5DT2A

Crystal structure of dot1l in complex with inhibitor cpd11 [n4-methyl-n2-(2-methyl-1-(2-phenoxyphenyl)-1h-indol-6-yl)pyrimidine-2,4-diamine]
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
311
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 98
structure length 311
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dt2A02
5E1BA 5GINE 3PT9A 3SGLA 4C06A 2OBFA 3V8VA 5CVUA 4CTKA 1IY9A 3FTFA 5E9WA 2P3LA 1FBNA 2PKWA 3LHDA 2EFJA 5DRYA 4EVIA 3UJ7A 1L9KA 3TM4A 2AZTA 4MTLA 3SM3A 3TKYA 1VQ1A 3TMAA 5EEGA 4XCXA 4BY9E 5F2OA 1HMYA 2GAFA 1N7JA 2QRVA 2AR0A 5GP1A 3SXJA 4RTJA 4ISCA 4GUAA 3JWIA 3NVMB 2IBTA 2ZWAA 2G71A 4PYKA 4YUWA 2JG3A 3C0KA 2Y1XA 3SSNA 1WZNA 2Z6AA 2VDUE 2NNWB 1AF7A 2N47A 2BR3A 3OPNA 2BM8A 1NE2A 5DSTA 3DLIA 4PNEA 3FUWA 3IHTA 5EKUA 3FZGA 4EKIA 3KQQA 3LDGA 4P7KA 4KWCA 4ER3A 1JSZA 3KR2A 4E2WA 5K8VA 3FRHA 3PFGA 2B25A 3BGDA 3KPUA 2HTEA 4PONA 5FQNA 4E32A 4E31A 1FJXA 3G2OA 4ER7A 2I6GA 3PFHA 3HCEA 2HR1A 1VPTA 2AVNA 3JWJA 3KU1A 4C03A 5LQKA 3UJAA 4R8SA 3P9CA 4RV9A 3LKDA 4O29A 3LSTA 3AWIA 1QAOA 2V7EA 2ZZKA 3A7EA 5EPEA 2VS1A 4AZVA 2PGXA 3LCUA 5EZSA 3PS9A 5HFJA 3ELYA 1EQAA 1KHHA 5EEHA 5E8RA 5DTQA 4RVFA 5CVJA 1BHJA 4QQNA 4U7PB 2XVAA 5FA5A 1UWVA 3HA5A 1YZHA 2JHAA 3OFKA 4QTUB 4RVGA 3TRKA 3LECA 4X1OA 4MHTA 4E30A 4GC9A 4LECA 3GXOA 3HNRA 4GBED 3K0BA 1KXZA 3P9NA 2WA2A 2JHPA 2XBMA 4OQEA 1FP2A 3PTAA 3FUVA 5D1HA 2OXTA 3HA7A 3GCZA 4YMGA 3FTEA 4DCMA 1JG3A 1VL5A 3BWBA 1XJ5A 5EIFA 1SQGA 3THSA 2PXXA 4WVLA 2UYCA 4PYIA 4CKEA 4RTSA 1NW6A 3D2LA 2BZGA 4G56A 1V39A 1JG4A 2IBSA 1JSXA 4OA8A 4PYNA 5HEKA 3TPZA 2B3TA 3VC2A 2K4MA 4CXMA 3G7UA 3I9FA 5K01A 1QZZA 3LCVB 4JXJA 1RI1A 2ZZMA 1DCTA 1QAMA 4M37A 4EQZA 3M6VA 2FYTA 2QE6A 3P71T 5IKMA 2QY6A 2NXCA 4PIPA 3ORHA 4L7VA 2VP3A 2IGTA 3LDUA 2YUIA 3PX2A 1B42A 3UJBA 3HCCA 1P39A 2E5WA 4M36A 3CJQA 4LWPA 1PRYA 4F84A 5EIWA 3I64A 4BLUA 2OPBA 4F86A 2DPMA 2C7OA 1KP9A 2IH2A 4FS8A 3V97A 3B3JA 5EQJB 3MTIA 1EG2A 2QRVB 4LWOA 5EMMA 2ZCJA 2I7CA 2XYRA 4MQ4A 3EVZA 3UJ9A 3DR5A 3VYWA 3FYDA 3DUWA 5LQNA 4RVDA 1PJZA 4IWNA 3DMHA 2FHPA 4CWAA 2IH4A 4OX9Y 2NXEA 3VSEA 3NDIA 1JTFA 3GRVA 1KPGA 2ZFUA 3O4FA 2IPXA 2VZ9A 3P2EA 4E2ZA 5BP7A 5K0FA 2HWKA 3Q87B 4RTRA 2JH9A 1L3BA 4HRAA 2WK1A 5LQCA 1BKYA 1KPIA 1XCLA 2AS0A 2WA1A 2AOVA 4FR0A 1SVUA 3SVZA 5KVAA 4XUEA 5KYGA 4HG2A 3B7PA 4C05A 2UYQA 3DMFA 1XVAA 5EC8A 4EMSA 3NWBA 4E70A 3R0QA 3KQVA 3HCBA 5GOZA 4KDCA 4HTFA 1IXKA 2ESRA 2YXLA 2ZTHA 4GQBA 4RYLA 4R6XA 1DL5A 3BWCA 2PX5A 5DSXA 2ZLBA 2P7HA 2YX1A 3G89A 3LL7A 5DLYA 2CKDA 3GJYA 5T67A 2ZSUA 3EEOA 5HIKA 4QQKA 3BT7A 1WS6A 3R6TA 4MWZA 5FQOA 2UYHA 2BR4A 2ADMA 3EVDA 3BKWA 2I62A 3B5IA 4FSXA 2PWYA 2P3OA 4PGGA 1F3LA 3C6MA 3KHKA 4DZRA 2O05A 3HVKA 1NT2A 1ORHA 3P2KA 3GO4A 2G70A 2P7IA 3QOXA 2R3SA 3IYLW 3O31A 3UJ8A 4U7TB 5GIOE 5FWAA 2AOWA 2XYVA 4HTFB 5D1NA 3FRIA 4KIFA 3IV6A 4ER0A 4QDJA 5BXYA 4LG1A 4CKCA 1XDUA 4GF5A 4R6WA 3KPWA 3JWGA 3UWPA 5KQRA 1AQIA 5GIPE 3Q7EA 1N2XA 2VDWA 1ZGJA 3FPEA 4FP9A 3TOSA 3HCFA 2CL5A 5FADA 3DP7A 3KQSA 4FT2A 5IH3A 3WSTA 4KDRA 5EOVA 1O9HA 2NXNA 4EKGA 1L3IA 3BZBA 4M38A 3MB5A 4DMGA 4A6EA 3MTEA 2P35A 4RTQA 3UBTA 5DX8A 5B1SA 1XXLA 1P1BA 3BKXA 1AQJA 1YFJA 1OR8A 4CTJA 3PB3A 3A7DA 4AZWA 5E2BA 1O54A 2FPOA 1R6AA 1FP1D 3KR1A 1HNNA 1NV8A 3THRA 2PX2A 4PIMA 5DX0A 3GGDA 2YVLA 4AZSA 3HCAA 3EGEA 4RTMA 3P9KA 3REOA 5ICEA 3C3PA 3EGIA 1JTEA 3HM2A 4DCGA 2ONZA 4QVGA 4YMHA 1Q0SA 5T64A 1KIAA 3G2PA 1TW2A 5HOQA 4GOMD 2Z6QA 3M4XA 1F38A 2KW5A 3GDHA 3AJDA 1IM8A 4PINA 1M6EX 2AOUA 3CKKA 4IV0A 3LBFA 2PXAA 2PV0A 5DWQA 4X61A 5BW4A 2YXDA 2O0LA 3CCFA 3O7WA 4R8RA 4ZTBA 5FHQA 2JJQA 2AN4A 4XUDA 1G60A 2PXCA 2G72A 4ER5A 2O57A 3IEIA 2R6ZA 4RVHA 3GRUA 3HVIA 3KQYA 4EK9A 2NXJA 3P2IA 5CVEA 5EMKA 2I9KA 3R9XB 2AVDA 3EVBA 4F85A 1RI5A 1RI4A 4V0RA 1FPQA 4C04A 8MHTA 2Q41A 2VDVE 3NDJA 3OCJA 1XDSA 2PT9A 3T0IA 2ZIEA 3I53A 3ELDA 4RTKA 3NVKI 5DXAA 2DULA 3FPFA 4XUCA 1UIRA 2EJTA 3OZRA 2JH8A 5EKXA 3B3GA 3UFBA 4RTOA 1JG1A 1ORIA 3EVFA 3ANXA 4Y2HA 4RTLA 3EPPA 4PCLA 3P9IA 5P8WA 5DTMA 1L3CA 3KQMA 2P1DA 4RSRA 2EX4A 2XYQA 4QDKA 3S68A 5F2NA 1R8YA 2JHCA 4C08A 3NTVA 2EG5A 3KR9A 1ZG3A 3KPJA 2G1PA 1D2GA 5K0JA 5FULA 3QV2A 3AXTA 3BUSA 2OZVA 2AOTB 5E8JA 1RJDA 1QAQA 3EVCA 3PX3A 5M5BA 4IKPA 3K6RA 3NWEA 5K05A 1RJFA 3SSMA 4OQDA 3SSOA 4Z2YA 4FSDA 3G8BA 1UFKA 3G5LA 3UA3A 3FPHA 4AUKA 4KRGA 1NW5A 4DKJA 5CUQA 10MHA 4KIGA 2P8JA 3MAGA 1SG9A 3TQSA 2IIPA 2OKCA 4PCAA 3RW9A 2Z6UA 1JQDA 3QOWA 1YFLA 2ZIFA 4YUVA 2P3QA 1AV6A 3HA3A 3G8AA 2ONYA 3A25A 1NW3A 3OZSA 2HMYB 1RJGA 3OU7A 5C0OE 3B3FA 3H2BA 4IV8A 3GRZA 3HEMA 5DXJA 2ZULA 1X1BA 1QANA 1G55A 5E1MA 5HIIA 1VP9A 4YV2A 1JG2A 5K0CA 5E1OA 2H11A 3I58A 2ZIGA 2IDKA 5HZMA 3GU3A 1XCJA 2OYRA 2C7QA 4M7RA 2BR5A 2GS9A 5FWDA 3FTCA 5LQAA 3BGIA 3B89A 1U2ZA 3E05A 3BGVA 3CJRA 3OU2A 5EHIA 5U4XA 2ZVJA 2ZBQA 5ERGB 4PYLA 3C3YA 4YV0A 1WXXA 3SX0A 3FPJA 4BP1A 5CCXA 3KPVA 1TPYA 2PT6A 3CVOA 5JR3A 3P97A 1RI3A 2GA9A 1INLA 5CM2Z 2YR0A 3LBYA 5T6BA 3FYCA 4P7FA 1Z3CA 1NKVA 3CJTA 1H1DA 5ICCA 5LQJA 2NP7A 3KQPA 2FRXA 5E9QA 1XTPA 3MERA 3OE4A 3R24A 2AN3A 5F2KA 1YZ3A 4UOEA 2NP6A 1BC5A 3KQTA 5DX1A 1X19A 1WY7A 2PJDA 2HNKA 2FK8A 2PSSA 4PYMA 4QPPA 1G38A 2IDJA 2BM9A 3ELUA 3R3HA 3DTNA 4X63A 1YB2A 4PGHA 4BLVA 4BP3A 3NMUF 2UYOA 3DH0A 5K0BA 2IP2A 3M6WA 1Y8CA 5E2AA 2YTZA 3AXSA 1JQEA 3G88A 1QYRA 3HCDA 4GOLD 5CCBA 4PYJA 1DUSA 1NBHA 1P1CA 5FTWA 2P40A 3DULA 2H1RA 4FT4A 3KKZA 1D2CA 1BOOA 1I4WA 1YUBA 1EAMA 4K6MA 1VBFA 5DM4A 5GM1A 4X60A 3UJDA 3E8SA 3KR0A 1ZQ9A 5EVJA 3I5UA 5K0EA 1KR5A 4X41A 2PLWA 2HV9A 3MCZA 2EJUA 2AOTA 3FUXA 5EMLA 2YQZA 4RX1A 5LQRA 3G5TA 5K0NA 1JQ3A 3EMBA 3MGGA 1P91A 5GWXA 1NBIA 4AX8A 3U81A 2AN5A 1KYWA 3CGGA 4YV1A 2IH5A 5E1DA 2F8LA 2CMGA 5FA8A 3F4KA 5FUBA 1ZGAA 3T7SA 4DM3A 1M6YA 3FUUA 3JWHA 2AOXA 2AOUB 1SUIA 2OB1A 3DXZA 1G8SA 1X1CA 3EVGA 5DM2A 4OA5A 3EVAA 5EGSA 5HILA 3P8ZA 4YUZA 5K0GA 9MHTA 3OU6A 3GNLA 1N7IA 2GLUA 2PX4A 2V74B 2P41A 2B9EA 3LPMA 4PYOA 1VLMA 3FUTA 5G02A 2UZ4A 2C7RA 2A14A 3ER9A 3M33A 3KPYA 3TLJA 3ER8A 2PY6A 2ZWVA 3KQOA 4E2XA 1SKMA 3HVJA 3UJCA 2ZBPA 3NJRA 3AY0A 5DTRA 4ATNA 1WXWA 4E33A 3LX6A 4KVZA 3GIWA 1TW3A 5EZQA 1KYZA 4PWYA 5K03A 3LGAA 1RJEA 4C07A 1M0EA 5LSAA 1EIZA 2FCAA 5HIMA 1R00A 5K0LA 3SR4A 1G8AA 3ID6C 5EHGA 3RIEA 3UA4A 1YF3A 3BXOA 3TKAA 1RI2A 4H0NA 4QVKA 2NYUA 3DLCA 2OO3A 4RTNA 3RODA 3PVCA 1EJ6A 3TR6A 1JR4A 3PLAE 4RWZA 3BWYA 3VC1A 3MHTA 2PBFA 2QM3A 4V0QA 4KW7A 1SQFA 2ORED 3DOUA 5CVDA 1ZHFA 1MHTA 4YUXA 2C7PA 1VP3A 2XVMA 3LKZA 2ZZNA 3DXYA 3ERCA 3OFJA 4DA4A 3TM5A 4QPNA 4GOOD 2CWWA 1WG8A 4OBXA 3T7RA 4HH4A 1VE3A 3HVHA 4P7GA 2YXEA 2PWPA 5C1IA 4DQ0A 5FCDA 3X0DA 3KQWA 3M6XA 4YUYA 1D2HA 2GH1A 4QTTB 5DM1A 3GWZA 4Y30A 3CC8A 4FGZA 3OE5A 4AZTA 2OY0A 4HC4A 2ZW9A 3EVEA 3A26A 2GPYA 3GRYA 3MQ2A 3OZTA 1EJ0A 1R8XA 5DM0A 5CIYA 2O07A 4A6DA 2FK7A 5K09A 1NW8A 3HTXA 3A4TA 3SMQA 4C4AA 2LD4A 3M6UA 5KS2A 4BLWA 4R05A 2CMHA 3A27A 1O9GA 1T43A 3C6KA 3E7PA 4HSGA 4OBWA 5E9JA 5C9ZA 1R74A 2O06A 2IFTA 5DRTA 1R18A 2Y1WA 5JUWA 1XDZA 1KPHA 1ZKDA 3T7TA 5DPMA 5GM2A 4WXHA 5FHRA 3TFWA 2ZBRA 4P7JA 3DMGA 4DF3A 4RTPA 7MHTA 3EGVA 4P58A 3UJ6A 1X1AA 5KQSA 5DT2A 3UZUA 5H02A 2PVCA 1Q0TA 2G8NA 1VIDA 3LCCA 3G2QA 1NW7A 4HGZA 5EG5A 3FTDA 3ME5A 4FZVA 5LR6A 5CD1A 2BH2A 1I9GA 2QYOA 3M70A 4HGYA 3DXXA 4NECA 4B17A 1L1EA 3LDFA 3L8DA 1NV9A 1X1DA 4GC5A 5EMJA 1SUSA 3HP7A 3BWMA 1G6Q1 2ERCA 3MCTA 4PYQA 4POOA 5ICGA 1I1NA 4GOND 4GEKA 5MHTA 3ELWA 2PX8A 2OB2A 4ER6A 3GRRA 4MIKA 2H00A 2GB4A 1MJFA 3EEYA 3FPGA 5LQUA 2B78A 3EMDA 3CBGA 2B2CA 3NW9A 3G2MA 5ICFA 5BW5A 3E23A 4E2YA 5HIJA 5CVVA 4CKBA
chains in the Genus database with same CATH superfamily
4P92A 2QD2A 2PLAA 3S2FA 3PT9A 3C48A 3C41J 2P75A 2FX2A 4TV8A 3V1NA 1SHLA 2NO4A 1U02A 4M99A 4R1OA 4X6UA 3V8RA 4F45A 5LN1A 5G0UA 1T3GA 1Y4SA 4TLMB 4ZCIA 3A9WA 3QF4A 4MGZR 2W43A 4YCSA 2AWNA 5DB4A 1CIVA 1X7WA 2R96A 5BRJA 2ZWAA 3BCSA 1RM4A 2GRJA 4U2BA 3L1PA 2BRUA 3TTWA 3O9XA 3OX1A 4KNVA 4LMAA 3TECE 3D4NA 3MUFA 5REQA 4ALNA 4DJAA 3AIMA 3FVQA 2Q3MA 1IN1A 2EL7A 4LDJA 3TLKA 1PJBA 5A4MS 4B3RB 2E1RA 2VHEA 1EKXA 2DFKB 4Y6LA 4JUCA 1YL5A 4JI3B 4O4IF 2OHGA 3T35A 4UHJA 1NP7A 3I45A 4PQYA 3UV7A 1POXA 4JH0A 1E2PA 1I7PA 5FQNA 4E31A 3A9XA 1UXOA 3QMPA 2HYDA 1MABB 1NRIA 3ETEA 1U0NA 4RK1A 4DUGA 1F8GA 4IFEA 4K9RA 4J1TA 5PNTA 1YMUA 2AG5A 3H11A 2ZVQX 1OYOA 3QW4B 4FC7A 4IVPA 3OM1A 2XF8A 1SU7A 3C3KA 3P0HA 4F91B 3H84A 1SH7A 5K99A 2BH9A 4DLKA 4TMKA 2BZ1A 4D6YA 3LXXA 2VTBB 5I9LA 5EIAA 2OHXA 2QLMA 3ZW7A 5JLJA 5JC1A 1QGOA 3PQ2A 3HO1A 4EPYA 3OLQA 4V02A 3DEAA 1ZVJA 4DJFC 1UJNA 3F46A 4GX5A 3JZAA 3LHIA 3HG7A 3SYMA 3GJ5A 3MGBA 5F21A 3ZS9A 4L3OA 1CP2A 4U7PB 4UCWA 2FPMA 3BGSA 1GGFA 2J48A 1P7PA 3N2ZB 4L73A 4EO9A 1DRVA 3JD3A 4OLJA 4ZIRA 1JKJA 4J0EA 2DQZA 1Q1BA 1GAWA 1SELA 2ICTA 5YASA 2O0KA 2ZRMA 3CNOA 3TEFA 4MOWA 1FP2A 1TGYA 1ZSYA 3DTTA 5EJMA 3BJRA 5C8YB 4YMGA 4JYMA 5FBLB 2FZKA 4RDHA 4TWJA 4XM1A 1DZ3A 3WGUA 3T5PA 3TVYA 1YBFA 4NYIQ 3QBJA 1GKUB 3S2SA 3FKJA 3TRBA 1DKOA 3AFIA 1U8XX 2A88A 4KQFA 5AHWA 3FTPA 4C0LA 4RTSA 3BMOA 1WEHA 1T8TA 4MO9A 2JIQA 4UPEA 2CE2X 5LIPA 1RQGA 5EY5B 1GFWA 3DC2A 4NYMR 4EKEA 5B55A 2B6HA 4D9IA 4UFOA 1NSYA 3D9QX 4DXHA 4EMTA 3WAJA 2Q2OA 1EPUA 2JAHA 4EQZA 3HKBA 3AI1A 1MG5A 3A6HA 1X0VA 3TUZC 1I7NA 5LJIA 1DKQA 1J8VA 3CLUC 3EG9A 1F4PA 2HK8A 3C7AA 5AO9A 1XPJA 4MR9A 2H2AA 1U65A 1Q1AA 2PZJA 2QPTA 4XW2A 5EUCA 4IRUB 1FFHA 1JNYA 1YZYA 2DRIA 2C4KA 3FSJX 1ZJWA 1X94A 4UUMA 1T8RA 1ONOA 4JBLA 3P9ZA 5G1NA 3THOA 1BCRB 2PBZA 3JW8A 4NI5A 5K3AA 1N6OA 4EP1A 2GQ0A 4NK5A 4DEYA 5JATA 3JZDA 1DEHA 4GAEA 4K6HA 5K9ZA 2HJVA 1L5ZA 2VKTA 3D8UA 2WOOA 4A73A 1QYCA 4TQAA 5IDVA 4OREX 4XSHA 1LC0A 3V80A 3GFGA 5K0FA 4MJ7A 3RG2A 3V8MA 2OORA 4K9MA 3PTLA 2ZT5A 3NHMA 1UJ4A 3RTGA 1CDOA 5FWNA 4X1KB 4DLUA 3RDPA 1US8B 2Z2YA 5HQ3A 1SVUA 1QUFA 2D5VA 4GD3Q 5IT0A 3U61B 3DNVB 1VHJA 2NTJA 3LBHA 3FVRA 3W8RA 1OHHD 4BNZA 5IZ4A 1ZA2A 2VNHA 4CKWB 4ZXFA 3ONFA 3WWYA 1USVA 4ACBA 2YXLA 3QFTA 3TPFA 1PQYA 1UL1X 4HEA6 1V9LA 2XQKA 1TO6A 1GAEO 3PI7A 2REXB 4JBXA 4CRWB 2AHOA 3TSAA 4DLXA 1XHFA 3NHKA 3PD7A 2BI7A 4W82A 2PPLA 3T9AA 3ZVMA 3GLKA 4FSXA 2BV3A 4DT1A 1NNLA 2R8EA 3G7NA 3EFEA 1C1DB 1UBRS 1DWPA 1P1JA 1JZSA 1QCYA 3W3AD 2RGBA 1V3UA 3AVUA 1QORA 2R4QA 3KE8A 3NBZC 2BFAA 1H2EA 3EJWA 3L41A 1VHDA 1EJ2A 4KL8S 3K3PA 2Q6VA 4EPRA 1X80A 1Z6PA 4F7WA 1MA0A 5DYGA 5EE9A 3FDXA 5KQRA 1JAHA 3A1EA 4J4BA 1QIEA 3B12A 2XJ9A 1KJNA 1OXBB 3Q6MA 5JRZA 2EZ8A 3CRVA 3NCHA 3AF3A 3DP7A 2RBEA 1K3TA 1XNJA 2PNJA 3RNLA 1RYNA 3KZCA 4QASA 1R4NA 1YCFA 2FDCA 4S05A 3N39C 2Y2VA 3PSHA 3BKXA 5IVPA 1S2NA 4U7FA 1AQJA 5J40A 2E0IA 1GG2A 4QE3A 5LNK6 4JUAA 3RFUA 4XKJA 1CUSA 4ZCMA 4BKQA 4CF7A 4RXMA 1M54A 3EEBA 5KVQA 1E2FA 1YULA 3GRPA 3ANNA 4LDPA 2IIBA 4DC9A 4AZSA 3FNRA 2QSJA 5TLSA 4CIVA 2EHDA 3COWA 1GTL1 3K9QO 3KCNA 1ODCA 4WCDA 5IMSA 2WIDA 4KK4A 3DDHA 1CTQA 2X2PA 3LBNA 1D1SA 1H05A 1KIAA 4IOMA 2J6IA 5J2UB 3GVHA 2CLHB 2HPAA 5CVTA 4YAKA 3UAWA 3EDYA 1F2TA 2Z3ZA 4PCVA 2PPXA 1GGKA 4XQGA 2Q4DA 3AKYA 1T2DA 4L8FA 4KLNA 5CMLA 4Z86A 1E3DA 4LSGA 3VNRA 1A9QA 2F64A 4AJNA 2OCKA 5KO2A 4BXOB 2IKSA 4CL2A 4I1SA 3L0SA 2O0LA 5AWFC 3P9SA 1WDLA 3TZLA 1F6BA 4XUDA 4CUJA 1S9DA 3ZCTA 1AN9A 5ENDA 2PUFA 4C4YA 3OQ6A 3KAKA 2RHJA 1N1DA 2P4SA 3KTFA 4NBSA 2JCYA 1OW3B 2HA7A 5CTAA 3OUTA 4A91A 3B7WA 3D3QA 1RI4A 4P4LA 4OGGA 1U8AA 4W8GA 1Y1SA 3BRWD 3CKYA 3UAZA 2AG6A 2PT9A 5H68A 1M0TA 1KVUA 1F8FA 4TKLA 1R1DA 4OK6A 1P4RA 3OCYA 3MJHA 2DULA 3FPFA 3PG5A 4OU4A 7MDHA 5L7TA 3EA4A 1PLLA 2W6NA 3OOEA 4AMGA 2WDZA 2XLBA 3HDJA 5HBGA 1FU4A 1C1DA 1OV4A 1Z6TA 2VJAA 4JX8A 3NX4A 4MRPA 3EQZA 4NJMB 1SB9A 1Y9DA 4PRLA 1R15A 1ULTA 1E0DA 5AJVB 2QR5A 4YJ2B 3PUYA 1L7EA 4RSRA 5H7XA 4DJ5X 3V4FA 3IHWA 3WHPA 1BRTA 2LXNA 2NVBA 3OA0A 2YVUA 1Y63A 2XTNA 4N5IX 2GYUA 4V0ME 5J63A 3GP8A 5AIAA 1M0WA 1XIVA 4REOA 3NBQA 2O14A 4ZU6X 4A36A 3UANA 4L6AA 1KIMA 1D2MA 1I2BA 2R7AA 5JO9A 4TROA 1PFUA 4GOKA 4BBAA 3V8BA 4RZSA 4F4UA 1QE5A 3QPUA 3A6DA 2A35A 4BTLA 1AK1A 1GGVA 2JGJA 3R3JA 4GPBA 2Z6UA 4BNVA 2GCOA 2JA2A 1JQDA 2Q27A 4IFBA 3QOWA 2BFDB 4OHRA 4OI4A 4C1NA 2P3QA 2Y1EA 1IUOA 3F74A 1AV6A 5TPZA 4EVSA 4HLDA 1WP9A 3OZSA 4A8TA 1GR0A 4XZ3A 1K8YB 3AFMA 4NHEA 4NMMA 4NYMQ 4PBSA 3RIMA 4DFDA 2XDAA 3OE7D 1E6CA 3SFZA 2WJ3A 3MF4A 3U48A 5BNFA 4KLAA 4HAYA 4EGAA 2HPVA 4YV2A 4G5FA 2H11A 2IU0A 4KGXA 4JMLA 4RACA 2WTAA 2AV6A 4NC9A 1N77A 1IHOA 4NYIR 4PU8A 2QMOA 1MDBA 2RGAA 3GRFA 1YRYE 3H7AA 4RFSB 5A2GA 1EK0A 2IHZA 3WAKA 5AESA 1XCPA 3M81A 3MLBA 3PPIA 2ZPTX 4I81A 4CJXA 3SX2A 1IY8A 3CJRA 1WCWA 3D5TA 2OG1A 3TLYA 4LF5B 2JRLA 4IZ6A 3OJCA 3QZUA 5CYOA 1WXXA 5CFLA 1RSZA 2PH7A 3LP6A 2QQEA 1AHIA 1AQNA 4CIXA 2V1XA 3FA2A 3HYLA 4HPJB 2XZLA 2X9VA 1ADFA 3LT2A 4XAQA 3IDZA 2GA9A 1IM2A 2PD6A 3OAAD 1C14A 1E7YA 3GBVA 3RSHA 3QU5A 3VH2A 4PPNA 4AO6A 2GJ9A 3HU5A 4EFDA 1E2MA 4Q00A 4GSLA 4OQYA 2WMYA 1K8RA 1OLOA 2UVPB 2BGTA 4YECA 3SYRA 4LKRA 3I04M 4AJIA 3DQPA 3NHRA 3HDHA 4KKXB 4KLRA 4AG5A 5D8DA 1MX9A 5DYYA 3ECSA 3R5TA 3VU0A 3U6BA 2AR7A 3BQMB 1P4HA 3B2EA 4OXQA 4L5YA 4CF5A 1KTIA 2J0SA 4QO7A 3A1WA 3WNDA 1TECE 4BZPA 4E5KA 2HB6A 2PA3A 4EM6A 1DIHA 1SD2A 2HUPA 3HCDA 3DMPA 4YTEA 1FUIA 2ZUVA 3ZCRA 1JKXA 1SD1A 3RJZA 4N0QA 1PNRA 1E94E 1NBAA 2XB8A 3TBKA 2IP1A 2YY6A 2JHFA 3OT1B 1T2FA 2VDQB 4XDHA 5HF8A 1ATIA 4K6MA 4D9EA 2H59A 4LOKA 4E07A 1N2HA 1G5HA 2WUGA 3D6AA 2ZGVA 4D26A 4TUYB 2OYCA 4JVNA 1SCQA 4OQMA 2C58A 4AKIA 1C9NA 1ZLXA 1JHZA 4B82A 1RXIA 1MO3A 1N0WA 1O6ZA 1SNYA 1YDEA 1ZXLA 2P9HA 3E5RA 4P84A 2H6EA 4G89A 4JLDA 5AH0A 5K0NA 5TS2A 3MGGA 4CMCA 2W8BA 5KSYA 3EIEA 4ZYUA 4C0KA 1QG0A 3R5XA 3RROA 1QBKC 1TO2E 1E1NA 3U39A 1P77A 1ODSA 1TJYA 2FW6A 2IYWA 1L7XA 3LFUA 2C04A 1HSOA 5CX4A 1PR1A 1TRHA 2QRNA 1K08A 2F7SA 2JIZD 2X9NA 3MCUA 2WOJA 5KVSA 4P86A 1Z6AA 2NUTA 3L8CA 1Q7BA 2PUAA 2B9EA 1TU0A 5D6OA 5ELMA 1DCKA 3TYXA 2DH5A 1DPGA 4ARAA 4ZJYA 2JEOA 4I8IA 5JASA 1IVNA 2QWXA 1CY1A 1SKMA 3EULA 3KXPA 3NYIA 4OAQA 1RHMA 1MMFB 3NDPA 1P45A 1PFYA 1SY7A 2D2VA 5KYWB 1Z8NA 4RD4A 2EGHA 3O4VA 3ID6C 5KNLA 4B0PA 2HMVA 2ZRKA 4B4DA 3QWBA 3TSWA 4CM5A 2A78A 3WKAA 2GRUA 4V0SA 3TR6A 3ZWVA 3VR5H 1JR4A 1U9IA 1V6AA 3BZWA 4RWZA 3JQCA 4L4SA 3BIXA 3QVUA 3ZQKA 2D62A 4JB2A 3BE6A 2BEVA 1ZHFA 1DULA 4INZA 4A26A 1KEZA 4YUXA 1MHTA 2RHHA 2Y3IA 1UR5A 3IILA 3IR5A 5BR4A 2VVTA 4KXUA 1U04A 1MTOA 4GZ3A 2PSJA 5DGHA 3IXQA 5H70A 4YXWD 2BHNA 1ZKMA 1ZJJA 4M76B 5EE1A 3DMRA 3COZA 3GUCA 3RABA 1MAHA 1HTWA 1R6TA 2C3MA 3PGKA 4W6ZA 3OKCA 3OZUA 4D7AA 1IBSA 1C50A 4MS4B 2WPDA 1RR6A 3AIIA 3K70D 2GFQA 5KOIA 1WSDA 3FMPB 1KSFX 4D9HA 3LK6A 4HC4A 3THWB 1KJQA 1D09A 2PGAA 2YFYA 4FR5A 3OM0A 1NU6A 2J0UB 4YR7A 4LSWA 3DZCA 3EQ9A 3N1UA 5CLFA 4HBGA 5MGNA 1O9GA 3OZEA 2ZJZA 1OX5A 1IN5A 3SQNA 3EQ8A 3LC0A 1JDZA 3FYMA 5T64A 2RGRA 5AVKA 3T4XA 4FFBA 3IBGA 4K86A 5BYAA 1UC5B 4OK3A 4LC9A 1N1MA 4J6EA 4M6WB 4IINA 3WP1B 1UAYA 5IVIA 3HYCA 1V37A 2X7HA 3A36A 1VG0B 4PZ0A 5ELXA 2C4MA 5ETJA 5IN4A 4L95C 3KHTA 3G2QA 5FOUA 3V3TA 6LDHA 4JROA 3L7DA 1O87A 3N8KA 5I9TA 2OSVA 3TWOA 1V5EA 3VNVA 4ZJZA 4B17A 2HSEA 1FTQA 2XZPA 2YC2C 4KDFA 1T0JB 3ESZA 2J3DA 2E89A 1PZXA 2O3TA 2AFHE 2QX9A 2ZIUB 2DJIA 3QFHA 2JGLA 4JP2A 3AW8A 2XEDA 4H1HA 4BBJA 3E8MA 2G67A 4L5BA 1YR7A 4FBIA 4BV3A 1L5HB 4ZIRB 3BB4A 3NOVA 3WB1A 4PG7A 5KYWA 3IERA 2B3DA 1Z4LA 2HQBA 5JPDA 3TLAA 3EMDA 1Y5NA 3LXMA 4RS4A 2O2IA 2ORWA 3JARB 3AIKA 3X44A 5BW5A 4C4RA 4MVJE 1NMQA 2FFBA 5JCJA 4LTDA 4F6RA 2H3EA 2OBFA 4JU9A 4ZDJA 4Y8VA 2FZEA 3OIWA 2CHGA 1UKEA 1WU7A 5JH7B 1CJKC 1JLKA 5KDLA 1DWKA 5HJ2A 1VQ1A 4M1WA 3G2HA 5F51A 2RAFA 3ZIAA 5BV1A 3HU3A 3SXJA 1QO0A 3UJHA 2JF0A 4X1YB 1TUBA 2EP8A 4GUAA 1CK4A 5CLHA 4D2IA 1J8DA 3H8JA 4TXNA 4Q9JA 5B7GA 2PAFA 4V2UA 3C0KA 2JIRA 1NAHA 4IDGA 3SSNA 4D3DA 3K0KA 5IHPA 1NYRA 4RSHA 1M3SA 3IUYA 4J8PA 4N5HX 1J5EB 1XR3A 4PX3A 4LJ4A 3DEFA 3OX4A 1EX6A 2N47A 3WIOA 1XBTA 2WB4A 3G02A 4G4SP 2W2PA 5DSTA 1L7NA 1M2OA 1T9AA 4R1UA 4MMXB 4PN7A 3ENKA 4XGRA 1UM9A 1PWYE 3ZEAA 1NLYA 1WCYA 3DF7A 3ICWA 1X2BA 5C1OA 3LX4A 1FPMA 1JZQA 1L7OA 4PLZA 4QU5A 4XSVA 5AQEA 5D01A 4ZN6A 4LF6B 1N78A 2CNNA 1HT3A 1PAUA 1XEFA 4AFNA 4HVCA 2XEXA 1NC3A 2EBHX 4CM9D 4X7MA 4HDMA 3I09A 3P9CA 3KKQA 4PG6A 3OX2A 2DCUA 1R0SA 4O29A 2PUDA 4KX3A 3ROPA 1JF8A 3U1BA 3D7KA 4NCBA 1UT8A 2HHJA 2RGYA 4DNFA 1NWCA 1ZCJA 4W5NA 1G291 2OE2A 2UVPA 2Y1FA 3EZ2A 4FYVA 1QF9A 2J9FA 2B8TA 2GJSA 1GTSA 3EPHA 1RNLA 4A10A 5BQ3A 3FSEA 4TXMA 5KPJA 3GPCA 3PC8C 2FWPA 4LHYA 4TWRA 1KI2A 2OKGA 2VJQA 4J1SA 3VR0A 4EFMA 1H5NA 1DCMA 3E3NA 3OTGA 4HWGA 3GUYA 1T2UA 4PNZA 1HKHA 1RAGA 1SCJA 4G5GA 4RVGA 5LUAA 3WL5A 5F3RA 2GAOA 2GBIA 3L4BA 5IUJC 1QE0A 3DZHA 1YIOA 3OTOB 5B3JC 2HCBA 2G5GX 1E4EB 3PTAA 3E2PA 2IV7A 3CT6A 2C9DA 1ND6A 1RHRA 3F6EX 4C4ZA 5GQSA 4ERXA 4JL6A 4I6TA 3QVXA 4Q1AA 5EP2A 1E8MA 1N57A 1I32A 4JGGA 4BCDA 1ZNQO 4IIBA 4CKEA 3G0TA 4X66B 3W5BA 1M74A 1OH6A 1PTJC 2ID9A 2QZZA 2G08A 1PTJA 5IYZB 5A03A 1UPCA 1AA9A 1JSXA 1A88A 1P73A 2I3GA 2VUTA 2Z2ZA 4ZOEA 1F12A 1LI5A 1IVYA 2IU7A 3VC2A 4RVSA 3WNQA 1U2PA 4K2HA 4NH0A 1XG5A 2G9VA 1QWOA 2YHIA 3DE0X 1QTQA 4HNGA 2MYPA 4G6ZA 3K30A 5JEEA 4RH0A 1A8QA 2D8AA 5LIRA 1PL6A 3CLTC 3ZI0A 4D8YA 1P3DA 3DBVO 4UDOA 3UJBA 3RS8A 4PSKA 5M2QA 1FJGB 2GXSA 3OJFA 1JLHA 2FMKA 1CUGA 3G9ZA 2YMLA 1JL3A 3OBBA 3BD8A 5TMEA 3ZIDA 4MEAA 4C88A 1IQPA 3L1UA 4F84A 4RXTA 3C1OA 2QTRA 5DIFA 4BIMA 1IJKA 4Q2JA 2X0NA 1E3WA 1GCIA 4LWOA 4IFTA 4EX7A 1KZ9A 1R8SA 3I4CA 4DV1B 1X7ZA 3EVZA 3LVBA 3H1EA 2B5AA 2HK9A 3E4DA 2BFMA 2I4LA 4F0JA 4I1PA 2FUG1 4WX2B 2JD2A 2GYWA 4JOCA 4UNQA 1KO1A 2OBYA 3W90A 1GIAA 1TM4E 5BN3B 3EZXA 5AXCA 4URFA 1WCV1 2O2JA 4R9RA 4K1LA 1X8JA 4MS1B 1EVJA 2QPAA 2VSNA 5ALHA 1PV1A 1QMPA 1QV9A 2P6PA 2H4XA 1KWKA 1AK9A 2I8CA 2O1WA 2UYQA 5LMCA 1TD1A 4PQFA 1SHJA 2E55A 2QL5A 2YXBA 1WUTA 1T29A 2HNBA 3WJAA 1R69A 2GHRA 3STUA 3DZ8A 1I0ZA 2MYTA 3AVTA 2VAXA 3FNEA 2ESRA 4KUHA 4MA4A 2JS7A 4J0GA 5BVGB 4XIIA 2K6GA 3GZNA 2GM4A 1DL5A 2GJAA 3DM5A 2PIDA 4G5RA 4QLOA 3PEVA 3S5JA 2I03A 3H16A 3KG2A 4MJ3A 4TUYF 5H3HA 3TMKA 2ZSUA 3D6TB 5SY9A 4IUCS 2AI3A 2FPUA 3QVWA 1E9EA 2I62A 1UPTA 2PWYA 2WV7A 4ZYZA 1G21B 1MGPA 2NO7A 3S6JA 4ZZIA 2C5BA 3GA0A 3P2KA 3FDZB 4TYMA 4NCAA 1JKFA 2W6IA 4YASA 1QK4A 4MI9A 1KP3A 1RCUA 3CVWA 1RCTE 3TELA 1ISPA 3I39X 1DOAA 4GF5A 2JZCA 2P2LA 2RSLA 3TTTA 4HLCA 3ZDBA 2I2XB 3U09A 1G8JA 4M1ZA 3GLIA 4M54A 2DPGA 1KQFA 5A4AA 3JYLA 1Q0QA 1NUSA 3NHSA 1EP1B 1CZOA 5FBQB 2WZBA 3O8DA 1KTVA 5LA6B 7ABPA 2OCPA 1TZBA 4N12A 3S99A 2QSYA 1DFIA 3O2JA 4XX1A 3AETA 2QQGA 5AW8A 2XKKA 1I2ZA 1JWLA 1OR8A 1W0JD 2B1RA 1R9GA 2VK4A 3A7DA 3F4BA 4H7DA 4GRAA 1M72A 2A92A 3RO7A 2JFNA 4GVLA 1E5TA 1FP1D 3IALA 1AS0A 1WVMA 4JYBA 4YO8A 4WXEA 4YJHB 1T8PA 2WSLA 4Z99A 3KQLA 4DV2B 2VPIA 2E3JA 1ZINA 3GEGA 1GTJ1 2AK2A 2Z6VA 3W6PA 3MOGA 2YDYA 3W3ZB 1AX9A 3C3PA 5JWHA 3STXA 4DCGA 4URVR 1WO8A 3SXUA 3C5CA 3EPKA 1XWRA 1Q0SA 1T10A 2I0FA 2YL2A 2FG5A 3A3NA 4OQPA 3SS9X 4NH4A 2Z6QA 1II8A 1W5AA 3EZ6A 3GLFA 1GG5A 1NMXA 1OXSC 4RH1A 1XDDA 4HB3A 5KMGA 5JALA 1NLFA 4IV0A 4R1SA 5BPFA 1QOPB 4B6PA 4UXHA 1WU8A 3RSZA 1FFEA 2TRSB 3CCFA 5IDXA 1EWYA 1KI3A 1YO6A 3F90A 2X5OA 4RHEA 4WACA 1PT6A 5ILGA 4AULA 5IK2A 3N0TA 3PKZA 4ZVOA 3GN5B 3P2IA 1L5VA 2ZTVA 3K0FA 2I65A 3PU6A 4J2OA 4ECEA 3U44B 5HRCA 2AVDA 3V4VB 4DRXA 4XVUA 1N2BA 4HWOA 2BY4A 3OZWA 2B4AA 4PO9A 1KP2A 3INNA 4R7TA 4ZQCB 2UXDB 4F9TA 2O8NA 1GCOA 2NLOA 4WE3A 3UOGA 4BC1A 3WV5A 4Q4CA 4MUIA 1JLMA 1V8BA 3RHZA 2PGJA 1GGNA 1UIRA 4ZA2A 1P5HA 1HGXA 1SWVA 4XIGS 1ZIPA 3EVFA 4KK3A 1EXNA 2LUOA 2FFHA 3D31A 4BFLA 4E08A 4QJIA 5JAZA 4EG6A 2GYVA 2GFHA 4ZCPA 4PAQA 2X0KA 4KN8A 4M9SA 1YS7A 2ZYSA 3RFXA 3ABOB 3PR2B 4C08A 1W0KA 3GARA 1OI3A 4D6XA 2GZMA 3KR9A 4UQLA 2QX7A 3KPJA 1VJ1A 2H57A 1BXRB 2A9OA 3HE3A 3OICA 4FB4A 3DE6X 4FNAA 4HFRA 3WISA 2DERA 1RJDA 1ZNZA 1AMOA 1R6BX 3NTQA 1JS1X 4ZVTA 3B1YA 1G41A 3C4JA 1HLFA 1HG1A 1TEHA 5KQPA 1RJWA 5K3OA 3ETGA 1ULBA 3HUUA 3HB9A 1N4DA 4ZC8A 3COJA 4DKJA 1XMVA 2LYJA 1KYXA 5F76A 1MD9A 3KLNA 2KEJA 1KORA 3IOCA 4NATA 4B9AA 1X57A 4GT1A 4MVYA 4CDNA 5KYXA 4QKQA 3FCYA 1UJBA 2NU8B 3C6ZA 4J29A 1BH2A 4DXAA 4A0QA 4PZ9A 1UPUA 2RAUA 2B92A 2PQ0A 3OU7A 1U2DA 2ZBUA 1X39A 2WNSA 4MWDA 4PHTA 3VMFA 5AVYA 3IRVA 2KMLA 2BGUA 3GRZA 3HKEB 2EQBA 4WADA 4L9AA 3ESXA 2BFCA 1UBNA 3QUTA 4I1OA 4Y9TA 5D51S 1TTTA 3L6OO 2IWHA 3UMSA 1W35A 3ICPA 2GRAA 4QNMA 3R77A 4J91A 4ZKDA 3IIEA 1V2GA 1WEKA 2O2SA 2OK8A 4FZ3A 4JJ7A 4R3NA 1FX0B 3X1YA 3QQ5A 4TSFA 1E7SA 3BGIA 3CE6A 3PPYA 4NCJA 2ZBEA 3C1UA 4W1SA 4WZAA 4EJSC 1WQ3A 1UPFA 4G85A 3DXFA 1K4KA 4KE9A 1X9HA 3D1JA 4QYIA 4R3WA 3RWMB 1FYXA 4XIFA 5IANA 1HDOA 2PMWB 4D82A 1JJVA 3QVTA 3SX0A 5TARA 5I7HA 1JR3E 1LFAA 3UNXA 3OCVA 5JDIC 1YR2A 3KQUA 4ROSA 3C7TA 3F7OA 3PYXA 4I4TA 1Q22A 1RRVA 1XLVA 4ZAZA 3ZW8A 5KQMA 1SU4A 1O4VA 3LUAA 1FDUA 1OT3A 3DVLA 1GZHB 4RABA 3UIEA 3VKVA 2YFKA 1OWNA 1ZJZA 3Q41A 1M73E 3H7IA 2C8VA 3OF5A 4CDMA 4D0NA 1NKVA 1QXSA 1QKIA 2PTGA 3KQPA 1C7FA 3F6RA 1ZUWA 3I9OA 4E6PA 1C9YA 4WK2B 1VHQA 3O9MA 1Q7CA 2LYRA 5HJ7A 5DX1A 4CM6A 4YR9A 2UUAB 4PLFA 2PJRA 2ZB4A 1RIOA 1VCMA 4PYMA 1NUAA 4KPUB 5L51A 4DNQA 4YRAA 4XDGA 3P52A 5BYJA 4TTPA 1E3WB 1PFWA 2GZDA 3UWSA 1P80A 4MK4A 3VPXA 1XWFA 3THYA 3ROXA 3SP1A 3PFCA 4KMOA 5FNVA 4YMTA 3TPCA 5A5FA 1BVYF 4HNTA 3K32A 2WUVA 1P1CA 1GT91 2DWCA 3C6QA 4TLEA 3MJTA 3K9NA 1S2OA 1EK6A 1YWGO 2EZ4A 5TPWA 1ZM9A 2VQ6A 4UMVA 5GM1A 4X60A 1CUEA 1EVLA 1RHJA 1UBHS 1Z2NX 2LIVA 3E8SA 4U9HS 4AF7A 1XQXA 1P0CA 1PJ2A 2E87A 2PM8A 2GZHA 1LI7A 5JI2E 2VHQA 1PEYA 3KEOA 4JN6B 2DLNA 1S2IA 3OPXA 5B1EA 5J47A 5KU1A 2YWCA 4EUFA 1CY6A 2ZYAA 5IVHA 3I9KA 3JYNA 5CYFA 1M1UA 4ZI7A 1JYFA 5A9RA 4GDFA 2BWJA 4M8IA 1YUNA 5FA8A 1J0DA 1L7QA 2BBTA 3PXBA 4MKIA 1ZLYA 2HA4A 3ZZTA 3QE9Y 2OB1A 4JVSB 1K6EA 3H2IA 1U9YA 1E2EA 2EXXA 5H1YA 2I9PA 5C7OO 2O2GA 4PYOA 3H87A 5DYTA 2H9IA 5B12A 2C7RA 2KB0A 3QXXA 1IUPA 2NZYA 2UUOA 3UUWA 4MP8A 3KTOA 2FSGA 2W70A 1KAEA 1O0SA 2GAJA 1AM4D 2QGNA 2W2LD 2ZBPA 3E2MA 1PJSA 4MAAA 4YQZA 1BVHA 4LRXA 4MRMB 3WP0A 2Z9BA 1DRKA 4FX5A 4ZOLB 4HQNA 3CBQA 4RNDB 4D3XA 1CIPA 1TZJA 2IHJA 3O8NA 3GN5A 4MUJA 1PWZA 5HFNA 4GS5A 3RIEA 1YRWA 1V41E 1Z6GA 5E3JA 1XWWA 3DAFA 1QH1A 4QVKA 4BO6A 1HG0A 4G07A 2NYUA 2AUNA 4YRRA 1OB5A 1CHDA 4GOJA 3K0AB 4RTNA 1SQ5A 4RK4A 1K6MA 3W79A 4B7UA 2R84A 3Q72A 4FSHA 4Q9NA 3ADKA 3VKHA 1H2ZA 4W1PA 3AVYA 5JMOA 2D0IA 1CUYA 1KI7A 1VMIA 2P4HX 5HVNA 5FPQA 4KQ9A 2WD8A 3I2IA 3DTYA 1LD3A 1H2RS 1PEAA 3LKZA 3QRWA 2ZZNA 3FGOA 3EDQA 1YDFA 3WZ2A 5J4HA 4JEIA 3DKRA 2FWNA 3ND8A 1DAHA 2YDXA 3WKCA 4CF3A 2YH2A 3EWNA 3OTIA 1XTBA 4DL9A 2GD2A 2GM5A 4CI9A 4RV4A 5JPCA 1D2HA 4HAXA 5DNAA 4DMKA 4QQFA 4XFKA 1IFXA 4RQUA 1TQ8A 2E4YA 4KPUA 1N5OX 4CMEC 3GRYA 4I3GA 4OGFA 1ZXBA 1ODKA 4UHHA 2IZ1A 1E6LA 1ONSA 2EWTA 2BW0A 4H4CA 1GGJA 2NVOA 1FYVA 3N0VA 1P2FA 2XODA 2ZS8A 4HVTA 5AVTA 4DLPA 4G1EB 1K3UB 2D8MA 2ID4A 3HCPA 3NNNA 2IPMA 4FCVA 4QPJC 2FW9A 2OP0A 4P7JA 5KWIA 3PL1A 4H3KB 3EGVA 1T5TA 3A05A 2EIHA 2Q5HA 5AW2A 2WUWE 3H86A 4AZ3A 3E70C 3IOBA 2CMKA 3KVNA 1TKAA 2CY0A 4PC3A 5AI6A 5TX7A 2V8BA 4WAUA 5LR6A 4CEIA 2HPHA 2AXVA 2Y1DA 3NBXX 2ECPA 4BNKA 5JAUA 1VECA 2EBWA 3PHLA 1SUSA 3CRMA 1OIVA 3AM1A 1U8TA 1OGJA 3FI0A 4WOBA 3TOXA 3B82A 5JVDA 4HKTA 1DEAA 2ZJ6A 1TO1E 4YJFB 4ER6A 2J0VA 1YVEI 3GAFA 4M1QA 1J0CA 4FQ8A 4ZOLA 2JJ1A 4OG2A 1NWHA 4R98A 1N34B 1KAOA 2H00A 2C77A 1NBME 5AOVA 3W5UA 5JU6A 2VWPA 1QHGA 5A4JA 1Z7WA 3EUSA 1J2JA 1GFSA 3WL6A 4IMRA 2B4QA 5EFOA 3T1OA 3HBAA 2VDRB 3B6ZA 4GR5A 3V8VA 1R16A 1G20A 3WJ2A 5FUXA 4CMAA 2EFJA 1KBOA 1M2NA 3GZTB 3MJVA 1ENPA 1K63A 4MJXA 3OHPA 1W73A 5EESA 1O57A 3TMAA 3SNHA 3ORYA 1GAQA 3PDIB 4QEDA 2Q28A 2QRVA 4M0KA 4KODA 1N3IA 1SPBS 3WIVA 1FB5A 3PYMA 3B52X 3DR3A 3BG5A 1U3FA 1OFUA 1HEUA 3LWZA 5BQFA 3LF1A 3FUCA 2POCA 4IO0A 2VSYA 4F4CA 3NT5A 4Y2QA 3PE5A 2VDUE 1LSUA 1GYPA 2C4TA 2W2TA 3GA7A 3ZI4A 1U2QA 3MMZA 1CEXA 4D45A 5K4GA 3P94A 5EKUA 3FZGA 1Q12A 3ZDAA 4EHKA 4I6RA 1SXJB 4KWCA 2W6CX 1MOZA 3GJTA 4R3UC 1P31A 5EJ4A 4BO8A 2EVWX 3KPUA 3Q5EA 2PGLA 1VIVA 1ESZA 4S24A 4XWKA 2CJPA 4HO1X 1FUEA 4I50B 1U7ZA 1HF3A 3ZQ4A 1ZZEA 5JHHB 1ZITA 2OC4A 1QHHB 4R9NA 2ZAOA 3V34A 4L4ZA 4OUKX 4U2KA 2E18A 2GXQA 2J6BA 4R8SA 5B37A 4DYDA 3GAAA 4Y7DA 5CIWA 5CP8A 3NEAA 1KK2A 2H1IA 4LA4A 4UHCA 1H2YA 4FYYA 3D43A 2ZQ5A 4C01A 5J4YA 5HFJA 4HNSA 4F5ZA 3ZHXA 2O0HA 4NBNA 2WQ6A 1Y5MA 4Y2YA 2OQRA 4J1WA 3TFQA 621PA 5KTSA 3QEBZ 2XVAA 4R2MA 5FA5A 1V2HE 2YBDA 1H5UA 4DADA 1Q1NA 2QX8A 5IJ0A 2QU7A 2O8BB 2A1TS 3O4GA 2GZSA 2KBEA 1Q83A 1ZESA 1E0KA 2CFSA 4KRYA 3IJEB 4R2HA 2O59A 5F1OA 4LQ4A 1KXZA 2WA2A 3AT1A 4AK9A 4IH1A 4ZGBA 2MT9A 4UEKA 2JGDA 4R2JA 4XOIA 3TDMA 1Q0HA 3B2QA 4XD7D 3IVAA 4ENUA 1NW4A 5KSWB 1K2WA 2UYCA 1MCZA 1JXMA 4C0QC 5DW3A 3ET5A 1OXMA 1MABA 4LVUA 4E51A 4BNDB 5JNSA 3DGFC 2WILA 2F4VB 3H9GA 2IIVA 2ZTMA 4UMFA 3UXEA 4URZR 3Q8WA 2W2NA 4BNLA 5KMGB 5D3MA 5FWXA 1DJQA 2XW6A 2H08A 3H2YA 2X4LA 4JVMA 2DPXA 4UKDA 2EQ5A 2Q46A 2X1MA 1G8FA 5ITVA 4L72A 4OATA 1NBMD 2FHSA 3BB3A 2HCSA 3E9ZA 1Z13A 2YRXA 3DWIA 4Y67A 3N8GA 2DBYA 4N03A 3IESA 4BZZA 3QTTA 2Q0SA 4Q1EA 4MQEA 3V2HA 4OYRA 2I7CA 1O95D 1YDGA 1ULUA 2RH5A 5AW3A 3P45A 2XNDA 4PFKA 5AUQA 3OZBA 1QU3A 1YZUA 3R3WA 3MWJA 1GNTA 5EFZA 2P2DA 3KL4A 3A3KA 2G0NA 3TX2A 6PFKA 1OWMA 4TXHA 3EGXB 3OP1A 2VZ9A 1ITZA 5CK4A 2BGLA 2YC4C 1XZHA 3D6NB 3S5UA 4MVCA 3ZU2A 5BW6B 2DFDA 2H8GA 2VF7A 4R0NA 1JTVA 1W1IA 2PRJA 4QTXA 3CH4B 2IHBA 2G9UA 1IUNA 3HFSA 2COKA 4HGQA 3K5WA 5DHAA 3ZV3A 1N5DA 3DZBA 3PP8A 2JLRA 5I8ZA 1LLIA 4YIKA 5GOZA 4OV6B 3LPCA 3ZXUB 3ZY6A 3WYGA 2MJLA 4UDYX 5TQ0A 1XZNA 2ZRLA 5EZYF 4I4LA 1T1SA 2QLJA 3UCFA 4A23A 1RRPA 5HKOA 2I78A 3FIJA 3FYSA 3GJYA 4KXWA 4Q03A 1WB5A 4QYMA 2Q2NA 1GCUA 4YCBA 1Z56C 4TMVA 4F3YA 4IRXA 4D80A 5JZ9A 2DMRA 4OQQA 3H6HA 3TQIA 1F3LA 2BM1A 3WTBA 4CIAA 4HRXA 4JA2A 2YWHA 3DYBA 1N3LA 1KS9A 2J7WA 2MDTA 1WHSA 2BMWA 3C14C 3JVDA 4R8KA 3QP9A 2X6QA 2E5LB 4UCFA 1HE5A 4R84A 3MJFA 3KU4A 4IIEA 2IYRA 3OQIA 4WY2A 2NG1A 2P62A 1XNHA 3HLYA 2RD2A 3HRHA 2AFIE 2C7VA 3OJWA 1T25A 2C7BA 2CDBA 3HWWA 4X7BA 5L3RA 3Q88A 4K40A 2PFKA 3PJDA 4R9UC 3TI9A 5JROA 3QU4A 3ZD8A 4ZDIA 2VRCA 3KAQA 1UBKS 1IRIA 3EVTA 3BZBA 2J0UA 1QHNA 1DRWA 1XKLA 4S1NA 2XCQA 3FGPA 2DR3A 3Q1LA 2HTFA 1YFJA 3KXDA 5HMMA 1QP7A 3BXZA 5BSFA 3LWNA 4D9GA 3O1HB 1Q19A 4WBXC 1A5BB 1TLFA 3K1AB 2JKVA 1R5OA 2IUTA 4B6OA 1EUDA 2WU1A 4Z58A 5A06A 2HJ9A 3T6KA 4CI0B 3PT5A 4BMXA 1ISMA 3GVCA 1L5MA 4DWJA 1PZMA 2PZKA 3ROFA 3TB4A 1COWD 1ZGHA 2VAWA 4CE6A 1HH4A 2HWUA 2Y76A 1MRZA 3GFSA 3WIDA 4BRSA 3UY4A 2FUG6 2H4HA 2JJYA 4WUTA 3RUDA 2BBSA 4OVKA 5J4VA 3D4BA 3O26A 2PV0A 4P83A 1K5PA 3P96A 1B8VA 3I9NA 4UEWA 4V3BA 4NBUA 1Q0LA 4MW9A 2HF7A 3FAKA 3J7TA 5AOBA 5HF9A 4DSAA 3RC7A 2PZGA 3TXXA 4ZRMA 3X1WA 3L7CA 1QYXA 1W6RA 1JHAA 1E8DA 4ZVUA 4Q34A 4DNXA 4NOMA 3PPWA 1T3SA 2QI9C 4I5IA 1CDZA 4QWMA 3PIDA 1XQ6A 2QJWA 3AWDA 1RYFA 1MAVA 4YRMA 2ZROA 5JBNA 4EEZA 3U7HB 4M8KA 5E7JA 3RQIA 4I19A 2YN2A 3NVKI 1CWUA 4ANFA 1R4MA 1PHPA 2C98A 4N65A 6AT1A 2IITA 2JGIA 5G0TA 3TOCA 4WZBA 3N2YA 3LY5A 3BD9A 5AR1A 4TV9F 4CQNA 1OTXA 2J07A 1CV2A 3H1BA 5DTMA 4PE5B 3K16A 4CM1A 4HDKA 1IPFA 4M86A 4Q1DA 4QDKA 4JVLA 4NX2A 2XZTA 4LYFA 5TGDA 1WRBA 2M98A 1WF6A 4AY2A 3O1IC 3PVZA 5CT8A 1JSLA 5AT1A 4MVJA 3OQIB 1BEUB 1DJPA 3E84A 3AXTA 4WY5A 5FEMA 2MR6A 2GUWA 4FOTA 3QGMA 4BQSA 4CR8A 3WA6A 3NP9A 3KJFA 3AERA 4L1KA 4MB0A 3SSMA 1E5QA 2ZETA 3ILYA 1LPPA 4D8TA 3KKOA 3IPCA 5J5VA 3ZD9A 4KN5A 2XNCA 4ZPXA 2N1MA 5A0VA 4PZLA 4X64B 3ZHMA 4KIGA 10MHA 1NPYA 1WP4A 3ZXIA 3ADDA 2V4UA 1R0RE 2WYVA 2Z5VA 2X7JA 3ABIA 3TLXA 4EAAA 2QVCA 2B99A 1S01A 3QHQA 3B9BA 5EWLB 2XXPA 4R5MA 4YC7A 1IEXA 2VSFA 3AHFA 3GLRA 4JQYA 4E3WA 1S7GA 1VMAA 2FVYA 2OILA 1VFNA 4IV8A 3HEMA 2ZXUA 3U6KA 1K6IA 3O0DA 1ZHOA 2PKEA 2J9FB 4Q4AB 1ZJYA 2VHUA 5E1OA 4ZVRA 3TCNA 3M4JA 2VSOA 3TH5A 1GRCA 1UWCA 3U44A 1E61A 4QUKA 3SQDA 1MNQA 1K7EB 4L3VA 2OT3B 5CA1A 3GIDA 2PUEA 5J2TA 3UHAA 5EHIA 3OPYI 1J1UA 5A7HA 1VYHA 2ZBQA 2X1HA 3ONEA 4U2EA 4N3NA 3W2HA 2IX9A 4BFXA 4YV0A 2MINB 1EUCA 2R25B 3MTAA 5CCXA 2DFNA 1FW8A 2AYYA 1ONNA 3QNUA 1KAGA 4HDSB 4BPRA 2OORC 3KO8A 1FNBA 1IK6A 1YQEA 4S1PA 1K7XB 4DHWA 3VR3A 3OOYA 2W11A 3RCBA 5K8CA 2I4MA 3FYCA 4FYHA 3FBTA 4L57A 4MLZA 5BSHA 1DBVO 3O4JA 2ZRPA 4GECA 1EB8A 1E32A 2ZRQA 1R9NA 2V7QA 1HT1E 1O6CA 1QB7A 1RYYA 2Q29A 1BJRE 2HO4A 5EJGA 3BCUA 1BC5A 2ZRAA 5DGXA 5ALMA 5B6JA 4YXFA 2PSSA 4RD1A 1G38A 1HQDA 2FN7A 3OSUA 4ZV4A 4DLTA 1T91A 2FUEA 1EJBA 4YP7A 2ZU6A 3T3OA 4EJ2A 1DVRA 3E9QA 1I80A 1TM7E 3H6KA 1LK7A 1XX6A 3PHIA 5K3DA 3V1LA 3RBZA 3I6QA 1JQEA 1MORA 2F00A 2QG6A 3AEUA 3H1FA 3R3ZA 4R8MA 4UHFA 5TT0A 3VHXB 4PYJA 2DUWA 2XMSA 3KQNA 1BDIA 2DUJA 4FT4A 2H1RA 4GZMA 3ML1A 5DKFA 2W42A 3RKRA 1B8UA 2JIBA 2EJBA 2W7TA 3IPAA 4N8EA 1TQHA 1V7ZA 2AQIA 5ELLA 1T9BA 3FY4A 4EA9A 1E4OA 2AW3A 3R3XA 3KR0A 2BEJA 1KAQA 2YWXA 1GU1A 4QICA 2JVLA 5LDGA 4X8OA 1B2LA 4WJKB 4QAQA 4PTYA 5EMLA 3ZHSA 2FTKE 2FV8A 2YQZA 2ZBFA 3SBEA 1P6UA 3IQEA 3QF3A 3ANMA 5HGXA 2B4TO 3UHJA 3OG9A 3GUVA 4OLHA 2WWFA 3U81A 2QTWB 1W34A 2APJA 3M34A 2CHFA 4YV1A 4FHFA 1Q11A 2WFAA 1NVMB 1Z18A 3OFND 3ICOA 4OXXA 5FUBA 1A8SA 5CLQA 4D46A 3EC7A 3OCZA 3L8FA 3UK0A 1BXKA 1E3TA 3IT2A 1X1CA 1T6BY 3LAWA 5DM2A 5EMNA 3ZV6A 2BZSA 3WGIA 2IYTA 2FW8A 1NN3A 5BVGA 2F3TA 3HXKA 5FJJA 5H9VA 1UBSB 3QYFA 1SU6A 1X2EA 2H48A 3IO3A 4QXMA 1R0BA 3RS3A 4FMBB 3UYLA 4HEHA 2GK4A 4NCKA 2ZI7A 5DTRA 4N3AA 4MI3A 2Y8EA 1J23A 5ALIA 4C0BA 5JY6A 3KEFA 1TW3A 5HNKA 2PX6A 1Y1RA 5KYVA 4EYQA 1LBSA 3BD6A 2LCQA 3P9YA 4YRNA 1Z45A 3GELA 1BG6A 3K2BA 2QR3A 4LVOA 3B60A 5JLAA 1YF3A 1T1IA 3TKAA 1XD9A 1KY5A 1IRXA 1JLLB 1GR1A 1TTHA 1V96A 2QYTA 2Y4OA 3GT0A 3EGDB 2C2OA 4HPWA 4O4JA 5GVRA 3MFQA 1NM5C 3V1TC 4AJJA 3I5YA 2VRBA 3IPYA 4MEBA 2WJAA 5L8VA 2VPTA 1OE0A 1FZTA 3DOUA 2C2GA 1DU4A 1FDRA 1DEXA 1I4DD 2BKVA 3CLHA 2BZ0A 3PK0A 4JJEA 4JUFA 4S1VA 3DE5X 2GR9A 3TLCA 4G8JA 4ENVA 5LJLA 3PKIA 2GSDA 5JJLA 2J7KA 2RKWA 3TW4A 3ZK8A 1P29A 4FFDA 1WBBA 2BEUA 2NSDA 1QB2A 2GN0A 3FOWA 3ZYZA 2HZBA 4A2CA 1A8UA 1Z0DA 4D02A 4F4HA 4ENRA 1H9CA 4Q4HB 2LRHA 5DM1A 5CT5A 2HIHA 3P9XA 2IXEA 3CC8A 4IEEA 1RWVA 2CZCA 3I52A 4L0CA 3WDSA 3WMWA 3WDLA 2HHHB 1K5DA 4K6OA 4KBGA 1FVXA 3VPCA 4BNTA 4C29A 5AK6A 1LI4A 3MQ2A 1JHVA 3AL3A 3QVVA 4GH5A 5B1YA 1YCGA 1B3BA 1N2OA 3F96A 1AOXA 3EE6A 3TRIA 4DUYB 2QL7A 3OF2A 4HLUC 3ZWMA 3U4QA 1CDDA 1P72A 1XZBA 2JZOA 4WN9B 1KVTA 4TRMA 3BGWA 4BRZA 2IBMA 3HB4X 1TYDE 2DPLA 1NBMA 3LO5A 4PNHA 3T7TA 4HYEA 4EARA 4FDAA 5JPIA 2GNOA 3K73O 3HWRA 4JLWA 2WVJA 3DMGA 3GWGA 4F3KA 1RRGA 1D4OA 4RTPA 2FEKA 1AZWA 5HFAA 2DCMA 3BF7A 2QLLA 4PG4A 1HQKA 4JC0A 4LK2A 2JLZA 3FTDA 2GN8A 4ZVMA 4BWVA 4AMVA 1C9EA 2A4MA 1GT0C 3NBAA 4NECA 3W5AA 1W0CA 4KN6A 1ZP6A 3O3CA 5B1IA 1FTGA 4POOA 4RJIA 1DT5A 4ZAGA 3LUFA 1IBMB 1DWUA 1I1NA 2FA9A 4L8WB 1EG7A 3RE1A 1EZZA 5CM8B 2PX8A 3ACCA 5A5DA 4IQ0A 2HCNA 1Z2PX 1N5IA 1OD6A 3MD9A 5H5JA 3RRFA 2I54A 1RM0A 1TJNA 3PC3A 2B78A 2WJJA 3I42A 4DJEC 1PV2A 4QXPA 3U4IA 3RUCA 1S8OA 3NNDA 3EXEB 4UEOA 2AUMA 3E7XA 3M2TA 2V7BA 4PG5A 3RYFB 4DSZA 1PFQA 5GINE 1SXQA 4K2AA 4D4JA 3KB6A 2GX6A 2IPNA 3SDBA 1MH9A 2O5CA 1IZ8A 1PYGA 2NTEA 4ZFNA 3LPNA 5DRYA 1UKAA 4GM1A 1XEWY 3T4EA 3WB2A 1WH8A 2FPSA 3RRMA 4ZEMA 1YZTA 2ZKLA 3S81A 4BY9E 4H6VA 2CBGA 4Z7NB 9LDBA 4RTJA 2FN3A 1VJ0A 3DVRX 4B2PA 2YXPX 3QE0A 3W0LB 4DBZA 1ZEMA 2D2IA 2ZR7A 3FKSD 3AK4A 4X4DA 1TEXA 3TFLA 4NU0A 1E2JA 4MQ6A 3VHLB 4U0KA 2WWRA 3JR7A 2KLBA 2WNIA 3GLQA 4P32A 5E0OA 3SQWA 3MRXA 2WF9A 4LYJA 5M34A 2P5TB 2DUUA 3NORA 4HFNA 4MVJI 2JGEA 1DKMA 6NULA 2BM8A 4MV4A 1EK2A 4EG5A 1PFVA 2J3QA 3EEFA 4DLWA 1P2DA 2VQ3A 4PZCA 4HAUA 4P7KA 2CVHA 4ER3A 3KUDA 1LQ2A 4UE3S 4HX9A 5AI9A 3PUHA 3WE7A 3QM1A 4XR9A 5IH7A 1QF7A 2XCIA 3WYDA 2NYAA 4KE6A 4O63O 1BN6A 2J31A 3IVGA 4JCCA 2LYKA 1U2GC 2PX0A 4WH0A 2MINA 4XWGA 3SYLA 2TYSB 3I9V1 1BXZA 1XLTC 2QMHA 1HT2E 2R5NA 1OBOA 3KU1A 1M8JA 2EZ9A 4KQGA 1L5KA 3T61A 1MLDA 1YCDA 3I73A 2H18A 1TXGA 3PUVA 1PG5A 3AWIA 4EBFA 1VKNA 2NPOA 4LXTA 4XYMA 5K4HA 3AOGA 3VM6A 2Z5FA 3E53A 3SYNA 4NDNE 4C14A 1G59A 3BAZA 4TSRA 3D8BA 3UG7A 2QVZX 4DMLA 1O6GA 2VF5X 1L7MA 3X1ZA 2B83A 2HLNA 1F8XA 3AYZB 3HA5A 3K4HA 1UBGA 2LCFA 4MPDA 5TRTA 4Z0PA 1IHXA 4NCHA 5BSGA 3IIIA 2J41A 4HYQA 3ROGA 4YX9A 3QKSA 3RWOA 3MXOA 3CH7A 4D79A 5J4KA 3DZGA 3KUUA 1GUAA 1I5RA 5L3VA 5AM0A 3LIIA 1J07A 1E3LA 3LL4A 4FDLA 3DBHB 2QNIA 3UV3A 3HA7A 3IH5A 3H6GA 1JU9A 5ALYA 3ASVA 1GYQA 4YP1A 1SIOA 5AKHA 1KRWA 1J1IA 3CWQA 2F43A 4PFQA 3BMCA 4HEQA 1DRUA 3DV0A 4RK7A 3LPLA 5CA1F 4GKKB 4W5JA 1Q0PA 1Z7GA 4PYNA 3AERB 1M75A 1D1QA 1JA9A 3UQZA 3EPJA 1V1JA 5NULA 4MCTA 4N5LA 3NTLA 1W5SA 1BXRA 5AXAA 5A9SB 2NN3C 2ECOA 2BSXA 1I7SB 5AKIA 3EA5A 1A9YA 3IE0A 5IHXA 3PIRA 2XIUA 1E2NA 5EXSA 3CZQA 4PEVA 5FT9A 3EXHA 1DNPA 2C0QA 4FOSA 1B42A 2YFQA 1UMCA 2E5WA 1Z5PA 2HY7A 2JGMA 1OHHA 4KXYA 2VPXA 1PERL 1LLUA 1QH8A 5EIWA 2IVFA 1KOGA 1KP9A 2J67A 3ASZA 3LDHA 4EYEA 4ZOBA 3T7EA 3WRWA 8LDHA 3EF1A 1PG0A 3MT7A 3AR6A 4E94A 2ZCJA 1M2VB 3NASA 3OO1A 4M0EA 4W9NC 5G3YA 5GONA 1KY3A 4AF6A 1CR6A 1ZM7A 4W5RA 2MWMA 3DR5A 1AGPA 3LCMA 3DUWA 3KKPA 1ZD2P 4H31A 1AE1A 1C29B 2Y68A 4GGPA 4JR0A 4QFBA 1KZGB 2KPOA 4P81A 4ALJA 4CWAA 5FA6A 3ZZUA 3T5DA 5TC4A 1W5BA 4BYGA 3A3OA 1U5AA 3GQBA 4LQDA 3WXMA 1D8AA 1H9AA 1UEJA 4KO8A 4ZI2A 1QTRA 2A0XA 1DDIA 2AWIA 1WM1A 1RRKA 4WKCA 2B69A 2OFYA 1O7JA 3C8MA 4H16A 1LUAA 1RTKA 2VZEA 3IE1A 3R75A 4YCCA 3Q7QA 5FX2A 1NF3A 1RLJA 1S3FA 2AFIA 3G0IA 3OHSX 4BU0A 4C0AC 4N7BA 3AB8A 3H5AA 4F7DA 2VQSA 1BH6A 1E7WA 1Q1EA 2YINC 3DE1X 3TLGB 2CWDA 2HIAA 3BL5A 3D81A 3JATB 4WOCA 3EA0A 5DSXA 5IBQA 5ES3A 1F6WA 1NI4B 3L8GA 4IDNA 4O1HA 3USCS 2GI4A 1R66A 1ULAA 4DR6B 1P9NA 2AI2A 3EVDA 3ER6A 3B5IA 4FHEA 4L15A 4DNPA 2X8WA 1NVGA 2YNMA 1V6CA 3ENWA 3LA8A 1U80A 3TK1A 4DILA 4GLOA 2MIIA 3GY0A 4E4TA 1J7KA 3UAVA 1W36D 1EINA 1RACA 4MCIA 3V2UA 2HC9A 4LY9A 1XDUA 3JALB 4R2KA 1ZH4A 1SUAA 1LB1B 3AR5A 3VU3A 4Z1OA 2DWPA 2WKQA 2ZK7A 3CT4A 3O92A 3Q7EA 4WIAA 2CUZA 1PZGA 1GGEA 2B34A 2CL5A 4ND1A 5FADA 1IC8A 1SHKA 3DMYA 2CLFB 4EF6A 3KQSA 2FQYA 3VZCA 2VSXA 4ZP1A 2C61A 1FRFS 4GW3A 3B48A 3M5CA 3VWSA 1WPGA 1W0KD 3QKRB 2D1QA 3MTEA 5DGDA 4R71A 2L42A 4G0XA 1DP4A 2N46A 3OM9A 3QLUA 3BIOA 2VDMB 3NTOA 1HE2A 4LDZA 1USIA 4YJKA 3EOZA 3OETA 2GN2A 2WIKA 1ACMA 4AZWA 3H13A 2XMDA 1TCCA 2WKRA 1HKUA 3FRJA 4XARA 4BV9A 3PQ8A 3PA8A 1YRLA 2VJKA 4PIMA 3ZWWA 2B36A 2AMFA 3NWPA 4MEJA 2PLRA 3P9KA 4NFHA 2YYZA 3IUJA 4Q3BA 5DBFA 1HWYA 2D0DA 5ESXA 3EGIA 3K0FB 1JTEA 5BOVA 4BYMA 2ONZA 2V7GA 4GX0A 5CG2A 3AZQA 3ZU5A 1BDMA 1DBSA 1JAYA 1PQUA 3U4DA 1M2JA 4WZBE 2GFIA 4RJLA 4IUDS 4PINA 2DP4E 1L5RA 1QZXA 1P5JA 2KYRA 1XZPA 2PYDA 4FJ1A 4X92A 4XX0B 2GZAA 1N6IA 3FETA 1DOHA 3RK4A 2V97A 3FPBA 1RYZA 3O7WA 3R6WA 1GU7A 4LKOA 1WCIA 5FHQA 1SBTA 3ZHYA 2VC2B 1NF2A 3T7KA 2R1ZA 1ATZA 1N25A 4FK8A 1QV6A 3RVKA 3STYA 3W3AA 1WMEA 1EEXB 5EERA 4FB5A 4XEUA 4KWIA 2O7RA 2HJRA 3ITNA 4F85A 5HM6A 4GBMA 4H0CA 5CA0A 5LQMA 3BICA 4RLQA 1RRFA 4AY5A 1E5LA 1R6XA 2R47A 5BT8A 3AL2A 3A06A 1A2BA 4KYIB 3KKLA 3ZLVA 1U0SY 3PUWA 1G7TA 3H3XA 3HPQA 4JI6B 4WLVA 3GH3A 5JXWA 4Q9LA 2R11A 2BVNA 3ELBA 4KE8A 2I2DA 1M1NA 1N6RA 1T6NA 1XLUA 2XTAA 1K68A 4JBGA 4EJ0A 2LTAA 3A32A 2FX3A 4D96A 4RXUA 2P1DA 1GPJA 2GBPA 4NENB 4WASA 4UVHA 1R8YA 4NEGA 1RZRD 1NI4A 2C1XA 1CHNA 2HEGA 3REQB 2GXUA 2H2FA 4EG3A 2XDQA 5FV7A 3NHFA 5LPNA 4KR7A 2XRYA 4HEJA 4KO2S 1SR8A 1KK1A 3MWFA 3G9XA 2AOTB 1OC2A 3EQ2A 3K6SB 2E4VA 2JLVA 3JYOA 4RE5A 1WB6A 2MXDA 1B93A 3RUHA 1OA0A 4KWHA 5C34B 4Z2YA 4AD8A 1U7HA 1DKNA 3U60B 2P4UA 9ABPA 4AUKA 1E9SA 3E9YA 1HPLA 5CUQA 5EJ8A 3BF8A 3MAGA 3AHJA 1RYDA 5CCEA 2OKCA 4P4GA 1MB2A 3CUVA 3J7AC 5EE0A 3KIPA 1F17A 2CFIA 1KFCB 2QUJA 4PRKA 3KB2A 3G8AA 3BMQA 3IMGA 5FTKA 3K0HA 2E4AA 5EIHA 3DEKA 3WX0A 2PWZA 3TR0A 1GKLA 3I3OA 4QDOA 3LZ6A 3LPAA 5J2UA 2Y1KA 2CNLA 3HM9A 4EF5A 4POAA 3LQXA 1R27A 1XQ1A 1J0EA 5JXJA 3UMYA 1CDEA 3QLVC 5HK8A 1W52X 4M9RA 2G3YA 1NVDA 3LNTA 4M9CA 2QW1A 2H3HA 2QN2A 3PDUA 4JLMA 3FIUA 2O3JA 4DE5A 3IQHX 3NP7A 4B83A 2AKEA 3OCWA 3FHOA 4X9XA 4L0DA 7REQB 2X5JO 2ZUTA 1RLOA 1FNCA 4I55A 2QD5A 1I2AA 3P2JA 4D3SA 2HPZA 1SZCA 1AK2A 2D5BA 3TSCA 1W59A 3WK8A 5BY2A 4M83A 3JQ6A 3HO6A 4JBIA 1ZISA 2B37A 2H4YA 3TSYA 1R5NA 3DOHA 1C80A 3LQYA 2IZ6A 3R0ZA 3RUFA 1CZLA 2XJ4A 1I3CA 3CEJA 3EXHB 2QE7A 1VHLA 5AVUA 2YZ7A 3C8HA 4R1QA 5BWNA 5JAIA 1G8KA 1UDAA 5KWSA 5A1TA 1CQJA 2BM9A 2X14A 1E3MA 4LMBA 3IUPA 3DH0A 3O2SB 3O4IA 2V6GA 4BDTA 1PT7A 4OHKA 3MGCA 4YI3A 2JLWA 5D86A 1W88B 2ANCA 3M6WA 5A4FS 3KSBC 4AKEA 4O2BB 4XPIB 1KE1A 2R5FA 1GZ4A 2H07A 2ZCUA 3PDIA 4EY3A 1JEJA 1DLJA 1U1DA 2B5WA 4QBKA 4C78A 1FS4A 5I6DA 3LOPA 2QUZA 4CV0A 1YC5A 1F7UA 2WWXA 1D2CA 2ZYTX 3B2NA 1YUBA 1T2NA 1OLSA 1NRWA 1CRWG 3EW9A 3RU9A 2IXBA 3LBAA 4P7BA 5ADUS 3EDMA 3KYCB 4JBYA 1D3AA 1PUJA 3GFRA 4QGBA 5EVJA 1H69A 3S2UA 4JAVC 4AJ2A 3B7HA 2JDID 1XPUA 3G0BA 4Q3NA 1IQ0A 4J7CA 1T36A 4F2HA 1I2DA 2PMDA 2M32A 4MVJF 1A9SA 4RZ3A 5H16A 4BGUA 2HREA 2X8LA 1SKYE 4H7EA 3TEJA 1GPKA 3GW8A 4O8ZA 2CVFA 2VHYA 3FOAA 4CDGA 4ZODA 2CJYA 3ZIUA 4NZPA 5EWMB 1F51E 3ZOZA 4ZJPA 1HORA 3UT0A 3NIBA 5I9MA 3WWZA 3GLUA 1OWOA 1LLDA 3L04A 5AVOA 1LZKA 3ES9A 2QTNA 3PENA 1XLWA 2V74B 3LPMA 1I3LA 4XSGA 4MQUA 1DTSA 3V8QA 3OIYA 4AZ3B 1XEXB 1X0XA 3WQRA 4GX1A 1XCBA 1Z5WA 3I2YX 3KQOA 2FRVA 4PQGA 4UBOA 4BLOA 4AG6A 1NN5A 5SYAA 2YZ2A 5SZIA 4G67A 4E33A 5MN6A 3KLMX 1T4CA 2I3AA 4YRPA 1M0EA 1NKSA 1KFKB 1USGA 1YV9A 2R8PA 1EH5A 1TA0A 1G8AA 4TOIA 3S70A 5JYBA 3VGPA 1Y7TA 4HXYA 4G0WA 3WZMA 4RPKA 4KHZA 5K7SA 4H0NA 3IT0A 4YUAA 1HRDA 1ZK2A 4LFCB 2ZB7A 1ANKA 1RBQA 1W4CA 1EJ6A 5BMVB 2XRMA 2CK3D 5G1OA 5KSPA 4DQKA 2IYNA 4FBMA 3BWYA 4F92B 4H3SA 4UVEA 3UC9A 3DG9A 4H59A 4H6XA 4KW7A 4CFSA 2ORED 5CVDA 1WVGA 4KO1S 4LJLA 3D4OA 5CB0A 2CL7X 1E3SA 3G2KA 3WYNA 2XD9A 4BFSA 2W0SA 3F5MA 3G0CA 4MUHA 5JMWA 4HH4A 1CQPA 1Y8ZA 2R5WA 4XWAA 5FTJA 3D64A 3DM9B 4G0YA 4ZHSA 1LBEA 2V9PA 1JH8A 4WXYB 4Y2SA 2Q7OE 4C0WA 2RK4A 1WH6A 1KJJA 2MSLA 2X5KO 4MH0R 1ZH6A 3A6PC 2Z43A 3QG5A 4YDQA 3JD1A 5GJVC 4XVRA 3OZGA 3BTUA 2C57A 3MS2A 3NUZA 4U7DA 2B35A 3CE9A 4QVIA 1FQOA 1BKSB 2FZVA 4GPAA 3OKZA 1IHYA 3UMVA 2JCGA 4BTEA 5JH7F 2B61A 1OFVA 2HM7A 1XLTA 2ZRCA 4US1R 4FINA 1T4GA 3SMQA 3I04A 4A0RA 1PJRA 1RQXA 4C4PA 4QUJA 1GLGA 4BLWA 2XCTB 1NVVQ 2VJNA 4LRTB 1TA4A 5BR7A 2GAIA 5DRTA 1O95C 1VYVA 2Q99A 4Y6RA 4Z4CA 3OP9A 3K09C 4B4VA 3GRCA 2CHUA 2Q6LA 4O6VA 3GMSA 4W63A 5KTPA 3AKZA 4OBMA 3ESAA 3F5QA 3M89A 5G0WA 5KNBD 2NQ8A 3BORA 2J5XA 5H02A 3OI7A 3JAWA 2KSQA 3VHQA 3U5ZB 2CXXA 3ME5A 1I9GA 4HGYA 3U7GA 3VVCA 1X1DA 1QNFA 2Y2UA 1AB5A 1GDHA 2C0CA 5AK5A 2L8NA 3KOOA 3KWMA 1HXHA 3F3YA 3B20A 4PXAA 1QO0D 2H51A 2ZSFA 4ZMRA 4ZZ0A 3GRRA 3T5MA 5DNYB 1GRRA 3SQOA 3UK2A 1AXEA 3UPUA 1VBKA 2X1VA 3FFBA 1T5LA 4JJ4A 4JP8A 5CDYA 1FUYB 4WKPA 1SGWA 3AIOA 4Q1BA 4H1UA 4YRQA 1GCAA 1FP4B 2QLFA 2WYUA 3R6DA 4B2LA 4QL3A 4MQLA 3W4JA 4OL0A 1COZA 2OCYC 2B8WA 3PDCA 4QFMA 1DKLA 1DQRA 3FCCA 3HVUA 4TL7A 3RAJA 1U3TA 1VIMA 1X3LA 2F1IA 2Q9BA 3GT7A 1QX4A 1R8QA 2C97A 2BJCA 1DG3A 2JGDB 3HN2A 1M6VA 2D3TA 3LYAA 3N74A 3QXHA 3PHCA 1KEWA 1E66A 4IGFA 1AGRA 2G4LA 2ZJ0A 3OIFA 4XCXA 1HMYA 2SCUB 4HPXB 3AQIA 4IQ4A 1MU0A 3HN7A 2I4IA 4MB6A 5AM4A 3AOEA 4P5DA 3AHGA 1D7OA 4CHGA 3OMLA 1HLPA 2AEMA 3BMXA 4TLLB 3D7NA 2FE1A 3I34X 1RS0A 2QOEA 3PGA1 4IHAA 4EQ6B 1HNZB 3AESB 1PHRA 1GPBA 2V59A 2CYAA 3I5MA 1JHOA 3OPNA 1HNXB 2EW2A 3IHTA 1FLAA 3RGGA 2V54A 1S2GA 2IEGA 1XDWA 4IBOA 1UXIA 5E9AA 5LUBA 4EGSA 2MSNA 1UFQA 5DU2A 1RMTA 3I2FA 2QTLA 3DFZA 2E37A 5IUNC 3D6HA 3MWEB 1WOYA 2FX5A 4ENTA 2NUAB 1B6TA 3D6VA 5LQKA 1FBTA 4NNOA 2PGIA 4YBRA 3W1EA 2O49A 3UT6A 5FNVF 4Q4DA 4YLYA 1DLIA 3QY0A 4CTOA 5B57C 2Q7DA 3ZXXA 5BSVA 2G1KA 1E2BA 1GA4A 1Z33A 3IOEA 3NI2A 4JBHA 5TNXA 4C4XA 1PR4A 1U0OC 1VL2A 3EIQA 3S44A 5DTQA 3KJHA 4HGOA 1CC1S 3EYAA 4FMPA 1VCOA 4B3JA 3MWDA 4D8WA 1VG1A 3L01A 5G1PA 1UUFA 2Q2QA 3C5EA 3GB9A 4BVFA 2I7XA 1RMYA 2AC4A 3F78A 4OY3A 3AR7A 4U7HA 1Z28A 4G5HA 3H1PA 5F78A 4MHTA 3INYA 1FXSA 3HACA 4LF7B 1VOTA 3IEKA 1WQ1R 3WL3A 3TSZA 1GYRA 2VQEB 1PJAA 2CZQA 2RHRA 5F7ZA 4BQRA 5JCPA 1Z4JA 1LCIA 4MVXA 4ON9A 1SQGA 2EF0A 4MCJA 1H22A 5ALXA 1JEEA 2OV3A 2YHIB 1XWIA 1EGAA 4MYUA 5J43A 4CFYA 3G5GA 3F0TA 4YV7A 3MT0A 2V0GA 3TZQA 2IW3A 5BV0A 3F49S 1UBLS 4ILEA 4RY8A 2VPYA 4LCJA 4W5OA 5TV2A 1WKBA 2F17A 4TLBA 2DTDA 2VWGA 3RUEA 3L77A 1MKYA 1OY1A 2HU2A 3JQGA 3OHMA 2R7NA 4ZAFA 1Q7RA 2MMCA 2XY4A 2J5RA 3QX9A 1P2UA 4P53A 3SAJA 2UKDA 5JSZA 1TT5B 3ZCVA 1PL8A 3E6AA 5BOSB 1T2CA 1W48A 3LV8A 5AK3A 2IV3A 1BHSA 2YV3A 1JHPA 2Q5QA 4OGKA 3SOZA 1GDTA 3GGPA 2YASA 3F3SA 5CW1A 3GGJA 3UATA 1SOMA 2F1RA 1XSEA 4HAWA 2O0MA 3D0KA 4QPCA 3ZWNA 3DWGA 1JFLA 3HWX1 1CUHA 2BGWA 1CEEA 1JMVA 2I67A 4QQRA 4O1MA 1FU7A 1Z83A 3LBIA 4TTQA 1WPQA 4U7WA 5TB5A 3DMHA 1I3MA 1QIHA 4UJ3A 4XPZA 4DM4A 1EUDB 1PQWA 4OX9Y 1S0UA 1QMGA 2ZFUA 3DB2A 4RTRA 2IQIA 1TI7A 3MTQA 5M3BA 1S8AA 5E3IA 2QYHA 5AVZA 3S1SA 1DSSG 1EP9A 1KPIA 1LDMA 1MO4A 2JZNA 1ZBDA 4TMWA 2CGEA 1GLNA 4MWTA 4C22A 1RLTA 4NMWA 3VDQA 1WZEA 2WTBA 5LA6A 1U8YA 1YA8A 3DAPA 2HOQA 2V0CA 3EAGA 4GR9A 4JENA 2J3EA 4JGIA 3TD6A 3TQFA 4E70A 5L4SA 2FDRA 2QXTA 4B79A 2PUCA 4IJMA 4P2BA 2P9GA 2YWRA 4MGIR 2EZTA 3EZYA 3MNFA 1PLJA 4ZREA 5IBPA 2P7HA 4UZEA 4L5IA 1A71A 1IMJA 5T67A 4P3KA 4RY9A 5IWCA 1CEYA 1UDBA 3GRKA 3AVVA 3DBIA 1V4BA 4C89A 4PGGA 1TAGA 4YS6A 1LFDB 1XMXA 3HV2A 4BFTA 2NMVA 4E03A 3RLFA 1SVIA 1GRNA 5ALNA 1BMFA 4FZRA 2HL6A 2B21A 3WOHA 4CLXA