5DT1H

Crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
245
structure length
243
Chain Sequence
VQLVESGGGVVQPGTSLRLSCAASQFRFDGYGMHWVRQAPGKGLEWVASISHDGIKKYHAEKVWGRFTISRDNSKNTLYLQMNSLRPEDTALYYCAKDLREDECEEWWSDDFGKQLPCAKSRGGLVGIADNWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy chain of broadly neutralizing antibody VRC26.25
publication title New Member of the V1V2-Directed CAP256-VRC26 Lineage That Shows Increased Breadth and Exceptional Potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1H01
4ENEC 4XNMA 5DUML 4Q2ZB 1ERNA 1A6PA 3CVHL 5BQ7B 1QVOB 4JGJA 1YECL 1K85A 2P5EA 4N0FB 4D9LH 4RRPG 3MV7A 4HGMA 4TSCH 1QFUL 2DMBA 2OTWA 1DZBA 3MRKB 5CJXA 3TBYA 2J12B 1ORSB 5I8CB 3L3KA 2WBJD 4OLXL 4PJGA 2CIKB 1HHKA 4ZSOA 1T1YB 4MAYB 4LSTH 5F7YC 5ITFA 4I2XB 3D48R 5FA3B 2EYTA 5DHVA 5FGCB 3GB7A 3REWB 3I2CH 5DK3A 1JZ4A 5CD3B 1NCCH 3TLRA 5D8JH 1AGDB 3QI9A 3MRHB 1F4YH 2WBJB 4NDMA 3RWFB 2GJZB 3GJEA 4G80B 4QHMB 4G42B 4OFPA 2XZCL 4OAWB 1P6FA 5C0JA 5D7LB 2CKBL 2R69H 1N2RB 4AEIH 2KBGA 1NAMA 4XCCH 4M7LT 4HLZG 5FO8A 1S9VA 1HQ4B 4FFWD 3WBDA 3OKEB 4M7LL 4HKZB 2R23A 4URTB 5KSUA 1T3FB 4YDJB 3KJ6H 4GRLB 5KVGH 3OQ3B 4LLWB 43CAB 2WUBH 5IHUL 1U6AH 1VGEL 2GHWB 4NZTH 3P73B 5DMGC 3R4DA 5DJCB 5C6TH 3FT2B 1QQDB 1BIIB 2CGRH 3B8SA 2G60L 1VPOH 4PLKD 3UJTL 3QP3A 1H9VA 1U36A 3GZKA 3ZL4L 1RURL 1FDLL 3RWCB 3VXQA 4P2YA 1L4IA 4UZGA 5EBLA 5C0ND 4ZTOH 2WQRA 2PYEA 4NZUL 3SCMD 1FC2D 5I17B 4BSVA 5DHVH 4DOHE 2EIBA 4LAQL 4A6YL 3U4EB 4TSAL 1KB5A 3ZDXF 3MLUH 1C08B 3S96A 3K1KC 5DC0A 5D1QA 2GT9A 3MRMB 3SCMB 2P5EE 5L9DL 3JZ7A 2ZJSH 3MV7E 1YMHA 2PTVA 3K8LA 3OWEA 1NUFA 2FL5B 5KANI 1MRCL 4XX1G 1TETL 2V2TA 3U1SH 2VITB 4L9LC 4E42B 5T5FH 1Q9LB 5D1ZC 1NAMH 4PJGE 4CMMB 3QEQA 3OR7A 4QXWA 3N1MC 5L2JB 1FORL 4I9WE 4YZFE 2A74B 3BKMH 3E8UL 4FZ8L 5FFLA 3KPRD 4NUJB 4BZ1L 5H94B 1SEBB 4LSRH 2ZKHL 3GBNH 3QXDB 5L0QC 1RUPL 4MCYA 2XXCB 1F3DH 3BPOC 4G9FA 3HFML 1CGXA 1YEEH 1LO2L 2EZ0C 1RZIB 5DMJB 4CUCA 1X9QA 4QRSB 2IANA 3FO2A 1HK6A 3TJEH 3WXVL 4M6MH 3HZKA 1URLA 4HK0B 4X0KA 4Z7WF 3DETC 4NKDB 3VGAC 4GBXD 1QNZL 1WFUA 4E5XA 4JE4B 1A6ZB 4PRID 1U8IA 1OAKL 2G5BB 1N8ZA 5IOPA 1K4DB 3UXFA 4F80A 4LOUD 2AEWA 3S4SA 3TCXA 1OAYH 3KDMA 3UJJL 3U82B 5LWYL 5JHDB 1BGXH 3O0RH 5JZ7D 4ZAKD 5FYJH 1LO0L 3PF2A 3AB0B 4GBXB 3MCLH 4S2SA 5CZKA 4LSSH 1WV7T 2J5LB 1XIWA 5C0GB 5DS8B 2FJFA 3VWJD 2DQDH 1MOEA 1SEQL 3WNMA 3QXWA 1QA9A 1ACYL 4QXUH 4CVXB 4MA7L 5D6DA 2PYEE 3KHQA 1CWVA 4M8QA 1I9RL 2VOTA 3HN3A 4H1LG 1CDBA 1QBML 3VWJB 3MBXL 1U93B 3BRDA 4IOFC 4TVPL 5I1KL 5JW4M 1G9NL 1G6VK 2QQNH 1G6RH 2V5SA 5FYJE 3ULVD 3RKPA 5GPRA 1KPRA 1CLCA 2J2ZA 3MO1B 1R3KB 3GSQB 1OSPH 5T33L 3DBXA 3VFRB 3OF6D 1NCWH 3BH9B 5ICXA 5C2UB 5MEOB 3GJFA 1ZLVK 3W11C 5IW6B 5BS0B 4Y4FD 3RPIB 1KEMH 4XH2B 3QEQE 3O2DH 3SPVA 1S7WB 4GT7A 2AJXH 4PJ8C 4JVPA 3VD5A 1VDGA 4GMTH 4DUXA 5CSZA 1FPTH 1HXMB 5EA0H 3GSNL 3KYMB 3QDAA 4U6XB 4Y4FB 4J4PD 5FXCH 4QHNA 3M1BA 4IJ3B 3MRFA 5GSVB 4P5TA 3BN9D 1LO4H 4XPBH 1IKFL 3WNLA 4G9FE 1J05A 1I9JH 3S8WA 2XXMB 4KJQC 4GO6B 1KN2H 3M17A 2IANE 4HEME 3LIZH 3SY0B 2FGWH 4Y1AD 3CMGA 4OIIL 3NCEB 2XQBH 3KXFD 1S78D 2NY5H 2VC2H 4YHPB 2C3VB 5IG7A 1XH3B 4OF6A 3PIQB 1S7QA 3V5KB 5B8CB 1FNGB 1S7XA 1P9MC 1SYVA 2X7LA 4TN9A 1EX0A 3EW3B 1KPUA 2ZUSA 4OKVA 1JPTL 3U30B 2ED8A 2XY1A 4GAJL 4Y1AB 5DVOA 5HTSA 4PJXF 4FQXA 3PJSA 1U8QA 2Z0BA 1XGUB 1Z3GL 3QXUA 4PUBL 3MRLB 4JM2B 4M1DH 4FTVB 2FD6L 1NFKA 3PWPE 2Z31C 4ZFOB 3KLAB 4FABL 2VR5A 3WFEH 4U1HA 2GJJA 4QYOA 3TESA 4MXQC 5IB2A 3GJFH 1TCRA 5D2NA 1INEL 2P8PA 2AK4D 3H9HB 4I5BB 3C5SB 2GY5A 2CJUH 4UTAL 3T0XA 4XMPL 1D5ZA 1RJLA 1JWUB 1GGBL 5FGBC 2OK0H 4OFDA 3N06B 3ZMRA 5SWQA 3NA9H 2E7MA 2MCPH 2Y1VA 5C70A 5ID1B 2H32H 4KKLC 2AK4B 4DEPB 3L5WB 3EOTH 3D1MC 1YY8A 4L8CB 1R3HA 4O9HH 3WEXA 1YEGL 4UIMA 5F93C 4NM8H 1KCUL 1VFAB 3ARPA 3ZDYF 4DW2L 3CAFA 3QHZL 1GGCL 5J4MA 5LGJA 5E8PB 4MNGA 3VXMD 1I75A 2IGFL 1C5DB 2OTPA 4XGZA 2IEPA 4WU5B 3WS6C 4LBEA 3C6LC 4PG2C 1YPZE 3O41A 4FNLH 3SDXB 4G8FA 2YA1A 1WZKA 4AT6A 2FJGB 3UP1A 4LCIH 5CP7B 4LKXA 4KDVA 1Q8MA 3EJYD 4JRXB 2Q8AL 3VXMB 3B4NA 4PIRF 1NL0H 1IC4H 1H5BC 1T1WA 2Y4SA 4PJ9C 4N0RA 3W39A 5D7IF 3VH8G 2YPLE 3TT1H 1H3XA 3QWRD 2N7AA 3DV4A 1VA9A 4LVOB 4UINH 3IJSA 5ISZD 3Q1SH 3PV6A 1OOAA 3MNWA 4PGCA 1OW0C 5C9JB 5F7MC 5E4IA 1RZGA 3MOBH 3OKMA 4AIOA 4PR5B 3AMLA 4NHUA 1M7IB 4FQLL 5GXBB 3QDMB 1INDL 3EGSA 3G6JB 1NBYB 3LQMA 4O4YL 2O5YL 1CLZH 1G9MH 3DURB 3QIUD 4GMSL 4LP4A 2H6PA 3C08L 2VDQL 1MCPH 5ISZB 4C83B 1G1CA 1FC1A 4PJBA 3A6OA 3CFDA 3SJVD 1N6UA 2WLZA 3LKRA 3MJ9L 4MQTB 2HH0L 9CGTA 1C5BL 1NUNB 1RVFL 4ORZC 4F7TB 3FB6A 1CICD 1K2DA 4TRPL 4F33B 5F7DA 1IC7H 3LRSB 5MERA 1DN2A 3QIUB 1RJZA 3KJ4B 2XTJE 4JY5L 5IQ9B 3KPSD 3KPMB 2UYLB 3G9VA 3RNQB 1REIA 3LHPL 3WHXB 1GCFA 1IT9H 3SJVB 2LABA 4UDUB 1DFBL 1CICB 1PSKL 1ZT1B 5I15L 4L3EB 1XEDA 3BIBX 1KIRA 5KS9A 2EH7H 4MA1C 2VDOH 3CUPA 1ZHKB 3THML 1G7IA 3FFCB 5BRZA 5F9DC 4MNHB 3B6SA 2F19H 5E56A 4MJ4A 5F9WC 5SX4H 1ES0B 1JGUH 3GIVB 5K9OB 4Y19B 1D5BB 3BD4A 4FFYH 5GRWA 2W92A 2X4QB 4OLYH 3CH1A 4GAYA 2CDFB 3BP5B 1ZV5A 1ZEAH 2IADB 4MNGE 2V17L 4F7EB 5CGMA 2YMXL 1CE6A 2NXZC 1GJIA 3MGTB 4KV5F 4YHIA 2ITCA 2NY6C 3BIKB 2XI9A 4R26H 3WJJC 3SO3C 3PXHA 2J8OA 4DKEL 2BSTB 5JOFA 5TE4L 1TVBB 3VXSD 4KRLB 5JO5A 4XAKE 4EDWH 1IAMA 1UCBL 2GK0A 1BBJA 4WGVB 3MREB 1IAKA 2D9QB 4F58L 3V6ZB 3K7UA 2HYMA 4XBGA 1HEZA 1IM9A 1AGFA 1AE6H 4JFZL 4K7FA 1IZJA 1EBPA 3CZFA 3BZFA 4ONFH 1IGTB 3HUJF 3VXSB 3RIFK 1TZHA 3R1GL 4QRUB 2NY1D 1FV1A 2VZSA 1A47A 2QADD 4NRYB 5LBSH 3O2VH 4IRZL 4UQ2A 1D5MA 5J6HB 4P4RA 4WI6A 3NIGF 1FSKB 5EB9A 4Q6IC 4XNXL 4RFNB 3ZDZF 3P30L 4J3SA 2HVJB 2W65B 3QSKB 4W6XB 1CL7I 4NOFA 2EDXA 3O6FD 3RWEB 2NY1B 3V7MA 4XMLH 5DSCA 2QADB 4K23H 3EOAB 4PJBE 5AAWA 3LKPA 5IMLA 1HIMH 1F45A 4WJ5B 2YKLL 2NR6C 4KUCF 5LXGL 1VCAA 1X5XA 5DI8B 4LIQL 3PWUA 2QSTA 4U49A 4ZPTB 2XICA 4P9HL 3JVGA 3QAZB 5L2KE 3BVNB 1F4HA 4YE4H 3OXRB 5M95B 1V7MH 1I3RB 4HXAH 1P4LB 4NBYB 5BJTB 5ANMA 4N5EC 1ZLUK 4KQ4L 3UBXG 1J8HA 2P44B 1EK3A 4HLJA 2UUDK 5H37H 3EYUL 2B39A 2R8SH 2PR4L 3HPJA 4W4OA 5DJDB 4DVBA 1R5VA 4M43H 4MNQD 4UAOC 5EZJB 5KW9H 4LLUB 5BRZE 4YUEH 4UIKL 5CIPB 3C2AL 1U8KA 4NQVB 1RY7B 4IOIB 3IF1A 5LGHH 4P0DA 4OD3L 5GIRA 3MZTA 1P69B 4QXGL 5L7XL 1JF1B 3OAYK 4MNQB 1XZ0B 3WFDH 4JY4B 4YXKH 1U8JA 2NX5D 4X98B 1F58L 5AZ2L 3CLEH 1HXYA 2YN5A 3L7EB 4GAGL 4XNYH 3VE0B 4XNQA 3BT2L 1TZIA 1R3IH 3LZFL 3IDJB 4PG9A 2YUVA 3EOBA 2GSIB 3UTQA 1E4KA 3LKOB 1VKXB 1E6JL 4Z7NE 4MD0A 2Q3ZA 3VRJB 3NABH 4ZPVA 1BEYL 3UC0H 4LEOA 4HBCL 4Y5VA 5AD0B 1CGTA 5EOTB 3FMGH 3S5LG 2BMKA 1OB1A 2O5ZL 4AQOA 5GGUB 2CLRB 2HKHL 3STBA 1AH1A 1BREA 3MNZA 4JVWA 3L3HA 4HIHA 5HI4C 1MRDH 4I3RL 1DBAL 2V2WB 3L7FA 4HMEA 4I18A 2LAAA 5CWSA 1Q0YL 1R0AH 3S9DB 4NC1C 4QRQB 5E6ZA 3U36B 4LLDB 5FKPB 4RSVA 3RWHA 1A0QH 1BFTA 2QHRH 3DLQR 4KK6C 5T1KA 1T22B 2PNDA 5DO2C 3LS4L 4F57L 5DGQA 4JG1L 5DEFA 1TDQA 4DVRH 2VN7A 4F7PA 1WFOA 2VDKH 5DTFB 5A1AA 3RWJB 1DL7L 5I6XC 5AZEH 1W2KT 4Z7WE 3BDYH 3DX6B 4M4PA 2ED7A 1QBLL 5FYLL 4MSWB 4KY1H 1Y18B 5EU5A 2MPAL 4WNQB 1UYWH 2R1XB 2IBZY 2IQAA 1DR9A 2N1KA 5B3JF 3QDJD 5BV7H 3MLSL 3SDDC 1NGXA 1CXHA 3MRIA 5DMGD 2JK5B 2R2BA 5IHLB 2FH8A 3R8QA 1LE9B 5ANME 2A0LC 4PJXA 5DQJB 1J8HE 5J0BA 4B0MM 1N26A 2DYPD 4EUPA 2DIAA 1A1NB 3NCJH 3QPQC 5T1LB 3PHQA 5FK9A 4WW2A 5TE6H 1MFAL 3UTZB 3WHE0 1KCRH 1FYTA 3FQTB 4HBQA 1HDMB 5EU6A 3U6RA 2AEQH 2A73A 3UJIH 2HFTA 2BK8A 2BNQA 2L7JA 2ICEA 4G8IB 1IJ9A 2DYPB 2AJZA 1KBGH 1KENL 1CFSB 4NBXB 1I7UB 4PJ5B 2GQHA 1V3JA 1MWAA 3GSRB 4HWZB 3MV9A 4FQJH 1FAIL 1YQVL 2JELL 3F7YB 1A2YA 1JI1A 5E9DD 1ITCA 4U1JA 5B22A 3T2NL 2R9HC 4JGMA 2VZTA 4N0YL 4L4VB 5GRZA 4ISVB 2P5WA 5D6CB 3EYVB 5HHQA 1KCKA 4XPTL 2XQYK 1UZ6E 3TVMC 5FOBA 4K8RL 3VJ6B 2BX5A 4KK8D 4PRBA 4UOW1 3DVGB 3IXTA 4NNXA 4PLJC 3QZWG 3H9SD 2P48B 4S1QH 2F5AL 3D39A 1JGDA 5ALCL 1KFAH 4L9LB 5FHBH 1AFVH 1A6UL 3F5WA 5D1ZB 2DLIA 2VR9A 2PXYD 2QQKH 5HVHC 4LDEB 3U9UB 4WCYL 1AJ7L 2HFEA 4OCXL 5CD5D 4IHOB 2HFGL 5CJOL 4EUPH 4YQXL 1RZ8B 4MA8H 4XWOD 5D7IA 8CGTA 1U8HA 1PKOA 2X4OA 3FO1A 1HHJB 3ARBA 3RU8L 4D0BA 4RFOL 3ME0A 3BGAA 4JN1H 1OTSD 3FHAA 3HE6C 5L0QB 3E0GA 2FR4B 1BVLA 2YXMA 3BPOB 1OGAD 2RFXA 1PX4A 5DEGB 4ELKA 4RRPA 5E99H 3Q6FA 5DFTA 4DN4H 1MWAH 4WIQA 1B4JL 2HJFA 2FHBA 3VFOA 2HFFA 4N0UE 4YK4C 3CXDL 3CSBA 3PQYD 3DJ9A 1P6AB 1WTLA 4PJXE 5JUEL 3GSUA 5DUBA 4XAWH 3VWKC 1AKJD 2WUCH 2H1PH 2PW1B 4ORGA 3GIZL 3EDKA 2CDGA 2DQCL 5CEZH 5HHXH 1FYTE 4HFUH 3ZKSD 5EU6E 2K7PA 1QSFD 4LCYB 1KTLA 4X5XA 1JJUA 3HAEB 3CFJB 3TZVC 1AKJB 1AHWC 4C58B 3CSYB 3GSVB 4JPKH 5FB8B 5D5MA 1UWEL 2EYSB 1CD9B 5I8KL 3MV9E 3GMPA 3OXSA 1A6AB 1UWGH 5GGVL 2QKIB 1G7QB 3EBAA 1QSFB 4LHUG 3FAXA 4ZO8A 2LTQB 2FX7H 4MMZC 4PGEA 3MLZL 3QHTC 1WBYA 3ILQC 2X4PB 3SKUD 3O3BB 2Y5EA 1TIUA 4D9QE 2WZPD 4CMHB 1T0MB 3ZDYE 1MNUL 1YEKH 2P5WE 4HPYL 4KMTH 1BVKB 2WINA 2X4UB 1I3GH 3GUTB 1FQ9C 4H0IA 2WWKT 1ADQH 1XGQB 2R1WA 1F6FB 1HILB 1MHHB 1I7TB 1OAQL 3F7QA 5E2UH 3VU2A 4JJ5A 4P3DB 5D72L 4I3SL 5KVEL 3LKSA 1SJHA 1UACL 4LSUL 1UB6A 4OM0L 2OP4L 3QFJA 4PJ8B 4HIIA 4PJAB 1CL7H 3S3PA 2AJUL 2C1PB 4NJ9H 2K1MA 4ALAH 4PGZA 3QEUB 4QWWD 1R3LA 1YNKL 4X9HA 4Y5XC 5D7IE 4ZFFB 3GDBA 2X70B 4YDKL 5EULV 3ARGD 1I8IB 3JWOH 4U2ZA 5JPNB 2VAAA 4MJ5A 4MGXA 1MJ8H 3WS3B 3JV6B 4O2FB 5HI3D 2YUXA 3DXAB 5E2WL 4KQ3H 4GKZB 5DJAA 1UXSA 2ZUXA 4MX7A 3R06B 2BVTA 4X4XA 4TYUA 1KIQB 3IDXH 4IOSD 3S97C 2YD8A 4XWGH 1IM3B 1RZFL 5AYUL 1KELH 1SM3H 1QD0A 2VZ1A 5E5RB 2BOCB 4GW5B 3MLRL 4AEEA 1OTTD 4J1UA 5MENB 5IFAL 3L1OL 4U3HA 4JQIH 3TM6A 3U0TA 3BMWA 4HLZH 4PGBB 4UV4L 5GZOD 3QHFL 4ZUTB 5EWIH 3CC5A 1B2WH 1CT8B 5IP4A 1SJVA 1AC0A 4MXQD 4MZ2A 2V7NA 4LF3A 3U7WH 2LU4A 4JHWL 3T0AA 3UTSA 4P46C 1U8OA 2EDNA 3ARFC 5IT2H 1KULA 1UZ8A 3IYLW 2PYFB 5A2KH 4KKAC 2Z31B 4U6VL 3QISA 3GMMA 1P5VA 3CK0L 2OTUA 1CXLA 1WC7B 2D3VA 1C1EL 4PB9H 2R0WH 4KKLD 1QR4A 5E5MB 5BW7A 3IXAA 3TPUA 4LLMA 4RFEB 3DI2B 4RQQB 3TBTB 2C4FT 3QUZA 2XNAA 5ETUB 1JNNL 4ZXBC 1LD9B 3VXRB 2X5PA 3QA3B 5JOPE 3ROOA 5F1OB 1W72A 1ZANL 1GHFH 4OUOA 2OL3B 4M9PA 4HHAA 2VYRE 4L4TA 4DAGL 1GH7A 4HX1A 1EHLH 2AGJH 2FYYB 4OQ1A 4XP9L 4LRNL 3TBSA 2GAZA 5IESL 1YA5A 1VACA 4KV5E 2QJDA 1FO0B 4PJIB 1ZGLB 2H2PC 5CLTA 1EIBA 4HT1L 4JRYA 1E6OL 2AERT 3CFBA 2NXYD 4OV6F 4DQOL 1NDGB 5EPMB 4UILL 1JZ5A 1U8MB 4TUKL 5C9KA 1A1MA 1PZ5B 3QFJE 4I0PD 3IVKA 1SJEB 5DJ0A 4IEFB 2X44D 3C6LB 5CEYA 4OGZA 4TTGA 4XPFL 1J18A 1NSNH 3HR5B 5SWZD 4M93C 4H1LA 1JMZA 4TULH 4JFPB 2C4XA 3A6CH 2ATPB 2JJWA 4EI5D 5C3TA 5CAYB 1N4XL 1RMFH 4WU7B 3IKCA 4GKSA 1H5BB 1B6DA 5DRNA 2VLKD 4XBEL 4PJ9B 1NMCC 4YO0A 4I0PB 2NMSA 5FGRA 1UXWB 4RZCB 3UROR 1KT2B 3MFFB 3MLXH 4XVTL 3RWDA 4QF1B 4F9LC 2WP3O 4UQ3B 1MCIA 5IROA 2W9EH 5E1AB 3QCTH 3ZKMC 3ECBA 2BHZA 1X6LA 5D9SB 5GRUH 4XX1E 4Z7QF 1I4FA 4NO3B 4N1HB 4NKMA 3BWAB 5J9PB 3QH3B 4YFLI 3R0MA 2XRAH 2NY5C 3H6JA 5C08D 4OQTL 1S9WB 4WFFD 4L1DA 4XBPA 3UTSE 3QEGH 1LE5B 4QT5A 2A77H 1JPSH 3VD9A 4Q58C 3NN8B 3X13B 1K9TA 1P5UA 5C07B 3MYZA 3AVEA 4Y2DC 1DP0A 1J86A 1YEJL 2JKXA 5C08B 2VDMH 2N4IA 4WHYG 1G7HA 4M5ZL 4BQCA 3LEYH 2CIIA 5HHPA 5SV3A 3QUYC 1OGTA 3P4LA 3RZCD 1AXTH 1GL4B 5DVMA 5F7LB 3B5TA 5C8JB 2XN9D 5I19L 1UKTA 2D9CA 2CR3A 1U3YA 4ZS7H 3MRJB 1UA6H 4LCCA 3DO7A 1O7SA 2Z92A 5FHAL 4IM8A 1BQSA 5ERWA 2F8VA 3ILPB 1MSPA 5F9WB 2NXZD 1FL6A 1RZJH 4P2RA 5C0EB 5F3BB 1PJ9A 5D2LB 1OM3H 3SBWA 3JV4B 1CU4L 2XN9B 1P7KB 1T5WA 4JRYE 5F7NC 1AR2A 2CMRH 1KNOB 4K2UL 2VERN 1QSVA 4DFHA 3GO1L 2EDYA 4NN6C 4HJJH 5KZCD 5ESQA 4Y5YB 2NXZB 4NSKB 3I50L 1GAFL 3LMJH 4H8WH 3ARRA 4RGNC 3QNZA 4LFHG 5ADOH 2NY6B 4G8EA 2E7LA 2W60B 3AREC 3SO3B 1KLGA 4LPUA 1MLCB 4Q0XH 1N0XH 4HS3B 4RMVA 5E8EA 5IMKB 3MRCB 3FT4B 1ZHBB 5KZCB 3CFIC 4QRPA 1IL1A 2BHUA 3MV8A 1OVZA 1Z9SA 3UZQA 4C56A 5J6GB 3FCTA 4GKNB 1TNMA 2CDEA 4NRZA 4XI5C 1MJ7L 5CMAA 2HT4D 3P4NB 1Q1JL 4EVNA 1N59A 1MFDL 2A9NL 2NPLX 2VLMD 5DZNA 2BVOB 3VFWB 4HC1A 4I4WA 3TP4A 2IH3B 4M6OH 2WK2A 3WD5H 4P3CL 1EPFA 5JLZA 3CJJA 5IFHL 1EEZB 4Q6IB 3WJLA 3QO1B 2DQEH 2X4TA 3O4LB 3CVHB 1A7PL 1LNUB 3IDUA 4HWEL 3SE3C 2VO5A 1KLFA 4YIQB 5MHSE 1U3HA 4KTDH 3TBWA 3FB7A 4ZO9A 1T0PB 4EQ2A 1CLYL 3WUZA 1QHOA 3LD8C 1QFOA 3QQ3A 3SDCA 3V8CA 3WKML 1ZVSB 1JPGB 2YEZB 1J1PH 4PP1C 3S36X 3SHSA 4BQ8A 4OCWL 4HKXB 5K9KB 4NFDA 5I30H 5ICYB 3ULVF 4CU7A 3CDYA 4WFEE 4DKDC 4DUVA 1GGUA 1EZVY 1J88A 3TO2B 3CFCH 1WSST 1JPFB 3X3GH 2XKUA 4UAOB 4PJFB 2BNRB 1NGWB 1SYSB 1UH2A 4F7MA 1HWHB 1A02N 2IBZX 1CFVH 1EXUA 4RDQG 2GUOB 4RWHA 2CKBB 4P5KA 1N6QH 1IGJA 4P2RE 4RAUB 5HPOA 1YUHB 4AIZA 3BZEA 1SBSH 2XACC 4JGUA 3WUWB 4NJAH 3FB5A 2SEBB 1LEKB 4JFQB 4PYGA 4H26B 4HC1H 3AU1A 5C71A 4MAUL 1AQDB 1RU9H 3GMOA 4LLQB 3U83A 3C9NA 1CTOA 4BUGA 1MFBL 2APVA 5L88H 4HKBA 2BVQA 3T0DA 5E6IA 3BGMA 5EUKA 5JXEA 3MNVB 3T0VA 5HYSB 3GI8H 3NCFB 4CJ0A 4B41A 2R0ZH 2VL5A 5EBGA 2EIZA 4QRPE 4JM2F 3MV8E 2E27H 3ETBF 2ICWB 4C56E 1P7QD 4U1SB 4DKFH 1C5CH 1RI8A 1HN1A 5DO2D 3SE9L 4I3GA 4UT6H 3C5ZA 3D85A 4GRWB 4XCNA 3PP3H 1CG9A 1LO3L 4U6HB 3W81A 3GMNA 4P23C 5HYJD 1T1XA 4WUUD 5KSAC 5BVJA 2F54B 3VGHA 1BZ9B 4A6YB 2P49B 1I85A 3B2VH 5CINH 5ID0B 5LCVL 1S9KC 2MKLC 1P4BL 2R0KH 1LMKA 1HE7A 1ZA6A 4EBQH 3SDDD 4K8RC 3EZJB 1XR8A 3VGGA 3BKYL 2A0LD 1A9BA 1YMMB 4G6KL 2X1PA 5I6XB 3LKQA 4M4RA 3NA4A 2KL6A 3QPQD 5J1AB 1H3PL 3MXVL 1FZKA 1OSZA 1DQDL 1RK0A 4X6DA 5IK3B 4GSDH 3SDDB 3S36L 3IJHA 4QRRD 4Q2ZA 4YWGL 3HRPA 4R4BB 5BQ7A 35C8H 3CVIL 4OFYD 1QVOA 3L5IA 3KPPA 1DUZB 3SQOH 2DQUL 4F15C 5JW5B 4OT1L 4JKPH 2EDQA 4N0FA 4HH9B 3GKWH 5C2BH 1YNLL 4TNWK 3SDXF 4YX2H 4KKCC 4YNYB 5C7XL 3LS5H 3MRKA 4QRRB 1ORSA 5I1HH 2BVUA 1XGYH 4LSVH 3VFMB 4MAYA 1MH5A 2QSVA 3IB4A 3NH7H 4I2XA 3REWA 3UTPE 1A14L 5CD3A 4NQDB 5BO1H 3N85L 3MODL 3Q48A 5T3ZL 3CZJA 3MRHA 4Z18A 5F71A 3TVMD 2BC4B 1OCWL 1A8JH 3RWFA 5DWUH 5JDSB 4WEBH 3UDWA 4G80A 4QHMA 1XGPA 1PEZA 2LU7A 2CXGA 3KR3H 4G42A 2EE9A 1A3LL 5D1XC 3UBXA 2GJ6B 3PP3K 5D7LA 5DFVD 4OCSH 3EFFA 3T2QA 4CNIA 4Y8AA 1FNEB 3QPXL 2D2OA 3O9WC 4UT9L 5DMIL 3TVMB 2ZCKH 2X1OA 4LNRB 4CAGA 5A2FA 1BM3H 1MPAL 3I02A 1HQ4A 4MDJB 2B2XL 3QNXB 3OKEA 4HKZA 5IVXF 4TVPD 1FZJB 2A6DA 3G04A 5E70A 1T3FA 4RMRA 4YDJA 3HCVB 3FAWA 4XCFL 3ORJA 4BFBD 4GRLA 4MLIA 1BHGA 3ZYJA 4LLWA 1UENA 4X4ZA 1XGTB 5HVHB 1A3RL 2BSRB 3P73A 5IEKA 5DJCA 2EXYC 2RJMA 2B4CH 2C4FU 3FT2A 3EDDA 3HE6D 4TQEH 4QHUB 1QQDA 4UNTA 1BIIA 4JN2B 3U4AA 2MKWA 4Z0XB 5I16B 1HYSD 1GGIH 3DRTB 4NM4L 4K3DL 4B53A 1IAIL 5IB5B 1IEHA 4DZBA 1TMCB 1Z2KA 3BO8B 3HE6B 3L3DB 3TV3L 1EHAA 2IG2H 4G8GA 4HJ0C 3VWKD 4N68A 2OBGA 4PJHA 4IMKA 3HC0B 5I17A 5I1JH 1OPGL 3S5LA 1J5OH 3BAEL 3P77B 1W0VB 5KVFH 4X6DE 2Z4QB 3ROLA 4HK3N 4YK4B 1TLKA 1MVUB 1C08A 2BRRL 1VEMA 4S1SL 2FHCA 3EIFA 3MUZ1 4PRNA 3MOAH 4XP1L 3O4OC 4NZJA 3MLWL 5BV7C 3TZVD 3VWKB 1ZSDB 3SCMA 2JB5L 3KWWB 2EECA 2OZ4L 4P57B 2IC2A 2FL5A 3AUVA 4K3EH 2VIRB 4JFDD 1YC8A 2VITA 4E42A 3WYRA 4CMMA 2JJSC 1DTUA 4KAQL 4G3YL 2AEIT 1SMOA 3TZVB 4X4YA 5L2JA 1AHWB 2BSED 4FQIL 4I2XE 4XB7A 3RVWC 4OF7A 3G6DH 1JWSB 1MRFL 3G5VB 4PY7B 1MY5A 3MMEA 4O00A 5DC4B 2A74A 2NY4C 1IARB 2OMNA 3PGFL 2BRQA 4XC3L 5E2VL 5HJ3B 2NTFB 3BISA 4JO2L 4NUJA 5H94A 1SEBA 3TA3C 1NH6A 3QXDA 2VDPL 3ARXA 5D7LE 1RZIA 3INUH 2YD2A 1MHPL 1IZKA 4KI5D 2H9GA 1HCVA 2YD3A 3ARDA 4QRSA 4UBDC 4F9PC 2MHAB 4NQSB 4Y8DC 4HUXB 2VDNL 2BVEA 4JM4H 5IWLA 1KB5L 4NKDA 4APQC 2C26A 1OWWA 2A1WH 2EC9T 4S0TD 4PGDA 1A6ZA 4WI9A 4BQ9A 2G5BA 1K4DA 4KVNH 1J7VR 1CXKA 4PB0L 1CLOH 4WHTB 5LQBL 1FVEB 1IAOB 4R6UA 3DIFB 4OIBA 1MCOH 3GMLB 5JHDA 2GKIA 3B5HA 1X5JA 1OD7A 1T0NB 2PO6C 1CF8L 4S11A 4GBXA 4K94H 2E7BA 1TVDA 3WXWH 4Y5XB 3UMTA 1YYLL 5JMOC 4OI8A 3OR6B 1U92B 4CU8A 5K9JH 4Z7QE 4CVXA 1YC7A 3WFBL 3VMPA 1A1OA 4LKCB 1GC1H 4UB0L 3L6FB 3FO9A 4M5YL 5CSBA 3KYOB 5E8DH 25C8L 4OZHA 4Q9QL 5HHVH 4JG0H 4NKIL 3VWJA 1U93A 4NQXB 4N1CA 3RX8A 1L7IL 3QZWA 2YWZA 3EKCA 3ARFD 4QNPF 1L0QA 3V4UH 2PTTB 3V8OA 5IM7A 3F7VB 3NTCL 3GSQA 4FQ2L 3J8F7 3VFRA 4CJ1A 3BH9A 4XVSL 1CE1H 1NCDL 2AJXL 4P46B 5IW6A 2DL2A 3RHWF 5BS0A 3ARFB 3BKJH 4HUWA 2BFVH 4YXHL 4GXUN 1ZTXH 2BDNH 1S7WA 5EC2A 4FQ1L 5GRXG 2ZPKL 4CW1B 4NRXB 1FE8H 4JFXB 1HXMA 3ZYZA 1IFHL 4U6XA 3KYMA 3QR2A 5F1NB 1A5FH 5IMOA 4M1CC 3FQUB 4IRSD 1MAKA 1C7SA 4PP2B 4ZXBB 4NO0A 2FWOB 1RSFA 1HQRA 3S34H 3MA7B 3SY0A 5F9OH 1D5IH 4Z76B 3CXHK 1ZWIB 4Y4KA 5I18L 4YHPA 1XH3A 3PIQA 3V5KA 5B8CA 1FNGA 2HT2C 4M7KH 4LAJH 1PAMA 1E0OB 3OZ9H 1M6OB 3K3QA 2FX9L 2AXJA 4XP4L 2V9RA 5TPWH 3S35H 4G43B 5JHDE 2FBOJ 3I85A 1XGUA 3NCBB 3MRLA 4JM2A 4LHUA 1QG3A 4FTVA 4M93B 3KLAA 3G08B 3T0BA 4G5ZH 4OZ4B 3ZKMD 3O6KH 2ZCHL 4XVJH 2C9AA 2H8PA 3BP4A 5BOPA 1A7OH 1UM5L 3H9HA 1XF5B 3LEVL 1NMCB 1MAJA 4JFOB 3ULVH 4EIGB 3K2UH 3JWOC 3RUGB 5EUOB 1VGKB 4XP6H 4K9EL 3GBLA 3VFPB 1C12B 2JIXD 2W0LA 1OP5K 3S98A 2AJVL 3UYRL 2V7HB 4GG6A 2CUIA 4Y16C 5LJYH 4LCWD 5F7EH 3V6OC 2WWMC 3TNMB 1I1AC 1I8LA 4Y2DD 3PWNB 5DT1H 1X7QB 4OLWH 4L8CA 5IJKC 2AABH 4L3CB 2JIXB 4OGYL 2ZSWB 5D71H 3BX7C 5F7UA 4KJWC 3VFSB 5BS0E 4A2LA 3RNKA 4LCWB 1P53A 2UZIL 3CMOH 5E8PA 4PBWD 4Y2DB 5E24E 3FZUD 2APFA 2Q8BL 2YPVL 3ZT7A 1NJ9A 3U7YL 2LFGA 5A16B 1DBMH 1YYMH 2DBLH 3IRPX 5MEQA 2FJGA 3QUYB 5CP7A 5F6IC 4I1NB 5D7SH 4OD1H 1J10A 2MSPA 4JRXA 3VXMA 4NZDA 3VMOA 4MB3A 1F4WH 4F37K 3BSZL 1DBBL 3KYNA 3QDGD 5DRWA 1WBXB 1TJIL 2D03H 4K3JH 4V1DB 3BE1H 2R2HA 3OKDB 3DUUB 1T5XB 4RGND 5FUZH 3KPNB 5C9JA 1YDPB 2H32B 3LOWA 3ARED 4HWBA 3QDMA 3G6JA 1EZVX 1GIGL 1NBYA 4GJTB 1TQBC 4O02H 3DMMC 3DVNB 3TN0C 1B0RB 4NN6B 2XY2A 2DTML 4QCIB 3MC0A 4Y1AE 2BOBB 4RGNB 5D4QA 3VI4E 1AIFB 5CGYC 3AREB 1LQSR 1UM6L 4KDWA 3N1GC 4F7TA 4FTVE 4M7JL 5LKNA 4F33A 4XZUB 4Q97A 1WBZB 4PTTB 5CHNB 3QIUA 4P5MA 3CSGA 3P9LB 5FAAA 3Q5TA 5IQ9A 1QLRA 5MP6H 1KTKE 3KPMA 1UM4L 3IDIB 3WHXA 4BSWB 5DD1H 5DVKA 5F88A 4S1DC 1RK1B 5IBLC 4UDUA 4HUMB 1IGFH 3U0WH 2HMIC 2RCSL 1MCFA 4RWYL 4L3EA 5SX5K 1Z0MA 3HPLA 4GG6E 1ZHKA 4OUUB 3FFCA 2AK4E 4MNHA 3PNWB 5C6WH 1OAZL 3GIVA 5DLMH 7CGTA 5K9OA 3OPZL 2YD6A 4LLAA 2ERJC 4Y19A 4PP1D 1FLRH 1D5BA 1S9YB 4XRCB 3TNNB 1WEJH 2X4QA 4KKBD 4M6NL 3ARQA 5B3NA 5DD5H 2CDFA 3NAAH 3ALWA 2IADA 4F7EA 4JO3H 3LD8B 4BSJA 3MGTA 4ZMAT 2DBJA 3JSSA 2EO1A 3BIKA 3MXWL 4FFZL 3TCLB 5EOQH 1DSFL 2BSTA 4OB5L 1AE6L 1TVBA 3MLVL 1XT5A 3PE9A 1UKSA 1FZMB 3SDAA 3MREA 5FYLD 2KH2B 3BP7B 4JRXE 5DC9B 3VXME 5KAQF 2OS7A 4PJAF 2CLVA 2G75B 4FQHB 3SGJA 3OKLB 1VEOA 3NBNA 4S0SD 5D7JD 5D7KD 2AJYH 2OQJB 1IGTA 1WAAF 2Y23A 4QRUA 4AJ0A 5GZNC 4GXUM 1B0GB 4NRYA 4YHKL 2ICCA 1MUJB 4H5SB 5J6HA 1MI5D 3S88L 5FKAB 2DQFB 3G6JE 1WT5C 3QDME 3MRPB 2W65A 3ULUD 1G7LB 1HSBA 3E1F1 1RHHB 3MRGB 3RWEA 4HKJB 4TNVF 3UO1H 4G6FD 2P8LA 4HW6A 5F1SA 5FYKL 5ISZE 4WV1C 3GK8H 1NEZG 4NYLB 3O8XC 2OSLB 1E4XI 2DWEB 3IDMB 4R90L 4WJ5A 5DQ9A 5LVEA 1U3ZA 2QTEA 4HXAL 1YEDB 4C57C 1NFIB 4H8WC 1C16B 3SKOB 4LQFH 3QRGL 2HKFL 3BVNA 4GQPH 2NZIA 4G6FB 5E94B 2FB4L 5J06A 1D3CA 1IC5L 1P4LA 4KK9C 4P23D 4P2OD 4QLRA 5BJTA 5JORA 1DBKH 1X5FA 3AS3A 5KSAD 3B9KC 5AAMA 3RDTC 2ATKB 4J12A 1S7VB 4L3EE 2R39A 1H3TA 5DJDA 4JDTL 1ZLSH 3REVB 2FCBA 3I6KB 2RB8A 5EZJA 3T0EC 4RGOL 4LLUA 1FL5B 3FFCE 4PGJA 5CIPA 3WLBB 4NO5B 4NQVA 4P23B 2AQ2A 3WLWC 5EIIB 4IOIA 3TBVB 3N9GL 5KSAB 5E2JA 1LWRA 4L8DB 3AY4C 1AGBB 4Y19E 4K55A 5IFJB 3EO0B 1JF1A 2RBLA 4MNQA 5F7KC 1XZ0A 1DJSA 1ITBB 4JY4A 1T7VA 1FIGH 5C0AD 1MIMH 4WWKA 3KNBB 1PQZB 3FRPG 5CZVH 1U95B 5HDBF 2V9QA 3L7EA 2QSCH 3VE0A 4G9DA 3IDJA 3UC0L 1WK0A 3MRNA 1FVDB 1FG2B 2GSIA 2BVPB 3LKOA 4KKCD 4KUZL 3VRJA 2VQ1B 4S1RL 4NZRH 1IQWH 3MUGA 4QXTB 5CJXC 5AWNH 5AD0A 4F15B 3RTQC 4WHYH 5EOTA 1Y0LB 3VW3H 1ONQB 3TT3H 1R0AL 2NW3A 5GGUA 2CLRA 1HHGA 3RGVC 4JLRB 1IMHC 5FM8A 4M61B 2V2WA 4G6MH 4O58L 5DD6A 5A2LH 5HPMA 3QI9C 4OKDA 3G6AB 3H7LA 4ODSH 3U36A 4LLDA 4DVRL 1LEGA 1R3JB 4YAQA 2Z9TA 1Q94B 2I60H 4JZJC 3FONB 1T22A 3PDGA 3O9WD 4R0LA 1MCQA 3EO1B 1HHHB 2CK0H 3PDDA 1NLBL 4YLQT 1RIUH 4TSBH 1AI1H 2EYRA 4DN3L 3RWJA 2E8ZA 4G7YL 2AK1H 5D1XB 4PREB 3DX6A 4TPRL 5FDYA 4MSWA 4WNQA 2R1XA 3BEWB 3O9WB 5HHOD 5CFHA 2VXQL 2OR9H 4OCYL 5CJQL 2JK5A 2EXYD 5IEHB 3IAGC 1ZHNA 1KB9K 2AEQL 4WW1B 1JRHI 1UT9A 5T1LA 3MJ7A 5IIEB 3F58H 4ODTH 3UTZA 5HHOB 1Q72L 2OJZH 1J0JA 1NCAH 3FQTA 2OMBA 1HDMA 12E8L 3FB8B 4G8IA 4HJ0D 4KTEL 5IB4B 2DYPA 1WUNT 2IAMA 1CFSA 4PJ5A 3K4DA 1KEGL 4U1NB 4WI2A 4MNQE 2H3NB 4HWZA 5JHLL 2FEDC 4HUVB 1NC4D 4J23A 4QNPE 3F7YA 1JUFA 5MEPB 4NNPH 3WIHH 3VG0H 2MQCA 4HIXL 3EOYG 1P84J 3HG1B 4BM7A 3A6BL 4L4VA 4NQEB 4HS6B 4MJ6B 5D6CA 4ONGH 2FDBP 3EYVA 5SV4A 3HI1A 1NC4B 3O4OB 4LASL 5BV7B 3VJ6A 1JWMB 3BW9A 3DX8B 4KXZI 3BDXA 2BNUB 3DVGA 3IU3B 1MF2H 2EKSB 2X40A 4LLVB 3JWDL 4ONHB 1PDKA 4OLVL 5CILL 1T21B 5A3IC 3B9EA 4L9LA 5J13C 4LLYB 5D1ZA 3TFKD 3VD7A 3CFEA 1IBGL 1DQLH 3U9UA 3H2WA 3VDAA 1OTUC 3TA3D 1BF8A 4NWTL 5FCUL 4NN5C 4PRPB 1A6VL 3RX7A 2IALA 1C7TA 5KVMC 1EUUA 2R1YB 1MEXL 1RZ8A 2NY4B 5KSBB 4ZFGL 5EU3B 5DJXB 3F6LA 4F8TA 1JVKA 5E99L 3GEWB 4YBHA 1XAUA 3EO9L 3TA3B 4H88L 1WLHA 1GVIA 1N5AB 3VRIB 3L3IB 4Z0BL 1QLEH 3IU4L 2FR4A 1E27B 4KRPC 4OF5A 1KPVB 4RIRB 4OLZH 4AENB 4NGHL 32C2A 2DIJA 3CFKB 4APQB 3MGOB 5I2IB 5CBEB 5L8LB 2GYSA 1CXFA 1QZ1A 2PW1A 3P0YH 3V79C 5DK0B 3TEUA 1NCBL 3FN0L 1MLBB 4LCYA 2PO6B 2RQ8A 3MZGB 4YGVB 3UX9B 4Z8FL 4Z7VB 1AGEB 3CFJA 1QHPA 1S7TB 1AKJA 4PJ5E 1MJJB 3CSYA 1MAMH 4P2QD 5FB8A 3IFPA 5GISL 5GS0D 5DHYB 1LILA 4XPHL 1JN6A 1G7QA 5B39B 5F9JB 1EEYA 4XPAH 4X6FB 1CCZA 4JHAH 1JNJA 5C1MB 5C0FA 1S9XB 1X5LA 2VDRL 3U4BH 5ENWA 2DMCA 4P2QB 2X4PA 4L4VE 1XGRA 4UOJA 3IDGB 1JGVL 1BF2A 1C8PA 3E6FB 1BVKA 2X4UA 1RULL 3FTGB 4W6WB 4FS0A 3WO4C 1BQHB 1DQMH 1OAUH 1QO3B 2ZCLL 5TH2B 1XGQA 3IFNL 1UKQA 3LQZB 1CDHA 1TQCC 1HILA 3HI6H 4JPVL 1I7TA 3KPQB 2HT3D 5KN5B 3K8KA 4WFHE 3BYTA 1LDPL 2CRYA 4P3DA 1JTTA 3OKKA 5J7CC 3H3PL 5TF1H 4K9EC 4PJ8A 2W9DH 3TJHD 4MXWH 2C1PA 4ZFFA 4HH8A 2M1KA 3VXUA 4U4BA 2X70A 1LDSA 4KZDH 5LAXB 1I8IA 5C0RL 4M62L 1E4XH 3IDNB 4RA0C 4U1IB 2DQGL 2P24B 4XWGL 3WS3A 1JMXA 4O2FA 3SKMB 3RFZC 3DXAA 2HT2D 2DIBA 4M3KB 2DD8L 3HAEH 4GKZA 3QEHA 5FO9B 1JE6A 1NBQA 3RAJL 1KIQA 1IM3A 1YEFH 4J3VA 1K4CB 8FABB 1YEIL 4M03A 2BOCA 4GW5A 4BFIB 4F3FA 5FECB 5MENA 4X99B 5EIQA 1P9MA 4PGBA 4ZUTA 5I1AB 2YD4A 4J7RA 2X6MA 1RJYB 1JHLL 3O3EB 3KLHC 2BSSB 5F6HI 5IB1A 1NAKL 3JWNC 3VRLF 5D2NC 5C0BD 2IFFL 1TTFA 4FFVC 2Z31A 5JIKA 4LPYA 4JFFD 2RAMA 1CQYA 4XHJC 4X9BA 4H0HB 4LGRB 1QR1B 1WC7A 3NZHL 5I1GH 3D69B 5E5MA 5T1DH 4PRHA 1FH5H 1QSFE 4WUKL 3QJHB 4RFEA 4X7TB 4RQQA 3TBTA 3F65A 5FGBA 4JPIA 2DI7A 4JFFB 5F6HJ 2GITB 1YJDL 1LD9A 3VXRA 4Y16B 6FABL 1N6VA 3SKJH 2OL3A 3O81A 1RUMH 2B20A 1I1AB 1VFOA 3C09C 3GRWH 2FYYA 4K71C 1FO0A 4PJIA 1YN6B 1ZGLA 2W07A 1W0YT 4IS6B 3CLFL 1RD6A 5IF0B 2VXSH 2ICWI 1VFBB 4JR9L 5ICZA 4EEEA 1NDGA 5FGSA 1CGSH 3D18A 3FO0L 3W2DL 4FMKA 3KYKH 4MQXD 3TYGH 3X3FH 1PZ5A 4AQ1B 2XG5A 4HS8H 3QFDA 3DX9B 5HD8D 3C6LA 4KZEH 3HR5A 4QY8B 3W0WB 4JO4H 5F3HA 4JFPA 4D9RD 2ATPA 5F6IB 1H3VA 1IEAB 1INQB 5DJ6B 2JB6B 5IBTH 4KHTH 3DXAE 2ICWJ 2NQCA 4PJ9A 1NBVH 1BAFL 1HH6A 4RZCA 1KT2A 1RFDL 2YA0A 2PW2B 1FGNL 4UQ3A 2AJSL 1L7TH 3I3DA 3LH2L 3UZVB 2HRPL 3QNYB 5D93C 5D9SA 3UPRB 1OW0A 3L3GA 4NO3A 4HZLB 5MENE 5CGYD 3F12B 4RA3A 1JRHH 3HUJB 2JJTC 4LOUC 4KWUA 1W72L 3QIBA 3BWAA 1QLFA 3QH3A 1TQBB 1CZ8H 5JXAL 2L0DA 4JFHE 3WL9B 3DMMB 5ADPL 3TN0B 1CGUA 4JFED 4YHOL 2X1WL 5JZ7C 4UTBL 4ZAKC 1S9WA 3D6GA 4KRNA 3GI9L 1JNLL 3U9PH 2O5XH 2NLJA 3JTSB 2OL3H 4S1DD 1MFCH 1HWGB 3NN8A 3X13A 2P43B 2VH5L 5C07A 3FT3B 4PJCA 5KANG 1FO0H 1NLDH 1S7UA 2PCPB 1DN0A 5DRZB 4OM1H 3MQIA 2HWZL 4PRHE 2IPKB 2ZG3A 5JQ6L 1T66D 4PJ7B 3VD4A 3C5JB 4YHZL 5BXFB 1FLTX 4PD4K 2A9ML 5C8JA 3G9AB 5T1MB 4NWUL 2Y36H 3ULVC 1WJ3A 1KG0A 5EH1A 3VXRE 4ZNEE 4IDLA 1YEHH 2XZAL 2I5YH 3A67H 5E7BA 4EN3D 3ILPA 4C4KO 4KXZH 2E6QA 2VXVL 1FZOB 3RI5F 5EZLB 5C0EA 5F3BA 2YS4A 3ELAT 1RUKL 5D2LA 2ERJB 4PJIE 3JV4A 4R4FH 1P7KA 3HE7D 1V3LA 1KNOA 1H15B 1Q0XH 4JVUA 4ODVH 2DF3A 2XTLA 3D25B 2DM2A 1UH4A 2O26U 3I3BA 5CUSH 3VFVA 1KC5L 4Y4HA 4FXKB 1DANT 4HIJB 4E41D 1FGVH 4NSKA 3PUCA 4U33A 5J57B 5E08H 3LCYA 3WJJA 2W60A 2AJ3A 5T3XL 1A7NH 3GGWB 4J4PC 5C0CB 5INCB 1AQKL 1N5YH 2QV2A 2D7PA 3NFSL 4HS3A 3I3EA 4KI5F 3ZE0F 3ARYA 5IMKA 3TO4C 3MRCA 2EE2A 1ZHBA 3FT4A 4NQUA 4NUGL 4MD4B 4E41B 4ODBD 5GGQL 3ZKNC 3EHBC 5K93A 4WFGD 3S37L 1L9NA 2QBWA 3NIFE 5A2IH 5J6GA 2Y07L 1AD9B 1QYGH 4UU9B 4DGYH 5L6YL 3P4NA 1EO7A 4RX4D 3TIDB 3TF7C 4H25B 3BESR 2BVOA 3VFWA 4JQVC 4P3WA 2IH3A 4RNRA 5JQHC 4J6RL 5FO7B 3W9EB 1EEZA 1M7XA 4Q6IA 4J8RA 3V95A 4QTIH 4HWUA 5H37G 3SE8H 4PV8B 1RZ7L 3QO1A 3O4LA 2J8HA 1LNUA 1LP9B 2YC1B 4MCZB 5IV2B 2M8XA 4KK9D 3ZHLA 4WV1B 1S5HB 3BXNB 3O8XB 3HI5H 4X6BA 5B38B 1AY1L 1T04B 2JCCB 4BA8A 3GBMH 4YDIL 5C07E 5A40E 5BVPL 3VA2C 3H42L 5I30L 1F13A 1HKLL 4OI7A 2MCG1 1UEMA 4K7PH 5T3ZD 1ZVSA 4PJCE 1JPGA 1WQVT 1AO7D 2YEZA 5C08E 4L5FL 1L0YA 1V7NL 3CNKA 4HKXA 1LK2A 2D0GA 4XCEB 1QSED 3WLWD 5ICYA 2FZ3A 2OLDA 4KVCH 5KJRL 5F1IB 2F74A 3GM8A 2ZSVB 4BZ2H 3B9KB 3RDTB 3DV6B 4DGVH 2YWYA 1JPFA 3MBED 3RIAF 2BXZA 3G5XB 1AO7B 3TWCL 1KYOJ 1XMWA 3JV5A 4PJFA 3RQ3A 2BNRA 1NGWA 3T0EB 2DJUA 3EUUA 3FOMB 5GJSL 1F90L 1QSEB 4BQ6A 2CPCA 4GRMB 2GUOA 1KCSL 1JYWA 5D2LE 2F53A 1JTPA 4HC1L 4RAUA 5J11C 4OLUL 1YUHA 4AG4H 3P11H 5IW1B 2F9BT 1T2QL 2HLAB 3MV7D 2SEBA 4MHHI 4JFQA 3DVIA 1H0DB 3IFOA 4H26A 3ZHKA 4XNMB 3C8HA 1HINL 2P46B 1X44A 5IVOA 5DZOA 4RMSA 4ZOCA 4LLQA 1KXQE 1HZHH 2W0KA 1DE4B 1P1ZB 3S3SA 2ZG1A 5DQDH 3RGVD 5DUMH 3EJYC 3WMSA 3MNVA 3PWVA 4MMXC 5IMMB 3CVHH 4HIEA 4P2CG 1KCLA 2X09A 3W82A 1B3JA 5DUPL 3TBYB 3QI9D 4JPWL 3RTQB 4FP8L 1YECH 4U7SA 3D0VB 4ETQA 3BUTA 4KMLB 3ZE2E 4ZSOB 1CFQB 1QFUH 4U1SA 3RGVB 5ITFB 3VFUB 2GSGA 4OLXH 1F4XL 4K7PX 3QI9B 4ZS6C 5HDOA 3DGCR 5DD3L 1HI6B 3QCVL 4U6HA 1EHXA 5EUOF 2F54A 1F3JB 1BZ9A 3T3ME 4JZJB 4JZNA 3O4LE 5ID0A 5C0JB 1U58A 5TDOB 3MLTA 2H2SC 3OHXA 1J87A 4EDXA 4QGTA 1KLUB 1KN4L 5I1EL 1V8HA 4XCYA 1YMMA 4E0RB 2ESVB 1S9VB 2XZCH 4OGXL 2CKBH 5HGAB 3MRRB 5J1AA 3L9RB 4P59L 3E3QC 4X7SL 5IK3A 5H8DA 3BP6A 3SDDA 2Q7NA 3GHBL 4WW2C 2HJLB 1MJUL 4H20L 4R4BA 4M7LH 3U46B 3ES6B 5I66B 3LS5L 3FHQA 1DUZA 4N8VB 4KI1A 4HH9A 2NY7L 4I0KA 2J6EL 4PJFE 2BNRE 2FEDD 5E8NB 4YNYA 5IHUH 1VGEH 4OD2B 4KHXL 4GFTB 2B1HL 3AS0A 5AUMB 1DLFL 4OFYA 3TH2T 5D1QD 2G60H 5EBLB 3VFGL 3UJTH 4M7ZC 2RR3A 1NEZA 5GRJL 2HG5B 5M94B 1LEIB 3GSWA 3ZL4H 1RURH 4NQDA 4GS7B 1FDLH 43C9B 3N1FC 4R96B 4TVSa 2J8UA 3MA9L 2BC4A 4YC2C 2AP2A 4GRWH 4NZUH 2ORBL 3HMXA 4PRAB 3QEQD 4XXCC 3SGDI 2W91A 3FQXB 4LAQH 3I75B 4A6YH 2GJ6A 4TSAH 2J88L 1FNEA 2FNBA 3FRUB 4HXBL 2E7HA 3IT8D 4LNRA 4Z95H 2PUQT 1OTUD 1MY7A 1HNGA 3HZVB 4MDJA 5F96H 1B90A 1OHQA 1NANI 3D3VD 4OF3A 3WFCL 2NY1C 3ARZA 3JV0A 2HTLC 1MRCH 1TETH 5HVFB 4X9IA 3B43A 4B5EA 5J13B 4X7EC 4GRWE 3LVEA 1ORQB 1XGTA 4NC1E 1BQHG 2IAND 4JO1L 2BSRA 1P4IL 1FORH 3FRPA 3ARBC 4NN5B 4QHUA 5E2TL 3O6FC 3D3VB 5SWSA 5I1LA 1DBJL 5JR1L 2F54E 2VL4A 3K4AA 3OKNB 4JN2A 4G7VH 4ZO7A 3FQNB 5I16A 4KRPD 3E8UH 4FZ8H 5IB5A 3X12B 4XMKL 4BZ1H 5ACZA 1YMME 2ADFL 2ZKHH 3BO8A 3L3DA 3EYOA 1L6XA 1RUPH 3HZKB 3WFHA 4X0KB 3HFMH 3MR9B 5TQ2L 1LO2H 1CFTB 3P77A 1XF3B 3HHRB 3STZA 4KRPB 2IWGA 1XIWD 1N8ZB 1CIUA 3C8DA 3P4OB 4Z7UF 3WXVH 4WRLA 1MVUA 3EDFA 2FEEL 3EFDL 4JDZB 4RBPH 1KJMA 1QNZH 15C8L 3VRLE 4GG8B 1ZSDA 1OAKH 4OZIF 2Z35A 5HHMB 3KWWA 1EV2E 1A4JB 4P57A 4YBLC 1IGML 3WV0A 1XIWB 2ID5A 5J1SC 3UJJH 3NACL 5LWYH 1H8OA 2VIRA 3MRDA 1LO0H 4HCRL 1XCQA 1UVQB 3NPZB 3TZVA 1NMAL 1AHWA 1JGLL 1NGYB 5H2BB 2EE3A 1SEQH 3OJDA 4I77L 4LP5A 4NQDE 3G5VA 1I8KB 4PY7A 1ACYH 2B1AL 5J89A 2D7TL 1BQLL 3NGBC 1S7RB 2ZUVA 2J8UE 4MA7H 5HI5D 1F4AA 5HJ3A 2NTFA 4EIZC 2C3GA 1I9RH 1KPRB 4G6AD 1QBMH 2AS5M 3MBXH 4Z7OF 4LARL 4TVPH 2GJ6E 4D3CL 5I1KH 1BBDH 1G9NH 2AVGA 2MOVA 2MQ0A 3QIWA 3HMWL 5L8JB 3WO4B 2EDRA 4ZOAA 4NQSA 5DDHB 5T33H 1PLGL 1WICA 4HUXA 1QSZA 2P4AB 1FN4B 4P5TD 3SPVB 3ULUF 1TQCB 4WWID 3RL1B 3RJQB 3HR6A 4WHTA 3I9GL 2CRZA 1FVEA 3DIFA 3GMLA 4PBVC 5SWSE 1T0NA 3OV6A 2IF7A 4TVPE 3RPKA 1YJDC 1FFOB 3K74B 3WN5A 1WWWX 1VFMA 3ZTNL 3GSNH 2VLLB 3M45A 1NBZB 1JHKL 2Y25A 4RBPK 1E4WL 2ZWLT 1U92A 4R8WL 1UFUA 2VQTA 1IKFH 2VE6B 4LKCA 3DSFL 5EORL 1S7QB 3KYOA 3KLHD 3HB3D 1Z0NA 2UZYB 4NQXA 1DANU 4OIIH 4OKVB 2XTJD 2G9HA 5GJTL 2PTTA 4AZ8A 3PJSB 5HGBA 3B9AA 1U8QB 3F7VA 4FFVD 4X4MA 4Y7MA 2DQIL 3PL6A 4OTXL 4WI8A 4XHJD 4LPVA 1JPTH 1S5IL 3ARUA 1JV5B 3R8BB 2A38A 3RVVC 1ZT4B 1V05A 4GAJH 4P46A 1ROWA 1RHFA 2VISB 4ELMB 5JMRA 5IB2B 1KIPB 4TOYL 4ZFZB 1Z3GH 4PUBH 5D2NB 3FFDA 4E9LA 4JEGB 2FD6H 1FCCA 5BW7C 4U1LB 4FABH 1FNAA 3P4MB 2X9WA 3KPTA 1N64L 4HMDA 3OX8B 1I1CA 1I1FA 4CW1A 3QUZC 2VWEC 4MXVE 1INEH 4JFXA 3MPCA 2I07A 1IILE 4N0CC 2DJSA 2F5BL 4UTAH 3HZYB 4OZFB 5F1NA 1WCBB 4XMPH 1GGBH 3FQUA 3HNSL 4LEXL 4CVZA 2RGSA 4PP2A 4ZXBA 3AS1A 1TVHB 3ABZA 3WEXB 1A7RL 4UIMB 5GGRB 2VXTL 4KK8C 3MJ9A 3MA7A 3ALPA 3C09B 4Z76A 4U1KB 5IJVB 1QRND 4K71B 1YEGH 4FQCL 3S6CA 4YHYB 1G6RA 1KCUH 1QKZL 2ZG2A 1KYOK 1M6OA 2PXYC 4DW2H 3O3AB 4LBEB 5HGHB 1IQDB 2ITDB 3QHZH 5CD5C 1GGCH 4G43A 2IGFH 3BGFC 4AT6B 1QRNB 2EDJA 2FATL 4XWOC 4I8DA 3WKNA 4FG6D 3UYOD 2AQ3A 2X9XA 1IRAY 3KPRB 3O2DA 3Q2CA 3G08A 4O2CA 1J1OL 2XZZA 1G7JA 4OZ4A 1P7HL 1OTSC 3LAFA 3ZYOA 1M7DB 5GGVY 2Q8AH 3QB7C 1D6EB 4NHCL 5IROC 4R7NA 1SMAA 3PV6B 3RUGA 1Y6MR 5EUOA 1VGKA 4F9LA 1G0DA 2F8XC 4NHUB 3RY6C 3VFPA 2CXKA 4MVBD 1R5IA 3IKKA 2V7HA 3BHBA 1RIHL 5D93B 3QCUH 3PWPA 1NQBA 4PRIB 1F8TL 4FQLH 4X4ME 3PWNA 1INDH 4O4YH 2O5YH 4GMSH 3C08H 3FB6B 4CRPA 1ZT7B 2VDQH 1FRGL 2JIXA 1DUYB 4ZAKB 2AW2A 5TDNB 4P4KC 2LTQC 3VFSA 3VGDA 1JHTB 3MJ9H 3LQAL 2HH0H 3DYOA 1C5BH 4LCWA 1RVFH 1JZ6A 1ZA3A 4TRPH 1JF6A 4CMHC 1YYML 4YHLL 1NGZB 5D7SL 2FH6A 5FYKD 1QP1A 4JY5H 2APTA 1X5YA 2DL9A 2NY0C 1CR9L 1KIRB 5KS9B 2VLJD 3LHPH 3BPCA 3CUPB 4RMUA 5B38G 3QUYA 5JW4Q 1WZ1L 5EZOL 1DFBH 3SGDH 1WTGT 1PSKH 5DZLA 5I15H 2XG4A 3LEXA 3CU1A 5KSBF 4V1DA 1I7ZA 4KH2A 3THMH 1WFTA 3OKDA 3S3JA 2VLJB 3DUUA 3CH1B 1NANH 2IQ9L 1YPZA 4GAYB 1BX2B 1PGRB 3KPNA 3ZKXC 2DDQL 4GOSA 1VADB 1YDPA 2H32A 3NCMA 1IM9D 2ZOKB 1M4KA 1KSRA 2YPKA 3TO4D 5EZIL 3DVNA 3OJ2C 1B0RA 2V17H 5JO5B 4QCIA 2YMXH 3WCYA 2XA8L 3ZKND 3VDBA 2YPLA 2W0FA 3EHBD 3D9AL 4OFIA 1AIFA 4QWWC 2W0PA 3AREA 2KZ1B 1PYWB 3RIAK 4DKEH 3ARGC 4K7FB 5TE4H 3UPAA 1WBZA 4PTTA 2P1YA 1T89A 5CHNA 2Z93A 1UCBH 3TO4B 3HLAA 3P9LA 5HI3C 1MHEA 1Z9MA 2Q76B 4F58H 4BH8B 2EDEA 1FV1B 4BSWA 4JFZH 2OXHA 4MQSB 4Z7VF 4FXGB 2DM7A 1RK1A 1D5MB 4P4RB 3RUGE 3D2UA 5EUOE 1HHIA 1SY6L 4G6JL 4HZAA 4ZODA 3ZTJH 3KXFB 3R1GH 4YJZL 1N3NB 1OTTC 4IRZH 4OUUA 5GZOC 1D9KC 5I8OL 5DURD 1OARL 1WFNA 4XNXH 3P30H 5IMLB 1SHMA 3QRFM 5IGXL 4C59B 2P8MB 3OL2A 1FP5A 5JW3L 4YH6A 4W68A 3Q5OA 3SE3A 1UC6A 4N5UA 4XRCA 3TNNA 3SDCC 4V2CB 4YHNB 4QRTB 3O2WL 4M00A 4HWBL 4LCWE 2YKLH 2E8YA 5LXGH 4WHCA 3S7GA 5CLWA 4LIQH 4P9HH 4XPGL 4R2GC 3TCLA 3BFOA 1EO8L 5EDXA 1XCTB 4KJPD 4DGIL 2FBJL 2AV7B 3MGAA 2ARJB 4KQ4H 3BP7A 4WI3A 2EDOA 4UUJA 2GTWB 3EYUH 2PR4H 2G75A 4YR6B 4X80L 4FQHA 3OKLA 3GMRB 1EJ6A 4V1DE 5KVDL 2VB5A 4UIKH 4OV5B 3C2AH 5TFSL 1AGCB 3HNVL 3DUSB 1U8JB 1B0GA 4OD3H 4LIQE 4OCRL 4KC3B 2EH8L 1MUJA 4H5SA 4N8VG 3O3UN 5DR5L 5J11B 2NXYC 3FQWB 4P9ML 4QXGH 5L7XH 5FKAA 2DQFA 5FM4A 3MRPA 1G7LA 1F58H 5AZ2H 1G7PB 1RHHA 3MRGA 4HKJA 4GAGH 5E6IC 4MD0B 4I0PC 4N8CL 3BT2H 4XC1L 4ZPVB 4RGNE 3LZFH 1F97A 1A9EB 5ACMA 2BY0A 4LEOB 1MFEL 2OSLA 2DWEA 3IDMA 4LSPL 1FNSL 1YEDA 3SGKC 4EI5C 2IPTL 1E6JH 4QTHB 1OB1B 1NFIA 3W9DB 1EFXA 1C16A 2CO7B 2NYYD 1BEYH 4X6CF 1T7YA 1LK3L 1IGIL 4HBCH 4HIHB 4JB9L 4ZD3L 3GJFK 4ZS6D 3SE4C 4B7IA 4OSUL 2D31A 3CCHB 3L7FB 2O5ZH 1RPQA 1QOKA 4ZQKA 2HKHH 5CCKL 1CGVA 1K5NB 3GFUA 3IS1X 1W8OA 1YQ2A 4I3RH 1DBAH 3VI3F 1OWRM 2H2SD 1AXSA 3I6KA 3O6LL 1Q0YH 1ZK9A 5FUCC 3GSXB 1FL5A 5IVXB 4IDJL 5IVZA 4NO5A 5DEFB 1ZGLP 1CBVL 5CJ8A 3TBVA 5EIIA 2BY2A 5L2KA 2M26A 1AGBA 5ABDE 4WI4A 3C8KB 4JFYB 3LS4H 4F57H 3EO0A 4JG1H 5EU5B 5HDQL 4PS4L 4OF8A 1FYTD 1U95A 2Z8VC 1DL7H 5FYLH 1QBLH 2BNQD 3KPSB 2MPAH 1J0YA 1FVDA 1FG2A 1BJMA 1OY3B 1I9IL 2EIEA 5DVNA 3MLSH 3RZCC 5FK9B 4WW2B 5J12C 4NNYA 2FX8H 2JJVA 3MV9D 4CL7A 2MNUA 3U6RB 2C3XA 4ZDHB 3SOBL 1IGYB 2BNQB 1OLZA 1QFWL 2ICEB 1CDJA 4HDIA 1CI5A 1ONQA 1U8NA 5EG6C 2XWTA 2EE6A 4J3UA 4TUOA 4Y5YC 4ODSL 4HG4J 3T65B 1CD1B 4N9OB 4M6AA 5FV1L 2I60L 2P5WD 4PY8I 5FYLE 3L5XL 1BJ1J 2XT1B 4YXLL 4M7ZB 1KENH 2Y06L 5E03A 3U79A 2VDLL 1J1XL 5F44A 1DQJB 3RWIB 1Q94A 5GS1A 1A6WL 1FAIH 4J3XA 3FONA 1YQVH 2E5EA 1ND0B 3EO1A 1F5WA 2JELH 3D39D 4YC2B 5FOBB 3T2NH 5D1XA 1K8IA 4PRBB 2YUZA 2HTLD 2VQUA 4PY8J 4N0YH 4WI7A 4XNUL 5HY9A 5C0DB 5IKCB 4XPTH 3BEWA 5FUOL 3D39B 1JGDB 3ARSA 4K8RH 3F5WB 5IEHA 3ARBD 2HT4C 3VDCA 3RVTD 5FV2A 4JDVB 1EBAA 2HFEB 2F5AH 1I8MA 5ALCH 5JPMB 4XVUC 5CJ5A 1A6UH 2WBWB 1IGCL 3IRZA 4Z7WA 1A7QL 4PV9A 3MX0A 4WCYH 1AJ7H 2HTKC 4OCXH 4PJ7F 3LPWA 1G9EA 3ARBB 3O6FB 5I1IL 2HFGH 5CJOH 2DQJL 5FF6A 5IB4A 1PG7X 4YQXH 2FJHA 5DD0L 5FM5O 4IMKC 5TE7L 2BCKB 4ELKB 4PYHA 3BJ91 3EJZC 4YDLC 3RU8H 3ULSB 4HUVA 4RFOH 1NKOA 2D4DA 2ADGA 2Q7YB 3LKNA 2HFFB 5MEPA 1NFDF 2XZQL 3GSUB 5DUBB 5C6PB 3CD4A 3ISWA 5DF0A 1I3VA 3HG1A 1B4JH 2XKNB 3CXDH 4ORGB 4NQEA 1G7MA 4HS6A 4MJ6A 1GOHA 2EDLA 3KYAA 1NC4A 5JUEH 3RVUD 1JWMA 1M05B 1EGJL 3DX8A 3ZDXE 3IU3A 2EKSA 3GIZH 4LLVA 4YBLB 1EH9A 2DQCH 4ONHA 1XFPA 2X4NB 5D5MB 3T04D 3DECA 4LLYA 1YY9C 3GMPB 3OXSB 5JOPD 5EO9B 2JJSA 2AI0L 2XWBB 4ACPA 2AEPL 5DMKB 2NX5B 4PRPA 1KJ3L 3VG9C 3B3IB 3I6GA 5HBBA 1UWEH 5I8KH 2H26B 4OJFL 2R1YA 5GGVH 3NGBB 2WV3A 4K3HA 5IB3B 5EU3A 5DJXA 5CP3H 1T2JA 2EDKA 2WINB 2HAZA 3ARDC 4HUUB 3MLZH 1JCKA 3PHSA 5DJZB 1N5AA 3VRIA 3L3IA 3QFJD 1NGQL 1MNUH 4HPYH 4RGMC 1LP9F 2ARWA 3T8XB 1E27A 2R1WB 4OZFG 4F9PA 1KPVA 3HC3L 3P0VH 4RIRA 4AENA 2KDGA 2JCCF 4BFGA 3LKSB 1SJHB 4YEFA 5IQ7L 1UB6B 4WVRA 4APQA 3MGOA 4GUPB 4Q7DA 5I2IA 4HIIB 3V4VH 1OAQH 3VFTB 3DYPA 4WO4A 1M1SA 5HHOE 5D72H 4I3SH 4R4ND 5KVEH 1UACH 2ZUQC 4LSUH 4OM0H 2OP4H 4Y0GA 4D0DA 2VAAB 1MLBA 3LB6C 2PO6A 2AJUH 2UVEA 1X6NA 3V0VA 5B4MC 1AGEA 4NPYB 3BI9X 1K6QL 4UV7L 2C7UA 1S7TA 4N0UA 1YNKH 1PG7L 1MJJA 1T1ZB 4GW1B 4YDKH 2B0SL 2VAJA 3QG7L 1OAXL 3K8MA 1T80A 5F9JA 5I9QC 1PBYA 4ODHL 4AMKL 3UTSD 4MD5B 2D7OA 3DARA 5E2WH 4ZUWB 1A4KB 1BWWA 3QDJB 4J1UB 3HC4L 5BMFL 3BKCL 3ULUL 4HJGB 1S9XA 2IMMA 3RVVD 3C60C 3HG1E 1RZFH 3I6LE 5AYUH 4NQEE 3IDGA 2V7NB 3MLRH 3E6FA 1UJTA 5IFAH 3PWLB 3L1OH 1U8OB 4LRIC 4L29B 4UV4H 1QUNA 3QHFH 1BQHA 2FIKA 4FHBD 2Q1EA 5CKGA 3DI3B 1CTNA 3LQZA 3QUZD 4JHWH 2E6PA 3KPQA 4N0CD 3BEVB 3KPOB 5KN5A 4AL8L 3MRQB 2ADJB 2B7DT 1NMBL 1TJGL 2OTUB 4IRJC 1EJOL 4U6VH 4L4TD 5DVLA 4PRPE 2A6IA 1CVSC 3BMVA 4ERSL 3CK0H 1XR9A 4YZFF 3QUZB 5KSBE 1C1EH 5E9DB 3W5NA 1BJ8A 2P7TB 5LAXA 3ROOB 1W72B 1DVFC 3IDNA 4J3WA 1MCKA 1BFVL 4GH7B 4M48L 5DFVC 4L4TB 3SKMA 1JNNH 2F58L 4OQTA 1DDHB 3FN3A 3OAUL 4Y4KC 1KJ2L 1VACB 2F8OA 1ZANH 1VB9A 4CN6A 4JQXC 5FM5M 3CFBB 4DAGH 1NC2D 4WTXA 1K4CA 8FABA 2MQ3A 2BJML 3H9SB 4XP9H 4LRNH 4BFIA 1G9NC 5FECA 4X99A 2WQ8A 4HT1H 2PXYB 3LN4A 1E6OH 5DJYB 5I1AA 5CEYB 4DQOH 1YN7A 1KJVA 5E00A 4M02A 1RJYA 2HP4A 2VXUL 1ADQA 4H1LB 4JKMA 4ZTPL 1NC2B 1KTDB 3BGFB 3GNML 4TUKH 4LVEA 1HYSC 4L4JA 2VJXA 3IKCB 4GKSB 4Z7VE 1MCJA 1IVLA 3PDOB 2R4SL 4YO0B 2O61A 1N4XH 1QR1A 1OGAB 3SDYL 3SKNB 2DRUA 4XBEH 3ECBB 5T3XD 1R5WA 3HTLX 5EU7C 1ZLWH 5GHWL 2DQTL 3QJHA 4XVTH 5EOCL 1BJ1H 1RUML 3PQYB 1T2XA 2E9WA 4YFEA 1OD9A 1OQOA 3CPLB 1DLHB 3DRQB 4HQQL 2Z8WC 4P4KD 5DYOB 4Y16A 3M8OL 2LVCA 5I74C 3K2MC 3WNNA 3E6HB 4ODXB 1I1AA 4N90D 1F02I 4WFED 2DLEA 1FBIL 4KPHL 1YN6A 1O5DT 4OQTH 4L9DA 1RZKL 5IF0A 2NY0D 4X9GA 4P4KB 4W4NA 1VFBA 1IAII 5CEZE 3Q5YA 1YEJH 3CU7A 3LN5B 2DQHL 4FQQB 3DX9A 3KLDA 2YXFA 3MRBB 4U2YA 2NY0B 4WY7L 4M5ZH 5DJ8B 3W0WA 2XPGB 4LDOB 2Z92B 5TDPA 1INQA 5DJ6A 2XQYG 3T0WA 7FABL 1FL6B 5I19H 2J1KA 5TQ0L 2V2XA 3ZKQD 4KI5C 2DN7A 2Z91B 4HV8B 2PW2A 5FHAH 3QJFA 4BYHA 4O51B 4AEFA 3ZKXB 3UPRA 1FFPA 3BRGC 5ESQB 1CU4H 4YBQC 3F12A 3HUJA 4QRPD 3V4PH 1GPOL 3QNZB 4MWFB 2J3SA 3DNKA 5ITBL 4C56D 1IEBB 4K2UH 4HG4K 3WL9A 3DMMA 3GO1H 1MCRA 3LSOA 3P0GB 3TIEA 3TN0A 3JTTB 3QWOB 1ZLWK 1HYRC 5E8EB 3AAZB 3K81A 3I50H 1GAFH 3JTSA 4CU6A 4HFWB 1L6ZA 4QRPB 1IL1B 3ARGB 1BVZA 1A3QA 4CKVX 1JFQL 3EYQD 3QWQB 4AEHL 4F7CB 4NRZB 2CDEB 3VI3E 4DTGL 4GXVL 2XKSA 3IS0X 2PCPA 3MCKA 4KGJA 1D9KD 5I1CL 4UNUA 5MI0B 3VCLB 2IPKA 4BK4A 1U3HD 1TTUA 3T4YB 5F7WC 1GZQA 3C5JA 2EXWC 1HSAB 5BXFA 1MJ7H 1N0LA 1F3DJ 2R56L 1Q1JH 1ACZA 4JFFE 1EEQA 4B7LA 1MFDH 2A9NH 5T1MA 4CN4A 4JHBA 3SDCD 3DPBA 2X4TB 1D9KB 4P3CH 2FSEB 3V6OE 4HF5L 2V5MA 3TBWB 1VERA 4WHDA 5GRVK 1FZOA 5EZLA 3FB7B 1UJ3C 4R2GD 3V2AR 4RMQA 1OT2A 1A7PH 2FO4B 4HWEH 3QQ3B 4XP5L 4ZYKB 3SDCB 4MJID 1H15A 1NKRA 4MA3B 3QUML 1WZLA 3VH8B 4QHKI 1CLYH 1EERB 4FXKA 4PTUA 5HHNB 2AAVA 3WDHA 1JTOA 3SDAC 5KTEL 4O2EA 4R2GB 3WKMH 1JYVA 1TJHL 5F7HA 1FNLA 4YHMH 2JTDA 1EMTL 3GGWA 4OCWH 5INCA 5C0CA 4MJIB 3OMZA 3W0WE 1FNHA 4EOWL 4IRSC 3UTPD 3V6FA 2X89A 4MD4A 4NT6B 4FZEL 4ZUUA 1E28B 1IGJB 3KG5A 1H3UA 4QHKJ 1AD9A 5GS0L 3NPSC 4UU9A 2E7CA 5JOEA 5E6ID 4D9RE 3TIDA 5JXED 4H25A 3EYSL 4D2NA 2F15A 2P45B 2A2QT 4LSQL 4UT7L 5FO7A 3K4ZA 2NXYB 3BN3B 3W9EA 3HUJE 5I73C 5F9AC 5HXMA 5IW3A 1NUDA 4PV8A 4EJ1C 3Q6GL 4HPOL 4QOKD 1LP9A 1RIVL 5E6IB 4RX4A 2YC1A 3BGMB 5EUKB 4DCQB 3NIGE 4MCZA 2BP3A 5IV2A 3B2UD 3DTXA 3B8YA 4MAUH 3BXNA 3ZDZE 2VL5B 3O8XA 5SWZB 1MQKL 1MFBH 5B38A 1T04A 5I76B 4EI5B 5BZWA 3RP1A 5I71C 3LPGA 2VLKB 4QOKB 3MROB 3MYJA 5DHXB 4PBXA 4ELMF 1QFPA 3RA7L 2R4RL 4BKLB 1QEWB 3Q3GA 1RUAL 4XCEA 1OF2B 1CXEA 5F1IA 4XCNB 1JZ2A 3QQ4B 4UDTA 3B9KA 3RDTA 3DV6A 5DGRA 1T1XB 4Q9BA 5HDLA 3SE9H 2YR3A 3FL7A 4P49A 3T0EA 3KS0J 1LO3H 1IAIM 1U9KA 4FOMA 3RIFF 2PN5A 2VSCA 4WWKC 2DJ4A 2YK1L 5LCVH 4JKLA 1P4BH 3LY6A 5CEXB 2R0LL 3PWJB 5IW1A 1RK0B 3BKYH 1H0DA 1TTGA 3FZUC 4G6KH 3IJHB 5GGRY 1JGEB 1H3PH 1U41A 2A6JB 3MXVH 3KPPB 1DE4A 1P1ZA 1DQDH 4MAYD 1T03H 5C0CE 3RZCB 3S36H 4ZOEA 4YWGH 5J12B 4P9HC 5IMMA 3RJDA 3CVIH 4E41E 3PP4L 2DQUH 3RTQA 4ODWB 4Z6AT 4OT1H 3D0VA 2GTZB 5IR1A 3IJYA 1KCVL 1CFQA 1YNLH 1MH5B 1ZHLB 3RGVA 1TZGL 3VFUA 5C7XH 3ET9F 3QUXC 5D7LD 1CQKA 3U48A 1NCNA 1PY4A 4LQ1A 4R0LC 4GQ9L 2IJ0C 1HI6A 3U2SB 3L5HA 1U2CA 4WFGE 1XGPB 1F3JA 2I9TA 1A14H 4D94A 3N85H 4JZJA 3UBXB 3MODH 5T3ZH 5HYIA 5TDOA 1LP9E 1I7RA 3EFFB 4CNIB 3SGEI 1OCWH 4GRLD 1K8DA 1KLUA 4PJBF 3DHJA 5BZDB 1Z6JT 3QUKB 1CK0L 4E0RA 2OZ4A 2ESVA 2JCCE 3I02B 1A3LH 5D70L 3VFNB 4Q9RL 5HGAA 1HH9B 3BQUA 3MRRA 4XVUD 2A6DB 3G04B 3L9RA 3ZE1F 4BH7A 3QPXH 4UT9H 5DMIH 1Y6KR 1JZ3A 3WIIL 3V52L 1MPAH 2HTKD 1EFQA 2HJLA 2GEEA 2B2XH 1ETZA 5D96C 3U46A 2DB8A 3ES6A 5I66A 5IEKB 4MLSA 5B3JE 4N8VA 4XCFH 4U3CA 1BFOB 5T3ZE 4G8GD 1AO7E 2WW8A 2IAMC 1MIEL 4KDTC 5I8EB 5KS9F 2QQLL 1BZ7B 3QXAA 3T0EE 5E8NA 1A3RH 3EJZD 4OD2A 1AP2B 1QSEE 2EO9A 1FVCA 5AUMA 3V0WL 1D7FA 5EO0B 3MACL 4DZBB 4KKBC 1D6VL 2YD1A 5EBMA 2HG5A 3OGOE 4G8GB 1LEIA 4NM4H 2GW5A 4K3DH 4PJHB 2X2YA 1IAIH 5ALBL 3S5LB 4XXDB 4YDLB 1S7SB 2J4WL 3ROLB 43C9A 4R96A 3TV3H 3RY4A 2ADIA 5LG1A 4Y88A 3H9YA 1T4KB 1OPGH 1S3KH 3IFLL 4PRAA 3BAEH 4PRNB 4Z95L 3FQXA 5F96L 3I75A 5JIIA 5SX4I 2BRRH 4Z7NF 2BXYA 3O11B 1YY9D 4S1SH 4X6EB 3FRUA 1KV3A 2XOTA 4XP1H 3MLWH 2NNAB 5D7JC 3HZVA 1FFQA 3ALXA 2JB5H 4LK4A 2OZ4H 4ZSOE 4O5LL 3H0TA 1A22B 4X4YB 3O6ML 2AXGA 4G7VL 3MMEB 4KAQH 1ORQA 5E4EC 4LU5L 3MLYL 2DLFL 4G3YH 3EDEA 3ARDD 1CFNB 4OIAA 3ULUC 4BZYA 4AIXA 4FQIH 3VG9B 3D3VA 1ZLVH 4RISL 3OKNA 1MRFH 4JZOA 1NGPL 2UY6A 3FQNA 3PGFH 4JKKA 1U2HA 4XC3H 5E2VH 3X12A 3M07A 2H9GB 4JO2H 3ARDB 4L8SA 2ESVE 2R2CA 5TF0A 5JHDD 2VDPH 3ZLQC 3X11A 4LVNC 3MR9A 1RUQL 1XF2A 4RGMB 2ZZUT 5E8OA 1CFTA 3H3KA 1XF3A 4P2OC 1MHPH 5GQBA 4PGDB 2R29L 4N9GA 3IETB 3HMXL 4X7FC 5JIHA 1P7QB 3P4OA 4KJYB 3GHEL 2VDNH 3K46A 1BFSA 3LB6D 4JDZA 5B4MD 1KB5H 1TPXB 2NZ9D 5ILTL 2HN7A 1CGYA 4GG8A 3ZSTA 3VXNB 4NP4L 3DHMA 4PB0H 1A4JA 3DROB 5HYJB 5LQBH 1R24B 4WUUB 2ZUQB 3PHOA 3T2PA 1W0WB 4JCLA 4QHLB 3DYMA 1CF8H 4IIQC 4D9LL 1DQQB 1UVQA 3BJLA 1BECA 4J3OC 4TSCL 4ZO6A 5H2BA 1NGYA 4R7DB 1A1OB 3N1PC 3C60D 1YYLH 3FQRB 3FO9B 3OSKA 3QO0B 1FCGA 4OZHB 1I8KA 5I9QB 1S7RA 1BBDL 3QZWB 4OBSA 3STLB 2VNCA 3WFBH 4Q9CA 5BS0D 4LSTL 4UB0H 2WAHA 4M5YH 5IM7B 25C8H 2Y6SC 5I8CA 4Q9QH 4KMQA 3I2CL 4NKIH 1NCCL 3C60B 1L7IH 5D8JL 2CIKA 3KAAA 4X7CC 1F4YL 1T1YA 4IRJD 3WSQH 5FA3A 1JZ7A 3NTCH 1UZ6F 4FMFA 3AM8C 5DDHA 4FQ2H 4X8XA 1AGDA 5ESAB 4HUWB 4XVSH 1FN4A 2R69L 2Y5TB 3HAEG 1UG9A 2WBJA 1NCDH 4AEIL 2GJZA 5EC2B 3RL1A 4EZMA 4I48B 4POZC 4PRDB 4NO0D 4XCCL 4IRJB 1DVFD 4OAWA 4OZGB 4YXHH 1M71B 1N2RA 1TENA 1CDGA 4OF0A 3D3VE 4FQ1H 5IMOB 4RCAA 2ZPKH 4Y4KD 1FFOA 3KJ6L 1IFHH 3JUZA 1GSMA 5KVGL 4NO0B 2VLLA 1NBZA 2WUBL 1U6AL 4NZTL 1DVFB 1HQRB 2FECL 5C6TL 3V0AC 3KS0H 3CSPA 2CGRL 4TTDD 1VPOL 1RZKC 2V9TA 2VE6A 4Y4KB 43CAA 4JM2D 4LHUD 1WISA 4WTZG 3U7AA 4FTVD 3BUYB 1MCDA 3SQBA 5I18H 2DLTA 4ZTOL 5EFIB 4ZUSB 3QT2A 5HHME 3RWCA 2FX9H 4LHUB 5KAQG 4XP4H 1JV5A 4WW2F 1ZT4A 1SVZA 3MLUL 3OTTA 2R15A 1IKNC 2EDBA 2VISA 4ELMA 1KIPA 4ZFZA 4HSQA 2H8PB 3N50A 3BP4B 3DOSA 3U4EA 3WNKA 2UY7A 2ZJSL 4U1LA 2WWKO 4HUKB 2BY3A 2XFXB 3P4MA 4NCC2 1MHCB 3MRMA 3OX8A 2ZCHH 3U1SL 5T5FL 4KTYA 3ZO0A 5K9QI 1NAML 3ZT5A 1UM5H 3GSNB 3LEVH 3HZYA 4OZFA 1GXEA 1WCBA 3LV3B 1T20B 2YBRB 4GG6B 2XWJB 2OJEB 2EDWA 1SBBA 4K9EH 2DKMA 1Q9LA 2APXA 3EYFB 4NC2B 2AJVH 1TVHA 4D8PB 3UYRH 3OB8A 2YUWA 3BKML 1T83C 5GGRA 2NY2D 1XF4B 5I74B 5FGCE 1ULVA 4LSRL 3F7RA 4LVHB 4U1KA 3RNKB 5IJVA 3GBNL 4MS8D 1VSCA 4JRXD 4JFDB 2HJKB 3RY5A 1ZAGA 3TFKC 1YEEL 4OGYH 5GRYA 3O3AA 5HGHA 1NJ9B 2HA1A 1IQDA 4KRMB 2ITDA 2NY2B 3DVFA 3TJEL 2UZIH 3HA0A 4M6ML 1JNHB 5MEQB 1QRNA 2YSSB 4D0CB 2Q8BH 2YPVH 3U7YH 4TUJB 3KPRA 3KYNB 4KFZC 3SGEH 5DRWB 3QDMD 4HK0A 1OAYL 1M7DA 1BGXL 2R2HB 3O0RL 1D6EA 2Q3AA 5FYJL 3BSZH 1DBBH 4YBQD 2DAVA 1RJCA 3QCUL