 2AN4A 3GY0A 1LF0A 3KOYA 2OHIA 4B79A 3GW8A 2FR8C 5CMLA 3QMMA 2R00C 3GCGA 3JVIA 3R5XA 5BYKA 1Y5LA 3A4NA 4XSVA 4FB5A 4EKEA 2CKDA 3V4LA 3FCAA 1N1EA 1GPLA 1FFAA 3CRQA 3PU6A 2ERXA 4X1YA 3SSAA 3U3KA 5DTMA 5KWJA 3U5TA 7ADHA 2OD2A 1RYBA 1SA0B 4UD6A 2H5EA 3DZIA 3IP9A 3PTLA 2VUSA 2X1LA 3O3MB 3KQOA 4I1UA 3UH1A 1F8UA 4FZRA 3Q3GE 1V5IA 3EZFA 3RC3A 1YS4A 3TVDA 2X6XA 4Z7OB 2YYYA 2BTQA 3RIHA 4ESVA 5BPHA 5BSVA 3JYQA 4LDNA 5AKYA 2G1AA 2QE6A 1E94E 4E31A 1J1UA 4ENUA 2BFNA 3G5AA 1A9SA 1LVGA 1OX4A 3E5MA 2C2HA 1IZ9A 4MR8B 5AW6A 5IAOA 1GZVA 4NBWA 1N9GA 3EUAA 3F96A 3KOUA 2H85A 2RHOA 2BDEA 1E2FA 3PGA1 4RCVA 4ZU1X 4CM8B 4TV9B 1GN8A 1EB9A 1VKOA 3VOBA 4EMUA 3H4IA 2FWAA 4FN5A 2HM7A 1GU7A 4LGVA 1XPRA 1G3RA 3O3NB 1CEEA 2DY0A 1OV4A 4N4AA 1B26A 4MHOA 3F9CA 2XNKA 4G1FA 2O5EA 2ZTGA 4L78A 4GO1A 2C4WA 4DQDA 1ULZA 3RRBA 4FWBA 5JLAA 4MULA 1PGNA 4MO9A 1KSHA 3PGXA 2V7UA 1U8CB 2X8JB 4GG1A 5TE9A 4DCUA 3O0DA 2AG8A 1ZK2A 4D0GA 1ONPA 3OZRA 2PZEA 4ICIA 4EEZA 2H18A 2WYWA 3D02A 4JJGA 4E5SA 2J4FA 3L4BA 1XLTA 5L3SA 4DA4A 3MBIA 2BFEA 3FVWA 2HK8A 3LF1A 3WZLA 2OKCA 3SR4A 2FGJA 4HPWA 4NLLA 4NAVA 1J8MF 2V96A 4POOA 3PS9A 2GEDA 4F6RA 5A4JA 4MUMA 4PQFA 3UA4A 2JGIA 4CMKA 2WFMA 4AX8A 5CGQB 1F2UA 3KFVA 1COZA 1DRJA 2D1SA 4PWZA 4ALMA 4ASUD 1Y7HA 2WJJA 3KQTA 1D09A 1SY7A 4M8IA 1SIBE 2NZ8A 3ZHSA 1JU3A 1NI5A 2NYRA 3EEFA 4X85A 2GESA 1G0NA 2Q8QA 3BMQB 3TTVA 1V6SA 5C51B 2OAGA 4RY0A 1IZ8A 3OF2A 4BDTA 3I0NA 3WA6A 1EUCA 5KUTA 4KAAA 2CZQA 2GJ9A 4K9MA 3WK8A 3ANTA 2NO4A 2M2IA 3MILA 5FP0A 4PRYA 3G5TA 4OMUA 5ED4A 5DHTA 3RHFA 2CBXA 3T4XA 5G1OA 2DC1A 2HY7A 2Q0HA 4X7RA 3GUHA 1T1SA 4J91A 4UNIA 4B7ZA 4ENVA 4RDLA 5ALNA 4OU4A 4B35A 1HORA 2C5GA 3G8CA 1UKYA 3VM6A 4W7SA 1AMNA 3EFEA 4FNAA 3BIJA 3GRUA 3JQRA 4I5GA 1RI2A 3TSZA 1HSZA 1RMTA 3FBTA 2FUCA 3TAUA 4KR6A 2GJPA 3MSXA 2YRXA 4BEVA 4D3FA 1N7GA 1J21A 1WP9A 2B2NA 3IIEA 3P7MA 4XCVA 4AZ0A 1JX6A 4OFBA 1M83A 4RH3A 2NUBA 1CJMA 1MMFB 4NNPA 2J0UB 1IXZA 4XSHA 2Q4EA 2NV4A 1ZJ6A 3HGQA 3KSRA 4RH1A 1J7KA 1P3DA 1Z16A 2VTVA 3LLMA 1FRNA 1CR2A 1VL2A 2DSNA 4UM5A 2VWPA 4LJLA 1QNLA 4QDKA 4QUDA 4IFEA 4UBLA 4O2AB 2ZXIA 3CC7B 2G77B 1OFGA 2VJMB 4FXPA 4HS9A 2QG6A 3A2NA 2Q41A 3T4PA 4HLCA 4A0RA 4G23A 1VQNB 5CDSA 4OI1A 3WL8A 1PJ2A 4AJJA 1K0FA 1WQ4A 4OF4A 1JKMA 2G83A 2XE4A 2CV2A 3A58B 5EE5B 1T4CB 1BMFA 1GQ2A 4IOKA 3PPYA 2ZZEA 1JF8A 2J6BA 2OZLB 4JUBA 4YP9A 1PR1A 4FM9A 2XMQA 4V0KA 3LV8A 2XT6A 2PQ0A 4TXJA 1G63A 5KOIA 4TUYB 2C5AA 3KELA 1WHTB 4HAXA 1K75A 3R7SA 1XL1A 3DHNA 3U4QA 3BTVA 4AS1A 1XC7A 3CFYA 3W1EA 4RD3A 4ZAXA 1J39A 4EL5A 4HL6A 2FMKA 2PS9A 3CLRC 3DE4X 2JJ8A 4YJHA 3SHVA 4HI0E 4CKXA 3QG1A 4RTRA 2BIFA 4BMDA 3MNFA 1SKYB 3RU7A 5LUAA 3A8TA 4KN5A 1G20A 4CFSA 4MHSA 3B1VA 2GJKA 3MXOA 5DDIP 1FW8A 5K6AC 2FP3A 4C78A 4LE1A 5J2TB 1TUGA 1ZGCA 1U80A 3GIWA 3PKIA 5GP1A 3CR8A 4LGMA 4RDCA 3VNRA 4L4UA 3URKA 1T3HA 1J8FA 2DUNA 1H2EA 1LLFA 1V8OA 2QW8A 2ZDHA 3JALA 2GZHA 3OH8A 2VDUE 1QCZA 4FHFA 3RB8A 5A1TA 1P81A 1IVYA 4C03A 2OO5C 4LJ4A 1YI0A 5IJXA 1T3GA 1I7DA 4NHOA 1NFQA 2BCJQ 3ZHTA 1UEJA 1OXSC 2H2IA 2H9IA 4CKWA 1ZGGA 1RCTE 1GGHA 2OCAA 2PZGA 1SXPA 4RZ3A 1W7AA 5EKDA 1EIWA 1E6EA 2EW8A 4RM3A 2RGEA 3U80A 4EM6A 1PDVA 5GY7A 2OFPA 2CK3A 1DT5A 1M1YB 2A1UA 2VA8A 4QUAA 2WWRA 3ZE2B 3FRIA 1M6EX 2DPXA 4MS1A 1ZC4A 1MORA 1WCWA 1THTA 2QW1A 3PXXA 5FYQA 4DCCA 4DIFA 4DWVA 4EELA 1SXGA 1GG8A 4XIJA 1JFSA 1Z2AA 5B3AA 1KDZA 1M34B 2PYDA 4FCTA 4H7PA 4XQ9A 3OCVA 9GPBA 1WZUA 3IUPA 2NU8A 2WKPA 4R8LA 2FGKA 4U2EA 3E2PA 3R7LA 3AV3A 4KLRA 4N8SA 1MA0A 1E3WA 2VZEA 1WABA 5IJ0B 1P1IA 3PPWA 5IFLA 4PQRA 1JNYA 4OXQA 4QNRA 2D0OB 5HSGA 3EFBA 4XR4A 5JSYA 1V37A 2HU5A 1NQ5A 2QLFA 1U2QA 1Z5VA 1Q7TA 3I83A 5IAAA 1NI4A 5HKKD 1XV5A 4ZCPA 1Y4AE 2QMHA 2I4MA 3QLJA 1Q20A 2QRLA 2H5IA 3H5VA 4G6ZA 3WWEA 3OSZA 1P9OA 3C4JA 5GAJA 2GVNA 4AZ3B 3TSYA 1F8GA 3DULA 3WKDA 4G41A 1ZJ5A 3R3WA 4JX9A 4BO8A 5J4YA 4FTWA 1HBJA 4PY2A 1ZEMA 3GT4A 3DMPA 4CLOB 4N3NA 3ESQA 1YZTA 5KU1A 2SICE 1PVDA 4KUGA 3ZJ5A 4YAGA 3AR8A 3KQHA 3TQQA 1DADA 3CF6R 1IHPA 2RC6A 2BDUA 2R86A 5A4DA 1WW3A 3DCNA 2B6HA 2Y6VA 3OD5A 4C7JA 4D9KA 1VYUA 1JPUA 1T0PA 4G09A 1TCVA 4UTPA 2HK6A 3I23A 3PB3A 4FBMA 3H5AA 4RF5A 1JKIA 2H11A 4OX9Y 2P3OA 4S1VA 4G89A 1DS6A 5LQUA 4DYDA 4JI0B 1YQ9A 1L8QA 3UJ7A 3EMDA 3T5MA 1OF1A 4GX0A 4ABTA 2XWJI 4Q37A 4LZLA 5DVZA 3C3WA 3K31A 2CMFA 3M70A 4YBRA 1T15A 3EF0A 5AJVB 2H7XA 1KVTA 2QTWB 1N6PA 2ZS9A 3E20A 2IU3A 3R44A 2IS4A 1GWNA 3GNSA 4WOPA 2IYQA 2J45A 3BQ9A 5B4UA 2PWZA 1TUBA 4FD2A 2D7CA 5HM8A 5GONB 4Z6KA 3CMAB 1YQEA 1E1RA 1MD9A 1Q17A 4HDRB 6AT1A 5LJLA 2NTEA 2IOQA 2O2XA 2ZT6A 1C14A 2EFYA 2RGAA 1Q44A 5AM0A 1GQRA 4CLXA 3SIPA 2GZSA 2PX4A 1YR1A 5EMMA 3SFTA 1Z7YA 3ADPA 3DO5A 4KYVA 2VT6A 5DTIA 3QFSA 1P0MA 4UJ3A 1RS0A 4YRDA 5DMXA 4IIBA 3OKCA 4UBIA 2FTKE 3SF0A 3CZ4A 5BT9A 5AQ1A 5EJ4A 4PLGA 3ZHUA 4DSOA 4HN9A 3THYA 4KK4A 4DV1B 2GF9A 4JLAA 4ZKEA 3UT5A 4JXKA 1G8JA 3FHOA 4WJZA 1GPDG 5BSFA 4P7GA 1IG0A 2RI6A 1JIXA 1FDTA 3HRHA 3E5HA 2PD3A 4G0XA 4ZVVA 4K05A 2W2KB 2XNJA 3HGTA 2XCUA 2WU0A 3CZPA 2F3RA 3F74A 4PYNA 4WKCA 2CCGA 1A5SB 1S4MA 3TOZA 3Q0IA 3ER9A 1LDNA 2AFVA 3OW7A 4QDXA 5HCUA 1R9MA 1C4XA 3Q8LA 5EJAA 2QXYA 3Q11A 3HCDA 3RNOA 4EATA 4DCSA 4OHRA 5JEDA 4ZU6X 2C4HA 4F3KA 1F0PA 3WGNA 4CIWA 1ECLA 2H31A 1AU9A 1R9GA 1DWUA 2DPHA 4XNFA 2DCMA 2OL4A 1ND6A 3O8CA 1PKVA 2B9EA 1BTOA 4OXYA 1KMMA 4KVZA 3BHJA 1S3FA 3AETB 1LPSA 3VU9B 1F9EA 1GUFA 5TX7A 1Y1SA 3ND5A 4E5UA 4UE6A 5JD4A 2OAQ1 1XZNA 1X2EA 2QRZA 4V02A 4BNDB 4C21A 3D5QA 2JK0A 5CEFA 2HMAA 4Y2VA 1PP4A 4W7IA 2XKAA 1WXGA 5A9TA 1DAKA 4OG2A 2Y1CA 3IQFA 1CYDA 3ESBA 3S29A 1SZJG 4B46A 1H5UA 3CF0A 2PANA 2PX5A 2X13A 2FR1A 2X6QA 5AK6A 1VQ7B 3PVZA 5LBTA 1C30B 2PSDA 3AI7A 5FADA 5HIJA 1N2GA 5F98A 4V0LA 3RRXA 1RBYA 2AIRA 1QC5B 1TAUA 5ALVA 3ZZ0A 1ENPA 3P9CA 1D03A 4QGHA 4DNFA 3AXSA 4FLMA 1T4GA 2LCFA 5G0VA 4WOKA 1TC2A 4CFZA 4ZICA 2C0PA 5LXTA 4WWHA 4X7EA 1KOJA 2ZB2A 3G8DA 3OM8A 2VBUA 1EU1A 2C4VA 1OI2A 3FTCA 1Z6QA 3GGPA 5KAPA 3RODA 3RT1A 3C6YA 3Q40A 3RYIB 3H1PA 3OWXA 4A10A 1T6YA 3AOEA 3L01A 3PWKA 4Q0MA 2CBZA 1JPJA 2FN7A 3GVCA 4JLJA 3A14A 4LWQA 2QR5A 4ND8B 1RXIA 5DYIA 3WGJA 1SZCA 3MA0A 4RORA 1XTPA 1ZISA