5DT1H

Crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
245
structure length
243
Chain Sequence
VQLVESGGGVVQPGTSLRLSCAASQFRFDGYGMHWVRQAPGKGLEWVASISHDGIKKYHAEKVWGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAKDLREDECEEWWSDDFGKQLPCAKSRGGLVGIADNWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Member of the V1V2-Directed CAP256-VRC26 Lineage That Shows Increased Breadth and Exceptional Potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab Heavy chain of broadly neutralizing antibody VRC26.25
total genus 47
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H01
3U9UB 1XGRB 4OZIE 1T1XA 2FBOJ 2HLAB 3JWOH 4TULH 1SBSL 5T1KB 4OFIA 3WJLA 1J0IA 1HHIA 1U8OA 1NLBH 2W9EL 5HHOE 1MY5A 4BQBA 1XF5A 2XG4A 1DL7H 5TF0A 1MNUH 2AQ3A 2F8OA 4RAVA 4F7CB 1K6QH 5ACMA 1YN6B 4YWGL 4BA8A 5F1KC 1EEZB 4WFHD 4NBYB 5DJ8B 5IG7B 2AJXL 1CIDA 4ZTPL 3FO9B 3G5ZA 4H0GA 3GMQB 4DKAA 5FO8B 2D7NA 3DRTA 4X99A 4M6OL 4KY1L 4NN6B 4P4RB 1P4LB 2L4OA 1AE6L 3BOVA 2ATKA 2BVTA 5J13B 1JK8B 3S4SA 3WNNA 3QO0A 5C08D 1KENL 3VFTB 3BQUA 2W9DL 3T09A 3MOBH 5KTEH 4F7MA 3W39B 3IDNA 1OHQA 3R0NA 5I1LA 2PKDA 4Z76B 2YD8A 4WEBH 4U1LA 2Q6WB 3B9EA 3HE6A 2H2PC 2X4NA 1K5NA 2PXYD 1QHOA 3CDCA 4HMCA 3MLZH 1LMKA 2EIEA 4FABL 3IKKA 2KBGA 3B2UC 1KPVA 2YPLA 4ORZC 3OQ3B 3LRGA 2YD7A 1JWSA 4CN1A 1S5HA 3G6AA 5SWZA 1BEYH 4NOBA 2Z31C 4WDIB 3ULSB 4PTTB 1UZ8B 4MQXD 4OQ1A 4GKNB 1G0YR 1N64L 5DHVB 4I1NB 5TQ2H 1X7QA 3FN3A 3TH4T 4DGIH 3U46A 5T3ZL 3IDJA 3CH8A 5E2UL 4NDMB 4OCXL 3KPTA 5GJTH 4KI1A 3G5VB 1AR1D 1CLOH 4NSKB 3DRTB 3S88H 1TNMA 5FHBH 4ODSL 1VCAA 5CJQL 3DHJA 4R26L 3QUYB 3U4BH 2C7UB 1K2DB 2VLKA 3DXAD 2NY0D 4GSDH 2O61B 4FQJH 1FRGL 1OAYH 2CO7B 5E5MB 1I1CA 1RZ7L 4JY5H 3QBTB 5JW4R 2ESVE 1DQJA 5D6DC 3QWRD 2AGJH 5F9JB 3ARSA 1PD6A 3ZMRA 1CQKA 2QJDA 1RK0B 1QFHA 4NRZA 2FLRT 5C07B 2OSLB 3KPLB 3O4LA 3D9AH 3O6FC 4KV5E 1HHIB 1HH6A 2FHFA 4OLXH 4GQPH 4K07A 3VG9C 3LQAL 1BJ1H 5C0BB 3S3SA 5ENWA 4YO0B 2HN7B 4LLMB 2A6IB 4LCYB 4OGAD 2Y4SA 4HMEA 4LSTL 1A64A 5HI3D 4URTB 5TE7H 1WZMA 4GMSH 3N50A 3U4EA 3KYAA 3RRQA 4QRUA 2CLRA 1OOAA 3QEGH 3W82A 2LAAA 4PGDA 3L5WB 1A1NA 2ZCHL 3T2NL 1OW0A 1A6UL 4X4XB 5DQJB 3SPVA 5L8JB 3FQRB 4QT5B 1CT8A 1I1YA 4MJ2A 1MCWM 5FM4A 1KJMB 4LNVA 1S9VB 5H8DA 4Q2ZB 2YD2A 4IMLB 4PRAB 3VFWB 3H42H 4LF3B 3RWGA 4JJ5A 1MFCL 3QB7C 4PY8I 3DIFB 5E4EB 2VL4A 4R4BA 5LG1A 3EOYG 5KSBF 1M1SA 4TSCH 3MV01 3X12B 3O6MH 4L4VA 4XXCA 2COQA 1KIRB 1GC1C 3U36B 1J05B 4QHKI 4F3FB 5F9AC 4R4FH 5IP4A 5FA4A 1P1ZB 4KJPC 5C0DA 2X10A 1ZT7A 2BNRE 3VG9B 1CXFA 2DL9A 4D9QE 3QDJB 3GMLA 5DMIH 2Y7QA 4GBXD 4DVRH 2EIZA 3MNWA 3ZE2F 3PGFH 1ONQA 3JBG7 1PSKL 4UB0H 1ZHKA 1P7QA 2DWDA 4QXTA 2J8UE 5HHOA 5LXGL 4KU1A 1HK6A 3SE4A 4HKBB 5TFSH 1CE6A 5E70A 4GMTL 4CVXA 2D0GA 3ECBA 3OKKB 4PJ5A 1RIUL 2FH6A 4Y89A 1RHHA 4F7EA 3CAFA 3KS0J 5EIQA 2NY4B 3VW3L 3KLHD 1FO0A 1OAKH 2E6JA 4U6XA 2N1KA 3SKOA 1IAKB 5F7WC 2Y5EA 1OAUH 4P2OD 1CR9L 3RU8L 5I17B 2P7TB 4R26H 1BLNB 1X44A 1YC8A 1LP9B 2OTUB 2EXYD 1VPOH 3P4NB 4XCCL 5E7FA 3L3GA 4XMKH 3VXTA 5B39A 1D9KD 1FFPA 3NMEA 4NHUA 4QCIA 2A6IA 4YZFE 5DRZA 5DJ0B 2DQDH 3DGGA 4M61B 1FHGA 2VQUA 4LKXB 3GSXA 3KDMA 4P2RB 1T6WA 3D48R 4X6DE 3ULVC 1MCNA 3QIWA 3TBVB 3SDCB 4P46A 2G5BB 3OKNB 4LCCB 3RHWF 1QRND 4PD4J 5KS9A 4FQCL 3GBLA 3GSQB 3V8OA 4WEUD 2N56A 3CU7A 2ARJQ 1OF2A 1R5VB 4XC3H 4XNZC 5C0RL 3GJEB 3SCMB 1WLHA 3MUJA 2JJSC 4NGHH 3BP6A 5BV7B 1N4XH 3TJEL 5DVOA 4JAMB 1HSBB 2VE6A 5A2JH 4X7FC 3TYGH 2R0WL 5F8QC 3O6FA 3N0PB 2ZSVA 1D9KC 3QP3A 4LQFL 2EXYC 2UWEF 2JELH 5B39B 1ZT4B 4UU9A 1F8TH 3U46B 1ZWIA 3DX6B 1F6AB 3MRRA 3PWPD 4P2OC 2YWZA 4WO4D 2UUDK 2MCPH 4D9RD 1U8NB 3BKYL 5D70H 5CS7A 1S5HB 3G6AB 2BOBA 4HBCH 5C0GA 4MJIB 4XT1C 3CLFL 2EE6A 5DJYB 4DKEH 2HT2C 4M7KH 4XZUA 5FUZH 5FUOH 4W4OC 1U3YA 3GSOB 5IJVA 3C5ZB 4ZOEA 4HLZH 4TULL 3PP3H 1PGRB 3QA3A 1CFTA 5GSVB 4JDZA 5GRXG 4CU8A 1X6NA 2JLLA 5DMKB 3VH8A 5C0CA 4E42B 1BZQK 5E2WH 2XKNA 5ICXB 1DQQB 2E9IA 5C0AE 4GMSL 4OD1L 4JFED 3UJTL 3GJFB 4GW4A 2DM2A 1T03H 1K4CB 3R8BB 1KLGB 3AC0A 3BW9B 3S34L 3EO9L 3IDIB 3QCVL 4RSVA 1UVQB 3QH3B 2DBJA 1KJ3L 4KJYA 4Q9RH 4EZMA 2AERT 3U0PA 1KTRL 4HHAB 4J23A 5F88B 2EE9A 4ZS6C 2VC2H 1WK0A 1RUAL 4UT9H 4EJ1C 4UDUB 5FEBA 5F7NC 1OCWH 3MR9A 1FGVL 5MHSE 3OGCB 1YEJH 2OM5A 4G80A 1RHHB 5FGBA 3IU4L 3TJEH 1SHMA 4PRBA 5IB2B 1JWUA 3KPOA 1T2JA 4QKXB 4H0HB 2XY2A 2BNQB 3EZ8A 2VLJE 4ERSH 2DI9A 4HAGA 2J1KA 3VFPB 3BZFA 5HDBF 3MNVA 2I07A 4M93B 1U8IA 3KYNB 3HE6D 3KXFA 3L7EB 5F1IA 3OTTA 2R1XA 2W0FA 5A40E 1CDGA 1Y0LB 3QXDB 3QXDA 5GHWH 4HQQL 4N9GB 5JPNA 2VZUA 4A6YH 5HYIA 4A2MA 1RVFH 3NFNA 4YK4C 5I16A 2PF6A 2WBJB 4YFDB 3BZ4A 2NY1D 2ZCLH 1WWCA 2HT4D 4X0KB 3T0VA 1BP3B 2FO4A 3TH2T 1FP5A 1V3MA 2RCSH 4LEOA 4Y8DC 2BK8A 4JHAL 1G7IB 2OR9H 5JXEC 1EAPA 3V4UH 6FABH 2Y6SD 3IFPA 1BQUA 3ULVH 4XCNA 3B5HA 3K1DA 3MOBL 1YEGH 3U0PB 4PB0H 3BPLB 4XCEB 1VADA 3NA9L 3KLSA 4YHYC 1XR8B 3P4MB 4KRPC 5CZVL 1I8LA 3J8F7 5GRYA 4EBQH 5JA9A 3U6RB 3WO4C 4RMQA 4PJGB 2XN9A 2ADFL 4LASH 2VZ1A 1JZ5A 1IC7L 3E8UH 5HHPA 3T65A 2F54B 5DSCA 4ZFOB 4I0CC 2DIAA 4L8SA 5EWIH 2R2BB 1IGCH 3B2UD 2JE8A 4ZFGL 5C08E 1NC2B 4MXWL 4OZGB 1NLDL 5E8NB 1JYVA 5AYUH 1KUMA 2VDOH 4KPHH 3CZFB 2PXYC 4NM8H 1U42A 4POUB 1DUZB 1P5VA 5BOPA 3MRCA 2OTPA 4X4ME 5DA4A 3ZTJH 4NFCA 2AEWA 4WI7A 5C0EA 3HZVA 1UXWA 1SJHB 1TLKA 2LABA 2IANB 3TCLA 4ZQKB 3QDMB 5FF6B 1QLRB 1U3ZA 1MQKL 5JIPA 5BV7C 2WIMA 4Y88A 5HD8C 1HNGA 2X1PA 3RL1B 5D7IE 3DRQA 4EKXA 4PJHF 2HLFC 1YEKH 3IT8D 4TQEH 3ULVL 1OGTB 1AXTL 4UT6H 2NW3B 2NLJA 3WE6A 2DM3A 3KPPA 4PJEB 3B9KA 2NY0B 2OL3B 1FH5L 4LSQL 5LWYH 1GC1L 4NP4H 4P57B 3VXRA 1GIGL 4HD9A 4MNHA 3NN8B 1RFDL 4NQEB 1LK3L 4JKPL 1C1EH 5LBSL 3KYMB 2CH8A 1G9MC 1H3UA 3ULUH 3J7HA 3PHOA 3UROR 5EBWA 3NIGF 3G6JA 1KN2H 5C9JB 3BVNA 3RA7L 1R0AH 1H3PL 2DD8H 1C16B 3WLBA 1T1XB 5EOCH 5GS3A 2X4RB 3VJ6A 1NCCL 3IDGA 3IF1B 4ODWA 2YEZA 3AU1A 3TBYB 4Z7OF 3MCG1 3KR3L 2J12B 3T65B 3D0LB 2DJUA 5I73B 5T1MB 4HC1L 3VFTA 3QO0B 5I66B 5E2JA 4HWEH 5B38B 32C2B 4M7JH 1CS6A 5FO8A 4AIZA 5ITFA 1JPGA 3MACH 5DFTA 3RVXD 1P7HL 5E8EB 4ZUSB 3AXLB 1UH2A 4YDJB 3MOAH 4GRLB 3GM8A 4P59H 2ATPB 4XCCH 4IS6B 2OYPA 5LWYL 3PWJB 1NSNH 2ADIB 1FZMB 1J8HA 1J8KA 2YD6A 2PO6C 4AQ1B 4ELME 2Q3ZA 5D7JC 4S0TD 1H8SA 1S7QA 2X4TB 2NY6D 4OZ4A 1GZPA 2HJFB 3MQIA 2ZPKH 3X11A 5BOZG 5HJ3A 6CGTA 4FQIL 1N5AB 4JN1H 3ZKXC 1BQHG 2HKHH 4QRSA 5C09A 4P57A 1PSKH 3QDHA 4S1QH 5DRZB 4KXZI 1SYVB 5AYUL 3CFDB 1F2QA 4WEMB 1KIRA 4DKEL 5T5FH 2XNAA 1SQ2N 2X4UB 3NCYP 1J86A 1B3JA 3MROB 1KTLA 2WQ8A 1RJZA 2EDHA 4MMXC 4YQXL 3RNQA 4JHWL 4KI5D 1FYTE 1XMWA 1RZ8B 2NXYC 2Z92B 1XF3B 3OKKA 4CU7A 2DIBA 3FO1B 3VGEA 2IC2A 2IPUG 4CDHA 4MNGB 1FIGH 3AB0B 5D2LF 2CLVA 2R0KL 1AIFB 3MSPA 3VD7A 1ROWA 4JLRB 3RKDD 4LLYA 1YMMB 3EBAA 1N6UA 2MKLC 1M71B 5TGBA 5D7LE 3X3FL 4XNQB 2E8YA 3MRLB 5KJRL 4LPWA 4NKIL 3MNWB 3ZKXB 1J1OH 4P4KC 1AO7B 3LVEA 3C60C 5K9OB 3SDDD 5J6HB 3MRKB 3I3EA 4AEHH 1I7RA 4HWBH 3MV8E 5C09B 3WNOA 2K3TA 1F3JA 3QDGB 2HN7A 3ILQC 4F3FA 2VLKD 1IAMA 3V79C 1G9EA 1AGCA 4FA8A 1MVUB 4OZ4B 4GAJL 4KROC 4RWHA 4BFIB 4FXKA 2DJ4A 4UTAL 1RK0A 1FC2D 5D71L 2OXHA 3CXDH 3RWGB 2V17L 2XACC 1T89C 1SYSB 2GUOB 4I18A 4PJBB 4W6XB 5CJBA 3IDMB 3ZL4H 1FE8L 1S8DB 4GT7A 5F7EL 4NQXB 1MAJA 2NY7L 5GGSY 5A16A 4J4PC 1IJ9A 3KAAA 1ZSDA 3WNLA 1QBBA 1A1MA 1QNZL 3HR5A 4K7PX 4L8SC 4RBPK 1EFXD 4B7LA 4LVNC 4D0DA 3FQTA 2H3NB 1JGEA 4AEFA 2EIBA 3Q5YA 1HXYB 1ZT4A 3U7YL 5E9DB 2PW2A 1R3JA 4ALAL 4DFHA 4J4PD 1MWAL 4X5LA 5D2NE 2D7TH 3DO7A 1IT9L 3VCLB 2X70B 5F6HI 1G9NC 1X5KA 4IRZL 3BQUD 4Z7OE 3TVMA 2YSSB 5E5UB 1F90L 4HJ0C 3TVMD 4HS3B 2Q7YA 3MMEB 3DPBA 4KTDH 1DR9A 2HFTA 1BOYA 5I15H 4OTXH 5CMAB 3WKNA 3ZHKA 1J18A 4MYWB 1BGXL 5EBWB 4X6CF 1OT2A 3N1FC 3C60B 5C9JA 4YR6A 4LLDB 5LVEA 2MFNA 3BIKB 1HEZB 4OCRH 1CCZA 4WUUB 1JPSL 2NY4C 4KQ4L 4UT7L 4KKBD 4R97B 1ADQH 2A1WL 2IH3A 3RP1A 5GGSA 4LARL 4OT1L 3BGFC 4YHNB 1FFRA 5IKCA 3AREC 2MHAB 4L1HA 1IM9A 4OSUL 4BUGA 1X5ZA 3BMWA 2WBWB 3P30H 1KJ2L 2OTUA 4IRSD 1C5BL 2YUXA 2IPKB 1XF2A 2BNUA 1QTYT 3TT3L 1BLNA 2C9AA 2ERJC 2ILLA 4V2BA 1CFVL 4KK9D 4M7LT 5E2TH 1FH5H 12E8H 3WKML 2F53A 3MV7D 5CEZE 4JREB 5J6GB 4YDIL 5CMAA 3GMNA 5E95B 3V6OA 1K85A 1LO5A 1ZHLB 4NQVB 5IEKA 5I0DA 1NKOA 1CF8H 3P30L 5E6YA 5E8NA 4PJCA 3AREB 3GSVA 1VKXA 4G6FB 5E08L 1D5ZA 2UZIH 3T0EE 2A77L 4IOFC 1JPGB 4F9LC 3DURB 1NUNB 3A6CL 3EO1A 3MRBB 5LQBL 4AENB 1JI1A 4TNWF 2ADJB 1ZT7B 3WFBL 4OCRL 5LJYH 5DI8B 1P4BL 4ZFGH 2MSPA 4O2EA 3VXMA 2CIIA 4FNLL 4B7IA 1FLRL 2W65B 1I8KB 3Q6FB 4IRSA 2FIRT 3H9SD 1I7TA 4O58H 3CZJA 3G9VA 4G6MH 4G8FA 3MLRL 2XQBH 2VUOA 3BQUC 4ODHH 2FJHA 3NFSL 3UZVB 4F33A 5SX4H 4O4YL 1NEZA 4I18B 3IXTB 4YHPA 2BZDA 5LGJB 4NQDE 3BPOC 5F8RC 1WEJH 4Z7UE 5IK3A 3LN5B 1V3JA 4F7TB 4E41E 1N8ZB 1H15B 3QUXC 3MV9D 3NFNB 1IFHH 5CKGA 1KV3A 4WTXA 1Q0YL 1SY6H 4NN7C 5DJ6B 2A9NL 1GJIA 5JO5B 4PJEA 1HXMB 4F15C 1CDUA 1UM6H 4O5LH 3M17B 4P9HH 3GMOA 3ARXA 5IVOA 5E03A 4QYOB 4XX1E 3TNNA 1WWAX 4EI6B 5D5MB 4M4RA 2EZ0D 3ULVE 1IC5H 3JV6A 3BISA 1VACA 1FO0B 2XA8L 2ZCKH 1DQLH 1MI5B 4UV7H 4V1DE 1FNGA 4G8GE 1YECH 3RNQB 3S98A 3NZHH 3B6SB 1JGLH 4KKCD 5T5NF 4UDUA 3WS3A 2FECL 3HB3D 2EKSA 3QEHA 3VXQA 1XGQB 3UTTD 3VWJD 3MLRH 3QUXB 2UWEA 5EU4B 1A4KB 2OZ4L 3WFEH 5HYJA 5L9DL 2L0DA 3HRZB 15C8L 3RKDC 5ILTH 1IM9B 4C56E 4GW1A 1EHLH 1OCWL 4CDGC 3LKNB 2CK2A 4HJJL 3OF6D 3SJVE 3MUZ1 5F7EH 1TNNA 1RY7B 4CRPA 3HZMA 5EU6D 2EC8A 1LEIA 1BWWA 3X12A 5IK3B 5DUBA 3EYVB 4XVSH 1AC6A 2CKBA 4UDTA 1M7DB 25C8H 4PRPB 4NYLA 4WHTB 4P23C 5IBTH 1QLFA 2LVCA 4RGMC 5IB4A 5J57B 4PJIE 5DJ2A 5EU3B 3D39E 3G9AB 3E3QC 3C5JA 5CEYA 1UENA 2R2EB 4XTRC 1FFNB 5GGVL 4MXQC 1GGCL 4M5YH 5ITFB 1PY4A 1YEFL 1F6AA 1QR1A 1MFCH 4PGZA 5EUOB 5IB1A 5FECB 4KKLC 2XPGA 3OMZA 4WV1B 3CX5J 4MS8D 1JK8A 5FYLL 3T0WA 3K4ZA 4K2UL 2PXYB 2R0KH 4LHJB 4LAQH 3O8XC 3JZ7A 5L0QB 4CADB 4TPRH 2A6JA 4F58L 3QZWA 1H5BC 3GI8H 1MRCH 3TN0D 1EZVX 3U83A 2Q8AH 3U7AA 5FHBL 3FFDB 3MBED 3BSZH 1KCVL 4IIQA 4WW2A 1N26A 2F5BL 3QFDA 3PQYE 1HNFA 4NYLB 4WHTA 3VFVB 1CG9B 1IAIL 3TYGL 4WI6A 4HUKB 4LCWE 3U9PH 3TA3C 1IC5L 3CFJA 2IG2H 1D5BB 2DLHA 2XI9A 3KDMB 4P2RA 1IM9D 1MAMH 5SWQA 4ZPVB 3WJJC 3QI9C 5IVXA 3HI5L 4WHCA 4G8EB 4PFEA 1RZJC 5L2KA 5F1NA 4HEME 3QI9D 1E28B 4NQTA 4QRRB 3UCRA 3VRLE 1Z3GH 3B43A 1G7JA 2XA3A 1YYLL 4JM2A 5HYJB 1NGWB 4CNIA 3ILPA 4R90H 1FZOA 1ETZA 1OGTA 1WTGT 3RA7H 5FUCE 4X6EB 5IESL 4RNRB 3GJFK 4IDLA 5JR1H 1DLFH 5DHVA 2VIRA 3U9PL 1DBJH 2CLVB 3EJYD 3IU3A 3VXOB 1Z0MA 3OKMB 4N8PA 4HIHA 1U6AH 1QPXA 5HGDB 3JWDH 1R5IA 5KN5A 4RQQA 4YGAB 3CMOH 4L8CB 3FFCE 3UEZA 2APBA 4NO3B 1KELL 4I2XB 5FYJE 4YGVB 1IKNA 4RWYL 1JWMA 1A6TA 3FB6A 3D3VD 3QJHA 4M7JL 3O45A 2E9BA 1BD2B 4OV6F 3HA0A 4YEEA 1CN4A 2HLFD 3LDBB 1MSPA 4DEPC 5GS2H 3FKUS 2A6KB 1EMTL 1HILA 5JORA 1GRWA 3PDDA 4Y19E 2O5YH 1NC2D 5DJ6A 2K9UA 5GGVY 2HH0L 3MRQA 3QG6A 5EUOA 3KJ4C 4U1MA 4MXQD 2VN7A 2RBLA 1YY8A 3FN0L 1JV5A 1DVFA 3BJLA 1H3PH 2DD8L 2XFXA 4RGNB 3GHEH 4MD4A 2EYTB 4OJFL 2VDOL 4FXGB 1WQVT 4TUJA 5IIEB 1OAQL 2F19L 5D8JH 5AD0A 5JXAL 5B3JE 3CFJB 5DMIL 4XWOD 5D1ZD 5EU6B 2NY5L 4IMLA 4PRAA 3QEQB 1QLFB 2F53E 4LF3A 2HTLD 1BFOA 1IGMH 3VWKA 5ADOL 4N0UE 1OVZA 3AM8C 1XCTB 2C1PB 2LFGA 4XVSL 3LQMA 5IBLD 2HT3C 4EBQL 1RZKL 4B50A 5CGYC 3IKCB 3U0WH 3BUYB 3W2DL 3UBXG 1LO2L 4FQ2H 4HX1B 1F8TL 1A7PH 2UYLB 3OKDB 5EC2A 4EEEA 2AK1L 3ARFB 3WXVL 3H3KA 2Y6SC 4DTGH 1ZGLM 2YPVL 4ODVH 5DLMH 5JXED 1CZ8L 3KPSA 1RURL 4YDLC 2XICA 5C0JB 1K4DA 1GSMA 2R4RL 4R3SB 2DS4A 4FQLH 1H3XA 3U82B 1UM5L 4IRJD 1GGIH 2HH0H 4KRNA 4N5UA 5ESQB 3BUYA 5MEND 5EORH 4Z7NF 3CSGA 3VD5A 1C08B 2XXMB 5JIKA 3HUJA 2X1QA 4NKDB 3WCYA 1ZTXH 2G9HB 1U41A 3LDBC 4YH6A 1MLBB 3DV4A 3N06B 1DQJB 5GRUH 1AD9B 5L8KB 1TZIA 2EZ0C 4LHUD 2AW2A 3QEQA 3VXUD 5D5MF 3DYOA 1EA9C 1D9KB 1KC5L 4HCRH 4M5ZL 4OQTA 4Z7QE 1JTTA 5CJOH 1Q0XL 5AZ2L 4OBRA 5IROC 1BF8A 2AXJA 4MD4B 2HTKD 3MXWH 3HZMB 1HKFA 1JV5B 5GS1A 2W59A 3RWIB 1NGYA 4OF6A 4YUEH 4MA7H 1T3FA 1XF1A 3ZDYF 3U2SA 3EHBC 3U2SB 4U7KA 3PP4H 4QNPE 4XXCC 4GW1B 1WZ1L 1OTUD 2HWZL 3DRQB 4ZUTA 2DOCA 3KYKH 5HDQL 1DFBH 3KLHC 4LLAA 5DD1L 3SCMD 1A1OB 1YEJL 2BHYA 4NQDD 3ZDXE 4G6KL 5GZOD 1NBVH 2ESVB 4R4BB 4KJQC 1WEJL 4C83A 4DN3L 3WS3B 2E7HA 2YPLB 2FBJH 5LGJA 1S7SA 1PY9A 3A6BH 1E4XH 3AMLA 1JN6A 3WDHA 4HSQA 3S96B 1TVDA 5I6XB 1O0VA 1J9CT 2D4FA 4HS3A 3QCUL 4NKDA 5JUEL 4J3WA 3TO4B 5FYKE 1R3LB 4L9LA 4WIQA 5DRXB 43C9A 4YX2H 5CD3A 5C0FA 3C08L 3C8HA 3DX7A 1JZ2A 1A02N 4H20L 1FPTL 3DGCR 3T4AA 1JRHI 4YLQT 4NO5A 2R1WB 2WNGA 5D2NA 3HLAA 3MV8A 3QXAA 3TWCL 1K8IA 1FG9C 2JK5A 3X13A 3RZCA 2PW2B 5E9DA 1D6EA 4GAFB 4WI3A 1EZVY 3ZT7A 3MRBA 4MA8H 1NGXA 3GMMA 4EIGB 5F1NB 4OIAA 4P5TC 3LN4A 1A3LL 4JY6B 4HPYL 1Q9LA 4WI2A 4QOKB 4OIIL 3UDWC 2XTJD 3CFBB 3SHSA 4W70A 2ARJB 4PJ5E 5HDOA 1EGJL 4JY4B 3LEYH 1FIGL 3IDUA 3PXHA 2AS5M 1XGPA 3CXHK 4WO4C 4XMPH 3BYYA 3JV4B 4ZTPH 3ARFC 4KQ3L 4KMLB 3FQWA 4X6BB 4M61A 2VLKB 1J12A 4NBXB 4M00A 5GRJL 1I8KA 1ZT1B 5HHXL 3MFFA 4XNMA 1EJOH 5ISZD 4TTDD 1I4FB 5CILH 3ROOB 4Z0XB 3CLEH 1I1AB 4QF1A 3IS1X 4AMKH 4Q9BA 4JFDB 3SGJA 5EN2B 1FAIL 1B88A 5ICZA 5JIIA 1W0WB 3ARQA 2X09A 3VFPA 1QLRA 5DRXA 5ESAB 5JW5B 1Z0NA 5DTFA 5IVNA 1RZJH 1OWWA 1MCPL 4QRQB 3SKOB 1QP1A 3SDCC 3O45B 3CFKB 4WCYL 2J6EH 2OZ4H 1RUPL 4DGYL 3SGEI 5I1HH 4ZUVA 1NAKL 4P48A 4JFXA 3BE1L 1EO7A 3K80A 12E8L 3HTLX 2IPTH 2GYSA 4R2GC 1KEML 3B83A 4KHTL 3F5WB 3BGMB 4XP6L 3TVMB 1U95A 2E7LA 3V6BR 4R97C 1LP9E 5HGBA 3JWDC 3LEYL 5DZNA 1DJSA 3DSFH 2D7QA 4JFOB 4X6EA 2GY7B 1CGYA 4UV4H 4PJDA 4Q9CA 4TRPL 1NFDA 3L3IA 3DETD 4ZNCD 1ZVHA 5DD5L 7FABH 5FCUH 4MQXC 4HC1H 4JHAH 2W0LA 2Z31D 3IETA 3MRPA 4GG6E 2WLYA 4LK4A 2WBJC 5DMGD 5DYOB 3DLQR 1WJ3A 1ZLWH 2H6PB 3VXQB 3WV0A 4HWUA 1P2CB 1MLCA 4YDVB 1ES0B 3T4YA 1LO4L 3DVNA 4MDJA 4R0LB 5IQ9B 1AQDA 4LVEA 4PJ7F 2G9HA 3KPQB 3DMMA 2H9GA 4CMMA 4LVNB 4L3CA 5GIRB 3O9WC 3CUPA 5FM5M 5LGKA 4G42B 2HKFH 2ED9A 5I16B 5ISZB 1OTSD 5L6YL 3CDYA 4W6WB 1DEDA 4R3SA 4KHTH 3UTTA 1KOAA 3VWJA 1FVEA 3WIFB 3OJDA 5BRZB 1S7TB 2ZZUT 1GGUA 2E8ZA 4JANB 3RU8H 2CKNA 2NX5A 3HMXA 1E0OB 2V9QA 2ZSVB 2Y5TA 4APQC 2H8PA 5ANME 1SVZA 2A73B 2FJGA 5KVFL 1PKQA 4WFFE 2WP3O 3VGBA 5E4IA 1MCFA 5F7KC 4X8JA 4PD4K 1A7PL 3UTPE 4AYFA 2ARWA 2AXHA 1CFQA 4ZXBB 1JYXA 3VFUB 1W0YT 2NW2A 2ITCB 5D2LE 5J56B 3GGWA 2QLVB 5TE7L 5EU6A 1I7UB 2FCBA 4UMGA 5EWIL 5ACLA 1JF1A 5DFVC 2JJTA 5CEZL 2AAVA 1RZIA 3OAYH 4NWUL 3QG7L 3FB7B 3BWAA 2AKRA 1KTKE 3CXHJ 2BVPB 2BVQA 3DVGA 4U1MB 3TCXA 4DUWA 4IJ3C 3EFDL 3P4NA 2PCPB 1LO0H 5C0CD 5I1DA 2NR6D 1NGYB 1KELH 2AI0H 5C6TH 3U4AA 4LQFH 1L0QA 1ZANL 2LQRA 1MHHB 1EAJA 4TOYL 4LNRB 4MD0A 4W6YB 4OCSL 2MOVA 3SE9L 5FYKL 5T1LD 2UWEE 3ARBD 1MCBA 5BMFL 1N4XL 2VN4A 2PO6D 3GSOA 4PR5B 3KLAB 1UEYA 4KK6C 3M8OH 4RQQB 1TZGL 4QXUL 4I2XA 2BNQE 4V1DA 3SKNB 3OPZL 3D39A 3MXVH 1LD9A 4PJIA 1IAOB 4TVPE 5KW9L 3BXNA 4G43B 4JKWA 5GZND 3JV6B 5C70A 4K9EH 4EQ2A 2EH7L 4OIBA 1DBAL 2XA8H 3VDAA 1YNTA 3VRIB 1KIPB 2JKXA 1WCBA 1JNLL 4DQOH 4MAYA 3ZDZE 3GKWL 2BFVH 3RWEA 3FTGB 2AJZB 2HFGH 3GSNB 3Q0HA 1F4YH 3MLSL 4QF1B 4H1LG 4S1RL 3WBDA 1YEEL 3SBWC 3FO9A 4BYHA 2VXQL 5JDSB 1MHCA 5FYJH 4PRIB 1Y6NR 3KR3H 3T0AA 2YD9A 4M03A 2CXGA 4LLWB 4FQCH 3WMSA 4E5XA 4K55A 4K3DL 1A4JA 4J3VA 4ONHB 1N6QH 5HPOA 5L2JB 4OCNC 1KB9J 4J8RB 1CDBA 2AJSL 3UTZA 4QRPA 4N8CH 3K4AA 3QQ9C 2W9DH 4LBEA 5DEGB 4X8XA 1XGPB 2PYEE 3F6LA 1INDH 4D8PA 3UTSA 4AIOA 4I0PD 4CGTA 2VXQH 2JCCA 3QO1B 4DFIA 4WWKD 3VXRB 2R56L 4PJ8A 1BBJB 4L4JA 3KHQA 1Q9LB 4X80L 3S35L 1U58A 3TBWB 1FCCA 3BPOB 1CLZH 3IFOA 1ZHBA 4Y4FB 2F58H 1RJYB 1IEBB 3GSNA 5B39G 5B38G 32C2A 3D18A 1KIPA 4IRJA 1YEKL 2WUBH 4L4TE 1K8IB 3NH7L 1A7RH 1BHGA 1HILB 1CBVH 4CUCA 3KXFE 4ZTOL 1AGBB 1HH6B 1YEEH 2YEZB 5I1IH 2R69L 4NQXA 1HHHA 2R1YA 3WEXA 3PJSB 2AJYH 1A7QH 1BIIA 5CLTA 5I30H 3CX2A 1YQVL 1UH3A 1GHFL 3D85D 4TOYH 2ICWB 3EUUA 3ARWA 1XIWC 1ZGLP 1UYWL 2PR4L 5IMLB 2CJUL 1HYSD 1ONQB 3TPUA 1MIMH 1UC6A 4ZNEE 4AG4L 4CL7A 3I2CL 4JRYD 1YJDL 3QDMD 2NXZC 1N7MH 5L2KD 4KRPD 4AH2B 3U6RA 3V2AR 3G5VA 1HN1A 3GHBH 2WUCL 3IFLH 4M1GL 1IGTA 1WBZA 2VDNL 1G6RL 1ACZA 5EC1B 3SQOH 2JCCE 3RWIA 5EU4A 3L95A 2B4CH 4FS0A 5K59F 3QXWA 3MRJA 4XPGL 5IMLA 1JF1B 1D9KA 4JJ5B 3D2UB 5H37H 1IL1B 5F70A 4EDWH 1MWAA 2ZUXA 1MRFH 4TNVK 1F00I 4H5SB 4LCIL 1A6WH 1WZLA 4P9HL 2HT4C 3DX8B 5E8PB 5LGHL 1KXVC 2VSDA 4G7YL 3S37X 2O5YL 3DI2B 3L9RA 4CVZB 4EXPX 1NLDH 2HA1A 5DK0B 3EGSB 1FVDA 1M4KA 4MAYD 1AKJD 2VERN 1MQ8A 3KPRB 1H5BA 1UM4H 4MCZB 3MOQA 1CTOA 1MJJB 1KTLB 5C2BH 4M6NL 3KPSB 4GLRH 4M3KB 3C8KA 4JFFA 3DI3B 4WGWB 2HJLA 5JA8B 4NZTH 1ZA6A 3S8WA 1QZ1A 4HS6B 4M62H 4O51A 1QEWA 1E27B 4HX1A 1KBGL 2P49B 4ODHL 1QR1B 1BJMA 5LCVL 3KPRA 4Q9QH 1CFSB 4XVJH 2GT9A 4MHHI 3IFPB 5J06A 4ZFZA 43CAB 3BN9D 4ZAKC 4FQQB 4RGND 2GUOA 4BJLA 4JY4A 1TIUA 2ICWJ 2YA1A 3PV7A 3Q6GH 4OCWH 1MLCB 1KLUB 1IBGL 4X6DA 2BFVL 4Z7WE 5CJXA 2NY6B 3UC0L 1AGCB 1X5FA 3OXRB 1RSFA 4Y4KD 1UWXK 5BZWA 5FYLE 4NQSB 4JQXA 1YUHB 2CMRL 3CCHB 4WWID 3NCCB 4PLOB 3RZCB 3T0ED 2YD1A 3E6HA 5KOVC 5IW6A 4XPHL 3GSUB 1JZ3A 1J87A 1ITBB 1QFUH 3GSVB 3DNKA 4XBEH 1WFNA 3WLWC 1JFQL 3QUXA 1UWEL 1JNNL 2J5LC 2F8XC 1T2QH 1ZHLA 1WIUA 4L9LC 4NQVA 1FDLL 4FQXA 5FYKH 1B0GB 3NCEB 5FGCB 5FYLH 3F7YA 2GITA 2AK1H 4FQHB 1BQLH 3SDAC 3F8UB 4QHLB 4NRYA 5HGDA 5ICYA 2XKSA 2X05A 3W11D 3DARA 3MPCA 1CGSH 3MODL 1U8MB 4X7EC 3MGOA 4RGOH 5DEZA 2C3HA 4MXWH 1MIML 1VFMA 1A3RH 2R29H 1EDQA 4XVUC 5IKCB 3H0TB 3BT2H 1U58B 2IAMC 1U2CA 3TFKC 2D03H 5INCA 2GJ6A 4ZXBD 1RZJL 1T22A 2J5LB 3FT2B 3UJIH 5FB8B 3DV6B 3QCUH 1S7UA 1PG7W 1VGKA 3QDJE 5C09D 1YN6A 4WW2F 3OJVC 3UPCA 3V95A 3DXAE 1KG0B 1LHZA 2O5ZH 1IT9H 4H8WL 3JVGC 4HPOH 4GG8B 4OM0L 2PYFA 1YEGL 2DMKA 5CUSH 3ULVD 4I9WD 3D0VA 3MMEA 2Q7YB 3TJHC 1J8HB 4JY5L 2JJVA 1NC2A 4OZGA 1FFOA 1CWVA 1MREH 4BFBD 3ETBF 3LKRA 3WFDL 3IXAA 4OB5L 2UVEA 1G9MH 2HRPH 5KG9B 3GSUA 2A38A 3S36L 1B0RB 1IM3B 1NGXB 5I75B 3BRGC 4WV1A 2J2ZA 3DX9B 2GEEA 2EO1A 2X41A 3FQXB 5C3TA 2ED7A 3C08H 3FQTB 3LB6C 3NCJL 3THML 4I8DA 4NO5B 3BIBX 4BZ2H 2VE6B 5J12B 2FX7H 5GIRA 5I18L 3O2WL 1G6VK 4RMTA 3FJTA 3HPLA 2FGWH 1JL8A 1QFPA 3HNSL 4ODWB 4MA8L 4Y4KA 1HINH 5J12C 4JFHD 1AGFA 4O5LL 1JN6B 2XWTB 1U92A 2V7NA 5FA3A 5FYJL 3H9ZA 2AABH 1RIVH 3W0WE 3TWCH 4HFWB 4FQLL 2ICES 1T21B 2V2WB 3I6LD 5KVMC 5FCUL 2OX5A 3RVTC 2EDDA 3MLXH 3QUYA 2CDFA 1G7LA 1RULH 2EIZB 4KTDL 5J11C 4IBLT 4LPUA 3WD5H 3OKYA 4PJCF 5E8OA 4KJPD 5I74C 1ZLSH 4KUCD 3FT2A 2OJZH 4PG2A 4Y5XB 1NFDE 2B2XH 2FBJL 3DVGB 5EO0A 4O4YH 1T04A 3FB7A 4LSPL 5F1IB 1W8NA 1DQDH 1P5UA 2LAGB 2AJXH 4NUJA 4N0CD 1DLHA 3E1F1 1A6ZB 2ICWA 1ACYH 1IAKA 4MNGA 3H42L 2WIIA 2BSTB 3ISWA 5KSAC 1R5IB 1FNGB 3F65A 1W72H 4PJFA 4H5SA 3KWWA 4XAKD 4KZEH 5CCKL 5HGGS 4L3ED 3OKLA 3VGAC 4PP1C 3WHE0 3L5WA 5HI4D 5FUOL 3AMKA 4QYOA 3QRGL 1B2WH 1QA9B 4YNYB 3TNNB 3LEVL 2XNAB 1II4E 3CLFH 4HGMA 2Q86B 5EO1A 4Z7NE 2CLZA 4HXBL 3QQ4A 3U7WH 3SE3C 8FABB 3UDWA 4EVNB 4Y16C 2GQHA 5JO5A 4PYGA 2GK0A 3QQNA 3QQ3B 4GRLD 2O5XL 1KJ2A 4I3GA 2GSGB 1A9EA 1VADB 4DUVA 4AH2A 3QNZB 3BDXA 3SDAA 5BS0B 4QTHA 3QI9A 3D87B 5ICXA 3EYSH 2R39A 3OV6A 3INUH 4ZOBA 4LLVA 4NJ9H 1C5BH 1VA9A 3QIBD 1ZLVK 1AQDB 1T21A 2V2WA 5E99H 2NCMA 2NYYD 3RWFA 1Q1JL 4N5EC 1A7OL 1EPFA 1WTLA 4BSVA 2XWBA 4XZUB 2L7UA 1YN7A 1S9VA 2BHUA 3P77A 1CLYH 2EDQA 1VFAB 4IIQC 4WW2C 4X4YB 4EUPG 3AXLA 4ODUA 1I3UA 4HDIB 1I8LC 1LWRA 2VLJB 2XZQH 3E3QE 1AGBA 1U8NA 4KK8C 5DD3L 5K9KB 1E27A 4YHIB 4ORGA 3M1BA 4NZRL 3K2UH 1UXSB 5AAMA 3VXSA 1B90A 1OLLA 2GJZB 2CK0H 3QQ4B 4OLVH 4MQ7B 1X7QB 3S35H 3LKQA 1R5WB 3RVUC 5I2IB 1FNEB 1KYOJ 1DBAH 3PGCB 4FFYH 5HTSA 4OZHA 3TZVA 1S78C 3VI3F 3MUHL 5CBEB 4RRPA 4XH2A 4LHUG 4Q6YA 3VFMB 2BRRH 2J88H 3PIQB 2JF1A 4V1DB 3SKNA 4EQ3A 1SMOA 1DQML 1NKRA 4CU6A 5AUMA 1M7DA 3QFJD 1AJ7L 4ELKA 2C26A 5CHNA 4KJWD 5DTFB 1OARH 1X4YA 4ZDHA 3IU3B 3OB0H 1TTFA 3VRJB 5KVDL 4FFVD 3TLRA 3O3EB 4HHAA 2HMIC 4LEXL 1YMHA 3QUMB 4NZTL 2PUQT 5C6TL 5JDSA 5LXGH 5GXBB 2ZG2A 4XB8A 5IF0A 1KEGH 4JO1L 5CIPH 1F97A 3QUZD 5EOTB 3C9NA 3MO1A 5L7XL 3NIDE 1RUPH 2QQNH 3EKCA 3UAJD 3RVWC 1HHJA 5C0CE 2Q7NA 5DF0A 4POZC 5EZLA 5FYJU 4Y1AE 1HEZA 3L7FB 4YZFF 5KAQG 1LD9B 4PJIB 5GZNC 2DL2A 5KOMC 1ZGLA 3TNMA 5IROA 4KFZC 3C6LA 1S3KL 5FYKD 5B4MD 4IIQB 4WW2B 4GAYB 2R1YB 3WEXB 5F9WB 5FYLD 1T66C 1LDPL 2UZXB 3QHZH 1DUYA 1EVUA 5EUOE 3MZGB 2QV2A 4K2UH 4L3EB 1Q72L 1AC0A 5EBMB 5D7IB 2B1AH 3CMGA 4KRMB 3OHXB 5KSAA 3GBNL 5CBAB 1FC1A 3T77A 3L3HA 2DLGA 4KKAC 4YHIA 2VDMH 3T0XA 2GCYA 3UTQA 3Q2CA 3RWJA 4XWGH 2DIJA 4EN3C 4AG4H 1JGLL 4PJ8B 5HPMB 3NIFF 5I1EH 2CJUH 3G08A 3MREB 4OLWL 4HUNB 2OI9B 1RHFA 3OAZH 4W68A 5IEHB 4RAVB 5A2FA 4Y16D 4S1DC 4ONOA 1UCBL 4JN2B 1N0XL 5IQ9A 4JPKH 1XFPA 5EU7E 4Y4HB 4DVBB 2H1PH 43CAA 1AI1L 5T1KA 1N3NB 4GS7C 4POZD 3DECA 1LEIB 3RVWD 2OL3H 1U3HD 4D0CA 1KJVA 4GQ9L 3O2WH 3DBXB 1ZAGA 1FPTH 3OHXA 2DTMH 5EO1B 4GKOA 5FOBA 3SDYL 3HFML 3OAUH 1D5ZB 4Y1AD 4U7SA 4JKLA 2G75B 4Q0XH 1UKQA 4LRIA 2VXVH 3WJJA 3PWVA 3EIFA 5BQ7B 3BKML 4LU5H 3PQYA 1VFUA 3Q5OA 2AQ2A 3PQYD 3X14A 5DD1H 4M6NH 4JEGB 2LU4A 1MCKA 4P99A 4L8DB 4AT6A 3OSKA 3OGCA 1BD2E 4KTEH 3PUCA 4MZ2A 4I77H 4NOFA 1TPXB 1VACB 3STBA 4FQPA 4KUZH 3ORJA 1K4DB 4CKVX 2FX9H 2M8XA 4KK5D 4X6FB 1F4XH 2FJFB 1KN4H 2X2YA 4RAUA 1R0AL 1F6LL 3BYTA 4FFYL 4MA3A 2OBGA 1LILA 5FA4B 5C0DB 2B1HH 4BH7A 1QQDA 5C0AD 2GW5A 3BI9X 3DBXA 5SWSA 4Z7VB 4HBCL 5DC0A 1RAMA 3V6ZB 1KB9K 5GHWL 5H94A 5J13C 3W5MA 5CFHA 2CUMA 4C59B 4ZDHB 3SGDH 2BX5A 1I1AD 3W0WD 4GG6F 1OB1A 2P45B 3BGMA 1YEDB 5GPRA 4YHKH 4YE4L 5IGXH 5F7MC 2VDML 3I3DA 4WV1C 3GBNH 1FYTB 2Q3AA 2QTEA 4UQ2B 3ARGD 3EYFA 4ZFZB 4KDWA 1F45A 2NYYC 2QADC 3V0VB 4HWBA 1WAAF 4E41D 1KACB 5HHME 4AIZB 4UT9L 1FDLH 2AVGA 4ZUSA 4FTVB 1HXYA 4BQCA 1TQCC 4RX4A 1S9XA 1ZA6B 5CP3H 2WK2A 1R24A 5DZOA 3O4OC 3VDBA 4JFFB 4G9FE 3M1BB 3BEVB 3SGKA 1PLGL 2DQHL 4J4PA 3REVA 5IFHL 4JANA 5KG9A 1I1FA 3HS0A 2KZ1B 3UTTE 3SDXE 4K3JL 5DURD 3QDGE 3O3AB 3QZWG 3WIIH 4HS8L 4K23L 4L9LB 43C9B 5C0IA 1P4BH 4L4VE 3BD3A 2X40A 3KJ6H 3T8XB 4G42A 5TE4L 2ZUYA 3H9SB 3I6LE 3UBXA 3PDGA 3O4LB 3FN9A 1BFVH 3KYOB 1DN2A 1DEEB 3EYOB 5DEGA 5EUKB 4TSBL 3P9LA 2UZIL 4APQB 1S9YA 3HMXH 4Z9KB 5I1AA 1XGRA 2VITB 4KMQA 5HYQB 1NCWL 4H88H 2H6PA 3BP7B 3LEXB 4E5XB 4ZUTB 4OFDA 3C9NB 2VR5A 4O2CA 3A6OA 2CR3A 3MO1B 3R06A 2HVJA 1BIHA 2YZ1A 1JNNH 2VAAB 3KPNA 4NC0B 5BVJA 4HWZA 4GKZB 4TVPH 1LVEA 4WU5B 4Z95H 2BDNL 5CSBA 3MJ9H 1LP9A 4PJDE 3EOBB 4U0QB 3UPRA 3CMOL 1INDL 5FF6A 5I1AB 4PJBF 3HI6L 1J11A 1OPGL 5CHNB 3KPRD 5C0FB 3FO2A 3H3PH 3KXFD 3HCVA 4QTIL 5GGRA 2ZOLA 4R6UA 2NNAB 5HHVL 1P7QB 2GJJA 3TGXA 1Z3GL 4EN3A 1NBVL 2G75A 4GS7B 4FOMA 4LVHB 5E24E 3TO4D 1H8OA 3G04B 3SY0B 1UM5H 4PGBB 1EGJA 1NCCH 1ND0A 3SO5A 1I1FB 4I77L 5I18H 3VXSB 1QBMH 3BN9C 5K9JH 3QDJA 4MB3A 1JGEB 4WFGD 3T0EA 5E8OB 3SOBL 1ZA3B 4O2FB 5IB5A 3PWUB 2JJSA 5DJXB 2J6EA 1GH7A 1LO0L 4KWUA 2VXSL 3LKPA 4X4YA 4LSQH 4DZBB 2XTJB 4U1NB 4TUOA 2NW2B 1H0DA 4K3GA 1VFBA 5JW4M 1RUMH 3RWFB 4GAJH 1NANI 1KSRA 3TJHD 5DJDB 1I1YB 5C0BD 3HPLB 1ZMYA 3B9KD 5T1LB 3VDCA 1PBYA 1S9WA 1GCFA 4PJAE 4PJ9B 4Y5YB 4JKMA 4LKCB 5EORL 3MYJA 3KGRA 5JDJA 1LNUB 2A74A 5FO9A 2DLFL 3VXME 3ZL4L 2DLIA 5BS0A 4LMQE 5C0JA 3ZTJG 4HAFA 4ACPA 3GIVB 5I1IL 3BH8B 4Q58C 1B0RA 1LE5B 4HIEA 4ZXBC 2BNRD 3TZVD 4L3EA 4XVUD 3MLVL 3MCKB 4NM4H 2FR4B 2A0LC 3WHXB 3AREA 25C8L 2OP4H 3F62A 4BSJA 2DQFB 4WHDA 4P3DA 4XCFL 1JNHA 5F3HB 1TETH 2OSLA 4PJFB 4P2OB 1NGPL 1N7ML 3SBWA 1MAKA 5F9JA 4IDJL 1PG7L 4QLRA 3ZO0A 2B2XL 3TPKA 4U1NA 3QSKB 2VSCA 3MCLH 4FMFA 1X5YA 4GLRI 4PS4L 4B0MM 1EH9A 4PJ7A 1IVLA 3IDXL 5F9OL 1D5IL 1T2QL 3I84A 4KJYB 4WUUD 5JHDA 2AJYL 3S3JA 3K4DA 4HKZB 4JG1L 4I0PA 1JCKA 3QG6B 5EO0B 2P8MA 2Z35B 2QSCL 1Z9OA 5CWSB 2VDKH 1NFKA 1CK0H 5IV2B 3RJQB 2Y1VA 4Z7VF 5EOCL 4ENEC 2ZG1A 3QEUA 1QSED 3VFSB 1UZ8A 2ADGB 3W9DA 1WAAA 5I9QB 1RVFL 4OD2A 2J8OA 5D1XB 1CL7I 2B4CC 4U0RC 4WWKB 4ZUUB 3HUJF 2V7NB 3WIHL 3P73A 4YDKL 2SEBB 1MI5E 4JFZH 3ARDB 3CH1A 3HZYA 4ZAKD 1PKQE 3PL6D 1J1PL 2KZWA 3BE1H 3RWJB 1DFBL 2CIIB 4NN7B 4HMDA 4JO4H 5JR1L 2X4PA 5DMJB 5FK9B 2V2TB 4Q9QL 4NO0A 2P5WB 1UWGL 4X6CE 2JJWA 5BVJB 4JFEE 3OJDB 5BRZA 1FN4A 5HVGB 3MBXH 4HDIA 3GMQA 5B22A 4KY1H 2DQCL 3DUUB 3EFDH 1YPZE 4JRYE 2VXTL 3TV3H 5C0BA 3RL2A 1FZKA 3CLEL 4DVRL 5MI0B 5FKAA 1VEPA 2H9GB 5C0ND 1KPRB 1RU9H 3GMNB 1MJUL 4K8RD 1K6QL 4QHNA 5CSGA 1VEOA 1QBLH 4QRPB 3MUGB 3K2UL 2IADA 5EPMA 4QRTB 5M7QA 1NH6A 2LE9A 4PBVC 2DRUA 1KCVH 3FT3A 1I8IA 3BFOA 3WUWB 3BD4A 2W60A 3BO8A 3GK8H 1W72A 4X9HA 4PRIA 5DVKA 1K2DA 4CMHB 3DUUA 5CINH 2O61A 4LLWA 5CWSA 4JY6A 4YXKL 2GI7A 5C07D 3G5YB 2FD6H 4LSSH 5D6CA 4OCSH 3RIFK 3RWEB 3NZ8A 1IAIM 5JPMB 1MF2H 2QHRH 2MCG1 5JHDE 1JF6A 2P5WA 4GW5A 1YDPB 2ICCA 4NJ9L 2P7TA 3BJ91 4EN3D 5I17A 5LAXB 4MAUL 4MCZA 4M1GH 3K74B 1YNKL 3VFNA 2NMSA 2FATL 3BXNB 2J7LA 4A6YB 4KI5F 2F5AH 3EO0A 4R8WL 4WGVB 1HYSC 1FYTA 4UQ2A 1DDHB 2UVFA 3PWLA 2B1AL 1NQBA 4DOHB 3RPIB 3VMNA 4WWKA 3VI4E 3FCTA 1K9TA 5MEOB 1Z9LA 2NXZB 3KHOA 3O2VL 5FHAL 5D8JL 1GZQB 4XRCA 1TITA 2NQCA 1S7XB 4YBQD 4JQIH 3QFJE 5H94B 5ESVB 3MLPA 3QH3A 3SE8L 5I1DB 3BDYH 1W0WA 3I75B 4NM8L 2P5ED 2EDEA 3ILPB 2NY1B 4DN3H 5LKNA 4GKSB 3PDOA 5BV7H 4NQCE 5D6CB 3ES6A 3DJ9A 4P4RA 4RZCA 5I76B 5CSZA 1DQQA 5I9QC 3GKZA 4FP8L 1T1ZB 4F7PB 5C6PB 5D7IF 4OFVA 1RU9L 2XG5A 4HZLB 2CQVA 3ZKQD 2W60B 5IMKA 2EYRA 4DVBA 1L6ZA 1U93A 3QXUA 4LCWA 2XWTA 4NFDA 2YKLH 5GS2D 1BIIB 3PWLB 2FJHB 3BH9B 4X0KA 2E7CA 4MX7A 4I2XE 2EC9U 5DQJA 3QQ9D 3VXRE 2QEJA 4KDTA 4JCMA 1KJ3H 2DICA 2VLRE 4AL8H 2X4OA 1HDMA 3SDXA 2W65A 2M26A 4ZAKB 3D69A 1C5CL 3WHXA 3UJJH 2P8LA 2IH1B 2EYSB 1CK0L 1J1PH 4UU9B 4HUXA 2HJKA 4WW1A 5IVZA 2D7OA 3FT4A 1NBYA 4WO4A 1E6OH 3VD3A 3WYRA 3O11A 1A6WL 4Y19B 2XY1A 3D0LA 1W0VA 5DMGC 3A6CH 3ALXA 2FGWL 5AZ2H 1NAMB 2Z4QB 4ODBD 1MAML 3OKDA 5EC2B 4PJ8C 2VL5B 4XVTH 5F9DC 1A9BA 4KC3B 1H15A 4OLVL 5CILL 5EFIA 1A0QL 1D6VL 3O6LL 1UGNA 4L3CB 3BVNB 3B3IB 5GRJH 4YIQA 2IADB 5EU6E 5IB2A 1WAAE 4MCYA 4MNQD 2GAZA 3CJJA 2MCPL 3T04D 5D9SB 2X9YA 2CKBL 3S5LB 2JIXA 3VFRA 1UWXH 4PJHA 5ETUA 1I8MB 3EOBA 3S34H 1SEBB 4YPJA 3CVHA 5CSZB 3QIBC 3DVFA 4LVOC 4GXUM 1ZHNA 3L3HB 3WS6C 4D3CL 1NLBL 2W9EH 2YUVA 1RJLA 4U3XA 4YXKH 5TDPB 3KNBB 3JWOL 4M1CC 4JFDD 1HWHB 1S3KH 4M5YL 4WFEE 1S7VA 1CDJA 2BVOB 5FYKU 5JZ7C 2CKBH 2DKUA 5FDWB 4E42A 5SWZB 1BD2A 3SGDI 5C0EB 3BP5B 4B5EA 3ARTA 1QSFD 3ULUD 4MJ4A 2YN3A 2N4IA 2LTQC 5T1DL 1JNJA 3SGJC 5C0GB 3B5TA 3TIDA 4ETQA 1A0QH 5EBGA 4P46C 1JPFB 3AAZB 1A3QA 4XAWL 5ITBL 1CGSL 3VMPA 3HN3A 1F90H 3TZVB 2NXYB 4TTGA 2BOCB 2VXUH 3UYPA 5C7XL 3N9GH 2CPCA 4DN4L 3P2TA 3REVB 4DAGH 5DHYA 2C3XA 5BZWB 1UEMA 1YEHL 4NFBA 3G5YA 4M4PA 5L9DH 1Q9OA 4NKMB 2AQ1A 4HKZA 4JRWA 5B3JF 4PRHA 2RCSL 1U8KA 4XC3L 4UT7H 3UMTA 3X3GL 4RWYH 3G6DL 1C16A 3WLBB 4NKQB 3LRHA 4LEOB 1JGDA 1JGDB 1NL0L 4Y16A 3FOMB 5CJOL 4DGVL 2R15A 3F7RA 2DBLH 1HHKB 3HFMH 4Z7WB 5TE6H 5L2JA 2GY5A 3NBNA 3RDTB 1BBDL 4TNWK 1KJ2B 4RFNB 3LN9A 1A8JH 3PWUA 3HC3L 3CK0L 2ICEA 2BNRB 3GMMB 1TTUA 1T5WA 2H32B 3F6IA 2NLJB 4M7ZC 2XYCA 3MRQB 3VXTB 1KTDB 5CGTA 3GIVA 4BH8B 1X4ZA 3RL1A 4XP9L 4M1CD 3S37H 4Z0BL 1FYTD 1KT2A 5DLML 4F37F 1MIEL 4U1HA 4LHQB 3MV8D 4CMMB 3O41B 3LSOB 4Y5YA 4DAGL 4TN9A 3IDMA 2VLRA 1R3HA 5B21A 3NTCH 2WSKA 4N1HB 3W2DH 2HTKC 4PYHA 2X5PA 3S96A 3V6OE 4UTBH 3SDDB 4J3SA 2Z8VC 1OSZB 4NHCL 1SEQH 2KQMA 3EFFA 1BQHA 2IAMB 1Q8MA 3GBMH 4LNRA 3W9EB 3KJ6L 4UBDD 5E6IB 1L7TL 1BVKA 4KAQH 4NPYB 4Y7MA 4YBLC 2HFEA 4JFQA 1NPUA 1WVZA 2I27N 2BNUB 4OBSA 3FOLA 2QQQA 1ZHNB 2OR7A 1KPUA 3NACH 4ZD3L 4P5MB 3ZDZF 3HMXL 1A7QL 3RWCA 1I3RA 3SE8H 4YXLH 3VGDA 1J05A 3MLYL 1YQ2A 1KIQA 4U1GC 1KXTB 1QRNE 4JVWA 3VH8B 4AMKL 4J6RH 5KSBE 4U6VH 5JOFB 1KLUA 3O2VH 5ETUB 1I8MA 1RI8A 1KNOB 2XTLA 3QFJA 1UQSA 2OK0H 1I7UA 3BHBB 2C1OB 4U1IB 1CF8L 2D9QB 4JFXB 1FL3A 3BT2L 4NO2B 4XHJD 4LLDA 1J1XL 2BMKA 4GBXB 3B3IA 1BM3L 4LP5A 5MENE 1O7SA 2J3SA 4U3CA 1DP0A 5E8DL 5IW1B 3S88L 3NTCL 5E6IC 3ZE2E 3CGTA 3GSWA 2NX5B 2WWMC 1HSAB 2FEDC 5I6XC 2NZIA 3RBSA 1BVLB 3L3OA 3L3OB 2IAND 1DLFL 4L29A 2IH1A 1IGIL 3O9WB 3V4UL 6FABL 3ZKNC 2AXFA 1CGXA 1AJ7H 4PTUA 3V0WL 3NAAL 3HNVH 1N5AA 5HHOD 1J0HA 5IW1A 3IJSA 3D0VB 1JHKH 5GQBA 1TJHH 3FOMA 2A6DB 3KPQA 2NY6C 5MEPB 3RWDB 3RUGE 7FABL 3GSNL 3PHOB 2YXFA 3DWTA 1XGYH 3SDCA 3ALWA 3UC0H 4J1UB 2P5EE 2NY2D 2OTWB 5BW7A 4X5XA 3LKPB 4PRHB 4R4ND 5IT2L 5HBBA 2G60H 3SO3C 4GRLA 1MHCB 3D9AL 4JZJC 4D9QD 2XQYG 4Q0XL 4JO2H 5ISZE 5DD0L 4NNXA 4ALAH 1DVFB 5E8DH 4L8BB 5FKPA 3E2HC 4HIIA 5DI8A 4RZCB 2MNUA 1NBZB 4GW4B 3RGVD 5BRZE 4EUPB 3L3IB 4AQOA 2EDNA 4N8CL 2G2RB 1F4WL 4O58L 4P23A 4GXVL 5IHZA 2JCCF 5BO1L 1FG2A 4X6DF 1QNZH 4XPTL 3OWEA 3L3DA 5MEOA 2EDWA 3TBYA 1P84K 1GZQA 4XRCB 2SEBA 5FM5O 3TN0B 1F4YL 3C6LB 2VABB 3MLSH 1CE6B 1KPVB 5AUMB 5C1MB 4OFPA 2BRQA 3N1MC 1PFCA 4NC2B 3O0RL 4PJDF 3EO0B 5ACZA 2P46B 1T0NB 1XH3B 1SM3H 4OD2B 4ZD3H 4UTAH 1INEH 4EDXB 1N0XH 5AWNL 4ONGL 2CK0L 2Q6WA 3TA3D 4BELD 4X5WA 4ZFOA 2PETA 1HCFX 3MLTA 4RMUA 2FSEA 4FNLH 3O2DA 1R5WA 2P43B 4Y2DD 5J1AB 1AE6H 4RMWA 3VD9A 2AEIT 1C5DB 1TJIH 3GMLB 3H9HA 5KW9H 1I9JL 3MFGB 4X9IA 2LVEA 1L0YA 5EBLB 5C0NC 3GMOB 3KPPB 3MLZL 1MRFL 5ELIA 2V9RA 5DVLA 3U36A 4X99B 1J10A 1BBJA 2AJ3B 4YWGH 3VI4F 4JPWL 3DHMA 3NACL 3X3FH 1J5OH 1Q72H 3O8XD 4PJGF 5EU5A 1NFDF 1T7YA 3MLTB 1DANT 1Y6KR 3PG2A 5EPMB 2HVKB 5F7DB 1OP3K 5D96C 4MXVE 3P9LB 2JB6A 1ZLUK 1FZKB 1CICD 3TN0A 3ZTNL 2HLAA 2HTLC 3K8LA 5KANI 3ZKMD 3RL2B 3SGEH 3PWVB 1NAMA 2A73A 1MNUL 2QQNL 5I2IA 4EXKA 4WUKL 1S7WB 1MCWW 4PJXF 2PTVA 2EDTA 3GHEL 5CBAA 1D6EB 2F74A 1MFAL 2D7MA 2HKHL 3KYNA 5HXMA 4HLJA 3L5XH 3TBSB 5FECA 4ENED 4CJ1A 1UM6L 4OZGE 3T3PF 3RAJL 4PRIE 3CX5K 4PJXA 1EMTH 3EGSA 3FB8A 2A9NH 5I19H 3OZ9L 5D1QC 4JM4L 4XAKE 1R3LA 3QWRA 4J3UA 1ADQA 4P9MH 1AXSB 4OZIB 1F4WH 3VRLF 4H8WC 4BQ9A 5IEKB 1WIOA 1FL3B 1DQDL 3F7VB 3D2UA 3UTPD 3VG0L 3ZKMC 4P2CG 4C83B 5FAAA 2VC2L 5DJXA 1G6RB 2BRRL 2J88L 1YECL 2XZAH 4KKCC 2IEPA 3I02A 3RGVB 3GUTB 4M5ZH 3EJJX 3FQUB 4ODXB 4JFEA 1QQDB 3U79A 3TT1H 4GRLC 5GGTH 3VW3H 2X4QB 1BVLA 5T1DH 2DM7A 4TVPD 2V5TA 3JV5A 5D7IA 1XR9B 1I85C 3GB7B 1CE1H 2E9JA 5BV7L 2EE3A 2QSCH 3VGFA 4Q97A 3CK0H 1BZ7B 3C2AH 1QPPA 1OSZA 4HXAH 4HFWA 3B6SA 2OS7A 4H1LB 4JQIL 3ARBB 1DDHA 3FO1A 5MENA 1HOCB 1RURH 4WEBL 3IJYA 3L6FA 2BOBB 4S10A 3QUXD 3O41A 3MRNA 4Y2DB 2D03L 3JWNC 3SQOL 4FRWA 1RFDH 3INUL 3B9KC 3S36H 5I1GL 5IB3B 3BEWA 4R8WH 5L88L 3DX6A 1KEMH 1FNSL 3O11B 4KK6D 2EDYA 1LE5A 4W4NA 1CGUA 4N68A 4Z7QF 2FB4L 2HYMA 2NZ9D 4TQEL 3GJFA 3BX7C 4XMLL 4RDQG 1HSBA 3FMGH 3LEXA 5GS0L 3VFOA 1FFOB 2D0HA 4OLYH 5C3LD 5HJ3B 1CI5A 2FX8H 3GJEA 1JYWA 4P5TB 1FL6B 4JRXE 4LARH 1DBMH 4G7VH 4PLNC 3VFGL 3ZKND 5DVMA 3T4YB 3RWHA 3E6FA 1VFBB 4RMVA 1CXKA 1GGBH 3JUZA 2HT2D 1S5IH 1URLA 1HWGB 3QDAA 4LLVB 2FHCA 5J11B 2DMCA 4Y4HD 2P1YA 4LGPB 1IRAY 1J8HD 2DKMA 2V6HA 2MQ3A 3HAEA 4NKMA 3TT1L 5L7XH 1EXUA 5DJAB 3VXNA 5IB5B 3CVHH 3BIAX 4XVTL 1A9EB 3QNXA 4LGSB 1N0LA 3FTGA 3LV3A 1G1YA 2CDEA 2F74B 3KPSE 2DQCH 2E7BA 4IRZH 1U8QB 4FMKA 2XN9E 3V5DB 4U1KA 3EOAA 3GMPB 3F7PC 3OKOB 2W0FB 1T5WB 1EJ6A 2CDGB 4EIZC 5C9KA 2FNBA 2I9TA 3OX8A 3C87A 1OD7A 3KJ4B 3NIFE 3ULSA 4PJCB 3VXSD 1M71A 4PJ5D 3UJJL 1CGWA 1DUYB 2P48B 2QQLL 4EDXA 2DN7A 3RDTA 2HWZH 1JUFB 4JPIB 3AVEA 4G6AC 3TIDB 4ETQB 1G7PB 3VWJC 5E5RB 2GSIB 3I9GL 1V7NH 4E41A 1V3KA 3MV7A 4IOIB 4M7ZB 3OBAA 3VXUE 5E0QA 1OTSC 3TH3T 4A6YA 3HC3H 3HE7A 3HI5H 3O9WD 5JMOC 1HQ4B 1MHHA 1LGVA 4RFOH 3VFOB 3EYQC 1LEGA 5C09E 4B41A 1IGYA 1ZOXA 3WE6B 3PABB 4GKZA 2AKRB 4H26A 2W9LA 1L7IL 1FGNL 3G5ZB 4YHOL 4OZFB 1YJDC 2YPKB 5DJ8A 3QUMA 4CBPA 3BO8B 1RPQA 1XGQA 2V7HB 2RFXA 5E1AA 4NWTH 4JR9H 1BX2A 4O00A 1OAUL 1S9KC 2VITA 1JGVL 4KMTL 5CP7A 4G9DA 5HYQA 3IJHB 2CUHA 3JSSA 4TPRL 1CLYL 1AD9A 4KXZH 3MUGA 4XNXH 1XAUA 4YIQB 3L6FB 2E7MA 1U8LA 1TJGL 3MA9H 4UBDC 4XBPA 5EDXA 1TDQA 5I1EL 4R9HA 1MVFA 1PG7H 3GHBL 4TSBH 2NTFB 1QEWB 2ZCHH 3T2NH 5BZDB 3RNKA 5JIHA 2X44D 4JFFE 1FIEA 4XCFH 3RIAF 4AK1A 4M1DH 1D5MB 2X89A 3U1SH 4FZ8H 1FLTX 3RY4A 4HS8H 1ZTXL 2RR3A 1AQKL 3AB0C 1QBLL 2JK5B 3X13B 2B39A 5IR1A 3KG5A 2FD6L 2H26B 3BESR 4HWBL 4LCIH 3NGBC 3H9SE 3BDYL 1T0MA 2MPAH 2BSRA 1FAIH 1UG9A 1UFUA 5DQ9A 4RAHA 1XGUA 3G6JE 3IF1A 3IDGB 1UA6L 2DWEB 3SCMA 4TTDC 3QNYA 3RWHB 5KS9E 3DVNB 2NY2B 4OFYA 4U05A 2CKBB 4UDTB 3DXAA 1AXSA 4FXKB 2QQKH 3JWOC 5AD0B 4YBLB 3OKNA 1JGUL 3M45A 4OQTL 2GT9B 3Q6FA 1OAYL 1FJ1A 2FDBP 3V6ZA 4IMKA 3FL7A 4K7FB 1WBYA 3QAZC 4KK9C 2Q76A 4NHCH 2WZPD 3UTQB 5E00B 3QNZA 3QT2A 3SDAB 1TXKA 3D1MC 2Z35A 4X7TA 1BF2A 4GKSA 2VLJD 1Y18A 1IGJB 2OMBA 1I7RB 1Q38A 3RDTD 2X1XR 1RMFH 1Y0LA 4JREC 2HKFL 2R9HC 2XTJC 5KVGH 1JZ6A 3SE4C 4F9LA 4YO0A 3VI3E 3WL9A 4PV9A 3DTXB 3H7LA 3I50H 3LKRB 5HGAB 4GRMB 1HI6B 4TSAH 4DCQA 1MELA 2BNQA 2C3GA 2X7LB 1PKOA 1UXWB 1ZGLB 2NY4D 1OD9A 3LH2H 3BH9A 5TF1L 3V4VH 4MJIE 4GG8A 5BS0D 3ECBB 2AV1A 2Z9TA 3BN3B 1T7XA 4OGYL 3HNVL 4QRQA 1K3IA 3NOIA 3V5KA 5E5MA 1DLHB 4XNZB 4LPTA 2NZ9C 3MCKA 5DD6B 3WL9B 1SM3L 1YDPA 5JUEH 1S7UB 1L6XA 3IETB 3MRPB 3OJMB 5HHNB 5TDNA 4JKPH 4LU5L 1RUAH 1UVQA 2I9LB 3CCHA 3BH8A 4PRID 4PUBH 2OLDA 1IGJA 4XI5D 2YKLL 4QHMB 2Y06L 2EDRA 3MJ8A 4IHOB 1LQSR 1VSCA 1N8ZA 4WFHE 2X4SA 5D72H 5IMOB 1XZ0B 4BK5A 5DUPH 3QHTC 3RVVD 1A14L 2QQKL 3LCYA 4PRDA 2K7QA 1ZXQA 1CQYA 2IJ0C 1HZHL 3D25B 2ZG3A 1B4RA 3H9SA 5SX5H 5E2WL 1NEZB 2JJUA 4BKLB 1ORQB 3PIQA 2I25N 3CC5B 3MRMB 1T66D 1LEKA 1A21A 4IDJH 4WU7A 3HC0A 3IYLW 4Z8FL 3EYQD 5JHLH 5J3HD 4JVPA 5DC4B 3BQUB 2YWYA 2PXYA 2B4CL 5IHZB 1C1EL 1N59A 5LBSH 1RZFH 3LV3B 4NQSA 4ZO7A 4PGEB 3ROOA 3QXAB 3WKMH 1SJVA 3R1GL 4ODUB 3IXAB 3LD8B 1ZVSA 4HUWA 4XMPL 4MJ6A 2RHEA 4GAYA 4NJAH 4X7CC 1NFIB 2XWBB 4G8GB 2YPVH 4ODVL 3B9AA 4E0RA 4OLYL 4Y1AA 4LPVA 1G7QA 3SE9H 5J8OA 1XF5B 4ZUUA 3T0DA 4XP5L 3OAYK 1OY3B 3S37L 2VDNH 1FSKC 4F2MA 2HG5B 2IBZY 4JR9L 3OKEA 3IJSB 1AH1A 2XWJA 5DUML 4O02L 3MJ8B 4IHOA 5IV2A 2A83B 4C56B 1F3JB 4WHYG 4NUGH 3FFCD 2AJ3A 1CBVL 3VXRD 1BAFH 4ZSOA 2R4SL 4HKXA 5I8OL 3BZEB 2CRZA 4NHUB 4L29B 9CGTA 2KKQA 1ZLSL 3GBML 4XNQA 1U91A 4MD5A 4PJGE 3B9DA 1T1WA 2HFFB 4JO1H 1HCVA 1TVHB 4K94L 3UZQA 4YXLL 4YHYB 5ERWB 1RIVL 3HE7B 3BIKA 1SY6A 2XXCB 1OGAD 3NCMA 1FBIL 1RZ8A 4OAWB 4F15B 2VTFA 2IQ9H 1L9NA 1A7RL 3NH7H 4OLUH 2EIDA 3K7UA 4FQXB 4JZNB 4OZHE 3NPSC 4HFUL 5CZXD 1T5XA 2QQLH 1DBBL 5CBEA 2Y9RT 1J0KA 4X6CB 3K3QA 2CGRH 3ARDC 3FT4B 5DVNA 1E4KC 3BPNB 3EOAB 3GMPA 4YDKH 2ORBL 5L6YH 1HH9A 4X7TB 1DQLL 2NR6C 4KKAD 1V7MH 1UACL 3I02B 1E4WL 3JXAA 3RGVA 5DRNA 5I8CA 5ALBL 5IFAH 3MV9B 3HR5B 1CR9H 3HMWL 1RULL 1N64H 3OGOE 2H2SD 4PY7A 3LN5A 4F2MB 4NNYA 5GSRA 4DGVH 4R90L 2XOTA 4JDVA 3S9DB 4QGTA 1LO3L 5DFVD 4D8PB 4PJBA 3MA7B 2VQTA 4QRPE 4J1UA 1CDYA 1S8DA 4NQEE 2ZSWA 1OF2B 1R5VA 2DWEA 5LQBH 3PHQB 4MDIB 4O02H 1U8OB 2NTSP 2GJ6D 1KJMA 4IS6A 1FL6A 3CD4A 4ZXBA 2DB8A 2H2SC 4PP1D 2D0FA 4LMQI 4GFTB 4NN6C 4DQOL 1YEIH 4GG6A 1A9BB 4PIRF 2BSSA 5TE4H 4P4KB 5SWSB 1WBXB 2YHGA 5F3BB 4RMSA 2OZ4A 4K23H 3TM6A 4K8RC 4NQCA 5TH2A 2H8PB 4XMLH 2DM4A 4ZFFB 4L3EE 3ARDD 2FIKA 1AY1H 3MBEC 2WANA 2D31A 3ZTNH 3DURA 3AS1A 3RY5A 3L3GB 2FJFA 2Z8SA 3SY0A 5HGBB 4YHKL 3L5IA 2IFFL 3LS4L 5I1HL 3GIZH 2EKSB 4HEPG 7CGTA 4ZPTB 1AXTH 1FNHA 4JZNA 4LSTH 1Z9MA 5HD8D 4L8DA 4AT6B 3ROLB 1CXIA 1UKTA 1JWUB 3KPOB 4G80B 1EUUA 3BWUC 1NMCC 2XRAL 2QR0B 5F44A 2DAVA 3H9YA 1YEFH 2BCKB 3ARYA 3UTSD 3DROB 2BY2A 4LSUH 3UPRB 2P24B 1A4JB 3T3MF 2YPKA 4NUJB 4PLKC 2E9WA 3REWA 3MV9A 5FOBB 1PVHA 4HW6A 2FEDD 1MY7A 4UQ3B 2WWMD 2DYPD 1CU4L 1NCDL 2UZYB 1NUGA 3B2VL 1Y6MR 1LEGB 3BW9A 5D70L 5TDNB 4OTXL 4FQJL 5GGQH 4RGNE 4ZPVA 1QRKA 5F93C 5D7JB 1EEYB 5EOQL 3H9HB 1NMAL 2BOCA 2EC9T 1F42A 5D7LA 1D5XA 5DMKA 4MJ5B 3WFHB 2F9BT 1AHWB 3BDBA 4N0UB 3VG0H 1MUJB 4DKFH 2MKWA 4JFYA 5C07E 3S35X 1MIEH 2ITDB 4R2GD 5ILTL 4HPYH 4Q2ZA 1FNLA 5FO7A 3HG1B 3T8XA 1ORSB 3RTQB 2P42B 5C2UB 4L8SB 4X8JB 4YDJA 4MNGE 3IFNH 4HXAL 1FV1A 4FQXD 1KBGH 2A6JB 2HFFA 1DQMH 1X4XA 1S7VB 4C54A 4JO3L 5IT2H 1Q0XH 4HG4J 3PWPB 3PWPA 2GTZB 2PCPA 5I66A 1MFEH 2APTA 2V17H 3P9MA 4G5ZL 5J3HC 5TE6L 3ESUF 3NPZB 4K8RL 2GFBA 3QIUB 1P9MA 5F97E 5HSFA 3ULUL 3MFFB 4TUKL 2EH7H 4HQQH 4MA1B 5GS1C 1ED3A 2BSED 5F7YC 3STZA 5F6IC 1KN4L 3ZT6A 4U7MA 2VDKL 3C5JB 1GPOL 1MWAH 2HG5A 4PPTA 3E6FB 5KVEL 3O6ML 5HGHA 3VJ6B 4K7PH 3P4OB 1BFSA 3RWDA 4MDJB 3IJHA 4R0LA 3QFDB 4W81A 3CDGB 4YXHH 5SWSD 3RUGA 4PJBE 1GVIA 3SDAD 3UP1A 3V6FA 1MCPH 4MA7L 5EU5B 3GSXB 5IR1B 2LU7A 2FRGP 5E99L 4N0CC 3DV6A 2VLMD 2H45A 1W0VB 2OL3A 3NFSH 1GOFA 4P5TD 4DK3A 5D6DA 2JTDA 2CD0A 3QJFA 3L5HA 5DHYB 3VXMD 3P11L 2VWEC 4WFFD 1X5XA 3NGBB 4KROB 5SWZE 1YNTB 2J6EL 1WIPA 5D2NB 1OL0A 4L1DA 5IBTL 1HDMB 3SDXB 4PG9B 4N1CA 1NEUA 3VU2A 5JXEA 1RIHH 4OLEA 5CEYB 5HHQB 1N2RA 5D2NC 2OJEA 2Z91A 5IFJB 1ORQA 1GGIL 3LRSB 1ZLVH 3V52H 1DUZA 4PJXE 1UT9A 4G9DB 1C08A 5E1AB 1P2CA 3BKCL 4P3WA 4DTGL 5ESAA 5JW5A 5GS0H 3NIDF 3STLA 2EH8L 4ZO6A 1U8PB 1IQDB 1NDMB 4XB7A 1A3LH 1CTNA 2CDEB 4MB5A 2VZOA 4YAQB 4ZFFA 4L4VD 1RZKH 3LD8C 1VB9A 3IB4A 4P2RE 4I3SL 5DS8B 4X6DB 1DVFD 1IGML 1UYWH 2PR4H 3EFFB 5T3ZH 1JBJA 4LP4A 2VKWA 4OSUH 1N5YH 3RFZC 5DDHB 1IGFL 4MJIA 4HWEL 5E2VH 4ZUVB 5CINL 2YN5A 4HT1L 4P2OA 2IPUK 3SO3B 1U9KA 2CLRB 1A1NB 5J7CC 2HJLB 2WUBL 3LAFA 1TQBC 4FN0A 4O51B 4XBGA 4C57C 1OGAA 5B38A 8FABA 4HJ0D 3TVMC 1BOGB 4LLMA 2FIKB 4PS4H 4UV4L 4HK3J 2BNRA 2AEQL 1P7KA 1E4XL 3ULVF 1MJ8H 3MXWL 3PP3K 3O4LD 2CGRL 4O9HL 5DEFB 2IPTL 5D7KD 1KC5H 4TVPL 5C2BL 3FFCA 4PJFF 3HCVB 2NXZD 3MR9B 5F1SA 1FLRH 2RGSA 2VNCA 4JO4L 4WY7H 3EDJA 5MEQB 4JB9L 1HHJB 1CXLA 3MA7A 5DWUH 3SKJH 2GIYA 1OAXH 2VUYA 1U91B 3F58L 5ADPL 5M95B 1LK2B 3OR6A 4ODTL 5EZJB 3OF6A 4P2QB 2K7PA 3CSBA 4K94H 4HUVA 5E2VL 2FX8L 4Z6AT 2H2PD 1D5IH 3FQUA 3I50L 1KN2L 5HHMD 4ZNEA 5L8LB 1QRNB 2VQ1A 2VDPL 5KSBB 1Q9WA 5DRWB 1UB5B 4K9EL 2BJMH 2FSEB 2DDQL 5GISL 4IEFB 3ILQD 5C6WH 1S7XA 2WV3A 2WQRA 3T4AB 3A67H 1JPFA 1GC1H 4NP4L 4JDZB 3C60A 2XZQL 1CIUA 1M05A 3N1PC 5FXCH 4IJ3B 4PRNB 4DZ8B 4DZ8A 1ZLUH 3C09B 2ZKHH 5CGMA 1BZ9A 3CFKA 2PW1B 1MCIA 2QHRL 3WO3B 2W91A 3SOBH 1Q1JH 4HIHB 2EICA 5KANG 3W9DB 2ADGA 5GRVL 4F9PC 4WVRA 4LSSL 1ZANH 1FG2B 1KT2B 3LKQB 1X5AA 5E4EC 4LAJH 5LAXA 4M3JA 1EEYA 4FFZH 1IC1A 3GDBA 1OT1A 4R7NB 2BVQB 2B7DT 4QXWA 2R0ZH 3MRDB 1JPSH 5K9KA 2CRIA 1RIHL 2YBRA 4LQ1A 4XX1G 1WUNT 5IHUH 3IGAB 5GGSB 3C6LC 4FZ8L 5DK2B 1JPST 4F9PA 4Z7UA 2VDPH 4XXDA 3RUGB 5IB4B 4PJHE 5D2LB 1QYGH 3WDJA 3H7BA 5DEFA 5I8KH 4N90D 4MNQE 4QT5A 1KG0A 1IAII 5IMOA 1S7RB 2AGJL 1TPXC 3DGGB 3TN0C 4AZ8A 3RTQC 1FL5A 1WSST 5I0ZA 1WWBX 3LN4B 3LKNA 1M7XA 4KMTH 4PGEA 3H0TA 1ZV5A 1RUQH 3MRKA 1BOGA 4K7PL 1A6AB 2IQ9L 2D7PA 3MNVB 4JFPB 3EW3B 2XZAL 3NZHL 3MTRA 1H5BB 4U49A 1AIFA 5HVFB 1BJ1J 2B5IC 4DGIL 1SJHA 4Q9RL 4F7EB 1HKLH 4XAWH 5BJTB 3DUSB 5EOCJ 3EO9H 3P77B 4I3RL 1CD9B 3GRWA 2PYEA 3O6KH 1EO8H 2BSTA 5IHUL 5HHOB 4OD1H 3V4PL 1OW0C 2F53D 3CSYA 1T83A 2NY3C 5B4MC 2BVEA 5FDWA 3HNSH 2G5RA 5HHVH 3MZTA 1SVCP 4NSKA 1OQOA 2XFXB 3P40A 3ES6B 4LIQH 5JW3L 1WBZB 5DRNB 5I8CB 2IG2L 1PQZB 5FUZL 5I76A 3LQAC 1P1ZA 4PJEE 3IDXH 4N8VG 3MYZA 3H6JA 2Z31A 3UAJC 3QPXH 1NCAL 1LK3H 1QSEB 2CLZB 4ZODA 5FDYA 4POYA 2HFEB 3IRZA 4JFQB 5A2KH 4GUPA 5A3IC 2DQUH 5JHDB 3C8DA 3HC4H 2FYYB 3VWKC 5C7XH 3BEWB 1QFWL 4APQD 2ZUTA 3WSQH 3F5WA 4GAGL 1JVKA 2WINA 5GGVH 1OLZA 5ACZB 4NT6A 1F6FB 1YJDH 5FUCC 2VZVA 3QG7H 4U31A 2OR8A 3VFUA 2AV1B 2PYEB 2WLZA 4M6ML 3WN5B 5D1QD 4HGKC 2J4WH 4Y5VA 4UOJA 3FFCB 3DUSA 5T3XE 1CFSA 2ZUWA 4GRWH 1U0QA 1I7TB 4N0FB 3WNMA 1GYAA 5I1LB 2H26A 1TMCB 1MCCA 4XP4L 4OF0A 4I48A 1BECA 3VA6A 2AXFB 2C4XA 3U4EB 1KB5L 1ZWIB 4F57H 3BPLC 4JFPA 2MPAL 4I4WA 4QRUB 1KTDA 1P4LA 3W81A 5C0RH 1NGWA 4CNIB 4L4TB 4U1SB 4UIKH 4V1DD 4L8BA 1FVEB 1TJIL 3KXFB 4HF5H 4ONFH 3O6FB 2IQAB 1S7TA 2WBJD 3QUMH 4NQCB 5DMYA 2X42A 5HDBE 4M7LL 4ONGH 4YDIH 4YX2L 4B53A 1U8HB 5HY9A 4GRWE 3WUZA 3MYJB 2XT1B 5ISZA 5HYSG 3G5XA 5E56A 4DEPB 4UILL 4PREA 2C3VB 2C3VA 4NRZB 1IC4H 5T3ZE 2M1KA 4KHXH 3ZE0F 3QEQE 3VFVA 2F53B 1ES0A 4YDVA 3K0WA 2OCFD 2ZCKL 3AS2A 4BUHA 1FVCA 3OAUL 1I9EA 2YMXH 1TCRA 3I6GA 4F80A 2W38A 4FFWD 2DTML 3QIUA 2VDLH 4OLZL 4X7SH 3WIHA 1PX4A 1AGDB 3ARBC 5C0BE 4O2FA 4NWTL 3O3BA 2AABL 2W1NA 4YE4H 4Z78B 4XP1L 5HYEA 1FBIH 2FZ3B 3I85A 3V4PH 2YD5A 3QUYC 4HCRA 2RAMA 4QRRD 5H2BA 3CPLB 3MRGB 1NC4B 4C4KT 4Q6IB 2QKIB 5GRVK 3TO4A 4TRPH 3NCJH 5IJVB 5F96H 2CSPA 3GM0A 3RTQA 1ORSA 4AY0A 1WV7T 2I26N 3ZYJA 4NO3A 2ESVA 4WHYH 4HZAA 1YMME 5HHQA 4N0UA 5D7LB 2HAZA 1RUQL 2X4SB 3QEUB 1KF9B 3LS5L 2PTTB 1UH4A 3IDNB 4OF7A 3UTOA 1NAMH 4ZYKB 1FZOB 1MH5A 3ZE0E 2DTSA 1ZHBB 4Y4FA 3O3BB 1ZEAH 2WWKO 1J5OL 2H3NA 1I4FA 5TFSL 3BWAB 4AJ0A 2DQGL 4MJID 1YQVH 5EZJA 4R4NC 3RJDA 2O5ZL 2NPLX 1SBSH 2NY2C 5SWQB 1CDHA 1F02I 2EEDA 3UTSB 2CIKB 1KCRL 4JRXB 4JHZA 5TJWK 2ITCA 1WT5C 2HP4A 3WS6A 3CDGA 3MV11 3N85L 2ZUVA 2YPLE 3MNZB 4GQ9H 4L9DA 4P2QD 3MV7B 2R29L 2OK0L 4PLJC 4YHZL 4I9WE 3LSOA 2ARJA 3RVTD 4J3XA 1RD6A 2WBJA 4X80H 3VFMA 4M43H 2D9CA 1G1CA 1CFBA 4GRMA 1NMCB 3MLYH 5CZVH 1CVRA 3MGAA 2LTQB 5ALCL 1CFVH 3NFPA 3EDDA 1V05A 3LKSB 4D2NA 2GK2A 1G7MA 2XN9B 4PGCA 5E9DE 5K33A 2ZPKL 4WFGE 4ZTOH 4NC1C 5KVDH 4D9LL 3VRIA 1OP9A 5E7BA 3WXVH 4N0RA 5FGRA 1LDPH 4XBGB 4P4KA 4ZAKA 1QKZL 1QSFE 4K3HA 4LKCA 4K7FA 1QR4A 5BW7C 4UOW1 1LNUA 3KPMA 5HYFA 1NGQH 4HUMB 2C1PA 1CD8A 3FRPG 3TO2A 3S36X 4PJ5B 4LHUB 3VXUB 1Q9KA 5DK3A 1NCBL 3QIUD 1J0JA 4H1LA 2QBWA 5KSUB 1UQSB 4XXDB 4WFED 3WFZA 1LP9F 4XC1H 3GSNH 5IESH 2XV6B 2FO1A 1TQBB 1LO4H 1X5IA 1R3IL 3R8QA 1XF2B 3Q6GL 4OCWL 1TCMA 4W4OA 2C4FT 4KI5E 4Q74A 3ZSSA 5AYQA 2CUIA 1OAXL 4JGJA 3MXVL 1M6OB 4WI5A 5JPNB 1HINL 3V6OC 3I75A 2AJVH 5CJXC 5HVWA 1XIWA 2LV4A 4JG1H 1IQDA 1NDMA 3K2MC 2Q86A 4OCLC 5E6IA 4PTTA 5D1XD 4RFEB 5DJZB 1T5XB 4QTIH 4G6AD 1QFOA 4JLRA 2Y07H 3QIUC 1V5JA 1TZIB 4JM2F 1FNAA 4I0KA 3GI9H 3LRSA 2QR0A 4DJMA 3BRFA 5E8PA 1CFQB 2I5YL 4I13B 3PWJA 3HUJB 3CXDL 4KI5