5DT2A

Crystal structure of dot1l in complex with inhibitor cpd11 [n4-methyl-n2-(2-methyl-1-(2-phenoxyphenyl)-1h-indol-6-yl)pyrimidine-2,4-diamine]
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
311
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 98
structure length 311
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dt2A02
2YX1A 1O9HA 3UJCA 4XUDA 1XTPA 3LBYA 2GAFA 3BGIA 3A27A 3E8SA 3EVAA 3FTCA 3OE4A 5EHGA 4CKEA 4LECA 5K03A 1RI3A 4P7KA 4DQ0A 5JUWA 2JJQA 5CCXA 1AQJA 3KR9A 3CJRA 3R0QA 3LBFA 3PB3A 2ZBPA 1F38A 2I62A 4DCGA 1L1EA 5ICGA 5CCBA 4E70A 1L3BA 2GS9A 1L9KA 2OO3A 2FPOA 3OZRA 5E1OA 1YFJA 3SGLA 3HVHA 3M4XA 5K0LA 3HA3A 5HIJA 1XJ5A 3DMHA 5C1IA 2ZZNA 3A4TA 3G8AA 2YTZA 4RTKA 2KW5A 3EVGA 3FYCA 5DM1A 2YUIA 2EG5A 3MHTA 5LQRA 3EVBA 2ZULA 2FRXA 3LDUA 1RJDA 1YB2A 3ANXA 3HA5A 4KIFA 1B42A 2WA1A 4MTLA 4E2ZA 1X1BA 1TW2A 5E8RA 2HMYB 2NXNA 7MHTA 4R6XA 5DLYA 5DTRA 4MIKA 3EVEA 2ONZA 1RI4A 2O0LA 3ELYA 2GA9A 5HIKA 4KVZA 3FUXA 3UJDA 2H00A 4FT2A 1BOOA 3UJ7A 3I53A 1UWVA 2UYHA 3P71T 3KQPA 1KPHA 4DA4A 1G60A 2QYOA 4G56A 1EJ6A 1QYRA 1KXZA 2B25A 2NXEA 1EG2A 1BHJA 2P7IA 1SUSA 3DLIA 3KPYA 3OU6A 4MQ4A 5EEHA 2G71A 2BM9A 2Q41A 4ER3A 1YZHA 3GIWA 3P2EA 4PIMA 3VSEA 2PT6A 4CKBA 2IBSA 4PCLA 5DTMA 4OX9Y 3OU2A 3HCAA 2E5WA 3LCVB 4Z2YA 4YMGA 3CJQA 3CCFA 5FADA 1WXWA 3KQVA 4PYQA 4IWNA 1ZKDA 2XYVA 4RTPA 2G72A 3K0BA 4F85A 1NW6A 2QRVB 4RSRA 3DTNA 4EKGA 5KQSA 3FPGA 5GIOE 1M6YA 3RIEA 3BUSA 4NECA 3TKYA 3P8ZA 3HVKA 1H1DA 3I9FA 3FUVA 3PTAA 4ER5A 3FPEA 5E8JA 3SX0A 3BWMA 3TPZA 1JQEA 2C7OA 2LD4A 3UZUA 2NYUA 5ICFA 2XBMA 2P40A 4HG2A 5K01A 5K0FA 5EGSA 3THRA 2ORED 1SUIA 4RVHA 3KQQA 5ICCA 3HCCA 2ZFUA 4AUKA 4QDKA 2B2CA 3HM2A 4PINA 2JHCA 3EPPA 1I9GA 4LWOA 5CIYA 2AN3A 1M0EA 1XDZA 3FRIA 4B17A 2PBFA 4XUEA 1KYZA 2VDVE 1FP1D 3PFGA 2OB1A 2ZBRA 4YUWA 3REOA 1V39A 2BR5A 2O57A 3HCBA 3OZTA 2P41A 2AR0A 2BM8A 4OBXA 5EQJB 3TKAA 4YV1A 2UYCA 1Y8CA 5F2NA 1NW3A 2NXCA 3FZGA 1VBFA 3FRHA 5DPMA 1NT2A 4GUAA 4GQBA 2PXXA 3GXOA 3AWIA 5GIPE 3IEIA 1N2XA 3DMGA 1NV8A 3DMFA 4AZWA 3SVZA 1QANA 2AOUB 4E2XA 5LR6A 3TOSA 3M6UA 3UFBA 4GOND 3BZBA 4IKPA 2P3QA 3LECA 3DLCA 1R00A 2BH2A 3X0DA 3UBTA 2WA2A 3GDHA 4YUXA 3BXOA 3B3JA 3LPMA 2PX5A 2UYOA 1RI1A 1RJFA 2BR3A 2EJUA 1VPTA 2ZIGA 3NJRA 2YR0A 5FA8A 1X1CA 3SSNA 2NP6A 1AF7A 1XVAA 4C08A 4RTLA 2JH8A 1VLMA 3OFKA 4E30A 2ZSUA 4MHTA 3M6WA 3NTVA 2ERCA 1X19A 3EVDA 1EAMA 3P2IA 2YXLA 2FCAA 1XCLA 4FSXA 5K0NA 1NBHA 1M6EX 2P8JA 2AS0A 3FUUA 3JWIA 5KYGA 5E2AA 5EC8A 4HC4A 2A14A 3ERCA 4P7FA 3I64A 3M6VA 4V0QA 4Y30A 2IBTA 1NW8A 1KP9A 2BZGA 2HWKA 3DP7A 1G6Q1 4P7GA 5T6BA 3GCZA 3HCEA 4QQNA 1VE3A 3SR4A 2Z6QA 5F2KA 1UFKA 4YV2A 1MHTA 1G55A 5DRTA 2GPYA 4PYMA 4QTTB 5G02A 3FUTA 1JG2A 5E1MA 1NE2A 1NV9A 1YZ3A 4P7JA 4RTQA 4DMGA 4M38A 3AJDA 3KQTA 5IH3A 2AN5A 4AX8A 2WK1A 4X63A 1VP9A 2PWYA 3P9KA 3SSOA 5DM0A 5EMJA 4QTUB 3LDFA 2I6GA 2HR1A 5BW5A 2B78A 2JG3A 4O29A 4R8SA 2AVNA 3P9CA 4CWAA 3TMAA 1NBIA 5FULA 2ESRA 4CTKA 5C9ZA 4QVKA 5CUQA 2YXDA 3EMDA 2ZIEA 4OA8A 3B89A 4FS8A 5CVUA 5DTQA 2H11A 4PNEA 3HTXA 3AXTA 4C04A 5MHTA 4FGZA 4P58A 3TQSA 4EKIA 3MGGA 4DCMA 2PX4A 3FTFA 3JWHA 3S68A 2PLWA 3JWJA 2CMHA 2IPXA 5EVJA 3ELWA 3LX6A 3EGIA 3OFJA 1QAOA 3UA4A 5DX8A 2OB2A 3ELDA 4IV0A 5FUBA 4PYNA 2PKWA 2UYQA 3M33A 5CVJA 3BT7A 5HOQA 2JHPA 2FHPA 3RODA 4MWZA 2HTEA 3BWBA 3QV2A 3KKZA 2VS1A 3HVIA 1NKVA 2XVMA 3BGDA 4BY9E 1P1BA 2P35A 2CL5A 5HEKA 4CXMA 3M6XA 3G88A 4HSGA 3O7WA 5C0OE 2HV9A 4E31A 3KQSA 1R74A 3CVOA 4WXHA 3HVJA 4OQEA 2IH5A 2P1DA 3AXSA 3U81A 3DR5A 5DRYA 3G2MA 3JWGA 1XXLA 4CKCA 1FPQA 3CBGA 2XYQA 1JQDA 3D2LA 4ER7A 3IYLW 1ZG3A 3PX3A 3R6TA 5LQCA 3LHDA 5CM2Z 3NWEA 4E32A 1AQIA 3MCZA 2FYTA 4RVFA 2OYRA 4AZVA 4KIGA 5FTWA 3G5TA 3HEMA 1KYWA 2P7HA 3KR2A 3LCCA 3MAGA 3MCTA 5K0CA 5FWDA 3PFHA 2OY0A 4UOEA 2UZ4A 2I7CA 2NP7A 2OZVA 2ZIFA 4RTNA 3TM5A 1R8XA 1QZZA 4HTFB 2H1RA 2PGXA 3MTIA 2ZVJA 5ICEA 4RWZA 3QOWA 3I58A 3DXYA 3HP7A 5EIWA 3QOXA 4ATNA 3KHKA 3EVZA 3KPUA 3M70A 3TFWA 2VZ9A 5IKMA 1VQ1A 3DOUA 4GOLD 1PJZA 2R3SA 2XYRA 1JTFA 3LKZA 2Y1XA 1U2ZA 3GRYA 3VC2A 4M36A 2B3TA 4HGYA 4EQZA 1IXKA 2CWWA 3GNLA 4RV9A 1P91A 4OBWA 1R8YA 5DSXA 1SVUA 3I5UA 4X41A 5CVDA 1ZGAA 1O54A 2BR4A 4BLWA 2PSSA 2YQZA 3O31A 2ZCJA 5EKUA 3G8BA 3WSTA 2IFTA 2QRVA 3UJBA 4QDJA 3KPVA 1G8SA 5LQJA 2AZTA 2N47A 2GB4A 5BW4A 9MHTA 1IY9A 2XVAA 4YUZA 3FPHA 1DL5A 3P97A 5EMMA 3HCDA 5EPEA 3CKKA 1TPYA 3NVMB 3C6KA 4EMSA 3EGVA 3NDIA 4RTJA 3ID6C 3TM4A 2OBFA 3GJYA 5F2OA 2PWPA 4GOOD 4A6EA 3GRRA 4DKJA 5K0GA 3Q7EA 5DM4A 3HCFA 4C4AA 4DF3A 1T43A 4RVGA 2K4MA 1XDUA 4PGGA 4E2WA 1INLA 5HIMA 5ERGB 1SQFA 5EIFA 3MB5A 3BKWA 2CMGA 4HGZA 1VIDA 4QPNA 3O4FA 2Z6AA 1UIRA 1JQ3A 3OE5A 1F3LA 4PYOA 5K05A 3BWCA 3FUWA 5EZQA 5KQRA 4GC5A 3LSTA 2AOTB 3LGAA 3PX2A 3T0IA 4HH4A 2PX8A 5K0JA 3LDGA 1WS6A 2Y1WA 3KU1A 2AOXA 5DXAA 5GM1A 3DH0A 5HILA 3V8VA 5HZMA 5DSTA 3SMQA 5BP7A 5GOZA 5JR3A 3UJ9A 3P9NA 4ER6A 4H0NA 3SSMA 4BLVA 3DUWA 3FTDA 4A6DA 4DZRA 4PYJA 2G1PA 3E7PA 3P9IA 3G7UA 1EIZA 3EVCA 3K6RA 4RVDA 4YUVA 5DWQA 2ZWAA 4YMHA 2O07A 5HIIA 3R3HA 3ORHA 5EG5A 2VDUE 2O06A 3HA7A 3F4KA 5LQUA 4XUCA 4OA5A 1PRYA 1BC5A 3MERA 3GWZA 3GRVA 2NNWB 2ADMA 5FQNA 1OR8A 2PJDA 5DX0A 3OZSA 1VL5A 1N7IA 2AOVA 2ZTHA 5FHRA 3T7TA 5T64A 2C7RA 2QE6A 3EEYA 1DCTA 2ZZMA 3A7EA 4X1OA 3KQYA 3MQ2A 3MTEA 3V97A 2EJTA 3B3GA 4R8RA 4HRAA 5LQKA 4PYKA 1G8AA 1DUSA 5K8VA 4FT4A 4RX1A 4ISCA 5E9JA 5U4XA 4CTJA 5K0EA 3B7PA 1RJGA 2GH1A 4RYLA 4C05A 1TW3A 2IDJA 2YXEA 4PGHA 4PONA 4PYIA 2Z6UA 5EZSA 2PVCA 4U7PB 2GLUA 3KPJA 3LCUA 4L7VA 3FPJA 5E9QA 1R6AA 1X1DA 4M37A 5EMKA 1ZGJA 1JG3A 2QY6A 3T7SA 5BXYA 3BGVA 1G38A 3VC1A 3AY0A 4C06A 1JSZA 1ORHA 2NXJA 3EVFA 4KDRA 3SXJA 5CVEA 3PLAE 2PV0A 1RI5A 3C6MA 5EOVA 1JR4A 4PIPA 4YV0A 2ZZKA 3TRKA 4FSDA 1SQGA 5DXJA 3UJAA 2IH4A 1WZNA 4LWPA 4ER0A 1YUBA 5EHIA 4U7TB 5GM2A 3A7DA 4JXJA 3EEOA 1WXXA 3NDJA 3IHTA 3GRZA 5M5BA 3CGGA 4QQKA 3NMUF 4BLUA 1EJ0A 1JG1A 3FYDA 3G2QA 2HNKA 2CKDA 3B5IA 1JG4A 2PXAA 1L3IA 1YFLA 5GWXA 3PS9A 2IGTA 2O05A 2P3LA 2ZBQA 4Y2HA 5E2BA 3UWPA 3H2BA 3OU7A 4V0RA 5EMLA 2B9EA 4LG1A 2ZLBA 3A26A 3GU3A 2AOUA 4C03A 1Z3CA 2ONYA 4KWCA 4WVLA 2P3OA 1HNNA 3FPFA 1D2GA 2V74B 2VP3A 3CJTA 1NW7A 4IV8A 4AZTA 4QPPA 3C3PA 4ZTBA 1QAQA 4KW7A 5KS2A 2EX4A 2JHAA 2VDWA 3C0KA 4KRGA 5FCDA 3DXZA 1KR5A 3TLJA 3KPWA 3OCJA 4E33A 4YUYA 3HNRA 4X60A 5CD1A 1FP2A 3GGDA 3EGEA 5B1SA 3ER8A 2DULA 1AV6A 4R6WA 1NW5A 4K6MA 4E2YA 3EMBA 4FZVA 3GRUA 4RTRA 4FP9A 4FR0A 3C3YA 1KIAA 4GOMD 2C7QA 3Q87B 5LQNA 3ELUA 4GC9A 3UJ6A 2PX2A 2G70A 1L3CA 5T67A 3G89A 1X1AA 4GEKA 4XCXA 5E9WA 2ZWVA 1RI2A 4F84A 1BKYA 3DULA 2AVDA 8MHTA 1R18A 4BP1A 1I4WA 2OXTA 1FJXA 3LL7A 2I9KA 1SG9A 2AOTA 4BP3A 2F8LA 1MJFA 2V7EA 3B3FA 4QVGA 1XCJA 2C7PA 5FHQA 2IP2A 3BWYA 1WG8A 3UJ8A 4PWYA 5LSAA 3R9XB 4RTMA 10MHA 1JTEA 2PY6A 1QAMA 1Q0SA 3KQMA 5DT2A 3VYWA 1O9GA 1ZQ9A 3KQOA 4RTSA 1RJEA 3ER9A 1I1NA 3NVKI 3TR6A 3DXXA 5P8WA 1KHHA 1D2CA 2FK7A 4M7RA 2IDKA 3GO4A 3R24A 5DM2A 1N7JA 5EKXA 5GP1A 5H02A 3RW9A 1P1CA 3LKDA 3PT9A 3T7RA 2PXCA 4R05A 4EVIA 2IIPA 3G2PA 3UA3A 4F86A 1FBNA 1WY7A 5D1HA 2AOWA 3G5LA 1EQAA 2JH9A 5E1DA 3A25A 4RTOA 1KPIA 3KQWA 2OKCA 5K09A 1XDSA 1JSXA 2PT9A 3NWBA 3PVCA 1KPGA 4HTFA 4DM3A 2IH2A 3BKXA 1YF3A 5E1BA 3FTEA 3OPNA 2DPMA 5K0BA 5DX1A 2R6ZA 3IV6A 5D1NA 2G8NA 2OPBA 3ME5A 5LQAA 4PCAA 4C07A 3P2KA 3G2OA 5GINE 4GF5A 1ORIA 5FA5A 1P39A 1D2HA 3SM3A 3THSA 4EK9A 3L8DA 1ZHFA 4X61A 5CVVA 5EEGA 2AN4A 1VP3A 3CC8A 3KR0A 1IM8A 2EFJA 3E05A 5KVAA 4POOA 4KDCA 2ZW9A 1HMYA 5FWAA 5FQOA 2QM3A 5HFJA 1SKMA 3E23A 3NW9A 2FK8A 4PYLA 3KR1A 4OQDA 1Q0TA 4GBED 2YVLA 4AZSA
chains in the Genus database with same CATH superfamily
1EVZA 4KOAA 1KK3A 3VYVA 4JBXA 3BB3A 4HX9A 2R6DA 1K92A 5GONB 1EA7A 1T2EA 1LPAB 4YMIA 3WLKX 2VBIA 2POQX 4H16A 2E55A 4QHTA 3ZQ6A 4E1VA 2FG5A 1JEYB 4Z53A 1SD1A 2E2WA 3OOSA 2OORC 5JS2A 1X77A 3GY0A 4UNSA 4XWKA 3KR9A 1GARA 1S8FA 4KFTA 5ENZA 2IY7A 3IKJA 3M2TA 5CM9C 1A2BA 3SYTA 3PR2B 4PNZA 4QU0A 1XZFA 3PTLA 5CAEB 3L0CA 4CJXA 3IHKA 3L8YA 5C8VA 1IWPB 2Q7OE 3EZFA 3VDXA 2VUUA 1C3VA 4UMEA 3M4XA 4B7CA 4YRMA 3KYCA 4GKVA 4GVPA 5I5EA 4G86A 1CD5A 5KKNB 2I2CA 5IVHA 2GLTA 3RWOA 1Y98A 3FYCA 5DM1A 4IIJA 5KNDH 1N4DA 2EG5A 2OV4A 3HSSA 5EHXA 2HCNA 3AKEA 3ROPA 1EE1A 4YJHA 1G8KA 3V4FA 4UCXA 3ENVA 4QOHA 3LPAA 2Q5QA 3D6JA 4KIFA 2FNAA 4H7PA 3KEFA 4HQFA 3DOOA 1TW2A 4MS1B 2CE2X 1FFDA 2FRDC 3AW8A 3AZPA 1TAHA 3CE6A 1J0BA 3IHLA 1C9YA 3G2KA 3EVEA 3KS9A 4RIIA 2MSCB 1P72A 1U1FA 5F1KA 5DP2A 2EYUA 3D6UA 1TI7A 4DBZA 4EENA 1KH3A 1SCIA 2RJNA 2HGZA 4ZAWA 3GJ7A 2YOFA 3BD1A 3WGVA 3MWEB 5ICEA 4HAXA 3HKCB 3D3JA 3T1TA 4JKYA 4JT8A 4AM8A 3RT1A 2P1RA 1HLFA 4QUBA 3KSZO 1T9AA 1TVEA 3DBRB 2QZ9A 4OX9Y 1O89A 3T3IA 3M3HA 4TXLA 1AV7A 1EDBA 4GM1A 4AP5A 4AS2A 4D1YA 1QBKC 2JS7A 5ED4A 4E94A 1EFPB 4MDYA 2AMFA 4HWSA 4XVHA 1J7KA 4OYRA 2CNLA 2C83A 2AQIA 2E87A 1L7EA 2HU5A 3P2JA 3PC8C 4PHTA 4QPCA 5KYTA 1CF4A 5DV9A 1A8UA 3FKSA 3WAJA 3GG2A 4UTVA 3TDNA 1U0LA 2JLZA 3RIEA 1DX4A 2PXDA 1XC7A 2BAGA 1PJLA 3KZ3A 3DM9B 1GGKA 1GADO 1NMSA 1XEAA 3EOBI 3AHGA 3IVMA 2DBRA 1HDRA 3NHSA 5D86A 2VP0A 5AQEA 5T4EA 2PEZA 1NVVQ 1NPDA 1JIUA 3QYPA 4N40A 4FXOA 4RY2A 2IDMA 3HDVA 1S02A 3FOEC 2C82A 3D5TA 2J46A 5EGSA 3WLOA 3DOJA 5A4DA 4QU9A 3S2FA 1PP4A 3VO2A 1KH1A 4OQXA 2JATA 3JZFA 2NO9A 1XWFA 3COVA 3F49S 1XJQA 1L5OA 3MSCA 1UDBA 1QIDA 4LMBA 7AT1A 2PZLA 3G1WA 3PGXA 3NHUA 4YUWA 4AZ0B 3R09A 1JIQA 1V39A 1RXCA 1N34B 1NJ2A 2PUAA 2VF8A 2P41A 3HYLA 3OQBA 2FEMA 3S5JA 1J90A 3RKRA 5CA0F 2PXLA 1VMKA 1F4VA 4B3CA 1NVVR 1I0ZA 2I8LA 3KLOA 5D85A 5CBPA 1LQUA 1UBSB 4K9DA 5GIPE 1RC1A 1N2XA 5TNXA 3OPYB 4KO3S 3W05A 3BWEA 1QDLB 3R0IA 1IG3A 4MUYA 1AU9A 4NBUA 4UBKA 1SZCA 2P3QA 5KTOA 4ZI5A 4O2LA 1XEWY 2IF2A 1E4OA 2ODAA 3GDHA 2OV2A 3B6ZA 3LPMA 5JFGA 1PEDA 2DY0A 2VK8A 5JDCA 3O9MA 1O08A 4A8JC 2Q8PA 4ECAA 2P9EA 3PC2A 5JQWA 2XUHA 1O1YA 3TJRA 3NASA 4CDMA 2Q4EA 2QP3A 5JRZA 2RGNA 4IR7A 2C5AA 4M6WA 1U9CA 1YOVB 2G80A 1RKVA 2WSIA 1PRUA 1IQPA 3JSAA 3F46A 1NVWQ 4XCQA 1D0IA 1LPMA 2QX6A 2PRJA 3SE7A 2OHXA 3KKLA 3L46A 4KN9S 4V0SA 3THXA 3SIRA 1OYWA 2BLLA 3AR9A 4ZVOA 1UOOA 2CNBA 3EC1A 4ARAA 2D0OB 4BIIA 1P1RA 4KTTE 3SPXA 2PZBA 3SR4A 4PO3X 2AC2A 4JZYA 4LHWA 2KX7A 3QKIA 1I33A 5K98B 1BNCA 3SZMA 5IJ9B 4S1TA 2W6PA 4P0QB 5HZGA 3DVLA 4W7HA 4RABA 4B3BA 5BVHA 2EZUA 1FS5A 2HMAA 1Q83A 3H3XA 5DM0A 3VSAA 4N5NA 3K32A 1CLUA 2PO5A 2CDBA 4PN7A 1KMIY 1NFFA 2WY2D 3LC2O 5A5EA 1XCBA 1S9HA 4RETA 1GUFA 2E4UA 1GCUA 1ZUHA 3I2HA 1KZ4A 4GSYA 2Q50A 1PQUA 1KAEA 2M1XA 5DN6A 3IMGA 1U3FA 2VSOA 4C04A 1LDMA 2X86A 4AZ3A 4QG7A 4ND8A 4EKIA 3IRUA 1K06A 3EJ6A 3PL1A 4IVPA 4BXOA 1Z4JA 4JBYA 2HUPA 1XI2A 2CMHA 4IH9A 2DXIA 5K4GA 3ELDA 4J1XA 4FFRA 5FUBA 5ILQA 5F1OA 4P4GA 4UUBA 1N1GA 3FPAA 1VA4A 4U5XA 4QHYA 3E7WA 5F21A 2JGNA 4U6SA 4UE2A 3QF4B 3RHSA 3TEJA 2WAAA 3IC5A 2FWAA 2CJPA 2Q5FA 2FCRA 2REBA 2LE0A 1TRHA 4P6VF 3QLVC 4G67A 2A0KA 5F3DA 3WJAA 4YEDA 2QMUA 3V1MA 3K0FB 2YCLA 3DE6X 4C4SA 3NBUA 1QMPA 5C0OE 1JKMA 2A1IA 4WXHA 4R3UC 3GVCA 3B60A 4WJLA 1P7VA 3ZK9A 1VG0B 2ZPUA 2FJPA 5ALRA 3WLAA 1RT9A 3UW1A 1L1QA 5ITSA 4KJZA 1DU4A 4K3VA 1ZG3A 1T3TA 2HF9A 3J7AC 1ZEMA 5JRJA 3CKLA 3RT9A 3TRIA 1Q17A 3DZKA 2EEZA 1E9VA 5KYUA 3PLAE 2YWDA 3WISA 4PIVA 2EFHB 1ULSA 2OYRA 4XX1A 3WTCA 3G5TA 4LHXA 3PUJA 1O9BA 1P61B 2YMMA 1P2GA 1FYEA 2VF4X 4LCBA 5EJ8A 2UZ4A 4OMDA 2J3QA 2QVCA 4OXIA 5IUJC 3CGWA 5IVPA 1USWA 4RLQA 4S12A 2P6MA 1A9ZA 1ONPA 1CEYA 5LOVF 4UUPA 1E2NA 3VM6A 5JC8A 1RYNA 2AJBA 1JDNA 3OZVA 2SKCA 3PXXA 3BD6A 5BSRA 4B3HA 2JCSA 1PU2A 2CWDA 5BW8A 2XUJA 1AX9A 2X5XA 1L4KA 2FN7A 3JASB 4TWAA 4ATNA 4EDFA 4HYYA 3HY6A 1ZCZA 4O8ZA 1UP7A 1JTFA 4MRAA 3ZS8A 2HGSA 1OY1A 1YFZA 4DLTA 2HA7A 4M36A 2B3TA 4C7XA 3RRJA 1CY6A 3WGJA 2KEKA 3PXEA 1ZHHA 3F7NA 3LYAA 4U2GA 4AYTA 3GNQA 5CVDA 4MWDA 3PE6A 1Y1SA 2BEVB 4HLCA 2RGAA 3WYAA 4L08A 4MV6A 5EE9A 1BE6A 2FPPB 5JNUA 2QRVA 3EZ9A 1T5OA 2HL6A 2R6GA 5LZ7A 1J9ZA 1O8CA 3DONA 4ZQGA 1R5OA 2WJIA 1CR2A 3LHIA 2GBPA 1IY9A 3QWGA 1DG1G 1LI4A 1JSCA 1PGNA 3B7WA 1V5FA 3JARB 4QQRA 3X2EA 2ZATA 4OFWA 3VR1A 1BHO1 1KOJA 4RTJA 3BGOS 4R40A 2B7BA 1CUDA 2HADA 4IVZA 2J5KA 1LNSA 2GQ0A 4ZVQA 2B7LA 3NT2A 1RHRA 5BSUA 3SU8A 5MF6A 4HBGA 3LZDA 3OZIA 4IVRA 1QNFA 3PXPA 2H63A 3FDXA 4FOSA 3PUKA 4QNMA 1YC2A 5HR5A 3K1TA 1O8BA 2RHBA 3ZVNA 2YFYA 3FLMA 3HM9A 3U3ZA 2XW6A 1QX4A 4FFBB 2OC9A 4Z54A 2CMGA 1ZO8A 4DIKA 5E0KB 4YVFA 2QBYB 2AN1A 4ZV7A 2YH2A 3KJNA 1OBOA 2P2GA 1G9SA 4ZQCB 1OGJA 4CFSA 1GZVA 3E3AA 1MEJA 4EX6A 1RQ2A 1UBJS 5HZMA 4ERXA 4AJLA 1R9NA 3BFKA 3F6YA 1ZI9A 2GX6A 1L4UA 4ER6A 4E3WA 1AT1A 2HBRA 1MX1A 1UWKA 2PZMA 1OA0A 4GRDA 3DHYA 3EW9A 3HWX1 3M7IA 4LI0A 2AC4A 4UHKA 1DEOA 1SHKA 3P9IA 3T1NA 3V7NA 3GN1A 4GNRA 1DUIA 5LBIA 3OCVA 5IYZF 3X44A 2G4LA 3C97A 3EUWA 4A4DA 1FP6A 1J7JA 4N3CA 3WRXC 4AAYA 2O06A 2VYND 1M54A 4XJVA 1YZQA 1KDZA 3GP3A 2ZB3A 4OA5A 5K3FA 3V34A 3MOSA 3LY5A 3ZKWB 2K7FA 2IYZA 1NBWB 2Y0PA 1VGRA 2PL1A 5DHRA 5FQNA 4AMYA 3ONFA 3GFQA 4JMPA 2ZWMA 4WESB 3GOQA 1CEXA 4HQKA 1YJ5A 4OM8A 4QM7A 1P44A 4MWSA 3PEFA 3KZNA 4RVCA 3TI7A 1PT7A 3FPBA 1H3NA 2ZZMA 4IX1A 3MQ2A 4ZK6A 1NPTO 1PKXA 1U1DA 1NQXA 1XE3A 2AFHA 2G3YA 1ID1A 4J0HA 2QN2A 3LDAA 4HQ6A 4ZODA 2BFAA 9LDBA 3FR8A 2VHWA 1NEQA 4MRVA 4N9WA 2LCFA 5I8WA 1GGHA 2A7QA 1DT3A 3E7DA 5D00A 3P7MA 1OTHA 3PGKA 2J3JA 2BP7A 3AF1A 3K92A 1ESZA 2GN2A 3DZJA 2N3ZA 4FNOA 3WL4A 2PXEA 3AR6A 3DOHA 5K6RA 1DQNA 2YXEA 4CN8A 1JR3A 1KSHA 2P62A 1CJSA 5JTTA 4EX7A 4AECA 2W2KB 1X1DA 1CY0A 3B5EA 4PFSA 3A1VA 2E1RA 2ACWA 4NK4A 5L45A 4IXNA 3PX7A 3BZWA 4K87A 3C1TA 2FFBA 1Y3IA 3PXBA 5CH3A 5AYVA 4JBGA 3R5KA 1UC8A 1R0RE 3H2SA 5HCNA 1T2FA 1AMNA 3N59A 1ECGA 2YYYA 4Q9IA 4ER0A 2FPPA 2GJSA 2HJWA 1YUBA 1VRWA 2WD9A 2ZTLA 4NCKA 4OSOA 2OV3A 3L7AA 4IRUB 3THYA 3ZGYA 5LNK6 1Z0DA 2CBZA 4UHHA 3UC5A 5I6DA 3NMUF 3O2JA 1X80A 2WSMA 1VM6A 1VOTA 2AGVA 4BLUA 5INTA 3OC0A 1IQUA 4FHGA 4MUMA 2CE7A 4PSKA 3T35A 1Z88A 4XYGA 3JRXA 2Y2VA 3QVGB 3B1WA 4OHCA 5AM0A 1OIVA 5CLHA 2FPUA 2FKAA 2PMCA 2YMPA 4UQPA 4YRLA 5HVNA 3OSZA 5GWXA 3W5CA 3TE6A 1YFLA 5AW8A 2O05A 1FPMA 2JLCA 1Z2AA 5CX1B 5F3RA 3VZPA 3ZS9A 1KMHA 3AINA 5AJWA 1DQRA 1SULA 1NJ1A 2OG2A 3JCZA 3VPFA 2YC4C 1CEQA 5DW3A 1KMCA 3G49A 2JZCA 1X7GA 1UANA 2WM9B 2HXYA 4JS0A 2GEBA 2HZ7A 2BGNA 2OA0A 5LYJA 5ALIA 1S01A 5JSQA 5F7JA 3G0HA 2P6OA 3TW6A 5TV2A 4MYCA 5JNWA 5BQ3A 2PKEA 2GFIA 1GZUA 2IJGX 2R1ZA 4WUTA 3RTDA 2Q9UA 1MA3A 1R4NB 3QMPA 4M1YA 1M2VB 3IQHX 4P3YA 2WTMA 5B1SA 3WMXA 1B1CA 1KI6B 4M49A 4D9CA 5JSFA 1QM5A 4L15A 3AILA 1WCWA 2O7NA 4NOMA 3U3RA 4GOMD 2PXPA 1E9AA 3K8ZA 5CDFA 1Y89A 3CCBA 3A6FA 3AUTA 3ZV7A 1AA9A 1SHLA 1XPJA 1YZVA 2I55A 3NATA 1N7GA 1P74A 1LJ8A 2VAWA 3W2EA 2ZUFA 3CH6A 3GFSA 1WSBA 3C8ZA 5K5EA 3NTQA 4AICA 4DSNA 1A77A 5EWMA 1RI2A 3NBFA 4X6UA 1FEZA 4FZ3A 1WETA 2D5IA 4UU1A 4DCJA 1R15A 4KGDA 3VYUB 4JC4A 3GLHA 2NUPB 2V7EA 3A28A 3CQ9A 3KEOA 3P32A 1E6MA 2LGJA 1ONBA 1MTOA 1A88A 3VU9A 3TRJA 1KDYA 1PG2A 1A50B 3FBTA 1RKUA 2QRUA 3IJ5A 4W7IA 3UWOA 3VHXA 1YTUA 3KQOA 2WFAA 1I1NA 5JH7F 4TWRA 1W5FA 1KHHA 3S44A 1D2CA 3LVQE 1E79A 2IDKA 3GO4A 3TQOA 5GP1A 1N3YA 1QB7A 2AA3A 4OEHA 3L9WA 3WO1A 1A8IA 4JQDA 2E49A 3VDMA 1RNLA 2PXCA 1PWEA 4PAWA 2QBYA 3Q9NA 4URVR 2HCTA 9MHTA 3GRAA 4ZARA 2EKBA 1NZFA 3NBMA 3RYFB 5CG1A 2D6FA 4HQLA 2OAQ1 4IJWA 3I72A 5FUYA 1KBOA 3SICE 4U6NA 2CVQA 2V6IA 3Q8LA 3P0FA 1Y9JA 1XL0A 1JSXA 1ST2A 4ZJUA 1JG7A 4RJ2A 5BVHB 2AZXA 1QO0D 1FXSA 1PHPA 3ZIAA 4YI5A 1G3RA 1PZEA 4V03A 4CG0A 3IQEA 3RKUA 4D9KA 4ZDJA 2G8NA 5KWVA 1D7OA 2EQAA 1RLJA 2XMSA 3VR6H 5BV1A 2FJRA 1ADYA 1U1EA 2JI8A 3B52X 4AU1A 1PFKA 5D6OA 5JNTA 1V6CA 4KIJA 3WGIA 3QPWA 4AULA 2K5UA 5AKGA 4X61A 4K6HA 4B2PA 3RVSA 5I9MA 1T91A 4ZYVA 2HFZA 1Y1LA 3TQCA 1CT9A 3OOHA 2FK8A 2WWIA 4PPGA 2H52A 4C3OB 4GBED 4BUJA 2GEDA 4COKA 1OSNA 4IXWA 3PD0A 3AKYA 3A9CA 1GNTA 3ONWA 2Y1GA 4LECA 1XP5A 1RI3A 4G4SO 3QW2A 4QVIA 1GTVA 3W7BA 4Y2XA 5FEUA 2WG1A 3JXEA 4L4YA 1SJ9A 3KLNA 4QTXA 5LYJB 2R48A 1L1EA 5ESWA 2GM5A 4BNJA 5ED0A 4O4IA 3HADA 4UNNA 2YN0A 3OZRA 3JQ9C 4V3CA 5EFOA 4WRRA 3SGLA 3CRMA 3OTHA 4M8IA 4NV0A 2ZZNA 1HQYE 1GGVA 3FHTA 1EFVA 3OZCA 5T8KC 1V71A 1VMDA 3K15A 4ZV9A 2YUIA 3QUAA 4CI9A 2EGHA 3H05A 5CFZA 3BBPA 4O63O 2PGAA 2WQZA 4FMCB 5IJXA 3HJNA 4B3JA 4UM8B 4F4CA 4CMEC 1WBBA 3MCUA 4KMSA 2E4YA 1QP4A 2ZRMA 3V7FA 2H2DA 3E9MA 2Q4TA 2VK1A 2YWEA 1H2HA 4H15A 3UOAB 4YJFA 5E8RA 3Q8XB 3N8KA 4O2BA 2C5EA 3EIEA 2XSZD 3N1UA 2B34A 3FUXA 3THYB 2XNDA 3UJ7A 1G1AA 1RHMA 2VUTA 3I53A 1WIZA 4NYMQ 4B7UA 4KXNA 4LHZA 1WMFA 1OFUA 3IDOA 2P7IA 3ABRB 2JGKA 2D59A 2V96A 1Z62A 2BM9A 2QTMA 1YK1A 2LKDA 2WF8A 1NP7A 3CLRD 3GIWA 3JQCA 3L43A 1T35A 5DHUA 4CKBA 1Y5MA 1JP7A 1O2DA 2DFKB 2FMXA 1D0SA 1TA0A 2NGRA 1JIVA 3K70B 2DPXA 1HPLA 5JLAA 2R66A 3FTNA 3BZUA 5FNVF 3EXHA 3DMTA 4BNKA 2HAEA 2X0EA 1KSGA 1GU7A 1ZITA 1UBFA 1C3LA 1SU7A 1DIRA 3QENA 3DTNA 1G5FA 1U7HA 3GBPA 3M1IA 5KQSA 3MEJA 3F9CA 2IS6A 1L2TA 2XJ4A 4P81A 4FBMA 4D4HA 4INAA 3QWBA 4P32A 5E3IA 3WADA 1T8PA 1Z0FA 4IDOA 1AGPA 4BQPA 4UM5A 5ITWA 2CNWD 4JI7B 3K3PA 3CO5A 4H4EA 2I22A 2P0EA 5LZ8A 2Q1TA 4LF6B 1PZHA 2WJWA 1M5RA 2WYVA 4NXNB 4OP3A 2PXUA 3GUCA 3H86A 1L1FA 2NWQA 1YDMA 2P40A 4HG2A 1L5KA 1HL3A 2HREA 4OB8A 1Y5LA 1NVEA 2QI9C 1W76A 2XB8A 1Z22A 1U8EA 1ZCJA 4N03A 4BN0A 4KO4S 4B40A 5ICCA 4X0EA 5C34B 2DUUA 2VJCA 4AUKA 2VJOA 5AM3A 2Q3CA 4PU8A 2JHCA 3Q3CA 4E5NA 4ARSA 1RTTA 3E48A 4IDFA 4JOBA 4N4AA 4ZI3A 3H6HA 2G83A 1M3SA 1U28A 4G09A 4I1UA 1ADGA 1F1JA 3TQQA 3MJ4A 1DCKA 3UTDA 3W06A 5LQDA 3TLGA 3HYTA 1TYBE 4NE2A 2XUFA 2E4XA 1I6LA 2Q6VA 2QZPA 3H87A 3IUQA 2OECA 4X4DA 3W2IA 3ZTTA 4KNVA 3IP8A 2OGTA 5I9BA 4CF5A 1HSOA 2IVQA 4TZTA 4KQCA 1IBRA 2CYAA 4AZWA 3SS7X 3AYZB 2Y2UA 1O94C 5F4ZA 2P67A 4YLGA 1B8OA 1HLGA 3WX0A 3QFHA 1C30B 3WNCA 1D4FA 1MA0A 4JL8A 4AO6A 1X7WB 1RYBA 3ROZA 2HHHB 4HXFB 2C9CA 2ZVDA 4LTDA 3SYLA 1RI1A 3JXBC 3K9WA 1WVIA 3N76A 3S8MA 2I6UA 4C08A 4BQEA 2YKGA 3ZDXB 2BKUA 4PHFA 3U5TA 4M76B 1NVMB 3BSWA 4M1MA 2ZREA 3NT5A 1P5JA 2IOYA 2VNSA 2W6ID 4IZHA 3RWMB 3ZTYA 5BR7A 4WN9A 2KI5A 3PKZA 3RJZA 2DB3A 3AOEA 2VFAA 1S1MA 4IDDA 1LCDA 1AMUA 1OFHA 2CDNA 1PG0A 3P9XA 4MKFA 1L5LA 5IXYA 4C0SA 4ZCRA 1UJCA 3DP7A 1UH5A 3BRQA 3Q6MA 2VK2A 5DRTA 2EWVA 3AHCA 1M73E 4QTTB 1M74A 2BI7A 2G4CA 4LK3A 4NE9A 3DVAB 1DIBA 4UAJA 2QLLA 1U0JA 4JLDA 1JA9A 2FW0A 3O5AA 4Z5XA 4Y9DA 1ULBA 2IYFA 1ISIA 3P9KA 4HFMA 1A9PA 4QDTA 4QOEA 5AFSA 2IPOA 4I19A 5F9MA 4DBVO 4IHKA 3KKPA 5FULA 4YPOA 3N3AC 4JR2A 1FDRA 1YI0A 3PFIA 5IFLA 4AJHA 4DMHA 4YRZA 5CVUA 4FS8A 1E2KA 4P7BA 4BIMA 5L4NA 1YJAA 4UM9B 2QD3A 2RAVA 3Q72A 3K94A 1T8YA 2B4KA 1UK7A 3HDHA 3KBBA 4EFMA 1B74A 3HA2A 3QLUC 4L3OA 2W8BB 4M8SA 5JZBA 5KPDA 3JWJA 4KRXA 4J16C 1K6EA 2X0FA 2F4NA 1CNEA 3RYIB 4AURA 8OHMA 2FR8A 2M6LA 3TOVA 4KJXA 1ST3A 3PFFA 3MA0A 3B36A 1AKQA 3HBAA 1CUJA 4XOIA 2WSSD 5E7MA 3KM0A 4OO3A 2EATA 5DHSA 1RMQA 1Z34A 1Q1EA 3A11A 1AGNA 3M6MD 4EYQA 2HSJA 1QHNA 2VS1A 2Y68A 1LBQA 3SE0A 4BV8A 2VRCA 4O3MA 5D84A 3HKEB 1BRMA 2RGBA 3FM9A 5DBEX 3USCS 4EWLA 4MULA 4B3GA 2WOOA 3O7WA 1ML4A 1W35A 3U39A 4TV9A 1RLTA 3CVOA 3UGQA 1NYLA 1V9LA 3A05A 3GHYA 4IHQA 1UXCA 1YDEA 3DL2A 2FOXA 4LPKA 3Q10A 4MH0R 1SBYA 3TNDA 1DRWA 5KTNA 1HNZB 3T12A 3ICPA 4F46A 1PGQA 5AJUA 3LPCA 1UXKA 3DNFA 4B0OA 5LQCA 1VGQA 2I4TA 2C8JA 2Q1SA 1K4KA 2PUTA 3QU2A 4N12A 4JLJA 1ADRA 2DBVO 3H0KA 1N8SA 3O8DA 3QX7A 3RQIA 1T9CA 1RYEA 5CK5A 5KSWB 3CW9A 3LBAA 4YWHA 2WHEA 1BYIA 3IBSA 1DDIA 2CZGA 2GPNA 4FCVA 1H6DA 3V1KA 3DMNA 3CLTC 4I6EA 1N6NA 5K8JB 4YFVA 2WUFA 2H7XA 1WQ3A 2NOAA 2IIVA 5GQSA 4BMDA 2R11A 2J4DA 2XYRA 4S1PA 3HXMA 4MAMA 4BVLA 5AXDA 4RD1A 4Z4GA 1JEJA 2BN4A 4D74A 2I7TA 4G01B 4O5OA 4HGYA 1FRFS 4EHKA 1S9DA 1OBFO 1GPYA 1N5JA 1TCBA 3QKRA 4FW8A 1KK1A 4K8OA 4UCQA 3ZWAA 4DIFA 5L3QB 4L6IA 2QVBA 4YONB 4YG7B 1ZGAA 3RK0A 1CUBA 1RZSA 1MT0A 3TBFA 2GR9A 1B8PA 1TB4A 3KBOA 2CCKA 4TYMA 4WOBA 4B2LA 5EIAA 5CXUA 4X90A 3K5PA 1WXDA 4OHVA 1G8SA 1SOWA 1SVOA 1WM1A 2GFQA 1RXYA 3H4TA 4U2DA 4ZVLA 3DAFA 4NWIA 2PLAA 1J21A 3VR6D 3JAWA 5JHGB 4CL0A 2PUBA 4R9NA 2ZSKA 3E53A 3Q2KA 1YOVA 4IDHA 3MC1A 3K6JA 5T6MA 3Q7EA 4HB4A 2ZT7A 1Q6YA 1SOAA 1TM4E 2BT4A 4M99A 4E5MA 3MUOA 5CJ2A 4KUHA 4DF3A 4RVGA 3P1JA 3VHLB 2CL6X 2GTPA 3B9QA 4MPTA 1QVZA 3CT6A 4LJRA 3KOUA 5EIFA 1TK2A 1L8LA 1R0CA 1RZVA 1JDBC 1RXSA 1VIDA 2O0JA 3QHAA 4GLBA 4H7JA 5EKSA 4BNZA 4BU1A 3R9XA 2PSHA 1YJ8A 2GZAA 1RWNA 4GFDA 5A4IS 2A86A 2WP8J 2ZRGA 2GSDA 3C70A 3FKJA 1GNQA 2ZUCA 3WA7A 3AM3A 5EQTA 1ZD1A 2OBLA 2DHCA 1JJAA 3A1TA 2O8NA 4LX8A 4BWYA 1OYOA 1QDEA 3OF2A 2M32A 5FOWA 5BP7A 1N5RA 1IJBA 3UJ9A 3TVTA 2DMRA 4A6DA 4DZRA 5E4FA 1H0RA 2MSDB 4RO0A 1XAHA 4XD2A 5FXMA 1S5PA 3BMXA 2F64A 1N6RA 1HT3A 2AD1A 1SD2A 3B70A 1OV4A 3EC2A 3RASA 1SEVA 3VR3A 3LLMA 1E79D 3ELBA 2BEKA 1PVOA 1CHNA 1YJXA 5TJHA 2PJDA 4H77A 3HO8A 3RS3A 1KY3A 1E58A 3LOUA 5K6AC 1P9NA 2B9VA 4OXNA 3THWA 4OLJA 4Z8YA 2GUWA 3M81A 3H4MA 3TH5A 4I8XA 1GV0A 1N9GB 2QE6A 2V7WA 4WKCA 3CMCO 1G8YA 4ZCIA 2W0MA 4KQMA 4R2MA 3T34A 2ZWPA 1IOWA 1JECA 3HZZA 5JROA 1KZ6A 5B3JC 2ID4A 2W98A 3QF4A 2WIGA 4Q7EA 2IYRA 1IJEA 1DDGA 2JNWA 2UUOA 2VWPA 3GPBA 4LRWA 4O1HA 3T5DA 1OF1A 4HDNB 4CU2A 1NF9A 1MNQA 1VG9B 2NZXA 4JLPA 4Y1FA 3HHEA 1G3UA 3HXLA 3BX1A 2JK1A 1TW3A 3CVXA 1QP7A 4YRQA 5G53C 5KJ6A 3D0QA 1RRVA 1LVHA 2D4HA 2XMRA 3D7KA 4BEWA 2Q27A 3FPJA 4W1SA 9ATCA 4CIWA 1XAGA 5TQ0A 2RHWA 1G291 4IGKA 5E4TA 4EHFA 4ES6A 3PEWA 3TD6A 4F1JA 3ZK7A 3SZ3A 2HH9A 5EKDA 3GZCA 1USGA 3MMXA 1DULA 1HY3A 4UUQA 5IKEA 2ZZKA 3TRKA 4O5AA 2XITA 1AGRA 3V4LA 3MUFA 4NMLA 3GFGA 3SC2B 3QLEA 3STUA 3FYUB 1LRLA 1SBNE 2W58A 2QROA 2SCUA 3G7NA 3IHTA 3FVQA 4LOAA 1GP2A 3KOMA 4PQGA 4WY5A 1D6SA 2W2TA 3SHWA 2C7BA 3NC4A 5B7QA 2WB2A 1RRPA 3JQ6A 1UJ4A 3SFVA 5EIXA 3HH8A 2J0QA 4A10A 3IKVA 5J4YA 5CX1A 3ADCA 1T5IA 1F9AA 2GD0A 5I9NA 4MGHA 1J0AA 1WPQA 3PR1A 4YCAA 4MP8A 2X1HA 1TJ4A 4UHDA 2WLTA 3I42A 5FUXA 2BC9A 2R1UA 3P4XA 1L7MA 3ZV5A 5K0ZA 2QVXX 3DC2A 3NGXA 4CMGA 1KSFX 2H92A 4TT8A 2QSUA 4QFCA 4AJ1A 4RFSB 1Z3CA 1GA6A 1L7OA 5IASA 4TMVA 1FX0A 3LX8A 1ZMTA 2V74B 4CLRB 2RAFA 3EVNA 4E1AA 4GRAA 3W8RA 3HRIA 1P9OA 1RWXA 3CIFA 1SCDA 3M82A 4HLUA 5JS8A 1HGXA 3DXZA 1W2HA 4RLSA 4NS1A 4C7JA 1PR6A 1V45E 3WLPA 5HRAA 4IM7A 4X60A 1G66A 2W22A 4AP9A 4HQ0A 4JVMA 3SDSA 1NRIA 2IVFA 2VCEA 2Y9PB 3E9DA 3G59A 1RPJA 2DULA 3IAM6 4IDAA 2KLHA 1ADBA 1K8RA 2Q5JA 2W83A 3BE4A 1R0YA 3KXLA 1MO6A 3O8CA 3U49A 4I4TA 1VDMA 2O2GA 5CBKA 3NRCA 4PO8A 4L9AA 1Z5NA 1DXYA 3ZZNA 4B2YA 2H3HA 5TGTA 3OA0A 1L3CA 4HV4A 1YA4A 2X1MA 4QTZA 5C8XA 3V46A 5EIEA 3WB1A 2Z9DA 1W8IA 3G2LA 1E2PA 4CLDA 1I4WA 3F3KA 2I9KA 2C7VA 3ZYZA 1BFDA 4B4KA 1ND5A 4KQ2A 4HJRA 4M0KA 4REOA 2CXQA 3NX4A 4NZMA 1H4VB 1PUXA 5K1ZA 3QJ5A 3WL7A 2J3IA 4CPDA 1J06A 1D7AA 4ZANA 1Y4AE 4UTNA 2C29D 5ALOA 4ZMSA 4GDMA 1Z75A 1ONNA 2QAGA 1XELA 5B2EA 1XMPA 3C4QA 2WINI 3TZQA 1TF2A 1Q95A 1C1DA 3OPVA 2OZLA 1PX2A 3SY8A 3EA0A 4URWR 3RTGA 4BFWA 3WIOA 3O9VA 1A72A 4H9GA 3UA3A 2G77B 4BNUA 2AYZA 3KALA 1DC3A 1Z2CA 3JTEA 4H31A 1X7XA 1IUPA 4C30A 4CODB 2UXBB 1YQTA 3PSAA 4LMRA 5CG2A 2X0KA 1TLTA 3OO1A 4JUCA 3STTA 3UJHA 4W8OA 4XGRA 2PT9A 1VMEA 1EEXB 4FFWA 3OUZA 4DM3A 2O7QA 3CPJB 4LRTB 5E1BA 1EFPA 3ETEA 3D8TA 5G40A 4JI4B 3HO1A 1SOVA 5DX1A 2D0IA 1UIMA 3BHMA 1F5SA 4GE0A 3AVUA 1DKLA 4IBOA 3T9CA 5TMBA 1M2WA 2GK6A 4BMPB 3L4BA 2J48A 3MEQA 2DR3A 2CJYA 1OH8A 3EDOA 5FNVA 1SWWA 2CUTA 3MJCA 4ENUA 1DJNA 3E05A 1QGED 5CHEA 3AEQB 4YC7A 3QKSA 2EJVA 2R79A 1RQXA 4NABA 1VSQA 1QZTA 2O4AA 1UCFA 3LU1A 4PZEA 4ZI2A 1G0OA 2UZ1B 3E8SA 2DHDA 3DDWA 3FTCA 4HZUB 5FYDA 4CKEA 4ENQA 1QIFA 5LP6A 4GLLA 2J9GA 3UB4A 2GCGA 4O0LA 3LUFA 4S1NA 1I6WA 4D4IA 2Q5IA 3WXBA 3USES 3I28A 1R5NA 4UEOA 4A0HA 1U31A 1M1NB 4G5QA 1KKLA 4EKDA 3C6XA 2F00A 5AXCA 4L5YA 3WAKA 4XSVA 2BJCA 1BCSB 1K5PA 2CFTA 3CF6R 4M21A 5K0LA 3U40A 4CE6A 4CCYA 2G5CA 2O0MA 5JECA 3O21A 3FVVA 1H8ED 1ISMA 3PNOA 4XLLA 2FOLA 1OKKA 2RC5A 4TKUA 1W94A 4Y67A 1A9XA 1VZ3A 2JFXA 4CKZA 2RIPA 1MB9A 5JQGB 1ZUGA 2OEPA 2YJGA 2YWJA 4JJFA 4KYVA 1Q91A 1N36B 2Z56A 4CQMA 3H75A 3A1UA 2FP4A 4J3NA 2FW9A 1QVWA 3FCUB 3PENA 4XRGA 1H1TA 3HMKA 4UHJA 5JNVA 4KXUA 1C3JA 4P34A 4AL4A 1USUA 2C42A 4KZKA 3MIIA 2O1SA 1AS3A 2IF0A 5JH7B 3R77A 4PZUA 4LSGA 5KOHA 3SQXA 2ZUBA 1M10A 2QYOA 2HFKA 1E9DA 4G56A 5ALVA 4AQYB 4P80A 4EP1A 1BHJA 4BMXA 4P3NA 2WU1A 5IYZA 1NE7A 4ZEOA 5ECYA 1M2GA 1IPFA 1W5EA 3IE2A 1TTTA 3GPIA 1M66A 1G2PA 4YMGA 3L0SA 5FADA 1X0XA 1XA3A 2CL7X 4LNUA 1FLAA 4EGQA 4PQRA 1IK6A 3BSYA 1GXSA 3AEYA 3GD7A 4KL8S 3CWCA 1H8HD 1X8JA 1H5NA 2G72A 5EQDA 4KB5A 3AVXA 3CMMA 2PGIA 2PN1A 3KZMA 4W7SA 1PJ3A 3AUYA 3HR4A 4PZ0A 2DT8A 5G4KB 1ODSA 4KXXA 2FXVA 2XDWA 3VJMA 5JT1A 3R9WA 3K5WA 5I8ZA 2Q21A 1H1DA 4Y7CA 1J20A 3HU2A 4NJMA 3ZWKA 4IGEA 1Y9DA 1E6UA 2J6BA 4MDHA 3FUVA 1IVNA 2ZB4A 3AG5A 1E20A 4NPAA 3I23A 4OUKX 1D2AA 4X3PA 3IVPA 3V4ZA 3RS5A 3A4IA 4Q4DA 3GEMA 3VR3D 5KNBD 2FW6A 2Y0DA 4R9VA 3EARA 4UBIA 3CX7A 4RKEA 1C7RA 4DYVA 1JZQA 4TTRA 4R7GA 1UMKA 5BUCA 3T9EA 3OLWA 2YFHA 5E7JA 1KSJA 4FFSA 3RRNA 1IL0A 1I9GA 1WMEA 3H1PA 4Q5IA 4Q7MB 3X1MA 4DA0A 3MBOA 3OFVA 4IY1A 1KYZA 2CROA 1ISGA 1LPOA 1XA0A 1U28C 2ONKA 3PFGA 5CRIA 2CLHB 5GGYA 4AY5A 4FS3A 5KQLA 4FWTA 1OX5A 4AMBA 3J81A 1I5RA 5LXTB 5HP4A 4YV1A 4JXKA 4LCJA 1QQ5A 2BEJA 1OH7A 5CVTA 1F0KA 1NW3A 1KAOA 1PJBA 2I1WA 3IJRA 3WDMA 1V95A 2V0CA 2H7VA 5G0SA 2QU8A 1EVQA 3MOIA 1E0DA 3H5AA 1YS6A 2YICA 1OU4A 3WOHA 2NO7A 3KT8A 3LD9A 2BNNA 3U56A 3IKMB 5DF1A 3QKUA 1SCQA 2VL7A 1MZPA 4BHTA 4QAQA 5A4FS 1VRCA 3GCDA 1ZCAA 3ISJA 2X3UA 3NJRA 2MT9A 1HDYA 3CF2A 3I30X 4D9MA 3GH3A 4C0JA 4J7UA 4PBSA 1YCHA 4JLSA 2HF8A 3JVUA 4RZ2A 4TRNA 3RH0A 2H2IA 1BQEA 1SKUA 2BGKA 3V5NA 3A4LA 4D8YA 4E07A 3OHPA 2XIQA 4JKOA 1E1LA 5C4MA 4X1YA 4QBGB 5JSHA 2WAOA 2X7XA 4N0QA 3VKFA 2P2ZA 5AIBA 3TLCA 2MSKA 2PUHA 1DUVG 2YXLA 4QYIB 5AVJA 2QXTA 4MQLA 2EBWA 2PU5A 3IOMA 3SZRA 3EGXA 2I29A 5FPTA 2ZAMA 1Z4LA 3MYYA 1NBHA 2AHRA 3U3OA 4B6FA 4YT4A 1YMQA 4CL3A 2HYDA 2EZ8A 4HC4A 3H2GA 4LY6A 4KR7A 1I7DA 4D2IA 4Q24A 4YJ3B 2XRMA 3RS4A 1O77A 4B6RA 3SS8A 1I80A 2IKQA 1W6UA 1E2BA 1D6MA 2GBIA 3FFWA 4XX0B 2OENG 3PQDA 1PZXA 1HDCA 3ZWMA 1MHTA 4PYMA 1VG1A 4GMKA 1ZD5A 4MB6A 2OL4A 5ESRA 1Y34E 3HBLA 4RNDB 4PX3A 1XJCA 2CNOA 1ZVKA 4F93B 3LC0A 3MJHA 2XDYA 4DQLA 3R3SA 2BEWA 3A36A 5EMJA 2O4UX 2RGWA 4EKNB 5HJEA 1B26A 1BZYA 1YB7A 2OMEA 3BFVA 2PIJA 3PNBA 1U7OA 2DLNA 4I6GA 3VDQA 2WJGA 2Q4RA 4RK0A 3UV3A 1EX7A 2EX0A 1APBA 5DIZA 5AW9A 5EKTA 2AFIB 2BMEA 2D00A 2W8ZA 4IJUA 4XTCS 2XDAA 3T3PB 4BYGA 1AKUA 4D0RA 1QOZA 4DCMA 2H1VA 2HFJA 3GUUA 4HDOB 2VDPB 3W3AH 3FYUA 1P6XA 1VMIA 1HDGO 1QZ3A 1Q1GA 1OH6A 1JDUA 5JMTA 2OB2A 2VATA 3Q3GE 4E21A 5BYKA 2QR3A 5AM4A 2RHDA 3MQFA 3N05A 2CYCA 1JL3A 4MWZA 2ZGVA 1IM2A 4W1RA 3WYNA 4IHJB 1MV8A 4XLTA 3EK2A 5LWQA 1ODJA 4NI5A 1ZX1A 1M6VB 1R88A 1V11A 3TTXA 4NZPA 3ZTWA 3NHKA 5C52B 4GO1A 2XWSA 1BFKA 2XCUA 4PW0A 3VSBA 3VR2A 3S29A 4D3YA 1ZLYA 3KC2A 1FOEB 1N6KA 2V7GA 3FIJA 2Q0SA 1RAAA 2IV7A 4JJIA 1FU7A 1W0KA 2PFKA 3PPIA 3GDWA 5BMOA 3CBGA 4TLMB 1CJMA 3A1NA 1UXJA 1I3OA 2Z6VA 3CB2A 3L0IB 4TM8A 4O4HF 1TGYA 4E14A 5JCXA 4Z59A 2C2OA 5HGXA 4CQJA 4HCJA 4R5HA 4URFA 2HK7A 3BRWD 3W1WA 4JJKA 3D3EA 4RVFA 3S1LA 2VTBA 2EKZA 4AZVA 4CKWB 1N5IA 1F2UB 2IZ0A 3F6SA 4JI5B 4F60A 3DLHA 1FVHA 1QCZA 4KXFB 4WY8A 3I8XA 4Z0TA 2EGUA 1Q7RA 1K0FA 2D1YA 1TC2A 2O2DA 2I7CA 3OBBA 4IJ5A 2OHVA 3LHSA 4HQOA 2ZB8A 3HDJA 1DSSG 2HXGA 1PV1A 2H1RA 3IBCA 4J16A 1YL5A 2M6SA 2RDMA 3WQSB 3ZZTA 1LCIA 1N5LA 1U2PA 2GBCA 1CDEA 3OD5A 4J0DA 1Y4ZA 4TUYB 4G0UA 1HURA 2ZVJA 5FF9A 2I9PA 2P68A 2XQJA 1GT0C 4LDZA 3WMGA 5C51B 2Q1XA 3G82C 4J0FA 1CC1S 3K1YA 1DIHA 3I6IA 2O2JA 4BCDA 1EESA 3GVIA 5DGCA 2J6CA 3PRJA 3UWDA 4DRYA 5CJJA 4BDTA 3OMLA 1RKQA 3I0MA 3MLFA 1LVUA 3VZSA 3ZGOA 2O38A 4EECA 2D5LA 3VC2A 5HX7A 2XUOA 2YXPX 2W2KA 3LLCA 4OKIA 4MVJG 2R87A 3CLSC 4ND6A 4U7GA 2LCVA 1BKDR 3EGDB 5CITA 2M1ZA 3TAXA 4QJ3A 1PGPA 3HKBA 5ELXA 4MUKA 2WZDA 3NHWA 1K3TA 2IFTA 2OCBA 2LYPA 3HBJA 1BS9A 1L5ZA 5K8IA 1QLWA 4DJEC 2FW1A 4PU3C 1RW4A 1DHRA 4UPDA 1GRQA 3PGA1 3RFUA 3TTTA 4BNLA 1P9RA 1DVRA 3FJYA 3CKKA 4UW9A 3DD5A 5DU2A 3IKTA 3F73A 4UDOA 4N3AA 3RG2A 3VPHA 5JZVA 4I14A 3VKHA 2ODRD 1Z5UA 3QUCA 1NQ5A 4MCXA 3SSAA 1Z0AA 3TPFA 2IVGA 5KOHB 5ADHA 2YCBA 3IALA 4OXKA 1INLA 2XKBA 1MEOA 3BJRA 2VLIA 5FFNA 3VR5H 1NKTA 5TRTA 4EUNA 2OSBA 1LEHA 4TXMA 3SQDA 3QPAA 3TSCA 1DMRA 3OM0A 3OE5A 5C5CA 1XWRA 3IELA 4Y0AA 1SUCA 1WL8A 4YQZA 4BBZA 2BBOA 1MC4A 2ZE7A 3QJYA 2CMDA 4L4SA 5ALXA 3D4NA 4RF5A 4TVOA 4XM2A 2HHAA 1NN1A 1QE5A 3DC7A 3FFBA 3GLGA 5JR3A 2Q0XA 3P9NA 2PD3A 3UAVA 1Y63A 3PGMA 1B2RA 3LKBA 5BV7A 3O93A 4W5WA 4YARA 1RCTE 1UPFA 3QELB 5FNZA 3GAFA 2WYIA 3AM4A 4KUEA 1GZDA 1LK0A 1M67A 1UWCA 2DG2A 1FXWA 3MJFA 2QZZA 4ROTA 5JY1A 2EJCA 3UUGA 2NZ8A 1TZKA 3RUPA 2MDTA 1OH5A 2XGJA 1FP4A 2AFHB 3CEHA 4CL2A 1AKTA 3BB4A 1H2FA 1G7RA 1N5OX 4RPCA 3G0BA 3T1HB 3SIXA 3UTCA 3HXQA 1Z47A 4XYBA 4DE5A 2OYCA 3HK2A 3PEEA 1MJGM 2NQ2C 3Q5DA 4QYSA 4YAGA 2F62A 2RGXA 3T7AA 1TQ6A 3FI0A 3NNNA 5ALPA 5IK2A 2YJNA 4QJ4A 1TDJA 2JD1A 3FSJX 1N2ZA 3SX4A 4A8HA 2DBZA 2FPRA 3KTAB 5DEIA 3DE3X 3PHGA 2QORA 3GFBA 5IBPA 5SY9A 4H7FA 2P75A 5H80A 1GWNA 5E9JA 2EIXA 3TWOA 5JCJA 1XXHA 1GLGA 1K8YB 4D82A 5DNAA 3QP9A 3KSAC 4MVYA 5EZSA 3JPWA 2VQDA 4AWAA 5HS4A 2LKCA 3LT0A 1AHNA 2EWWA 2XSZA 3ISTA 3LQQA 4XDHA 4H6WA 1VSUA 1CZOA 4II2A 3PJFA 1R0WA 4KDRA 3W3ZB 3B6EA 4DSAA 3H8VA 3CEPB 3HMQA 2H1LA 4GP9A 5CPFA 1Z6YA 1A9SA 1X92A 1MO3A 1XRJA 3IEKA 4BFSA 1AF4A 4R2JA 4UQLA 2QF7A 1AB5A 5SYNA 5B53A 1FB5A 5KQGA 2CXUA 4C4PA 3CLUC 1ESMA 1G4UR 2Q5HA 4G8CA 1U04A 1DC7A 1MIOB 4IUYA 13PKA 1NBOA 4G84A 1VIYA 2ZJBA 1E94E 4WMLA 5J2TF 4F2DA 5M5BA 1PFGA 3GLQA 4OQMA 4WCFC 4PSVA 1BAPA 5KTRA 2I66A 5J1SB 4Y2TA 2WFZA 4HGNA 4M0MA 4NYJQ 3EVTA 1H6AA 1TCAA 5FT9A 3SQMA 1AH2A 1RHQA 3DO6A 1E5TA 2LPMA 2X5JO 2BKXA 4LBZA 3TK1A 3ZCPA 1ZS9A 2BSXA 1XZLA 3N3BC 1JDJA 1XZGA 1JJFA 3RROA 1N9KA 3OQOA 3Q7RA 2KM1A 3EUSA 3N6RA 3PXDA 4G4SP 1FNSA 4I3FA 4IUBS 4YROA 4A36A 1VYVA 4JUBA 1EUDB 2QP4A 4MIEA 3RK1A 2NX2A 2COEA 1KZ9A 5ES3A 2JGIA 3PL5A 3U7JA 3RIXA 3GN5A 2B1JA 4QPPA 4PU4C 1KOLA 4G1EB 3WYDA 1DIOB 4EY6A 1R0SA 3Q9UA 3UWSA 1R0XA 1V3TA 3CRZA 1XN4A 4V24A 4PX2A 4EGCB 2CNWA 4FHCA 3NALA 4Y0NA 4ZT6A 1CPYA 5IAKA 2WUSR 1R4MB 5AW6A 1OCTC 3DBHB 2HK9A 1Z8DA 3SKVA 3HU5A 4Q4JB 4P3PA 1DCMA 3LT4A 5LPNA 2WPDD 2SECE 1EFTA 2X2OA 5H3HA 1CR6A 2QY9A 3ZWOA 1UBMS 1WVGA 1DWQA 1NT4A 4C88A 4YCDA 2OQ2A 3KJIA 3R1FA 3I0NA 2WABA 3C2QA 2E21A 2V6BA 1L7RA 3NHJA 3VR0A 1P4AA 1YI8A 2F90A 4B33A 4YRIA 3ND8A 3T3EA 1KAGA 1JAZA 2DBYA 1NUAA 3V8PA 4MKZA 1QV9A 4I66A 4LBVA 1CX9B 2AG6A 5L7YA 3U0BA 4I7EA 2JIQA 3P9YA 3REQA 1CJGA 2MR5A 1CY7A 3BM5A 4LHVA 1SELA 3VISA 1U3TA 4NCXA 4LHYA 2GYWA 4JC8A 3RW9A 2L8NA 4O4IF 1MB3A 1Y82A 4DEXA 2JVIA 3FFXA 5K3SA 2FPLA 3RSGA 1RAEA 1KYTA 5EIBD 3RM3A 1WQ1R 3NIBA 2AOWA 2WJPA 2JAHA 2SCUB 5DULA 2M6KA 3UHOA 2WT9A 2ZT8A 3MW8A 4O2AF 5E3JA 3DAHA 5K45A 4V0KA 4GRIA 1XA4A 3B3QA 1M5UA 3L4EA 3SR3A 3WSVA 1AKYA 1R4ZA 3EBPA 3JVDA 1UPUA 3UFDA 2QENA 3IP1A 4FFLA 3FSGA 4D56A 1HNXB 2D1RA 1N1EA 2QR2A 2XWBF 5FJJA 3BCHA 3JALA 2DUMA 2X0JA 3B6KA 2LUOA 3T5BA 3V7YA 3E82A 4C0AC 5D1NA 2IYNA 4TKZA 4C89A 1N6OA 2NYRA 5J23A 1U2SA 2A0WA 4FONA 1HLDA 1LS6A 3C3XA 4PSAA 1IBMB 1YVUA 1KFEB 4AB1A 1ZRHA 2WJAA 3QVUA 2JD2A 2M98A 3FZQA 4B75A 1E4VA 4OGLA 2QTAA 3BIOA 1RADA 3GAMA 3O47A 1G2OA 5BN4B 1AGXA 1GD1O 1SNYA 2ZW9A 2FPSA 3BDVA 3IQGX 2W4MA 1QCCA 5HFJA 5BR1A 3EGDA 3EXHC 3VX4A 2K87A 2AXNA 1T1RA 1WU7A 2VTDA 2WJ4A 4JR1A 4EPWA 5KJ1A 1U1IA 1WXEA 2PVSA 4YH1A 2R65A 2GNPA 3O94A 4FYHA 2HT6A 4NMXB 4UUAA 3F6CA 1E32A 5EHGA 2AW6A 4NONA 5DLPA 3STVA 5K8CA 4P7KA 1M0TA 4DQ0A 1ZCFA 3PVSA 3LC1O 3ZC3A 3CJRA 4KLNA 3HYRA 4MYDA 5EWJA 4C7KA 4D3XA 2ZQ5A 4LK2A 5TIIA 1DJMA 2TMDA 4ECEA 3VNRA 4V1CA 4C29A 3V7UA 1IY0A 2FDRA 4JX9A 1K8XB 2ZAGA 4RKQA 5EMNA 1YZKA 4DEVA 1SGWA 5BUSA 4Y6SA 3P0JA 4AG5A 4RVNA 5JZ9A 2RKBA 4YJFB 5D3QA 1QFYA 4RELA 5AXAA 1S4QA 1NF3A 1M1NA 2GERA 3UB3A 3WLEA 2PWBA 2WI8A 3E5MA 4TV8A 1RJDA 4WSOA 1TD9A 4IIBA 1SD5A 1CDZA 4RANA 2ODBA 5E6RA 1LLDA 4MIKA 3PKIA 4ZAFA 4F3CA 2XHZA 4OMCA 5HIKA 1T2VA 3EG9B 4ZGWA 3WQQA 5EI5A 3GDOA 4R7ZA 2C8KA 4RESA 4INZA 1ZUNA 1BRTA 1KPHA 4B7AA 1VZ2A 1NMYA 1XCGB 1XX6A 4JUDX 4RHCA 3X1WA 1H05A 2B25A 2FQQA 3COPA 3FYHA 4KLRA 4KQ6A 4LTNA 3DLIA 1EBFA 4MVWA 3L7DA 5LMZA 1JZTA 1W8DA 1RBYA 3ANSA 3RC9A 3ACCA 5BV2P 5IANA 1CY8A 2PWZA 2ZI6A 2E5WA 4RW0A 1J2EA 3NYRA 5EZYB 3RJMA 2SKDA 3CCFA 3A9ZA 1XLTA 3I3OA 1DO0A 4IWNA 1ZKDA 2H1CA 5B1HA 1T0UA 3TW8B 1RQGA 3WSWA 2FN8A 3KJXA 4P53A 3AJ8A 3ITKA 3AIIA 2JBAA 3OQJA 4O4LB 1IZ8A 5ESDA 4UBNA 2YV5A 1LRKA 1VPWA 3HB7A 2RB4A 3M6FA 4Y1RB 1BXRA 2HLHA 5AI8A 2BBWA 3S27A 4FC7A 4BRZA 1KJ9A 1KS2A 3W2HA 4ZCTA 1EX1A 3D6NB 3LZ6A 4FFOA 4N7BA 3ZE7A 4ALNA 5U1PA 5AK5A 4HVLA 3W5UA 3PE5A 5ALJA 5KJFA 1FYFA 1Q57A 2BFCA 4JUIA 3FHCB 4MOWA 3U1BA 4OHBA 2HY7A 3G7DA 3AI2A 3FCYA 3L1JA 3FRJA 4CETA 4RVHA 1ZGBA 1XRQA 3HKCA 4OFZA 4LMAA 1B3RA 1SB9A 4K0RA 4BBPA 2VQFB 4GX2A 5E3HA 1DFIA 3BQMB 3HWWA 2OTCA 5JI2E 3K4PA 2GVNA 2WNIA 1G41A 4N7JA 1XDZA 2QTNA 2CLFB 3LVBA 2PBFA 2KEIA 2PMDA 5HQJA 3TFQA 5ENDA 2B4TO 3A1CA 3A9XA 3ZE0B 6Q21A 3QUTA 2CFRA 1XHLA 4J1WA 1XSEA 1XZNA 2C07A 2JBHA 3C6QA 2WICA 3ICCA 5BSTA 2WT4A 4N7MA 3WC4A 1J8VA 8ADHA 5AOVA 1F1BA 3M83A 4AYWA 3NTRA 4AWXA 1KJZA 4CKCB 1RCUA 4EYSA 1PR9A 1JJVA 1WU8A 3PJEA 2VBGA 3A04A 2O2HA 3LF1A 1GYRA 1TT7A 4R4JA 4IIUA 3K70C 1D1QA 3TN7A 3HPQA 2XODA 3BHIA 4MHSA 4WXMA 4F4HA 1PDOA 1E3QA 1PYDA 2ZSBA 7ADHA 4B3XA 1QHXA 4OFXA 2JAXA 4KE8A 4LV8B 1O6CA 5DWDA 5ICSA 3TFOA 4M54A 1DEKA 2C4TA 3LUGA 5CX4A 5KNCD 3CWZA 3ZU5A 3EPKA 1G18A 2UUCB 4JYCA 1CFJA 1O96B 3O74A 3O8NA 4EMUA 3EVDA 2QTTA 2WJJA 3Q85A 4JIMA 3DJFA 3FDZB 4FGJA 3AX6A 3D8NA 4WK4B 1PJSA 2KJQA 5EJFA 4Z3DA 3OMTA 3BCSA 2A14A 3QGMA 2C57A 4F4IA 3I1JA 4G0YA 1EA5A 2XPCA 3K5HA 4WIAA 3CRNA 4X1IA 4DMRA 3Q0TA 4LPSA 1JMKC 4NVRA 1V1RB 3QEMA 3W5VA 3OX1A 4EG7A 1G55A 5KTYA 4LF5B 3HB4X 4YDHB 4YK7A 4RTQA 2MIIA 3BEOA 5LIRA 3I5YA 1EX6A 2VPPA 4KLCA 1GFSA 4HB0A 1J22A 2EVWX 3NHMA 5B6JA 5IXJA 4B87A 4PU7A 2JKYA 2QNIA 3SSOA 3C98A 1E2UA 3LQ4A 3V32A 5AIAA 4KK4A 1QQ7A 4KYTA 3LUDA 3OUUA 4HNAA 3I52A 4PLYA 3WBKA 4O29A 2IT1A 1H9AA 4TMXA 4ZXFA 2G9NA 4EM6A 5GADl 2HRDA 5IJWA 1JHUA 3KTAA 1Q11A 4CTKA 3IVRA 1ZCBA 2OHOA 2ETVA 1X9HA 1RYMA 2W93A 5I7SA 2YN4A 3KKKA 2J87A 1E9EA 1UKVY 3O2QB 3WVNA 2JLRA 3E9RA 4FR2A 5ALEA 3AEZA 1MRSA 5KHAA 1Q1ZA 3QE9Y 3MGGA 4DSTA 3UGJA 1I3MA 1IQRA 4MTCA 3UYKA 2E37A 1UMBB 1GEGA 3FX2A 5JSUA 3JRWA 3LX4A 4IV0A 3FYSA 4D97A 4PG8A 5C2JB 1N3LA 3RE1A 4B09A 2UYQA 2FR0A 4JNKA 1UZUA 1LWNA 4QBFA 3ZI0A 4DC1A 1V8BA 3RODA 5JAQA 5FV7A 1EJBA 3G6WA 5ALGA 1A5AB 3TG2A 3QUSA 4CM4A 3N2NA 4KE9A 1V47A 1RPNA 2ZQZA 4R69A 1H94A 3WLLA 1TADA 5JJLA 1TVKB 2X13A 1JJBA 1OX4B 2V7TA 3UT5A 1RZRD 2HV9A 3H2YA 4RE5A 4L78A 3UQZA 4OQEA 1HYGA 1W36D 4NYIQ 2GRUA 3CCCA 3U26A 3WLNA 2QVGA 3DZGA 1V8DA 3EHEA 4WL0A 5F5LA 1FFYA 3OLYA 1I7LA 1Z7EA 3QVVA 4AKEA 5DB4A 5TC4A 3P2MA 1KJIA 4D41A 5K4HA 3H9QA 1CY4A 2XB9A 1B7GO 2BRUA 3K0CC 1P7ZA 3G13A 1EUYA 2EKDA 4WJZA 1COZA 3FZNA 5M29A 2XMGA 1XO1A 3ADKA 3HEMA 4QRDA 4BV3A 2G07A 1O57A 1KAMA 1IEXA 2JCBA 2PZGA 2W00A 3N7TA 3SX2A 1CWUA 5JNSA 5FWDA 1YQEA 2Q9CA 4JGBA 2ZIFA 2C2KA 3I04M 3LY7A 4MYRA 1PJ8A 1WV1A 1MLDA 3JVEA 3Q4GA 5TS3A 3ZCQA 3QYFA 3NQ41 4G9EA 1K7CA 1YQDA 3O1HB 3UH1A 5JATA 3OCZA 2GHRA 4FVTA 2FFQA 4PSDA 4MKRA 2HKIA 3BXPA 2G6TA 3OQ1A 1N2IA 4RL6A 2ZJ1A 4RWZA 3ZWQA 4JN6B 1MKYA 1Y3FE 2IUTA 1T0IA 2VHZA 2IS2A 1IHYA 1U99A 3DOUA 1M2FA 5J5AA 4C4RA 4QLBA 4ZCMA 1ZR2A 1ND6A 2UKDA 5TPZD 3W8NA 2FN9A 2J67A 4G63A 4YP5A 5IW8A 4L0QA 4KNYA 1ZGGA 4FGWA 5SY6A 5HK9A 1BDMA 4XWWA 1H3EA 1JKJA 4X4BA 1SVWA 1UJBA 4MUBA 3X43A 1T5DX 1W4AA 3KV1A 4Y2GA 1WXGA 3OQIA 5A7GA 3G85A 4QNRA 2ODQA 4KLZA 3V9AA 2NAPA 2G1KA 1GN8A 2IHTA 2GAAA 4W99A 3UKDA 2QMOA 3ZQUA 2ZJ3A 1NVTA 4DRXB 5JQGF 4A15A 2RJOA 4G5XA 4QL3A 1IY1A 2CHEA 4TRMA 3ZVRA 4C7OA 3GZTB 1S8AA 1DPGA 3NVMB 1QSGA 4PC6A 1K4YA 2GETA 4ZO8A 1QF9A 4U3JB 2AEJA 3HUUA 3I6YA 2A5LA 4I9HA 1YS9A 2J4CA 3C4VA 2NM0A 5AKJA 3ZU6A 3U6BA 1QR2A 3RAEC 4CM6A 1T5SA 2CDCA 2WOJA 1YZUA 1C0EA 3RIMA 2A5FA 1JHPA 2X2FA 1XDUA 1M1UA 1OZ0A 1X7XB 3DAOA 2PPXA 3WWOA 3JZAA 1A5TA 1ZAKA 4KN8A 4Q7KA 3LFHA 4HX5A 1BG6A 1OXTA 3K09A 4LKOA 2HD4A 4KXMA 5EP3A 3VOBA 1F3LA 5KYWA 2CJFA 1FX1A 4M0EA 2YXNA 4MEJA 5K8TA 3R3XA 1OHHA 2CFIA 3JAMA 2W6JD 2Q6LA 1PW5A 3KU1A 2AOXA 1YRHA 4WXYB 5GM1A 1E2FA 2ZBEA 1ZK1A 4JJAA 1OGYA 1WXQA 4IQ4A 3W8DA 1DGQA 4UDXX 4RL4A 3TSAA 1PRAA 3BIWA 3GVPA 1VIMA 3H9CA 3PYLA 4ZQFA 5F4BA 5A04A 1UR5A 3OAAD 3RVPA 3W5BA 3FIUA 2GVZC 3B20A 4CCSA 2IPLA 2WUEA 1JIKA 2IYVA 5BSVA 5KMGA 2WMOB 3WYCA 2OHGA 4ESHA 3LPDA 3K0CA 3GJZA 1Y0BA 2QUIA 4QC2A 4OYYA 2XCJA 2D54A 3PR3A 3F4KA 4OAPA 4ARCA 2Q2OA 3NGLA 3F4BA 1T26A 3BL6A 3H7AA 2Q4OA 4MYTA 5CDTA 2V97A 4TUYA 5JEDA 1AE1A 1WY5A 3QX8A 4HF7A 4EJ6A 3QEBZ 3VI4B 5AVXA 5JYBA 3BTOA 5L6MB 4P92A 3FNBA 4KFUA 4ND8B 2R4UA 4QU5A 2ANCA 5T64A 2BFFB 4NJOA 1Y6FA 4MUIA 3L8MA 1YIOA 4DV5B 3RTCA 4HRAA 4L2IA 1J39A 4LDRA 2YWHA 3R5TA 4PC7A 5EP2A 1RVV1 2B36A 3ABOB 3T3GA 1OKKD 4FT4A 1EPUA 1NLFA 5K6AA 3AQ4A 2ATIA 2B3DA 1GRNA 2NO5A 1XTIA 4JOCA 4YFYA 3G1UA 4D8XA 5GZ3A 4IOMA 4YJ2A 1H2YA 4MDFA 3L8GA 4N3GA 2Q3JA 1OXMA 1HEIA 1EHYA 1XMJA 3P45A 2B94A 1RWPA 4OGWA 4UNQA 2GLUA 2CNKA 2P5TB 2DSTA 3KPJA 1I14A 3KZOA 2W8BA 4M37A 4UATA 5GVRA 1JV2B 5K99A 2FZWA 4LZAA 5CR9A 3LJKA 4OBMA 3SCZA 2GXUA 1YUNA 4HLDA 4D9GA 1DKPA 3H16A 1W6RA 4A2WA 1RI5A 5KNBH 3BD8A 1JR4A 4OTZA 1ANKA 2FJ0A 3AF0A 3K1JA 4EQ6A 4KAXA 4YXFA 4M1ZA 1XVUA 3EEBA 3QU9A 1QU2A 4TSRA 1WD7A 1WZNA 3FMPB 4LWPA 3U2QA 1RFGE 3NROA 2VHJA 1WB6A 2ZT6A 3FN4A 3GOHA 1WXXA 2ZUVA 3C6YA 4KKXB 4LJ9A 3TNFA 1DG3A 3BS4A 3CGGA 1EVKA 1ZP6A 3DG9A 3AC0A 3ENNA 4QYWA 2QS9A 3EDMA 3I5MA 3OCUA 1JG1A 2ZB2A 3PQ8A 3QUQA 5FBKA 2H8KA 1XR3A 1VHWA 3GN2A 5J4KA 4JB8A 1KARA 1V1RA 3QEMB 4AP6A 1MF7A 1QJCA 1GNPA 4KQ9A 4QUGA 4FMBB 4XB2A 3TTYA 2RB5A 4FILA 1E3SA 4ZTUB 1EWTA 2BGUA 2B9EA 5GAJA 4AY6A 1WW2A 5ADWA 1EAYA 3BFJA 3CZCA 3KT6A 2Q99A 4QOFA 5EWMB 1C8KA 3KHSA 4QYMA 4B8WA 4YRBA 2ONJA 4WVLA 3LE8A 3AYXB 2AZMA 1NVXQ 1SA0A 1KMNA 2H8GA 3MIZA 4OK6A 3D6VA 4M8KA 2A3NA 2ORIA 3BB1A 3N0RA 1KDTA 4RZ3A 5HJ7A 1I8TA 2GYYA 2QN3A 4TT3D 1BO6A 2WUGA 3SLKA 1IM5A 3V9PA 1NRJB 4RMGA 1A8PA 1NL3A 4M22A 1LBHA 1P81A 1Q12A 1Q74A 5IU6A 1IMJA 3GA5A 4MI6A 1NI4A 3A6EA 3GFRA 3GLGE 4ESEA 1QK3A 3VH2A 1KIAA 4C2AA 1B0AA 1ODIA 5EWLB 2I0FA 4XQ9A 4GC9A 4GGPA 2MYTA 2PS9A 4XE5A 5ECDA 3VYRB 4XCXA 3PYXA 1IEVA 5K3AA 3UXEA 1XZQA 3SOPA 3JXCL 3TLAA 1UQTA 3ZI4A 1DRJA 4GL2A 1KYQA 1VMAA 2OXTA 2Q46A 1WRBA 3CZQA 3QQPA 4B5KA 1U7UA 4ENWA 2XLCA 3B3FA 3A1DA 1ZJ5A 1F06A 3RBVA 5F2EA 4ZKEA 3SYRA 4UFPA 4ZCPA 3A9UA 3PC6A 2Q2NA 2ATVA 4BX3A 3D2BA 5HFNA 3KNZA 1XRRA 1LDYA 2NV0A 2YWRA 1AHIA 2V6FA 4HFNA 1ZQ9A 3DKRA 5AKKA 3RYIA 4Z7QB 3PZRA 3NVKI 2E6KA 3ZH2A 1PL8A 1N7JA 3IAXA 1WP4A 3GNTA 1M5TA 2FFRA 3NAMA 4L57A 1ZY2A 1DWKA 1SC1A 2WU0A 3G2PA 2P9QA 3TE7A 4LC0A 4GG1A 4YT8A 5IEBA 4RSMA 3WB9A 3G9ZA 1MAVA 1OI7A 2VHXA 2ZJ6A 3OY2A 4S2EA 5L3VA 1FUEA 1GZ4A 2LTAA 3H11B 3HZRA 4ZVNA 5K09A 4CM7A 5DGHA 4G0XA 3QH4A 3RS0A 3KWFA 1WNTA 4YAOA 3WGOA 4CDNA 1DWUA 4CCWA 4DMLA 4MI9A 5J4HA 2FSSA 2X8AA 3VC7A 2B1RA 1F51E 3KK0A 4TQGA 4ZD6A 3UAWA 4AO8A 4HSEA 3DMYA 5TGZA 2DCUA 3IILA 1HTTA 3PF8A 4RQUA 3H5IA 1GILA 1P39A 5LMNB 3Q3VA 3M5PA 2QL9A 2ZR9A 3L7LA 3O8QB 1TKAA 3HFSA 4TL7A 4US0R 1IM8A 4POOA 4WY2A 3JD4A 4ZQIA 5DNCA 2O3SA 5LP6C 4C2BA 5KU7A 3WB0A 1Y6RA 2BP7B 3KQKA 2ZSAA 4HOYA 3SHOA 4D0SA 4H3HB 4PYLA 4Z4IA 4EPRA 3MWDA 1YB6A 1MNAA 1U4SA 5BWCA 2VHYA 2H1WA 1S6YA 3PDUA 4KPUB 2R1VA 4DV0B 5HCUA 2W6JA 2PS0A 3NEJA 4L07A 1JFLA 3DOIA 3CEJA 4MX8A 3CNEA 1ZESA 4YRFA 4Q18A 4PICA 1SIOA 1I4LD 3VTAA 3DE7X 3LQRA 2A35A 2CNDA 4D57A 1YZFA 2WM2A 3DE4X 1Y1TA 4Z7OB 1MO2A 4ILEA 5AVYA 4X4FA 1FUIA 1UMBA 1BDHA 1N2SA 4U7FA 2GS9A 5K6TA 1KFKB 1V41E 2COUA 2PZJA 2Y99A 5C1IA 2GN8A 1FE8A 1QE0A 1XZEA 4P38A 3ICWA 2LNDA 4I6JA 2DZDA 2HDNB 2P27A 1ZINA 3VH4A 3N07A 2JCXA 4R2WA 4WD3A 2P2NA 3AP1A 4N18A 5CA0A 3BK1A 2JJMA 4C4TA 5DI9A 2W2MA 4OL9A 5AJXA 1SOMA 4MWTA 3G9TA 4QWWA 2XZOA 3FCOA 3T7EA 1KI2A 1OHHD 1PDVA 4ALKA 2AKEA 1ZOLA 3ELYA 1W4ZA 3PUIA 3ZXYA 1HRKA 1QE3A 3IJEB 4GLOA 4U39A 1FRZA 3D4BA 2DEUA 1PN3A 4XEUA 2UYHA 2QQ0A 1WX1A 4LMPA 3BH0A 3RUFA 3V8VA 3DVAA 5LNK1 3BMNB 1KXZA 5EERA 2PUVA 3K2IA 1M7BA 1JT9A 1QK5A 2G71A 4UXJA 4UVIA 3ROXA 4ER3A 3VPDA 2PX0A 2VZ8A 5FWXB 1N2CE 2PT6A 1QO7A 4Z0HO 5DTMA 2BKLA 2I6QA 3V3KA 1LW7A 3KB1A 4FDAA 3PUYA 5A3SA 2EW8A 3DCYA 1Y8RB 4MS3B 4A7PA 3CE9A 3LC7O 1XTBA 4BL5A 3K0BA 2P9CA 3QWAA 4FGLA 4F5ZA 1I01A 4IV5A 2JGJA 4XQGA 4OHWA 3ACDA 2FUNB 3BUSA 3PWZA 1NHGA 4NECA 4V02A 5ECGC 3S2IA 1LV8A 3WRYA 2NV2B 4CM5A 1XMXA 2JKZA 3TXAA 4DHWA 3CH5A 1YKFA 1RZ3A 2JL1A 4BTVA 3TPZA 1SIWA 1N2EA 2BFEA 1KVTA 2GCNA 2HWYA 2AT1A 3GP5A 4BMYA 2B8NA 3BJZA 5JXJA 4LA4A 3DAPA 5CFNA 5K0FA 1X13A 3USZA 3IHWA 4XM0A 1Q7TA 1QG2A 3DE1X 3OLCX 4HNAB 221PA 1SU4A 3ZWPA 3THWB 4QDKA 3OO0A 2XIUA 16PKA 1KIMA 2B2CA 3HBFA 5JASA 1HXHA 3HP4A 3OA2A 4P2BA 4YDQA 1DIGA 3C8UA 3VHXB 3QE4A 3R7BA 2POCA 2OB1A 2IOHA 4OMFG 5BPHA 4ZKDA 1E96A 3CX8A 2O57A 4LYAA 4RPKA 1W581 4UOQA 3VTZA 2ACEA 1MRNA 1T3HA 3JR7A 3M6LA 4G37A 3HTXA 1VBFA 5HYVA 1LLCA 2QA5A 1TYCA 5A71A 5TEWA 4IJKA 4IIEA 3JQ7A 3BOSA 5KCMA 3HCRA 4XPZA 3ZKCA 1EUCA 3IEIA 1NV8A 2NU9B 3SVZA 4PANA