5DT1H

Crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
245
structure length
243
Chain Sequence
b'VQLVESGGGVVQPGTSLRLSCAASQFRFDGYGMHWVRQAPGKGLEWVASISHDGIKKYHAEKVWGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAKDLREDECEEWWSDDFGKQLPCAKSRGGLVGIADNWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy chain of broadly neutralizing antibody VRC26.25
publication title New Member of the V1V2-Directed CAP256-VRC26 Lineage That Shows Increased Breadth and Exceptional Potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H01
4KTEL 3QDMA 4HCRA 2EO9A 1JHTA 4IRZH 5IB5B 1PQZA 1TCRB 1WBYB 5MEQA 2NYYC 1FORL 2AEQH 4BSVB 3QJHA 3BP6B 1IQDA 2PXYA 5H37H 4IDJL 2APTA 2E9IA 3MLRL 3RWJA 4YEFA 5JW3L 3QPQD 1MY5A 1DLHA 5I1EH 3LKPA 1HQ4B 1A7RH 5ADPL 2CKBH 3LMJH 3P9LB 1MRCH 4FQXC 5DURB 1WZLA 3CFIC 5JHLH 1FYTA 1MFCH 1WUNT 3WUWA 1RIHL 3H9ZA 3VCLA 4FP8H 4X9BA 1BIHA 2F53A 3HE6D 4Y16A 4IRJB 4DJMA 3MA7B 3WDJA 3I3EA 4L4VE 3KPRD 3CUPB 2A0LC 1NLDH 1VPOH 4PG9B 3BZEA 3SOBH 3IDMB 4OTXH 1GGIH 1JRHL 5ADOL 2J8UA 5T5FH 2B2XL 4RGMB 3D25A 3MV7A 3MUGA 1S8DA 5C0BB 4XCFL 2VLJE 1EO8H 4E41E 2Q87A 5EPMA 3RKDD 5BZWA 4POUB 4BQ8A 1DLFL 4WVRA 2VDKH 3SDCA 4XCEA 4Y5VA 3O9WB 4MD0B 2VC2H 3IDYB 3NCCB 1FFPB 2XOTA 1FP5A 4TSBL 5DK0A 5DFWH 5KVEL 2YPKB 1ND0A 3DMMD 5F71A 1B0GA 1YECH 3GB7A 4FQQB 4K2UL 4PJCE 3EYOA 4LSTL 1J8HE 2JK5A 1NBVH 4L4TA 4M48L 4WNQB 3DVNA 1KXQE 4QY8B 4CJ1A 2BP3A 1GPOH 2IFFH 1MI5B 3FHQA 3FQNB 3RA7H 4M5YH 2GYSA 1KPVB 4PJEE 5AD0B 3RQ3A 4J3OC 4RGMC 1FFNB 2Z93B 4JRYA 4NPYB 2X89A 3MLVH 2UY6A 4YPJA 5KSBA 4J4PD 1FIEA 2I60L 1FC1A 5DQDH 4XP5L 1JZ5A 4OZHE 1BGXH 4XPTL 3IDNA 2VLKB 5EBWA 5T1KB 4R4FH 4EDWL 4ZTOL 3U9PL 2GTZB 3D5OF 1A6WL 3SDXF 3DUUB 2VZOA 2GJ6A 3O9WC 5GS2H 3IDYC 4NO2A 2H41A 4UIMB 5JPMB 3EOAA 3LEXB 3BO8A 4WY7H 4XB7A 4BUGA 4RX4D 2X9YA 3UTSA 1U2HA 1N5AB 4OBSA 4IRZL 5GZOC 5F3HA 4IM8A 3NCEB 3R4DA 5GGUB 1K5NA 5GRVL 4HIJA 2VN4A 3IFNH 5IR1A 4I13B 2H26A 5CKAA 1VGKA 1MJJB 5C0FB 3G5ZB 3L95B 3GBLA 3LHPH 5GGTH 1CXHA 2GSGA 3LMJL 3BN9D 5D7JD 3ZLQC 1PLGH 4WW2F 3U4EA 4NNYA 3NCBB 1MFCL 2YS4A 4ODVL 3VDCA 4CADA 2BSED 5MENE 4FP8L 3VI3E 4GRLA 1MFEL 2Y1VA 4BQ9A 5IBUB 4HUVB 1HSAA 2AK4D 1VFUA 4XH2A 1I7UA 1UGNA 4Y88A 3JUZA 3BWUC 4LHUD 4PJ9A 1NLDL 1VPOL 4NQDB 3UYRH 3E0GA 1KCKA 3GGWB 2E27L 5JW4Q 3SOBL 2DWEA 4OTXL 3G6JA 1A47A 4YHIA 5T5FL 1YMHA 2VZ1A 2HKFH 3ZE0F 2FSEB 1G9MC 5CJBA 3GMOA 2AEPH 4XNQA 2IH1A 3VGDA 3HZMB 1VFAA 3BPNB 4QRUB 1EO8L 3QJFA 1XF3B 3VDAA 2XQBH 4PJGB 3QI9A 2ESVB 1FNGB 4QXUL 5ESVA 4LAJH 5I66B 2VDKL 4PD4J 4JRXD 4PG2C 2JIXB 3U7YH 5BZDB 5FO9A 1A1OA 1YQ2A 2MKWA 4UZGA 5JIIA 4IRSC 3CVIH 2ITDB 1YECL 2DB8A 5IMKB 4PGEB 4RMVA 3ZKXB 4Y19B 1NUNB 1PKQE 2IPUK 2X40A 2IFFL 2AJ3B 5GZNC 3RA7L 4JGMA 4M5YL 3OKMA 5J13B 4IEFB 4OQTH 1HN1A 3CFJA 2L4OA 2X4PA 5DR5H 2Y5TA 3ABZA 3DI3B 3MLVL 1YDPA 3BPNC 1HHKB 5BRZD 5DQDL 3WHXB 5JUEH 3AS0A 1MLCA 4HK0A 4JFEA 3G5VB 1AY1H 3ILQD 4O02H 3IJSA 4R4FL 5IB3B 1FNEA 3JV4B 2AJSH 2CLVA 4D9LL 3GHBH 1XGUA 4XX1E 2FX8L 5CD3B 4WY7L 4XBGA 1WZMA 4PJDB 3EJZD 2ZUSA 1N5YL 1X4ZA 3STBA 2JJVA 4HH9A 3PL6B 2OMNA 2Q86A 4RMTA 5B39A 1T5WB 4AIXA 5AWNH 3U83A 2H1PH 3IFNL 4R2GC 1MH5A 3ZKQD 1OW0C 5HGBB 2G9HA 3MRHB 3LHPL 4D0DB 5GGTL 1J1XH 1A9EB 1NJ9B 3MO1A 1PLGL 2IQ9H 2DQGH 3L6FA 2VISA 5C0BE 4LQ1A 5D7LB 1OAKH 3HE6A 5EZIH 3UBXA 2HJLA 3QUZD 3CFEB 3KYMA 1EEYA 2BNUA 4EEEA 5D2NA 2CKBA 2NY6C 3MCG1 1BOYA 3LN4A 1CD1B 3KPRA 3UYRL 2FD6H 2VLRD 2OL3B 4G9DB 4HIHA 3LSOB 4Q9BA 3TESA 1W0WA 2R23A 2P5WE 1OY3B 4NO3A 4ONHB 3NCJH 5F7WC 2X7LB 3C8DA 3TIEA 5F88B 4X0KA 4PJFB 1GAFH 3N1QC 2XQBL 4MQ7A 1U91A 1UYWL 2YBRA 3NA9L 4RCAA 5TDNB 3D0LA 3SPVA 4JJ5A 3U7YL 5A16A 1PAMA 4NO0D 4LSRH 2EDWA 4ISVA 3FZUD 4MAUH 4L9LB 1XCQA 4NKOA 4XPBH 3DMMA 2ERJC 2VLKE 1INQB 3OKEA 2ZG1A 2RR3A 1PEWA 2Y07H 4WEBL 1X44A 1B88A 4DKEH 3R8QA 2NCMA 3MR9A 3WIFA 4YX2H 1KJVA 3QQ4A 4LCCB 5T3ZD 2J6EA 3MFFB 5DR5L 4GW5A 1RD6A 5DK3A 4ODTH 1D5IH 2H3NB 2FZ3B 4PLKD 4ODWA 3V8OA 1WBZB 4J4PA 5JUEL 1VFOA 1AY1L 4WW1A 1NCCH 5FYLD 5IV2B 3OKNB 4PJHA 2AJSL 3RL1A 2FYYA 4FN0A 5EU5A 2SEBA 1G7IB 3GHBL 3ARWA 4GOSA 3WJLC 3BT2H 3EFFB 4HC1L 3MRIA 2BC4A 3ULSB 4GKNB 4RX4A 4ZSOB 4L9LC 5T33L 4Z76B 3RWFA 4KI5D 1NLBH 5AWNL 3JWOH 1AR2A 3NOIA 3OGCA 1FZOB 2NLJB 1TNNA 4ETQB 4NQDE 5K33A 4M7LH 4LCCC 5E94A 4NRZB 3O3BB 2NPLX 1WK0A 5D7JA 2HP4A 5ICYA 1S9VB 2DQGL 1RZFH 4Z7UE 1RUQL 3EZJB 4DOHB 3E8UH 1QNZL 1VADA 3V5HA 4YR6B 1FIGH 2ATKB 5EZIL 2AI0H 2AK4A 4K3GA 1E4WH 4M00A 4WO4B 1FDLH 4F9PA 1YY8B 2FD6L 4LHUA 2CH8A 2J8OA 5CEYB 1XR9A 1HXMA 1JZ8A 1VB9A 1FBIH 3FB6A 3N1FC 5ITFA 5GGVY 1F90H 4O00A 2V5SA 3CU7A 4FQHB 2Z8WC 1GAFL 1T6WA 4W6XB 3VFWA 1PJ9A 4M6NL 4Y19E 2GSIA 2J5LC 4CVUA 1D5MB 5SWQB 1R0AH 1SJVA 5JW4R 5JORB 3X14A 5KSAB 1BBDH 3WEXB 1CZ8L 1Q72H 3BP4A 3WLBB 4HKZA 2V2WA 4PRID 4LGPB 2OP4H 1HEZB 3L3OA 4JRXA 4LSRL 1J0IA 3UCRA 1BVLA 5D1XD 2FIRT 1RJZA 2DM3A 3EOBA 3V6OA 5K9KA 4MAUL 2GI7A 1JF5A 4XPBL 1FO0B 3NN8A 3WNLA 3OJ2C 4KXZH 4L8BB 1KIRA 3VE0A 3SE8H 3IVKB 3CIQA 5IM7B 3VD5A 2Y07L 2W59A 4HUUB 5IP4A 5L0QB 5D5MB 3ROOB 5C0JB 3BPLB 3OJMB 5KN5B 2ZCKL 1FLRL 4YX2L 4PRHB 4GQ9H 4GMSL 4ACPA 1U42A 1FJ1B 4C56E 2CUMA 4ODTL 1D5IL 1EUTA 4U2ZA 3PHQA 4LEOB 3IXTA 3EOTH 5BRZA 2MFNA 5KSAC 1NCCL 4I48A 3RNQA 2AERT 2I9LA 4N5UA 3L3HB 5GRWA 5BJTB 3UEZA 1OF2A 1XR8A 3GKZA 4XI5D 5F9JB 1QLFA 1GGYA 2X6MA 3RWIB 3BT2L 1Q9WA 1UACH 4U3XA 1KELH 1OL0A 1IQWH 3CLEH 3HI6L 1H3GA 5D7LE 1NLBL 3JWOL 1D6EB 4YE4L 3MRCB 3KPQA 4YQXH 2DM7A 2AJYH 4NSKB 5L0QC 4DCQB 3CX2A 4RGND 5IVXB 4H8WC 4MA8H 1A3LL 1J5OH 3HKFA 5HY9A 4D94A 4M7LL 2PW1A 4MB5A 3JVGC 1RZFL 1CE6A 3V0WH 1RZJC 1UXSB 2E9WA 3RZCD 3I6LE 3TH3T 3OAUH 1ZHKB 5IB2A 4BK4A 2VDNH 3E8UL 4Q9QL 1FIGL 3U82B 4H25B 5KVMC 4AT6A 3C9NB 2AI0L 5F3BB 2PF6A 5HPMB 1A1NB 1HHHA 1CDCA 3QUZA 1E4WL 4UQ3B 1FDLL 3AY4C 3MJ9A 3AB0B 4L3CB 4X6DB 2VLRA 1FBIL 4PV9A 5FOBA 1F90L 3BH9B 3WO4B 5JO5A 2F8XC 1QR1B 1DL7H 2EDBA 1C12A 4OZFA 4HV8A 3FRUA 3IDGA 1R0AL 2JB6B 4QOKD 1BBDL 2XWBA 2BVTA 3SQOL 2EZ0C 3AMLA 5IVZB 4MCYB 2OP4L 3FJTA 4HK3N 2G5BB 1PX3A 4GRMB 3VGGA 5HHMD 4NO0A 3QDJB 1P84J 4XWOC 3V4VH 1QACA 4NQCD 3DURA 4NWTH 5GS0L 4OD1H 2Z91B 3CH8A 2DLFH 2LE9A 5FYKD 4EI5B 3GSXB 3SE8L 3IFPB 3KG5A 4L3ED 3T65B 2YUWA 5DJZA 4WFGD 4LLWA 1UXWB 3AB0C 4FFZH 5DQJA 2IPUG 4Q97A 1IILE 1KIQA 4JQIH 4RAVB 4OCRH 3WO4C 4GQ9L 4PP1C 4LCWB 1YNTA 2BSSA 5DQ9B 3T4AB 4AL8H 2W65A 1G84A 4XBPA 3U0TB 5JA9A 5JR1H 1JHKH 3TH2T 2ADGB 2F54D 3HLAA 2VAAB 4K7FB 2BY3A 1E4KC 4U3HA 3TN0B 4LCIH 1MJ8H 2W9EH 4OFVA 4W4OC 3HE7C 2H45A 1K4CB 1UACL 4NO5B 3TBWB 1BD2D 4DK3A 5K9OB 1KELL 4KKCD 1SEQH 3BMVA 1IQWL 4OCMC 4OB5L 3CLEL 3QHTC 5EO1A 4DUXA 3CSPA 4DOHE 2FL5B 4HG4J 3STLB 4EI5C 5HHXL 2XNAB 4J12A 4GLRH 1X7QA 2Z35B 5DJ6A 3H9HA 2AJYL 4U1HA 3NFNA 4HKXA 4MA8L 4LLYA 1J5OL 1HHJA 4JPWL 3PGFH 1A14H 3P9MA 4WI8A 4TVPD 1LO5B 1BX2A 2BHUA 4ZUWB 1BZQK 4U7SA 3TO2B 3V0WL 1RZIA 1NGPH 4NQSB 4AM0B 3DX8B 2ZOKA 3OAUL 2XN9B 3V0VA 4ZS7H 4NKDA 1S7TA 3ILPA 4YC2B 2PR4H 1QFUH 4WJ5A 2E7MA 4U0RC 4BYHA 3PGDB 2Y6SC 3TN0C 2DWDB 1QFWH 5DRNA 3TA3B 2X2YA 4JFQA 5HHPA 4JFYA 4KWUA 3TNNA 1B0RA 1Z6JT 3I02A 1U8KB 4QTHB 5D1ZC 9CGTA 5I18H 1DL7L 1OLZA 3QEQB 1OTUC 4Y4HD 1A6TB 3LKQB 4QHUB 4XVJH 2EIBA 1DBKH 3TPUA 1OSZB 1MVUA 4PGZA 5E2WH 2O61B 3CK0H 1BJ1H 2NY4D 1S9WB 3NPZB 4PRHE 4PRIA 5DRXA 5CEZH 2YEZA 4QXWA 1H5BA 5IHLB 1HYRC 3RUGB 1I85C 4OI9A 1JZ3A 2Y5EA 4AZ8A 3V4VL 4F9LA 4NWTL 5D1XA 4UU9A 2ICWB 4HEME 3BXNA 3MODH 4YC2C 4OD1L 5A2IH 2DLFL 3OXRB 2R0ZH 2IH3B 2J12B 5TJWK 1JPTH 1LP9F 3JWDC 3BAEL 2J2ZA 4HX1A 3TA3C 3ULUC 5CFHA 4FFZL 2IG2L 1U8LA 2HG5B 1CFQB 1PEZA 1KCUL 4OCRL 3FONA 2XZAH 1MCQA 2DLEA 3VRIA 1JCKA 3G5YA 5IESH 4AL8L 4OKDA 3BZDA 3O6KH 3QUKB 3G08B 5JR1L 2APXA 3MGTA 1A7OH 4D8PA 5J1SC 1CG9B 5IVXE 4JY5L 1MLBA 4NCC1 1PGRB 4X4ZA 5I74B 3WDIA 5IJVB 4LCIL 2W9EL 1T66C 3EGSB 1S7QA 1CYGA 5E1AB 2YSSA 1MCFA 1SEQL 5HDQH 1LE5A 3HS0B 4LCUA 3IXAA 4GW1B 1W72L 3GKWH 4GG8B 5HHNB 5JW4N 2HFFA 3BP5B 4YHKH 3K46A 4QYOA 3N1MC 4DKFH 5DDHA 4WU5B 2WAHA 5JDSA 2BNRB 3DRQA 2IBGA 4LQFH 5CD5C 4X6DE 3OAYH 4JE4B 1A14L 3DIFA 3ARDD 3OKYA 3SGKC 3FB5A 4OV6F 1KXTB 1S7UB 1B6DA 5GGRY 3VXRD 4ZAKB 5T1LB 3RZCA 3PABA 1R24A 4EUPA 2PR4L 1QFUL 2WP3O 4Y4KB 5I74C 2Q7YB 3LRSA 2LTQC 4APQB 1FC2D 1QFWL 1I7ZB 5FM8A 5GQBA 4M9OA 3FAXA 3QDJE 1T7ZA 3DRTA 3WL9B 3O6LH 3GMMA 4OCWH 3VA6A 3TBVB 2IBZX 4WU7A 3PF2A 5I18L 1RQ5A 1AKJB 4OKVB 3GUTB 4HWNA 4XVJL 4CN6A 3O6MH 1DBKL 5MEOA 1HQRB 3OPZH 5DD0H 5J6GB 2ARWA 5E2WL 2D0HA 3CK0L 3Q6FB 4QOKA 1P7QD 1ZLWK 5H94A 5CEZL 2P45B 5B3JE 3C5JA 1WISA 4JDVB 3V5DA 3MODL 4NQCA 1YNKL 1C5CH 2P8LB 3O2DL 2R0ZL 4NQXA 3T3MF 3ALWA 2WZPD 4Y4KC 5HYSB 4APQC 4L3EA 4U1KA 2OR9H 4LVNC 3BN3B 1KJMA 1UM6L 2BOBA 2GY7B 1P7KA 5AUMB 4RIRB 3VFSB 3ULVC 3WFBH 2XZAL 4OFKA 3SKUD 3H9YA 1RUPL 3WLWC 2QADB 1GHFH 2FEDC 3P73A 5IMOA 4OZIF 5IESL 3RWGA 1CIDA 3O6KL 4AIOA 3V4UL 1A7OL 4Z0BH 5E9DD 3IAPA 3BVNB 3CDFA 3ARUA 2WINA 2F54A 5J9PB 1H3TA 3WS6A 1TZHA 3HI5H 4OAWA 1NGWB 2ZOLA 3CJJA 2QEJA 2G60H 1HOCB 2KL6A 4XPFL 5FV2A 1BD2A 3HZKB 1JHLH 2XN9E 3IRZA 1LVEA 3EAKA 4PJ8B 4ZFZB 3GKWL 3Q0HA 1NCAL 1ZA6A 3ZKND 4R7NB 4HUXB 1Y6NR 1K3ZA 3RWEA 5JPNB 3WDHA 4DKFL 2B20A 2WQRA 3BH8A 1S7WB 3ULUE 3BGFB 4LQFL 1N2RB 3U46B 3C5ZC 2VXVH 5ACZA 4Z77A 1YN6B 2XG4A 4EI6B 2QADC 4IIQA 5FO8B 1IFHH 2BDNL 2BNQD 1QHPA 3QEQE 4DVBB 1QVOA 4L9DA 5HTSA 1FL3A 1OLLA 3GZKA 5J89A 1PG7H 5C0CD 1AFVL 3OKKA 5ERWB 1S9XA 4OT1H 4G42A 1MCDA 2BVUA 2J7LA 5E56A 1X5AA 5FA4A 1B4JL 5I15H 2BOCA 4OCWL 3T0EB 1LE9A 4YDLB 4YUEH 5F89B 1P4LB 3QUXD 2QQLH 2PKDA 4PJ8C 3S3JA 3FOLA 3RWCB 4JN2B 1JE6A 1SJHB 3FRPA 5E99L 2HKHH 2A74A 2D0FA 2IADB 2CGRL 1CGTA 2PCPB 3BGFC 4FXKA 3OPZL 4YHLH 3MXWL 3L7FB 4NC1C 5I30H 4HCRL 4R6UA 3BZFB 1P2CA 3V7AG 3DVGB 5EZJA 2IBZY 4UQ2B 2VR9A 3TJHC 2V7HA 3O8XD 4V1DE 3Q1SH 3BIKA 2FX7H 1KUMA 1QSVA 2CD0A 4P2OD 5L2KB 1IGTB 1IMHC 3N1GC 1JPFA 2MQCA 1LO3H 3OAZH 3T77B 1AHWB 1YEFH 1QSFB 4F15C 1ZGLM 2Z92B 3ES6A 1F4WL 3GSVB 2XWJA 5MP6H 4JQVA 3T0EC 1MHCB 4MA3B 4YDLC 1OQOA 4ZD3L 3TVMD 3U0PB 4FFYH 2WWMD 1QBBA 2J88H 4FQCH 1NPUA 4PJ7B 1GHFL 2WWKT 3L5JA 2EH8H 2P48B 5EN2A 1WWCA 5EU6B 2E7CA 2MHAA 1WICA 3AFLA 2DJ4A 5GS1A 4Z0BL 2BNRE 3K80A 3N85H 3KPPB 1S9YB 5JZ7C 2OCFD 4I9WD 4F7TA 3U6RA 2COQA 5JXED 2G60L 4CVXA 3K4AA 4GUPA 2E9JA 1C7TA 4X7CC 1DFBH 1CLOH 1ZHNA 1ZTXH 2VDLH 1AHWC 2HJKA 2A2QT 4Z7WA 1F6AB 3MSPA 1A9BB 2VNCA 4U6HA 4LKCA 1JYWA 4UMGA 4HLZG 4K3EL 2ZG3A 4DGYL 5BVJB 3ARDA 1OAQH 3U7AA 3STZB 3ULVE 1W2KT 4U6YB 1LDSA 1B3JA 1TZIA 2R39A 3VXRA 2NX5D 4FFVC 4F33B 1YY9C 3RVWD 3WJJA 5KS9B 1UZ8A 1CR9H 4BH8A 4OCYH 4HLJA 4OLVH 5C08D 1PG7L 5IW6A 3MMEB 4KROB 4MX7A 5I1LB 4OT1L 1J0KA 3EZ8A 4ERSH 1ORQA 1HCVA 1IC4L 5I15L 4YUEL 2QQLL 4PRBB 3JTSB 2E7HA 4GS7C 4IBLT 3E6FA 3QDAA 2XKNB 2HKHL 1U95B 3GSQB 3VRJB 2BMKB 1EHNA 1QFWM 3DV6B 4GBXC 4WHTB 2ICES 2OQJB 4YHLL 3GHEH 4U6VH 4Z7VB 2C5DC 4HF5L 5I30L 1NEUA 4PJIF 1P7QA 1UWEL 1MHHA 2VE6A 4L4VD 3IFLL 4D9QE 2APWA 3Q1SL 2DKMA 2KPNA 1JWUB 4WV1C 3LQMA 1LO3L 5HDBF 5LKNA 2JCCF 1YEFL 3GMQB 4KROC 5EIVA 3TCLB 3FT3B 4PGBB 3BJLA 1JNHA 1SEBB 4FMFA 4D0BA 3LKOB 4N0FA 4WHYG 4D0CA 1U41A 2VLJD 4E41D 1XF4B 8CGTA 3MJ8A 4TNVF 3QEHB 5TPWL 2VYRE 4L8SA 4P59L 5LGHH 4FFYL 2J88L 2LAGB 4FQCL 3E2HB 3WUWG 1IAOA 1LHZA 1MRFH 3BW9A 2R4RL 3WN5B 3ZDYE 2RGSA 4E42A 3N85L 2D7NA 5E9DA 3KPMA 5FGRA 2AJXL 1NBYA 4XTRD 4NC1E 5FYJE 1J8HD 1R3KA 1QLRA 3LS5H 3CXDH 3RWHA 4JDTL 4D3CH 3GO1H 2CXKA 4PP2B 4B41A 1DFBL 1CLOL 4ZDHA 5BOPA 1UCBH 4Z7NE 1ZTXL 2VDLL 2D9CA 1IE5A 2VZUA 2OTUA 5DS8A 1S5HB 2UUDH 2EXWD 3QG7H 5I1IL 4WIQA 4DZBA 4UTAH 2D0GA 4KUCD 1CQYA 1I3RB 4QTIH 5EUOB 3VJ6B 1OAQL 3QXDA 3T0EE 3E2HC 4LNRA 5GGRA 4GSDL 4G7YH 4G6AC 3H7BA 3TBTB 1LEKA 2BNQA 4WEUD 1YQVH 1CR9L 4OCYL 3MLPA 5DJYA 3FO9A 4YDVA 1FH5L 1I9RH 5FA3B 4S2SA 1AQKH 1VKXB 3DV4A 2BVPA 4GO6B 4XAWH 2AXGB 4ZUVB 1UA6H 4Z78B 5C0CA 1MIML 4FTVB 4ERSL 3RL2A 5FB8B 1YMMB 1I3GH 1UB5A 5DUBB 4CUCA 3IKCA 4ZFGH 1T2JA 3LEVH 3BKCH 3MGOA 4RA3A 4WDIA 5IW1B 4U1NB 5JOFA 3QUXA 1REIA 5CKGA 2BSTA 3QIWD 3MCKB 5DJ8A 5L8LB 2V5YA 1RZ7H 3AS2A 4GRWB 1QSFE 5C0DA 4HS6A 4U6VL 5IIEB 5SWZE 4KK6C 1T89C 5MEND 3TZVC 2DLHA 2R2BA 4N0CC 2BZDA 4QKXB 4ODSH 3VWJD 4HZLA 5JXAH 1CFNA 4PJ7E 1BREA 3O8XA 4E0RB 2XACC 4ODXB 5EU6E 5TE6H 4DEPB 3SKJH 2IPTH 4P2OA 2VLLA 5T1MA 4ZTPH 3MROA 4JFDD 5I1AA 1U8PB 1I8IA 4DVRH 5EBLA 2NYYD 1PZUB 5HI5C 4I0CC 1EAPB 3WUZA 2IANB 3KDMA 2V9RA 1XGYH 1NAMA 4D9RE 2EDNA 4G8EB 5LGHL 3CFKA 2NTFB 2FBJH 3TVMA 1ETZA 3PWVA 5F7MC 1HDMA 4X5WB 1MRFL 2EIZA 5DK2B 1D9KC 1GZPB 3VXPB 5C07B 3T3PF 1K4DA 4JZNB 4FQXD 2ARJA 1GRWA 1GYAA 2R4SH 4KJPC 5HBBA 5A3IC 2R56H 5SX5H 4DFIA 3T2NL 5LGJA 2HVKA 4NN6B 1Q0YH 3D3VB 3MRFB 4GFTB 3KYNA 2EDYA 3CXDL 5JXEA 3M17A 1JTOA 4D3CL 5KS9E 3LOWA 4G9FB 4U1SB 1DDHB 5JLZB 4JAMA 4WCYL 1UCBL 2A6JB 2HN7A 2D03H 3C60D 5FYKU 4R90H 4PJAA 1EHLH 3AS3A 5I16A 5IMMA 1BM3H 4PJBE 3HN3A 3BEVB 2ADJB 1AE6L 2VXUL 4BFIB 3BKMH 4UTAL 5JMRA 1T7YA 4QTIL 4DTGH 3MRQA 3GI8H 3OKDA 4FABH 5HVFB 1FRGH 1H0DA 3B9KB 3UX9B 2NX5A 1YQVL 5DURD 1J10A 4JY6A 1AXTL 3LV3A 1KENH 4XP4H 1NKOA 4Z7VE 2JB5H 1AQKL 4HS8H 5C08A 4U33A 3ARXA 5FM5O 2R1XB 3P77B 2CDEB 4NN6C 1UA6L 3QIUB 5DWUH 4PBWD 4IRJD 1OP5H 2PTUA 4D2NA 2J6EL 3Q6GH 2EDEA 4P9HH 4G5ZH 5BCAA 3X17A 1I3GL 4ZFGL 2FJFB 5CWSA 2P5EE 1A21A 1FGNH 4OIIH 5ICXA 4H1LB 2CDGA 5LVEA 2KQMA 4G80B 5IEKA 2W0KA 4HUNB 4XMLH 1RZ7L 3ZDZE 4MNGB 2EDKA 3I9GH 2HLFD 5C0BD 5EWIH 2GITB 3RHWF 4YHOH 3BGMA 5CS7A 4ODSL 3O81A 4DZ8B 2P46B 5JXAL 5C0AB 4X8JB 3O9WD 4L4VA 4WFEE 2ZG2A 4W6YB 5B39G 5TE6L 1X5HA 2C3VB 4JFXA 4JRWA 2IPTL 4PREB 2FDBP 5IB4B 2O5XH 3WNNA 4OFPA 5GZOD 4ZTPL 3MGAA 3QIUC 4KHXH 1ITCA 2NY0D 4NRXB 1U8JB 4X8XA 4HFWA 1C5DB 4YO0A 1XGYL 4ZNCD 2VLJA 4E41A 1E4XI 1MI5D 5TGBB 2Q76A 4IHOB 3PHOB 5J3HC 1L7TH 1WLHA 2FBJL 3H3KA 2ENYA 3GRWH 2R2EB 5ALBL 3H42H 5H37G 3HI1B 3U7WL 4G6KL 2BVQB 3T0VA 4JFHD 4O2EB 3T2PA 3UBXG 3U0WH 2R4SL 4Y0GA 1RZ8A 2R56L 1PVHA 5T1KD 2VLKD 5BQ7A 4R8WH 4R4BA 1Q0YL 5EUOE 2A6DA 1F4YL 1J8HA 1G9MH 1HH9B 2ITCB 4YWGH 2ICWI 3S37H 2CK0H 2GK2A 5EO9B 1AC0A 3F58L 3B9EA 1XCTA 3WKNA 3EOYG 1EHLL 5FK9A 1I8KA 2ADIA 4P2YA 3NFSH 5F1SA 1D5ZB 3DSNA 2QSTA 3QA3B 4M8QA 3BKML 4FQIH 1H15A 3AAZA 4NYLB 1EIBA 1HH6B 1YMME 4OZHA 5FECA 2Q6WA 4DTGL 3GI8L 5C0EA 4HSQA 1MUJA 1TVBA 5C1MB 1JUFB 1G7MA 2GTWA 3F7VA 1FRGL 3WBDA 1UFUA 2XG5A 4GKZA 1KENL 3HRZB 4RMWA 3DX7A 4IOSD 2JB5L 4U1IB 4HS8L 3SJVB 4KV5E 4YXKL 4L5FH 3MREA 5CBAB 5DWUL 5TE7L 3D39D 3WFHA 3F6IA 3SKNA 2H9GB 4YGVB 4P9HL 4IOIB 1IC1A 4G5ZL 4JPIA 4CMMA 1HCFX 3EFDL 3HPLB 3QZWA 4NQDD 5GJTL 3RDTB 2E7LC 1FGNL 5GZND 5FO7B 1JPSL 3RPKA 2B39A 5F1IB 5CILH 4XMLL 2W1NA 3QIWA 1ODAA 3I9GL 5DRZA 4WI6A 3H6JA 3REWB 3KPTA 5EWIL 2IANE 5MENA 1HWGB 3DXAB 2ESVD 4WI5A 3VWJA 3BEWA 5ENWB 43CAA 1JFQH 1YPZF 3ZZ1A 5F1NB 5HDOA 5KSUB 4HWZB 2JIXD 3QWRD 2DI9A 5J1AA 2ED9A 3SO5A 1L0QA 4FXLA 2O5XL 4O5LH 4NJ9H 4KHXL 5A40E 4JFDA 1G7HA 2NXZB 3D3VE 4HW6A 2R8SH 4Y19D 3REVB 5D71L 3RDTC 1X6NA 4G9FE 5H8DA 3GRWL 4X4XA 5DYOB 3OKOB 2OK0L 3H42L 1EFQA 1KIPA 2W60A 4L8CB 2CMRH 2LU7A 1O5DT 3MJGX 4MDJB 5B3NA 1JNLH 1I1AC 1IKFH 1BIIB 1CLZH 4FQXA 5HYEA 3CVHA 4TRPH 4FXGB 4M7LT 1KLGA 3RIAK 2BY1A 2P24B 1KTDA 2J8HA 5E8EB 1XGRB 5D7IA 3W39B 1G9ML 4YWGL 4NNXB 1JGLH 2X4OA 1PKQA 2O93L 1KV3A 3S37L 1X6LA 3EDFA 4CMHB 1J88A 3ZSSA 5JDJA 4RSVA 3C60A 3PL6D 5IB5A 4HAGA 3SDXB 1TCRA 3BD4A 3NFSL 1WBYA 4BSVA 4K3JH 3JTTB 3BP6A 3L3JB 1NDMB 3QFDB 4UOW1 5LAXB 3BYTA 4FQIL 3KYKH 2ICWJ 2GUOB 4LVOB 2HT3C 5EBMB 1FZMB 4UV7L 5K9QG 1HQ4A 5DGRA 4Z95L 5HDLA 5EC2B 1J05A 3HC0B 2ZUYA 3P9LA 3PWLB 5DD3H 2X70B 1TMCB 4Z5RB 4L5FL 2ADFH 3N50A 1OHQA 4Y1AB 5D7LD 3ZYIA 1DQDH 2DN7A 4IRJA 3V6ZB 2XA8L 4LCYB 2EDLA 3MA7A 5C0AE 2DKSA 4WW2B 3UTZB 3WFEH 3CUPA 2BY2A 2EC8A 3I6GB 4LLQB 4PG9A 3QUYB 5CILL 3DWTA 3IDMA 3D0VB 1U9KA 4FHBD 1A1MB 3I6LD 4C58B 2HRPH 2PO6C 1KOAA 3KXFB 5C0BA 2FECL 4LVOC 1ZXQA 4JB9H 4ZUTB 4JY4B 1B2WH 1JFQL 3LQAH 7FABL 3BPOC 1EJOH 3O9WA 4MD0A 2A1WH 1S7XB 4H26B 4PD4K 1FFPA 3ESUF 2I9TB 2YPKA 1B0WA 3H7LA 4HGMA 4WW2C 4WNQA 1EX0A 4U1LB 3CFCH 3O0RH 1MI5A 1OM3H 4B5EA 3QUYC 1A7PH 3FQNA 4UOJA 1FG2B 3NMEA 2IPKB 1KPVA 5AD0A 1MCSA 1D5XB 2CMRL 3WIHA 4BQ6A 1FFNA 2Z93A 1JNLL 3EYVB 1IKFL 1CLZL 4NPYA 1P5VA 2DLTA 3S7GA 4TRPL 3NVQA 1ACZA 2XFXB 5T1KA 2VLKA 2NY5C 2GTZA 3DUUA 3QPXH 4P57B 1MNUH 5E95B 1G7QB 4UIMA 5JPMA 3LEXA 4OZFG 4AENB 3SJVE 1N5AA 2ENSA 3MRMB 1EEUA 3BD5A 1RVFH 2DDQL 1JZ7A 4RDQG 2CDFB 4K3JL 5GGUA 5E08H 3EJYC 3RY6A 1GXEA 3WD5H 4EKXA 3KYKL 4Y2DB 1MJJA 5C0FA 3G5ZA 5IHUH 3BI9X 3L95A 4UT6H 3E1F1 1RULH 4P4KC 5DD3L 1HHIB 4I2XB 5EBGA 1IGYB 4RGOH 4PG2A 3LPFA 5ID1B 1Y0LB 4QRPE 1Y6KR 1ZT4B 4HWEH 2M2DA 3C87A 2V7NB 3DXAE 1DQDL 2AXJA 3D39A 1WWAX 3BIBX 4HUVA 4I77H 2DQDL 2XXMB 5LG1A 4I18C 3HMXA 4ZO6A 4WO4D 3S4SB 3WFEL 4NQDA 4UB0H 4NQEE 3GGWA 1OGAE 2HT2C 1QO3B 3B3IB 1MFNA 1MSPA 2FSEA 1NCWH 4TQEL 1OTSD 3CH1B 3HZMA 4Y2DC 1UVQB 4QRUA 1XF3A 2YD6A 4PJGA 5KSAD 2ESVA 1FNGA 3PP3H 2W0PA 1B2WL 3LQAL 5DXWA 3C5SB 1FHGA 5I66A 2A1WL 2JIXA 3QWRA 2IFGA 5BZDA 4H8WH 2VR5A 3LZFH 4P48A 2QQKH 3FFDB 2ITDA 2G75B 1I3VA 3W11C 4BELD 4BSWB 4PGEA 4LLAA 4Y19A 3BKYH 3CFCL 3O0RL 1OM3L 2AJ3A 1OW0A 1HZHL 4PRHD 4B7LA 2PN5A 2W9DH 5F9DC 4JEGB 5DC9B 3OAYK 4KAQH 3IDUA 1HHKA 4N8PA 3WHXA 4NGHH 5F7FA 2DQTH 3G5VA 3MYJB 1IM3B 5IB3A 4K07A 3JV4A 3PV7A 3QPXL 5B8CB 5MEPB 1MNUL 4K7PX 2GCYB 4FQ2H 2AQ3A 2FATH 4YPGB 1S7VB 1VESA 4HUWB 4X6FB 5CD3A 4JKKA 4PJDA 4LBEB 1J7VR 3TBSB 4XC1H 1RVFL 2KZWA 4Y1AE 3PL6A 2EYTB 1T5WA 5E08L 4BJLA 1QRNE 3K8MA 1EK3A 5L9DL 1TPXC 3WD5L 2ZUUA 3KPNB 2LFGA 3BE1L 3GSNH 1AP2B 5IHUL 3HUJE 4UT6L 5HGBA 2A6IB 3HC3H 3MRHA 1INDH 3CGTA 4D0DA 1A9EA 3V5KB 1NJ9A 4JREB 2UYLB 4JJHA 4RGOL 2AK1H 5F6HI 4XWOD 4HWEL 3MUJA 3KXFE 3U4BH 5BO1H 2Y4SA 3BJ91 5D7LA 3IGAB 4YJZL 5E70A 5B8CC 3CFEA 3ZE0E 3GM8A 3KLHD 3O45A 3T1FB 5IUSA 1CD1A 4MJIB 2P8PB 1GH7A 2OL3A 4RQQB 4G9DA 3LSOA 3D18B 4U05A 1OB1B 1YEIL 4PP1D 1I8LC 4ONHA 2X7LA 3AXLB 3FQWB 1NCWL 5F88A 4PJFA 5C09E 4OM1L 5JW5B 3PV6B 3UROR 5TDNA 3K2MC 4JREC 4OLXL 4LSDA 1M1SA 3QDJD 3LZFL 3SN6N 1UJ3B 2QQKL 3WJLA 4OGYH 2WIIB 4L9LA 3DJ9A 3QG6B 4EI5D 4KTDL 5I76B 1INQA 4LRNH 4N1HB 5DEGB 4GG6F 2DM4A 1KG0B 3V8CA 1VHPA 3FCTB 4ONFL 4GAGH 4DGIH 4QHMB 1QYGH 2FX9L 3VXSE 4H0GA 1KB5A 1LD9B 3VDBA 4LCWD 2W9DL 5F7KC 4LCCA 1ZE3C 2CPCA 4AQOA 4XNZB 3MFFA 3JV0A 5F7EH 2GIYA 1PW3A 4KAQL 1MELA 2H3NA 2FZ3A 3V4PH 4NGHL 4YFDB 1WBZA 2DQTL 2NW3B 3SGEH 4DKDC 2HFTA 3QP3A 1OARH 2E9BA 1NMAH 3THMH 3ECBB 3OKNA 4DAGH 3TN0D 1OVZA 5ICZB 4G43B 4FQ2L 4OF0A 1G7IA 3T0XA 4I4WB 1UJ3C 4YDJB 4GKNA 4ZSOA 4XC1L 2FH8A 4M02A 2Q1EA 4P5KB 3CC5B 4HKBB 5HVHB 3HG1E 3HR6A 1A02N 3N06B 1OTUD 2EYSB 1MIEH 2GY5A 2DKUA 4AEEA 1QSEB 1BVKB 3MZTA 2CRIA 3GSNL 4K7PY 1RZGB 1MFBH 2NLJA 3O3AB 3L5XL 3UYPA 4ETQA 1AGBB 3SQBA 3HC3L 3L7EB 1YEKH 1INDL 3JWDH 3MJ7B 4NRZA 3O3BA 4XNZC 3ULUH 4M9PA 4PLOB 1S9VA 4ODHH 3LQZA 2FB4H 2XN9D 2R1WB 3LRHA 4YHNB 1E4XH 4R96B 5E6IC 1G7PB 4KDTA 4YR6A 2ATKA 3H0TB 2R2HB 1KN2H 4NKIH 3OAZK 3TA3D 4WO4A 1IKNC 1YY8A 4JPKL 3CDGB 5CEYA 5F6HJ 5C2BH 3VI4F 5HVHC 3QEQD 4FQHA 2MTPA 2VIRB 4G8FB 4ALAH 1HILB 2APFA 1D5MA 5SWQA 4J3WA 5JORA 5KSAA 2K9UA 3WEXA 1CXFA 1HI6B 3WLBA 4QXTB 3QQ3B 4ORZC 2ZNXA 4LRIC 1HEZA 1T66D 1VEOA 1Q38A 2QV2A 1L6XA 2MSPA 3JWOC 3PWPB 3WS3B 3T8XB 4AY0A 1P84K 2W91A 1FO0A 1ORSB 3VXUB 1B9ZA 4QWWC 1KJ2H 3KPLB 1Z2KA 4KU1A 5IM7A 4YHPB 4GXUM 1CGUA 1KN4H 4DGVL 4HUUA 3P4LA 5D5MA 4I1NB 3ROOA 2H2SC 5C0JA 5CD5D 3DX6B 5D2LF 5KN5A 4YXLL 4K3DH 2M26A 5FGSA 2C3WA 3VA2C 2PTTB 4N1CA 5F7EL 3JVGA 1FJ1A 4ZFOL 3GJFH 1EUUA 3QXWA 3G5XB 4LEOA 3V4PL 5DMIH 4CDGC 3QH3B 5IFAH 1C7SA 1M71B 1OARL 4WI7A 3B8SA 5AAWA 3THML 4M1GH 1DQQA 4DAGL 3L3HA 5BJTA 5F9JA 2XZCH 2V2TB 3ARFB 3RWIA 4M62H 2F8OA 4K71B 1AI1H 2ORBH 2R15A 4U1GB 1RMFH 4OF6A 1D6EA 4NDMB 3MRCA 1SBSH 2CQVA 1MIEL 4XPHH 4KK9D 1NAKH 3BZ4B 4NSKA 5ECJE 2BNRD 5F9AC 4DCQA 1MFBL 5IVXA 4MJIE 1W8NA 1YEKL 5GS0C 1KT2B 3VG9C 1NCDL 3ULUL 2VQ1B 1B90A 4ZAKD 1WIPA 3CZFB 1UXSA 2FB4L 5T1LD 1T21B 3ULUF 1H3VA 1ZHKA 1G9EA 1CGXA 2D9QB 4Y4KD 4H25A 3HFMH 2HH0L 3E3QE 4M61B 4APQD 3C9NA 5ANME 2JJWA 5F3BA 5HPMA 1A1NA 3IRPX 3MNWB 3ARFC 3QAZB 4NKIL 3KNBB 3QNZB 4N8CH 1CD9B 4UQ3A 5H2BB 4L3CA 4X6DA 2NXYB 4LPTA 1ACYL 2YZ1A 3ULVD 3S6CA 5C2BL 1FNHA 4K71C 1EMTL 2VDQH 3BH9A 4K94C 4BZ2H 4UUJB 3C2SA 4NT6B 4U1GC 1TJGH 3WLWD 1QR1A 2FEDD 1AKJD 3SKMB 5JOPE 1MCLA 2D7QA 1NDGB 3SDAB 4ALAL 3PWNB 5FCUL 4P2RB 1DEEB 4UINH 4JVUA 4M7ZC 1RK0B 4P4RB 3DUSB 3TT3H 4HUMB 2JJTA 5IVZA 4F58H 1E4KA 2G5BA 4GRMA 3AC0A 4W4OA 1FYHB 3QDJA 4UDUB 3JZ7A 1MFDH 5IWLC 1A64A 2D7OA 2Z91A 3VD9A 3OQ3B 4EI5A 2WBKA 3GSXA 1KJ2L 3IFPA 3T65A 3UAJC 3QAZC 1KN4L 1TETH 2D2OA 3H3PH 3QFJB 1UXWA 5TQ2L 3X3FH 4WGWB 5E8DH 1WF5A 1QP1A 1ZGLB 2MQ3A 4RAVA 5CSBA 2UUDK 2ARJQ 4K3DL 4LCWA 3X12B 2QADD 1LP9B 4D9QD 3SDAC 5DQ9A 3T4AA 2G5RA 2IBBA 3DBXB 4Q9RH 5IFAL 1QSEE 3U0TA 5F9WB 3OF6D 2ADGA 4N5EC 2VAAA 2FJGA 4M1GL 5IVNA 2X5PA 4K7FA 1JN6B 1JRHI 5IJKC 4EOWH 3TN0A 2XZCL 4MXWH 5CIPH 4HWUA 1XGTB 1K4CA 4NO5A 4M62L 3TBWA 5K9OA 1TJHL 2DQHL 4PJ8D 5KZCB 1AI1L 2FL5A 3STLA 2QKIB 4IMLB 2XNAA 1RMFL 2JELH 1XF2B 5T5NF 1BQSA 1EH9A 2Z35A 1NAKL 3SGDH 5GGSB 1YYMH 2WWKO 3UJIH 5FYJD 3GI9H 3RHWK 1LO5A 3QWOB 4J23A 3LDBC 4ZUWA 1Q9OB 3TO2A 4CGTA 3D1MC 4NQSA 1W72B 1I85A 3CMGA 4AM0A 3DX8A 4MWFB 4LGSB 4P3DA 3A6OA 5F9WC 1H3XA 1KBGL 4XC3H 4OSUL 1IGFH 5JNYB 4A6YA 2DAVA 2DWDA 5CJXC 4HQQL 3S36H 4N8CL 1ZLVH 3TA3A 1I1YB 1KGCD 1IGML 3O6FD 1X4XA 3K4ZA 3T0ED 3W9DB 4JPVH 2VUOA 4BZ2L 4QTHA 1TJGL 1ZLSH 3VXUE 3QEQA 3OHXB 3QRGH 1A6TA 4QHUA 3G6AB 4UINL 2P8MB 4X6BB 1OSZA 2B4CL 2NQCA 2O61A 2AW2A 5JZ7D 1S9WA 2NY3B 3RUGA 5SX5K 3U48A 4NN5B 4PJAF 3LAFA 4HEPG 3RGVB 3PDOB 5DHVH 5L2KD 2ICWA 4KMTH 4HGKC 5IGXH 3OXRA 4XHJC 2IH3A 4LK4A 4EIGB 4FQJL 1QSFD 1TETL 1IEHA 1AQDA 5E8DL 5EZLB 3MV8B 3B9DA 2YD5A 3QIBC 5M95B 1OT1A 1CFBA 4JQXC 1CL7L 5EU6D 3KPSB 1YY9D 3RX5A 1FCGA 4Q9RL 3QUKA 1S3KL 2VDRH 1FFQA 3G08A 1CG9A 5CUSH 2NY3C 2YD3A 4EOWL 5IJVA 4OZIB 1IAKA 3B2UD 4LHQB 4D9RD 4HPOH 3EGSA 5E1AA 3QUMH 1IGIH 1OP5K 4F7EB 3HS0A 1HSBB 3BHBB 3CCHB 4ZQKB 4GW1A 5HHNA 3GIZH 4Q7DA 3X11A 2H32H 4HT1H 1W8OA 1NUFA 2XXCB 4OF5A 1YYML 3TYGH 4WU5A 2HFGL 2BNRA 2CXGA 5DI8B 5I8OH 3GI9L 5BV7L 2UZYB 3ETBF 3UPRB 4MQSB 5HGHB 1S7UA 2ZUTA 4ZAKA 1DUYB 5T1LA 1SM3H 4P2RE 1C5BL 3X3GH 4Y4KA 2Q7YA 4NRYB 4KROD 1B6UA 4APQA 4PPTA 3S36L 1EDQA 1NGYB 1I7ZA 2OXGA 2C3GA 4NFBA 3BESR 3SKOB 3GNMH 2WK2A 3WL9A 3NAAH 4JPVL 1MCCA 5F70A 2F5BH 1ZLSL 1OAYH 1FLTX 3M8OH 1AKJA 4OKVA 3GUTA 3OR6B 2I07B 1VEMA 4S1SH 5KVFH 3CD4A 1HQRA 2FLBT 2K7QA 3Q6FA 1V3LA 4PRPD 1CBVL 4EQ3A 1V8HA 5FFLA 1M4KA 4Q2ZB 1P69B 1O0VA 2BCKB 3RWDB 4JDVA 1GZQB 2P8LA 4P2QA 2N4IA 4QHKI 3WMSA 1RHHB 5HYSA 4CNIB 2EE2A 1KIUA 4DWHA 4F37F 3RZWA 1PY4A 1QQDB 4XP6H 5AUMA 4RIRA 3VFSA 1R5VB 4OLYH 1YJDL 5HHOB 3TBYB 1NCUA 4TOYH 4RMSA 3T04D 2YUVA 2DYPD 4G6AD 1SQ2N 2A9NL 2VDRL 3IDXH 2E7BA 4XP9H 4BK5A 1T6VN 5A43C 1ZT1A 3W81A 1BZ7B 3R06B 3OF6A 3BVNA 2GFBB 1ZWIA 5CUSL 1KEGH 5J9PA 2BHZA 4NBZB 3MV9B 3DETC 1NGWA 5SWSB 4HPOL 3EO1B 4XAKD 3QUML 1IGIL 4WEMB 4YIQB 5DGQA 5HVGB 5CJOH 3HZKA 2UZIH 1EO5A 3P4MB 4Q6IB 4PJ8A 4ZFZA 5E7BA 4MLIA 1OOAA 2YZ8A 1VACB 1EERB 4HT1L 4R7NA 4HUXA 2ATPB 5JPNA 3TYGL 3BDBA 1S7WA 5IQ9B 5HYQB 1N2RA 3U46A 3HC4H 5DLML 5I8OL 1K8DB 4N0CD 2PXYC 4L1DA 2GJZB 3T2QA 4EXPX 1YN6A 2VLMD 2YHGA 4EI6A 5FO8A 5IB1B 4MXQC 3O11B 4DVBA 2OZ4L 2EDOA 2Y25A 3WNOA 1WFOA 3MQIA 3X3GL 3ESVF 3DROB 1N64H 3WXWH 5ERWA 4FTVD 5HI4C 2FO1A 4XVUC 1BMGA 2K7PA 4XNXL 5KJRH 1YMMD 3EYOB 3M1BB 5DD6B 4L4TB 3O6FA 1NL0H 4KVNH 3T0EA 4Q6IC 1JGEB 1P4LA 2F5BL 3MRDB 3U1SH 2EIEA 3RWCA 1M05B 4JN2A 3M8OL 4OGXH 4N0UB 1SY6H 4S1SL 5KVFL 2IADA 1P5UA 2PCPA 5CCKL 4WFFE 5A3ID 3L7FA 3MV8E 4UV4H 2V6HA 3T3ME 3BZFA 4AJ0A 3DVGA 3EO0B 1N0LA 3ZDZF 2Z8VC 4UQ2A 2BSRB 1NANI 3KPSE 5C0RL 1PYWB 3QCUH 4Y5VC 3U79A 1NFKA 5L2KA 2UVFA 1IGTA 1RAMA 2XV6B 4PJIB 2LU3A 7CGTA 1AHWA 1QSFA 1KEMH 4FFWD 4OZIE 4XP6L 2NZ9C 2IAND 5CMAB 4HJJH 4NUGH 2Z92A 3GSVA 4P3WA 4XMKH 4OLYL 3QXTA 1MHCA 4MA3A 3L3KB 2HFEB 2WQ8A 3U0PA 1E4JA 2JCCB 4GQPH 4TOYL 4PJ7A 1DVFB 1SHMA 3FB7A 4I3GA 5C2UB 1FAIL 1U6AH 4QHKJ 5C07D 5EU6A 1GOGA 1EGJA 3IDXL 4XP9L 5T1DH 4M7KH 1A4JB 1L4IA 4KZEH 1BECA 1JL8A 4WUKH 1KEGL 1S9YA 1YZZA 1CF8H 4C57C 3D3VD 3QZWG 1TJIH 3DGGB 3FT2B 4NZUH 4XXCC 2OI9B 4RRPG 4N0YH 3O3EB 3VH8G 5CJOL 2UZIL 3TT1H 5DMYA 5DT1H 1BF8A 4IOFD 2JE8A 2P4AB 3K8LA 1BQLH 5LQBH 3K4DA 4LARH 1F6AA 3PWUB 2DWEB 1YEJL 3BSZH 3K0WA 1A9BA 1YMHB 4P49A 4NP4H 3O3DB 3HC4L 1DN2A 5BVJA 2DLIA 4RZCB 3STZA 5CGYC 1MQ8A 4U6YA 1YYLH 4RBPH 3D6GA 3ARYA 3B9KD 4O4YH 4BH7B 2LU4A 4F33A 5KS9A 1T4KB 5CINH 3BKJH 1JZ6A 1FG9C 1A5FH 3R8BB 5D9SB 5K9JH 4PLJD 5CP3H 4J8RB 4MCZB 3QIUD 4QRQB 1DSFH 1N64L 3MMEA 1IT9H 2YKLH 3LS4H 4X7SH 3WIHL 3WXWL 5I1LA 1WAAF 1YUHB 4J7RA 5I8CA 4U4BA 5KJRL 4FA8A 3MLWH 4KV5F 1FZJB 1DTUA 4JKLA 1JV5B 3U1SL 5J3HD 5EOQH 4PRBA 3JTSA 2XKNA 4QNPF 3CFBB 1SY6L 1T7XA 3GSQA 3VRJA 3DV6A 4WHTA 2OQJA 4Z7VA 1HXYB 4NFCA 4H5SB 4M1CC 2X4PB 2Y5TB 3IS0X 4UV4L 5JQ6H 4PRPA 1XIWB 2DM2A 3QI9C 5HHVH 5C0AD 4UILH 2BX5A 3O2VH 2I26N 2E5EA 2CLVB 4EQ2A 4UIKH 1GC1L 4ODUB 4WWKB 4ELKB 1KCLA 4JM2F 4MXVF 3VD7A 4TUJB 3GMQA 3TCLA 1KEML 3FT3A 4PGBA 3MV9E 2W07A 5KANG 3UPAA 4YBQC 5SWSE 4HJJL 4NUGL 1SEBA 4QLRA 1KPRB 1XF4A 4XMKL 1HK6A 3OTTA 2DQFB 3QEHA 4XX1G 1QTYT 5D7KE 4YHZH 2D4DA 1U6AL 3MV11 3KHQA 2DYPA 3WN5A 1PKOA 1KYOJ 5T1DL 2IAMB 4M7KL 3P4NB 5C9KA 4KZEL 2J8UE 2MCPH 3EYFB 2R69H 4WUKL 4PY7B 3AREB 2ZUXA 1CF8L 3T08A 1XIWC 3EDJA 3MV7E 1NFDF 3QDGD 3LCYA 1TJIL 2GQHA 4PJXF 2VABB 4NZUL 1S7RA 4N0YL 4MMXC 4PP2A 3TT1L 4QRRB 4KTEH 5DT1L 1HYSC 1T0NA 1JGVL 4WWKC 1V7ML 4OFYD 2EDQA 3VGAB 1BQLL 4LARL 1QOKA 5DRWB 2ZPKH 4MMZC 1S5HA 4PBVC 2VAJA 3C2AH 1T89A 1M6OB 3TIEB 5EFIB 1I3RA 2VDPH 4L4TE 3FT4B 5E8NB 3VJ6A 3WO3B 5J11C 4LVHC 4F57H 4KPHH 3IDIB 1YYLL 4KXZI 1N3NB 1N59B 1CVSC 2YBRB 5CINL 3PNWB 3BKJL 3PP3K 3SPVB 1A5FL 5TE4H 5K9JL 3AREC 5FA3A 4LDEB 2Q7NA 4OUUA 1VKXA 4YHMH 1I9EA 1DSFL 4ZUVA 2YKLL 2AXGA 3LS4L 4X7SL 4Z78A 4JZOB 2HAZA 3ALPA 4FTVA 2YA1A 3OKEB 3MLWL 2BY0A 5FB8A 1YMMA 3RDTD 5DUBA 1UWGH 2G2RB 5EOQL 5IW1A 4O2CB 2NR6D 3QSKB 4KKBD 4P46B 3VGAC 1BZ9B 3VMPA 2R1YB 5ADOH 3VH8B 3T4YB 3MCKA 4NCC2 4PS4H 3UTSE 5I71C 5IIEA 1ADQH 3HB3C 3B2VH 4PRDB 3DXAD 1WJ3A 5CJQL 5HDBE 5HHVL 2JCCE 4NBYB 3RKDC 1X4YA 4MZ2A 3SDYL 3O2VL 5MERB 4E0RA 4ODXA 3OWEA 3BUYB 4UIKL 1AD9B 2SEBB 4X7FC 1A7NH 5E8PB 5KVEH 1T0PB 1U8PA 4DUWA 1EXUB 1X5GA 2NXZD 4K2UH 3DMMC 4LSTH 5EOCH 1EAPA 2IANA 3I50H 1XFPA 4G8EA 5GRYA 3W0WB 2NTFA 4M03A 3SY0B 4N9GB 4V2BA 3WNKA 1DZBA 4X5WA 4GAFB 1TQBB 2EE3A 5DK2A 1GZPA 3VXPA 4UT7L 5C07A 1LK3L 1U92B 3TNMB 4JZNA 5E5MB 4P3CL 2R69L 3G6JE 3VFGH 3CDCA 2I60H 4XP5H 1HHGB 4J4PC 4XPTH 2ZCHH 4ZTOH 3D3VA 3U9PH 3MRFA 1A6WH 1VADB 5DHYB 1QFPA 2CO6B 4X7TB 5I75B 4U1SA 1DDHA 5JLZA 2FEEL 5EC1B 4PB9H 2A6JA 2D31B 3L1OH 2R0WH 2IJ0C 3ARPA 2QHLA 5MHSD 2ZPKL 3FB6B 3G04B 2XKSA 4BFEA 3BEVA 2ADJA 3C2AL 1V3MA 1ZLUH 4BFIA 5IROC 2VDPL 5IK3A 5INCB 4F57L 4F3FB 4KPHL 3TFKC 1UT9A 2LVEA 1TQBC 4BZYA 3B9KA 4XZUA 3DSFL 4HIXL 4ENED 5TE4L 4JVWA 1FV1A 4ODVH 1WBXB 1IAIH 4Y1AD 4YHML 2ICCA 1OWWA 2R1XA 3P77A 2CDEA 1RJZB 4OZGF 3QIUA 1KB5L 1MFEH 1LQSR 2E6QA 3NN8B 4X98B 5I75C 2DMBA 2FJFA 4CW1B 3MRKA 1UWGL 2NY5H 3QUYD 4W81A 4H1LA 5EU3B 1RJLA 2E27H 5DD1H 4Y5XB 3H9SB 3LB6D 3AMKA 4G80A 4PS4L 5DZLA 2LAAA 2ZWLT 2CIIB 3NACH 4MNGA 1ADQL 1F2QA 3FFCD 5T3XH 3KXFD 1PZ5B 3UTOA 3B2VL 1K2DB 2GITA 5FV1L 1ULVA 5FYJU 4DZ8A 3VXNB 3VWKB 4QXUH 1JWSB 5C7XH 2F74A 1E28B 5C0AA 4X8JA 4GLRI 1SJEB 2X41A 2I9LB 2X44D 1PSKH 2C3VA 3S5LB 4QGYA 4PREA 5IB4A 1A7NL 2P5WB 3PE9A 3HZYB 2OS7A 4ONOA 1YPZB 4NRXA 1U8JA 2CLRB 1G6RH 1C5DA 2EECA 3KJ4B 5EOCL 1F4XH 1WV7T 3EJYD 1EAJA 5CLWA 4LIQL 3T3PE 2V17L 3G6DH 3I50L 2NY7H 5TGBA 4QRRE 2X4UB 3PHOA 3QULB 2R2EA 4Y5XC 3N0PB 2I25N 3HI1A 2QJDA 1QFWI 2BVQA 4O2EA 2DIJA 4P9HC 3VFGL 2AXHA 2DL2A 5BMFH 5HGDA 4NBXB 3VWKC 5F7DB 4KRPB 2ZCHL 3QDGA 1A3QA 1AR1D 3ILQC 4OZ4B 1HH9A 2ITCA 1QLEH 4D9LH 4LAQL 2FX8H 4HDIB 5EO9A 3ZO0A 4PB9L 2E7LA 4OFYA 1N5YH 3L1OL 2R0WL 2HT2D 2VLRB 3EJZC 4YZFE 3KJ4C 2WBWB 1RJYB 5JO5B 3QRFM 5C8JB 3ZTNH 1G0YR 5GS2D 3QA3A 4M8VA 3RIFF 4NYLA 1HH6A 1ZANH 2OJEB 3WFCL 2HTLD 1JMZA 4N8VB 1FO0L 1JUFA 3KS0J 1KF9B 4K9EH 4LSQL 3HRZA 1KPUB 4U1IA 3HUJF 1F3RB 2PW2B 1IAIL 1I8MB 4HZAA 4IRSB 4KRPC 2ZKHH 4LPVA 5FUCC 3V6FB 5CBAA 3W11D 4AH2B 4YGVA 1DBBL 2BXZA 2C3HA 1WCQA 4IOIA 2LABA 4LOUC 1Z5LB 3F7RA 2FGWH 4PJHE 2Z4QB 3HPLA 3RDTA 4O51B 2NY5L 1DANU 5FO7A 5DD1L 1T03H 5F1IA 2DJUA 4G6ML 1QPXA 4QT5B 3GSUB 2VDMH 3NACL 4Z7UB 1J0ZA 5DVLA 5FGBC 5T3XL 3REWA 3GSWB 4PV8B 3RY5A 3D85B 3NFPB 1R3IL 3DXAA 3W0WE 3GJFK 3HZVB 1UYWH 5ENWA 5C7XL 4F7PA 3NA9H 1F97A 3MV01 1PDKA 4IJ3B 1F00I 3AM8C 4N90E 3V7MA 5AYUH 5F1NA 5KSUA 4HWZA 1PSKL 2V2XB 5EO0A 1EZVX 4M43H 2UWEF 1OP9A 3QEUB 3S8WA 1QKZL 1G6RL 3HHRB 1F4XL 1KJ3H 3VGBA 2WM0A 3D48R 4XMPL 2CUHA 2V9TA 2DQIH 4R2GB 3G6DL 1FAKT 3REVA 4AMKL 2NY7L 4WEBH 1WIUA 2HLAB 2AK4E 3BMWA 3NFNB 3FQXB 5DYOA 3OKOA 4O58H 1QUNA 1P4IH 4WI2A 4WUUB 4L8CA 4G7VL 4Q74A 4MDJA 1BIIA 1WEJH 4MD5B 5D1QD 5BMFL 4FXGA 2X42A 3D9AH 5ESAB 1AXSB 1PBYA 4PLKC 2P24A 4PUBH 2X4TB 4IJ3C 1XGRA 3W39A 1XGQB 1QLEL 4NNXA 2NY6B 1MCWW 1MY7A 4NZDA 1P53A 4LPWA 3PUCA 4HC1H 2AKRB 4JRXE 1F3JB 4KZDH 1FNSH 5T33H 5LBSH 3SDXA 4C56B 3A6CL 3ZTNL 3JTTA 3L3JA 3QFDA 5E24E 1NANH 1YEEL 5LAXA 1ZANL 2WANA 2GUOA 3MRRB 4MHHI 5E5RB 5EBMA 1I7TB 4JHBA 2EC9U 2HVJA 1FZMA 2QSQA 4E9LA 5HGAB 3H9SE 1BJ1J 1F4HA 3HC0A 1F58L 3PWLA 4K9EL 4CVZB 2X70A 2NY2B 1RUQH 4P23B 3TV3L 3B6SB 4Y1AA 2ZKHL 3ZKMD 4NZRL 1QNZH 2H8PB 3BXNB 1NUDA 5KVGL 3V6ZA 2ERJB 5BRZE 1IEAB 2YD7A 4O9HH 1JNJA 4LCYA 4QO1A 5DC0A 4WW2A 4JGUA 5GSRB 3UTZA 1CT8B 2FGWL 1FNAA 4YEEA 4MJID 2I27N 3I6GA 4LLQA 3QUYA 1T03L 4WWID 1YPZE 2VDML 1KLFA 3FONB 1A1MA 2XQYG 1CXKA 4ZNEA 5EULV 3FFCA 3KXFA 5GRXG 4M6NH 4ZUTA 3SE4C 2PETA 4JY4A 1CZ8H 3GK8H 3HAEH 1BEYH 3V6BR 5AYUL 1DBJL 3TH4T 1XF1A 2NY2C 1S7XA 4H26A 4P23C 4M43L 1H5BC 3NIFF 5BXFB 2NX5E 4JO1H 5I1GH 1F5WA 2I9TA 2X4QB 5JOPD 4XVSH 1WC7B 2MJWA 5FUCE 1KJ3L 5KW9H 2QR0B 2DQIL 3B9AA 2HFFB 4ZO9A 1TVHB 1OD9A 1EZVY 5JA8B 4MQXC 4O58L 3IETB 1FG2A 1P4IL 2IPKA 2ZCKH 1FLRH 1S78C 1D5XA 1U3HB 4GMSH 4YNYB 4A6YL 2EDJA 2VLRE 1T83A 3ZTJH 3EYVA 4HGWB 1U8HB 1WEJL 2AQ2A 1GJIA 3FB8B 3HR5B 4MDIB 3D9AL 1JNNH 2XFXA 2YD9A 2PTVA 4NZJA 4PUBL 1BFVL 4JM4L 1CK0H 4P57A 4LLDB 1ITBB 1ZEAL 1G7QA 5GRUH 1RUKH 4XI5C 4XPAH 4AENA 3WFZA 4KZDL 1FNSL 2YUZA 1ZLVK 3U30B 5LBSL 3HI6H 3GMMB 2FR4B 1FFRA 3K1KC 3LQAC 2CDFA 4YE4H 3C6SB 1EHAA 3QEGH 5F8QC 1QSED 1RURH 4ELMF 2ICEB 2J5LB 2VOTA 1A3LH 5E7FA 4RGNC 1DJSA 1U3HC 1U8NB 3W5NA 1SJXA 4J6RH 5DC4B 1U0QA 4PRAB 1HHIA 4I2XA 5H94B 1IGYA 5EG6C 1WFNA 5ID1A 1Y0LA 2DI7A 1CDUA 1ZT4A 1V7NH 2CSPA 2V7NA 5EIIA 5ESQB 4Q9QH 5AYQA 1URLA 4EN3B 4O9HL 4NQXB 4QWWD 1CD0A 2W38A 1G1CA 3Q48A 5GGTA 4F37K 2Y06H 5DEFB 2XIDA 3QR2A 3MC0A 3DPBA 1MCRA 2H2SD 1IAIM 3L3IB 1OPGH 3U30C 1QO3A 5K93A 3V95A 5I9QC 3B3IA 2Q8BH 3OZ9L 1P7HL 5IMOB 3P73B 3CH1A 5HI3C 1UVQA 5GISH 1PX4A 4LPXA 4MJ5B 4OGAC 3GK8L 1OGTA 3C5SA 5CBEA 1TDQA 1BEYL 3SQOH 5MI0B 4WUUE 3TWCL 3MTRA 4MNQB 4K8RH 3SHSA 3PWPD 4OAWB 4U6XB 4K7PL 1A4KB 1VFBB 4FNLH 4JO1L 2JJSA 2AGJL 5GS0H 3FFDA 5I1GL 2ZUQB 2G75A 4EN3C 1FZKB 4XVSL 1X5KA 2YPLD 4BSWA 5KW9L 5I1JH 1UZ6F 1K6QH 4KJQD 1T1WB 1V05A 1CU4H 2WBJB 4MAYB 1KXVC 3KPOB 3VFRB 3S35H 3UC0H 3EYSH 3MRLB 1DE4B 4GG6B 5CLTA 2Q3AA 1Q0XH 1MWAH 4U6TA 4FOMA 1U3YA 1CD8A 5D1QA 5DSCB 1JNNL 4P0DA 5L6YH 4CRPA 1BAFL 4K94H 3MYJA 2OR7A 1IM3A 2DQJH 5FUZH 3CAFA 1YNLH 5DUMH 1CK0L 5MI0C 4MNHB 5MEPA 2GCYA 3ARFD 3OX8B 3ME0A 3EYUL 2FBOJ 4HMCA 5GRUL 1GCFA 2VO5A 1S7VA 4YPGA 1RUKL 4OQTA 4HUWA 4XPAL 4X6FA 4LBEA 4OB5H 2ZUQC 3TBSA 5FM5M 4KKCC 5FA4B 3VFPB 3L3GB 4MS8C 1I8LA 5HHXH 4JZJB 2VMFA 4DN3H 5TDPB 3QEGL 5GGSY 1RURL 4KDVA 5JW4M 1AP2A 2OR8A 2WBJC 4MAYC 3VG0H 4FXKB 2A6IA 3GMRB 4JPWH 5KBNC 3SE3A 3V5KA 4J6RL 1OTTD 5CZVH 2UYLA 1F6FB 2NY4B 3UZEA 3U9UB 1P2CB 2BXYA 1JWMB 4PBXA 1T1ZA 1NH6A 1V7NL 3GSNB 3IGAA 1MQKH 3V2AR 3UAJD 5EH1A 1A22B 4B7IA 2Y06L 3B5HA 1P6AB 1T1XB 3VMNA 1UB6B 2ZUVA 4X6CF 2NXYD 3T1FA 4MJIA 4J2XA 3FMGH 2P8PA 5I19H 4RQQA 2WUBH 1KULA 4LSVH 2J4WH 3D18A 1OPGL 1C8PA 1OB1A 2YK1H 1QD0A 4JZJC 3N1PC 5F44A 2JF1A 2Q8BL 3AXLA 1NMBL 1IBGL 3FQWA 5CP7B 3SDAD 1AD0B 4P2RD 1MFAH 3U2SB 5DHXB 4XXDB 4OD2A 4LLMB 4YFEA 5GISL 5JW5A 4OLWH 2FRGP 3KS0H 3PV6A 1T7WA 3HTLX 3LEYH 3G9AB 4RGNE 2NY4C 4K8RL 3GBNH 2RQ8A 3ZE2F 3HE7B 4ZUUB 4X83A 1BFOB 1DANT 4FNLL 1RIUL 3S3SA 4HMDA 1H3PH 2WIIA 5IT2H 5DJAB 3QG6A 4JCMA 1QA9B 3KLAB 5I76A 3DGCR 5I1JL 5DEGA 2BFVH 1CE1H 2X1OA 4G6FB 3BFOA 3BAEH 3QFJD 1K6QL 3FCTA 3CZJA 5FDWB 2IG2H 1CU4L 4QHMA 5KOMC 1FL6B 3MLTB 4BM7A 4JQVC 3S35L 3UC0L 1KCUH 1LD9A 3PIQB 3EYSL 3QCTH 1K9TA 3MJ6A 3ARDB 43C9B 1Q0XL 1MWAL 5D4QA 4RFOH 1N0XH 2NW3A 3P40A 5L6YL 4K94L 5D2LB 5J1TC 4JY5H 5GS1C 2DQJL 5FUZL 4U0RB 3ECBA 1YNLL 5DUML 1CCZA 1KNOB 5ICZA 4G43A 4Z7QF 2BHYA 4CL7A 4NWUL 4KJWC 4I4WA 1IKNA 2BRRH 4ZFOB 4GKSB 5HHME 4FRWA 5KZCD 4Z0XB 4P5KA 5D1ZB 3CC5A 4HKBA 5BS0D 1W72H 4DN3L 2EYSA 2A9MH 3ARBB 1QSEA 1BVKA 3B83A 1RZGA 3UZQA 5C0NC 2C9AA 3O3AA 3VG0L 4HWBH 3MX0A 4WFGE 3L7EA 2NW2B 3MJ7A 5CZVL 3ARDC 5HYSG 3I3DA 2ZSWB 4YHNA 2R1WA 1ZV5A 4YH6A 1G7PA 5ID0B 4XHJD 1MQKL 4CU8A 1PG7X 4HXAH 3S88H 3IDJB 2N1KA 1VEPA 3H0TA 2R2HA 4TUOB 4MNQE 3FMGL 5I19L 2YMXH 2EC9T 2WUBL 3CDGA 2J4WL 4LSVL 2D4FA 4W70A 5I1HH 2YK1L 5GXBB 1G9NH 3FQUB 2HWZL 2X1WL 1EEZB 1TXKA 2VIRA 1IAOB 1GGBH 1MFAL 3ARBC 1BFTA 4G8FA 4AEIH 3UDWC 2J3SA 2Y72A 1HILA 5KANI 4OLWL 4LF3B 3F6LA 1HI6A 3LEYL 2NY3D 3SCMB 4ZFFB 4NN7B 4QXTA 5B38G 3QQ3A 3GBNL 1RUAH 3CXHK 1NBYB 4L4JA 4TTDD 4F8TA 4GG6E 3PWPA 4TVPE 4O2FB 3RGVD 3T8XA 2Z0BA 4LASH 1H3PL 1YNKH 2AV7A 5IT2L 1UCTA 3IAQA 3O2DH 2VR4A 4F7MB 3LIZH 1HWHB 2YPLA 2BFVL 1CE1L 3KPLA 1ES0B 5CEZD 5HD8C 1UM6H 4WFFD 3BD3A 3MV8D 5CJ5A 3DX6A 3QCTL 5AZ2H 3ZT7A 5I1DB 3FKUS 4L8SC 4X6EB 1RUPH 1E27B 1U8QA 4AK1A 2PTTA 4V1DB 3KPSD 4WENB 2VXQL 1KJ2B 3MLSH 1I9JH 3G5XA 4RFOL 3WV0A 3V4UH 1N0XL 2BNQB 1U8IB 4RBPK 1I7RA 1M71A 1BBJB 3T1WA 4H0HB 3SCMC 4NN7C 4LFHD 5IQ7H 5JIHA 5F7UA 3GJEB 1D6VH 2LTQB 1NEZG 1U8OB 1FN4B 2V2TA 5I8KL 3ARFA 2BRRL 1U8MB 3GJFB 4XPFH 3WKML 2E8ZA 1LEIB 3F5WB 1UKQA 3WXVL 3MGOB 1NCAH 4NDMA 4X7EC 2A9ML 1EO7A 5CGMA 1CN4A 3UTQB 5EUKB 3K7UA 3BZ4A 2EXYC 2XZQH 3MBEB 4JGJA 4AQ1B 4HWBL 1KT2A 1N6VA 2VQ1A 1WIOA 1HIML 4X5XB 2BDNH 3CZFA 3OR7B 5ABDE 1T21A 1ZHBB 3RAJH 4CDHA 4EJ1C 4HAFA 3OSKA 3KYAA 4HXAL 3S88L 4JFFB 2VLLB 3VI4E 4M61A 3KJ6H 1AFVH 3KWWB 1X5JA 3MNWA 4LVNB 3KNBA 3QNZA 5H2BA 5AZEL 5EBLB 2YMXL 4LLVB 1B4JH 4IMKA 5I1HL 3VRLE 1G9NL 4UUJA 4NT6A 5AEAA 2WNGA 3QUXC 5E99H 3SKMA 4NHUB 3BQUB 1KTLB 1GGBL 1X5ZA 3SDAA 3G9VA 1FVDB 4AEIL 1WFTA 3MBEC 3PWNA 2CGRH 4P2RA 1DEEA 2X4NB 5AG9A 3MXWH 1RK0A 4P4RA 1WT5C 4F2MB 2A6KB 4NFDA 3DUSA 4HCRH 5IJKA 3DETD 5K59E 5LGJB 2Z9TA 1RUAL 3VGHA 3VFMB 1KCVH 1CGWA 1H8OA 3MLUH 4UDUA 1Z3GL 4KTYA 4LASL 3VXRE 4GT7A 3DI2B 4XWGH 5CZXC 2CIKB 5D2LE 1I1FB 4P2OC 3LIZL 4KK5C 1Y6MR 2OTPA 4I8DA 4MD4B 5F97E 5HJ3B 4WHYH 3FN0H 1J0YA 1BP3B 3QFJA 2KUTA 1F4WH 1AGFB 1ZGLA 4X4YB 3C5ZB 3JSSA 4KKAD 4H88L 5AZ2L 4ZD3H 5LCVL 5HHOD 5C3LD 3X12A 3BP7B 2R9HC 1LP9A 3RVXD 3BQUC 2NMSA 3TVMC 3OJDB 1JK8B 3DBXA 1I9JL 2R0LH 3MLSL 3IJYB 4OLZH 4CVWA 1O7VA 1IC5H 1Q9LB 1VFMA 2K1MA 3P0YH 1WWBX 4MJ4A 5IQ7L 3GDBA 1JN6A 3MV9D 1N26A 1D6VL 5SWSD 5HPOA 5HI4D 3GEWB 1XGTA 5IBLD 5JXEC 2FECI 3NH7H 4HPYH 5B38B 4J1UB 3IU3B 2B4CC 1FL5B 1FFOB 2QKIA 2R0KH 4IMLA 5M7QA 2B1AH 5BS0A 1XF2A 5HYFA 5GGSA 5C6TH 2XZQL 4YGAB 1D5BB 4W4NA 1Y18B 3O4LB 1NC2B 5CIPB 3GMPB 3GSRA 4K3EH 4DGYH 1I9IH 1R3LB 3C6LB 2W9LA 1BFSA 2FGZA 4MWFA 3RAJL 5KVDH 1RU9L 4M6ML 2VH5H 2DF3A 3I85A 1H9VA 2IALB 5JNYA 3KJ6L 5BV7B 1L7IH 5E9DE 2GKIA 4F15B 5CAYB 1I1YA 1IC4H 1QBMH 3RNKB 2X4RB 5DEZA 3NCYS 1R3JB 2MCG1 1NEZB 3W9DA 3OHXA 4G8IB 4JQXA 4Y4HA 1WCBB 2PYED 4WI3A 3G6AA 4PTTA 2P8MA 4X6BA 2XWTB 4HF5H 2FO4B 2ZZUT 4F8QA 4PGDB 1UWEH 4K3HA 3C6LC 1GVIA 1KCVL 3SGJA 4EBQH 3MLUL 1NGZB 3IFLH 4QHNB 3JXAA 3RGVA 3PDOA 3AUVA 4EDXB 2CRZA 4XWGL 2BNQE 3MNZB 1SMOA 5DTFB 4I5BA 5BV7C 2NY1B 5E2TH 4ETYA 2OTWB 5D72H 3FN0L 4S1DC 1EJ6A 5ALCH 5SWZB 5FK9B 1GIGH 3IF1B 5C0CE 3TO4B 3MV8A 1TVDA 5DHVB 5TPWH 4M8QB 4P59H 3RIFK 1DVFD 5CGYD 5GRVK 1ZLUK 1DCLA 1MUJB 4PFEA 4ZO8A 1JYXA 5IFJB 2R4RH 3KPSA 2GTWB 1M7XA 2R0LL 3VFVB 4HS3B 4OLZL 1IC5L 2ZJSL 4AEHL 4JG0H 3P0YL 1E6JH 2AJXH 4QCIB 3WFHB 4R7DB 3NCFB 1CGVA 4JDTH 2J8UF 3NH7L 4HPYL 4F7EA 1GGUA 1G7LB 1HSBA 3BHBA 3CCHA 2R0KL 4KK8C 3KYOB 2B1AL 4GS7B 2NY1C 2B1HH 2PNDA 1M7IB 1IEBB 4JFFE 3K3QA 4XNYH 3IJHB 5C6TL 3W2DH 4GBXB 1QEWB 3KHOA 2HMIC 3TO4C 2YA2A 5I1IH 1N8ZB 2EXWC 4M1CD 5DI8A 2VXTH 2OSLB 3QUMB 1LWRA 3UPRA 1I9IL 2OJZH 1T2XA 1A6ZB 3ZMRA 4GSDH 4C55A 2H32B 5KVDL 4M3JA 1HINL 1EPFA 2VDOL 5HHQB 3RTQB 4WV1B 1A6VL 1FH5H 2VH5L 4XCNB 2DMKA 1Q94B 4EXKA 4DK6A 3B8YA 1S9KC 4OV5B 1YJDC 4NRYA 4PJBB 1L7IL 3DVIA 1MIMH 1NGYA 4M3KB 4YBQD 3S3PA 3FL7A 3MZGB 3SKOA 1T22B 1QBML 2H6PB 3LN5B 5INDA 4NNPH 2IMNA 5CZKA 3MRPB 1YA5A 5KSBF 3OR6A 2EDHA 5TQ0H 2I07A 5DUPH 3QIWC 4PJAE 5KAQF 5E2UL 4Q6YA 1CDHA 2HTKC 1XIWD 3VD3A 3DHJA 4EBQL 1OCWH 2EKSB 4AIZB 5E0QA 2YPVL 2BCKA 3RWDA 3QXAB 3RTQC 1GZQA 2P5EB 3HMWL 5J4MA 1BOGB 4WWKD 3MOQA 1MAKA 1T3FB 3EDDA 4HKJA 1RHHA 4CNIA 1XGPB 5E2TL 5D72L 3BRDA 1QQDA 4Y2OA 3C60B 1YN7B 4UT9L 5ALCL 5C08E 1GIGL 2ED7A 2D7PA 1R5VA 2AQ1A 1MPAH 1CDYA 3Q5OA 1AJ7H 2X1XR 4Q58C 1EVTC 1A7BA 2YD2A 2V5RA 5HHOA 3TBYA 2FJHA 3FO2B 2IAMD 1J05B 5DFVC 3O4LE 1JI1A 3ARED 4G6JL 1BZ7A 3R06A 4JG0L 2GFBA 3T2NH 1E6JL 2HT4C 3MV9A 5DMKB 3CLFL 5SWSA 1LNUA 2FWOB 4H1LG 3EO1A 4P2CG 3G6JF 2RB8A 4YIQA 2JKXA 4QRRD 3S37X 4U31A 2CLZA 2DJSA 3P4MA 4Q6IA 4WCYH 4RFEB 1ZHLB 3V52L 2B1HL 1VACA 1AGDB 1RJCA 4XNYL 3C60C 5EORH 3W2DL 2ATPA 2A38A 4QRTB 2VTFA 3AU1B 4B53A 4JO3H 5IQ9A 1NGQH 5HYQA 3HB3D 1AE6H 2VXUH 1INEH 2VXTL 1K8DA 3TZVB 2X9WA 2GJZA 5IEHB 2OJZL 2Z31D 2KH2B 1A7QH 1XEDA 3W9EB 5IB1A 3O11A 5I2IB 3UO1H 1AXTH 3FTGB 4PTUA 1CGSH 2FHFA 5IF0B 3DROA 2J6EH 2NY0B 4IRJC 1HNFA 3M1BA 5DD6A 4NNPL 3FOMB 2EE6A 3JUYA 2UVEA 1JGEA 4P46D 3MRDA 4CN1A 1M05A 2VZVA 4N0UA 2VN7A 5TQ0L 4QF1B 3NZHH 3OB8A 5DUPL 1D9KB 1MJUL 3VFNB 2PYEA 4OIAA 1R6VA 2VKWA 5LXGL 4ZOBA 2OBGA 3GSOB 2FIKB 2VWEC 4XP1L 1C1EH 2HLFC 1JZ4A 1JPGB 4ZPVB 1AIFB 5GIRB 3EO0A 8FABB 1OCWL 3GIVB 2F15A 2VL5B 2X4SB 1QPPA 4XXCA 1MAMH 2BSRA 2WUCH 1T20A 3T09A 4KHTL 1PYWA 5JTWA 4YDIL 1DQJB 1F11B 1F6LL 4PJIA 1QBAA 4LLUB 5B22A 1CFVH 4GKOA 3X13B 5HYJB 1P9MC 4CN4A 4MLSA 3CU1A 2NY0C 5CMAA 3Q3GB 3FN9A 2C7UB 3MLXH 2AEQL 1UH2A 2KDGA 1MPAL 3LKNB 3W0WD 1AJ7L 1X5LA 5HXMA 3L3KA 2HFEA 2H2PC 4JM2B 4LPCA 2JCCA 4N90D 4UAOB 3TM6A 5J6HB 3TFKD 1DVFA 5ALBH 5I1EL 4RWYH 1A7RL 4ZPTB 3U7WH 4G6KH 4N68A 1SYVB 1MCWM 5KSVB 2CKBL 4R26H 2Q20A 4DFHA 1A4JA 4X4ME 1MRCL 1KYOK 4HJ0C 2AS5M 5JHLL 1T5XB 5F7YC 3ELAT 2VSCA 4R97B 3DGGA 3FT2A 4BUHA 1F4YH 3D39B 4ZO7A 3O3EA 4G8GB 1QRKA 2A0LD 1NFDB 3F58H 4DKAA 4P5TB 1EV2E 4PJXB 4S11A 1DEDA 5EORL 4U1JB 3PWUA 1GGIL 3D69B 4JO3L 4JFDE 1NGQL 3EHBC 3O3DA 1INEL 3RY6C 3T0BA 4JM2C 2GW5A 4UAOC 4RZCA 1C16B 1GC1C 4YZFF 3FN3A 1A7QL 4RNRB 4BH7A 3KLDA 3UO1L 1T4KA 2IEPA 5B4MC 1V5JA 5D9SA 1BLNB 2VC2L 1CGSL 4YXKH 4J8RA 4MCZA 4QRQA 3RPIB 5TE7H 2YRLA 4R97C 3BGAA 2AP2A 1UM5H 1CWVA 1YUHA 3MOBH 1BJ8A 3VXMB 1UG9A 1IGCH 3MRGB 5D7IE 2DD8H 1H8SA 4QRSB 1NBVL 5TH2B 3SGEI 3EFDH 1RFDH 1FZJA 5GJTH 5DJ2B 1JV5A 2VZSA 5DVMA 1GPOL 3L5HA 1JPSH 3H9SD 4OFIA 4P5TC 4TSCH 4FQ1H 3QWQB 4JFOB 3CFBA 3NZHL 1J86A 4PJHF 1HXYA 3BWAB 3S96B 3CDYA 1Z9SA 4H5SA 1C1EL 4NM8H 1W0YT 3VWKD 3IYLW 4FQLH 4HH8A 1XIWA 5IG7B 1O7SA 5DZNA 2APBA 5ACLA 1BGXL 5I8EB 2QLVB 1MAML 3PJSB 2WUCL 4ODUA 4WWKA 2P5WD 4ELKA 1AO7B 1CFVL 4TUJA 4AEFA 1A0QH 2YC1B 12E8H 4RMUA 3P30H 2ZSVB 3MLXL 1KTKE 3CX5J 1KPRA 3EYQC 4PJ5B 3RJQB 5D71H 2DQFA 3ZKXC 4MJ6B 4YFLF 1GGTA 2OK0H 4R3SA 4RWYL 4DW2H 5GRZA 5J13C 4R26L 3ZDXF 3UXFA 2IAMA 3OG6B 3P4NA 2JLLA 3EYFA 3MJ9H 1FNFA 4G3YH 3AREA 4PY7A 4C4KT 4LGRB 2VWEE 4KRPD 4LKXB 4PJCA 2VABA 2P1YA 3ZT6A 4OZFH 4LOUD 2VITA 4QRRA 1R5WB 2IQAB 4B0MM 4NOBA 3RVVC 4MSWB 4XGZB 3O45B 4PJEA 4FG6C 2AAVA 4Q9CA 5DRWA 5ETUB 2MPAH 4HXBH 3PL6C 4RFNB 3LVEA 1IC7H 3CFDB 2HKFL 1M6OA 4BKLB 2AEPL 2GAZB 5EFIA 3FT4A 5E8NA 3CPLB 3FQTB 3IDIA 2Z31A 3FHAA 4UV7H 2YN3A 1N3NA 1AGEA 4Z95H 1N59A 1MI5E 5DMGC 1CTOA 3RVTC 1CXEA 1WAAE 5DD5H 5IHZB 1PG7W 3PNWA 4UTBH 4PGCB 4P5MB 3QISA 4FMKA 4IRSD 4JFHE 4RMQA 3IAGC 5E8OB 1FGVH 1UM5L 4JZOA 3MOBL 1ZMYA 3CVIL 3QNYB 2XA8H 4QNPE 1N7MH 5T3ZH 1IGCL 1JIBA 2DD8L 5TF1H 2OYPA 3MOAH 1RFDL 1QR4A 2G2RA 4OZGB 4O2CA 4P46A 3QCVH 32C2B 4TSCL 4FQ1L 1BZ9A 4RRPA 2R1YA 5FYLH 3VH8A 1ZSDB 4RWHA 3T4YA 5HYJE 1J8KA 3QNXB 4RFNC 1KB5B 4QRPB 1CI5A 1I1AB 2EDXA 2XPGB 4L29B 3D85D 4OQTL 2HJFB 4PRDA 4NM8L 1CICB 3DYOA 4FQLL 2WLZA 1HKFA 4MXVE 7FABH 4O02L 1I4FB 1PFCA 1BWWA 5MERA 3BUYA 4NQEB 1AD9A 1OGAB 4J3TA 5E8PA 4PRNB 5E4EB 2DQUH 3UMTA 5C0GB 1A0QL 1EXUA 3KLSA 12E8L 5F7HA 1G7JB 1N6UA 3P30L 2RFXB 4R2GD 3D39E 2WMPA 4GW4B 1MVFA 3RGHA 1ED3B 4G8GE 5IROA 2H1PL 3W0WA 4DQOH 3SY0A 4N9GA 1R3HB 1NFDE 4WUUD 4DW2L 5SV3A 2P49B 4PJXE 3I2CH 1J1XL 1U92A 2YD1A 3TNMA 2Q3ZA 2CR3A 1IGJA 1K8IB 2QTEA 5E5MA 2IQ9L 3MJ9L 4G3YL 3B43A 2WW8A 1CICC 3LQZB 2I24N 1MCHA 3S4SG 1HHGA 4NUJB 1OAKL 4PJGE 5DHYA 1BHGA 2ESVE 3L9RB 2NY6D 4U49A 4NC0B 4X7TA 2E3VA 3SE9H 1TFHA 5EC1A 2DICA 2D31A 4Z18A 4PYHA 5E4EC 3GMLB 2DDQH 4RDQF 2ID5A