5DT2A

Crystal structure of dot1l in complex with inhibitor cpd11 [n4-methyl-n2-(2-methyl-1-(2-phenoxyphenyl)-1h-indol-6-yl)pyrimidine-2,4-diamine]
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
311
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 311
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dt2A02
4PINA 1F3LA 2OYRA 3NWBA 1AQIA 3GRZA 5EC8A 2ZWVA 2PJDA 4PWYA 1BKYA 4LWPA 4P7FA 4HRAA 3GRYA 1JG4A 3EGVA 3L8DA 5K01A 3MCZA 4E31A 2BM9A 3O31A 3ELDA 3G5LA 2P40A 4E30A 4PCAA 1QAMA 4U7TB 1EQAA 3OE5A 3A7EA 3R3HA 4OQDA 2A14A 5FWDA 1XVAA 3FZGA 5HEKA 1V39A 3M33A 3TKAA 1I4WA 1NBIA 2Z6QA 4PGHA 2P7IA 1M6YA 1H1DA 3LSTA 1FPQA 4R6XA 1VIDA 3GNLA 5CCBA 2AZTA 1R18A 1ZGAA 1RI5A 5JR3A 2BH2A 4BLUA 5CVEA 1G8AA 2V7EA 1R74A 4M38A 5GIOE 2AR0A 1QYRA 4XUEA 3RW9A 1EIZA 1VQ1A 2HNKA 3FUXA 5F2KA 1UIRA 2PLWA 5HIIA 3G2QA 1AQJA 3QOWA 4PYMA 3TFWA 3EVCA 2QY6A 3TM4A 3TM5A 3NVKI 4ER3A 3ME5A 3THRA 2ZCJA 4IV0A 5BP7A 3C3YA 3PTAA 5GOZA 2VDUE 3GCZA 2XYQA 3OU6A 1RI4A 2QYOA 3KPVA 3MHTA 4WVLA 5E2BA 5EQJB 4CTJA 2JHCA 4M37A 3NW9A 4G56A 3LCVB 2K4MA 3FUWA 1TW2A 5EG5A 5ICGA 1NBHA 4R8SA 2AOTA 2EJUA 3PX3A 4IWNA 1WY7A 1O54A 3LECA 4PONA 1QAOA 4QTUB 3VC2A 1JQEA 3GWZA 3BGDA 2YQZA 1WXXA 5CIYA 3CBGA 1X19A 3G2PA 2IH2A 3IYLW 2P3OA 3I5UA 5D1HA 5FHRA 5DM4A 4AZVA 1BOOA 3FUUA 4FT4A 2AOUB 1TPYA 2ZIFA 4BY9E 4QPNA 2AOVA 3UJBA 1O9GA 1SUSA 2QRVA 2IPXA 3KQYA 2V74B 5EIWA 3UA4A 1KYWA 3NDIA 3CJTA 1PRYA 2IIPA 3NWEA 3LCCA 3M6UA 4QVGA 1N2XA 2B9EA 3G2OA 5E1MA 3KQVA 2WA2A 2G70A 2YVLA 5EOVA 4CTKA 5ICCA 5KS2A 5LSAA 3I9FA 5BW5A 3A26A 4X60A 3MCTA 1UFKA 4MWZA 4EKIA 4A6DA 5K05A 3JWIA 4QPPA 4C05A 5ICEA 5HIJA 5DM2A 4QDJA 2O0LA 2IFTA 5C1IA 2FYTA 3RODA 2IP2A 1D2HA 1SVUA 2PY6A 3HCFA 3PVCA 3LCUA 2ZZMA 3EVEA 5P8WA 3U81A 1B42A 3GRVA 4PYOA 2P8JA 3DXZA 4BLWA 1RI1A 4C04A 1Q0SA 2PSSA 2XYVA 3T7SA 2YR0A 3V97A 2G1PA 3HP7A 3EVDA 3MB5A 4R6WA 2JG3A 3ERCA 3TPZA 4DQ0A 1INLA 5DX0A 2PWPA 1XDUA 2GB4A 2OY0A 4MIKA 2NXNA 4YV0A 3FTDA 3AWIA 2Z6AA 5LQNA 2C7OA 2VDWA 1P1BA 3LKZA 5EHIA 4F86A 3FRIA 5K0FA 1RJGA 5K0GA 2FHPA 3LL7A 4H0NA 4YUXA 3BZBA 3EPPA 3E23A 3SXJA 10MHA 3DOUA 5G02A 4HGZA 3DTNA 3KQTA 3SSNA 3MTEA 3ANXA 4CWAA 4E2YA 3OZTA 2ZTHA 4GOMD 5LQCA 1N7IA 3O7WA 2NNWB 3FPFA 4C03A 4MQ4A 4RTKA 2FCAA 4EVIA 3BXOA 3HVJA 4KDCA 4DA4A 5EKUA 5IH3A 2ZZKA 3FRHA 2ZIEA 3P2EA 5FQNA 5EMKA 4IV8A 3FPJA 3KR0A 3SVZA 1RJDA 1L1EA 4P7KA 3TRKA 4YUYA 2PX8A 3I64A 1NW3A 3OZSA 5GWXA 4AZTA 3TKYA 2XVAA 3OU2A 4PYNA 2AN3A 1NW8A 3DMGA 3KQWA 2AOTB 2ZBQA 3I58A 4GEKA 5EEHA 3A25A 3UJDA 5E9JA 2KW5A 3CC8A 3EMBA 3G8AA 3KKZA 4FSDA 3FTCA 2HMYB 4ER6A 2QM3A 5ICFA 4RTSA 3P2KA 4RX1A 2P35A 4RTQA 1YZ3A 2F8LA 3B7PA 4OA8A 1R00A 3P9KA 5CVDA 5BW4A 5LR6A 4CKEA 2B2CA 1VP9A 3FTFA 1MJFA 3EVAA 5E1BA 2I62A 3M70A 4GC5A 2AN4A 3AXSA 1KYZA 1FJXA 1QANA 2FK8A 1U2ZA 2QRVB 1RI2A 1NT2A 3ELWA 1L9KA 3GO4A 4DCMA 1KP9A 5EMLA 5EEGA 2O05A 3BGVA 2FRXA 2YXEA 3C0KA 3EVZA 3OE4A 4GQBA 3H2BA 5DM1A 5EHGA 4E2ZA 4E33A 3DR5A 5K0NA 1QAQA 2BR4A 5DTQA 1P91A 3FTEA 3A7DA 3OCJA 1ORIA 4HTFA 2YXDA 2PGXA 1QZZA 4LWOA 4PCLA 5E2AA 3FYCA 4C4AA 3KQOA 4K6MA 4O29A 3DH0A 3HVIA 4YV2A 5F2NA 3CJQA 2OPBA 5EMJA 3TQSA 4GOND 2PX4A 2BM8A 2DULA 2Z6UA 4AUKA 5FA8A 3B89A 3OZRA 4FT2A 1KHHA 4LECA 5LQUA 5HFJA 3UWPA 3HA5A 4XCXA 3DMHA 5DX8A 4GUAA 2IDKA 1WZNA 3CVOA 3QV2A 3UJAA 5DRYA 4Y30A 2VZ9A 1DL5A 1NKVA 2G72A 5HILA 1AF7A 3T7TA 5M5BA 4WXHA 2I7CA 1R8XA 3BWCA 5GP1A 3EGEA 4ATNA 1JR4A 8MHTA 4KWCA 3THSA 3T7RA 4V0QA 3OFKA 4P58A 2NXJA 4C08A 4FZVA 1JTFA 2OXTA 1I1NA 4OX9Y 2ZULA 5LQAA 3DLIA 1NV9A 2R3SA 3G7UA 3MTIA 4UOEA 2PT6A 3MAGA 3F4KA 3AXTA 1BHJA 1G60A 2IH4A 3VSEA 3TMAA 3KR9A 1P1CA 4RYLA 4X61A 3CKKA 3UJ7A 2NP6A 2PVCA 7MHTA 3LBFA 3CGGA 3LBYA 4M36A 5CVUA 5CVJA 3FUVA 3NVMB 5CM2Z 3Q7EA 5DPMA 2EJTA 3LDFA 1IXKA 3PT9A 4KIGA 4BP3A 3V8VA 3HVHA 3JWGA 4U7PB 2IDJA 2O06A 2XVMA 3KU1A 3M6VA 3LGAA 4P7JA 5T64A 1XXLA 1XTPA 3REOA 4HGYA 3SSMA 5ERGB 1DCTA 1F38A 3R24A 1RJEA 2PV0A 1ZG3A 4QQKA 5FQOA 3C6MA 2AOWA 2EX4A 3MQ2A 5FHQA 3UJCA 1KXZA 4ER5A 4RV9A 3TR6A 2YUIA 4CKCA 4M7RA 2AVDA 3DLCA 1XJ5A 3B3FA 2P3QA 3A4TA 3G5TA 5FWAA 1FP1D 4OA5A 3IV6A 4QQNA 3BGIA 2JHPA 2VP3A 2NXCA 3FYDA 2BR5A 5DT2A 5FUBA 1JTEA 3MGGA 2YXLA 2ZBRA 4XUCA 3KQPA 4YUWA 2C7QA 2IH5A 3KHKA 9MHTA 2C7RA 3ELUA 3KR2A 1G38A 1DUSA 3LDGA 1JSXA 3HNRA 4FR0A 4RTOA 1JG1A 4HTFB 2ERCA 3G88A 4QDKA 3HVKA 2ADMA 4DCGA 1NW5A 5K0CA 1KPIA 5KVAA 3X0DA 4PYIA 2O57A 2WA1A 3OPNA 4FS8A 4DMGA 4V0RA 3Q87B 5DWQA 2ZIGA 2ORED 3B3JA 5EPEA 4DZRA 5K0JA 2GAFA 5C9ZA 3P2IA 3KQMA 3CCFA 3KPUA 1L3CA 2NXEA 2BR3A 1RJFA 2H1RA 5FA5A 1VPTA 3HEMA 1NW6A 5IKMA 2VS1A 5HIKA 4ER0A 3ER9A 3UBTA 5EIFA 4HC4A 4E70A 3K6RA 3HTXA 4GOLD 1M6EX 3O4FA 5CCXA 4XUDA 2LD4A 5EVJA 4GOOD 3LX6A 5DLYA 3SM3A 3T0IA 5JUWA 4RVFA 5GINE 5DSXA 1EJ6A 4ISCA 3B3GA 3PFHA 2I6GA 4YMHA 1IM8A 2P7HA 3NDJA 3S68A 5EZSA 2UYHA 3BWMA 4E2WA 4QTTB 2XYRA 4YUVA 3EVGA 1NV8A 3LHDA 3VYWA 5HOQA 1XDSA 3HCBA 3DXYA 4R05A 3HCAA 1M0EA 4GC9A 1SUIA 2CWWA 4ZTBA 3UZUA 1WS6A 4FGZA 5E1OA 5KQSA 2PWYA 4PGGA 5LQKA 5B1SA 5F2OA 3IEIA 4YUZA 3LPMA 3DMFA 3E7PA 3HCEA 5GM2A 1D2CA 1NW7A 3C6KA 3FUTA 2G8NA 3MERA 4AZSA 4RTLA 4IKPA 4JXJA 2B3TA 2E5WA 2PKWA 2FPOA 3ID6C 5K0EA 1Q0TA 3TLJA 3KQQA 1D2GA 4KDRA 2Y1WA 4B17A 5C0OE 4MHTA 2ZZNA 3E8SA 2O07A 3HCCA 5D1NA 1OR8A 2NYUA 4OBXA 3OFJA 2YTZA 1TW3A 2R6ZA 2CL5A 2UYOA 1KPGA 5DXJA 1BC5A 4C07A 4KW7A 5K0LA 1KPHA 2AS0A 5FTWA 4Y2HA 2AN5A 5FADA 1R8YA 2GLUA 3A27A 3CJRA 3EEOA 1XCLA 4PNEA 3GU3A 4PYJA 3R9XB 2OB1A 5K03A 1KR5A 1VBFA 4EK9A 4EKGA 2XBMA 3SMQA 1ORHA 1ZGJA 4L7VA 2G71A 4P7GA 1WG8A 4PIPA 5CD1A 4KVZA 3P71T 2DPMA 2PX2A 2HV9A 5DTRA 1R6AA 4FP9A 2OO3A 4KRGA 1PJZA 5GM1A 2Y1XA 3UJ8A 2IGTA 4CXMA 1HMYA 2OBFA 1SKMA 4NECA 1FBNA 1N7JA 4RWZA 4DM3A 2JH9A 2OB2A 3SX0A 3K0BA 4C06A 2UZ4A 3M6WA 2ZLBA 3BKWA 4RTRA 3R0QA 3PFGA 3UFBA 1X1AA 4RTMA 3RIEA 2CMHA 5DTMA 3ORHA 3DUWA 5E9QA 5K0BA 3BT7A 1YB2A 1XDZA 4HH4A 4GBED 1I9GA 4MTLA 1ZKDA 2JH8A 4RVGA 3UJ9A 2QE6A 5LQJA 2CMGA 2ZFUA 3D2LA 3TOSA 2ZW9A 2IBSA 3QOXA 2GA9A 3KQSA 2HWKA 3P97A 4GF5A 3PLAE 4ER7A 5E1DA 5DXAA 3ELYA 3LKDA 4F85A 2GH1A 2H00A 3FPGA 3G89A 5DSTA 5K8VA 1NE2A 4RTJA 4RVHA 4E32A 1SQGA 4OBWA 5EGSA 3GGDA 3GRRA 3PS9A 3EVFA 4HG2A 1G6Q1 5E8RA 1VP3A 2OZVA 3KR1A 4PIMA 3BKXA 3LDUA 3E05A 4RVDA 3P9IA 5CUQA 3P9NA 5H02A 4RTPA 1YFLA 2I9KA 2FK7A 1ZHFA 4YV1A 2UYCA 4X63A 3M6XA 3DULA 3BWBA 1MHTA 4FSXA 3EGIA 5HIMA 3HCDA 4DKJA 2NP7A 3NMUF 3JWJA 2PXCA 4HSGA 5CVVA 4LG1A 3AY0A 4A6EA 2GS9A 3KPJA 2PXAA 1VLMA 3HA7A 2PX5A 3WSTA 3B5IA 4EQZA 4PYQA 5GIPE 1WXWA 3DXXA 4X41A 4DF3A 1EAMA 5DX1A 3NTVA 5U4XA 5EMMA 3M4XA 1O9HA 1X1BA 3FPEA 2ONZA 4BP1A 1YF3A 1HNNA 2VDVE 1JG3A 2ZWAA 4AX8A 3ER8A 2B78A 3JWHA 1JG2A 2AOXA 4RSRA 5HZMA 2P3LA 2EFJA 2H11A 4BLVA 3SR4A 3IHTA 3VC1A 1JQ3A 3DP7A 2PBFA 2B25A 3UJ6A 1JSZA 2JJQA 1SG9A 5FULA 3SGLA 1UWVA 2ONYA 4PYKA 4F84A 3R6TA 2CKDA 2OKCA 3C3PA 5E8JA 1EJ0A 2IBTA 2P41A 2YX1A 3UA3A 4CKBA 1G8SA 3P8ZA 4YMGA 5KYGA 1IY9A 1VE3A 5DM0A 4AZWA 1X1DA 3HM2A 4POOA 2ESRA 2C7PA 2P1DA 2ZBPA 3NJRA 2PXXA 2WK1A 1VL5A 1L3IA 2ZSUA 3EEYA 1Y8CA 1RI3A 3P9CA 2N47A 2AVNA 5K09A 1ZQ9A 4X1OA 1X1CA 2HTEA 3G8BA 5BXYA 5KQRA 3EVBA 3BWYA 3OU7A 2Q41A 5MHTA 4R8RA 2HR1A 3PB3A 1AV6A 3AJDA 4PYLA 2UYQA 4RTNA 1JQDA 1L3BA 2PT9A 5DRTA 1EG2A 3BUSA 2ZVJA 5LQRA 1YZHA 1T43A 2GPYA 2JHAA 1YUBA 4QVKA 1YFJA 4EMSA 3KPWA 5T67A 2BZGA 3FPHA 1XCJA 4KIFA 3GDHA 3EMDA 3SSOA 3GIWA 1G55A 1KIAA 5EKXA 2AOUA 3GJYA 5E9WA 5FCDA 3HA3A 5EZQA 3KPYA 3GXOA 1FP2A 4E2XA 3PX2A 1P39A 2EG5A 4OQEA 4Z2YA 5T6BA 3I53A 3G2MA 1Z3CA 3GRUA 1SQFA
chains in the Genus database with same CATH superfamily
5A2QA 3G79A 5U9CA 3S1LA 2OHOA 1HQYE 5AXDA 2QXTA 4BFLA 5B1HA 5DT9A 2DQ4A 3TTUA 2GBLA 3RNLA 3VNUA 2BFDA 2MT9A 4Q4AA 1H9AA 1YTLA 3MT0A 4MARA 4BB6A 1C8LA 4XOIA 4G41A 6Q21A 1RYNA 4W9NC 3EGVA 1GVNB 4AIRA 3OFSA 4LFAB 3NT5A 1EQAA 1FP7A 1YHYA 2ECFA 1JVBA 1X8KA 1AB6A 2FZEA 1XF1A 2BISA 4IH9A 1RVV1 1Q17A 2QY9A 3V4LA 4BQIA 3B70A 1YZUA 1N1MA 3PIDA 2VYCA 1E1DA 1D1PA 4BFVA 3LVQE 3Q8LA 1GAEO 3LXMA 1EDOA 3DEAA 5BWCA 1NUQA 5JBIA 4EG0A 1KAGA 2YWFA 4P4GA 1QYRA 4XJTA 3M0EA 3TSAA 2AK3A 3ADKA 1UIRA 1H22A 3W6NA 3ZGZA 2AI1A 4UNPA 4YRGA 3TM5A 4CLXA 2WT4A 2L49A 3TM4A 3V46A 4Q3CA 1Z82A 5ALXA 3N0RA 1Y0BA 5DOVA 1YR9A 3O3NB 1W2WB 1QQBA 4MV8A 2MEZA 4MPTA 1ZOPA 3PT5A 4Q39A 3TCXB 2QYOA 1N2GA 2WKRA 1MAHA 1LPSA 4FC7A 4Q3BA 5E2BA 3VJMA 3EXEB 1WD7A 2JASA 5JNSA 5T4EA 2M98A 1ODLA 3NU1A 4GZ3A 2CWDA 2I1WA 3TLCA 1ITZA 4Z86A 1ADCA 5TV2A 4MW6A 1QF7A 2MINB 3BG5A 3U9TA 3U7QB 3FB4A 4ZICA 1DZIA 1ZD4A 3KSUA 4N12A 3KJGA 5EJEA 4MIEA 4IR7A 2O0KA 4QTUB 2V7XA 4U2EA 4WBSA 5KAPA 4QOJA 4HXYA 4C5AA 4KFTA 5I5EA 1R4NA 3G2PA 3EW9A 1W30A 1RADA 2X19A 3OUUA 4QFMA 3VDMA 4G1BA 4OSEA 5CLHA 4D3DA 2XTAA 5JDIC 1JHVA 4TYMA 1N2SA 1U1FA 1K5DA 4KXFB 2FDCA 4NXNB 4AKHA 1V9SA 2WHXA 5CK4A 1V2HE 2FUKA 4ZP1A 3ZEAA 4N65A 5A5DA 3U56A 2ID7A 3LXXA 2OXRA 2DWOA 1SC6A 3O4IA 4ND8B 3ENZA 3IXMA 1KYWA 4L8VA 3V1NA 2XUKA 1JIIA 3HXQA 3DDUA 1YA6A 1ZIPA 4HNQA 4UZSA 1W4RA 3SFVA 4PFSA 2HM7A 3N07A 1D2RA 4C2AA 3ZCXA 5ECDA 2X22A 3KSDO 2VQSA 4MWZA 4N0PA 4H7IA 4DNOA 3ZBQA 5ICEA 3DMNA 1JBEA 2YY6A 1IXSB 3FHTA 4KE9A 1D2HA 3VO2A 2PY6A 4DE8A 3I34X 4N8SA 2B1JA 2XNKA 4XSHA 4D82A 4YYZA 2OECA 1P5JA 3S3TA 3I0NA 4XD7D 2PSSA 5HK9A 3M6AA 4B3GA 3OPYA 1LJ8A 4R2JA 1CF4A 2XNCA 4OVKA 4DQ0A 2WYUA 4UVHA 5DX0A 2OFXA 2GB4A 2OY0A 1IRIA 1JAIA 5AW5A 3ZLBA 2RGNC 2ISSD 2JGNA 5K2OA 2Z6AA 2VDWA 1BCSA 5EHIA 3N2NA 4F86A 4PAOA 2I7XA 1Q21A 5SZJA 1P2GA 1L4EA 5T41A 2VA9A 4CV1A 1JX6A 4WFQA 1IC6A 1GL9B 3EQ9A 4IDHA 4BNKA 4EMUA 4UBLA 1EFCA 2HT1A 1HF0A 3QGMA 3DEKA 3UJNA 5C4GB 4CWAA 3BTVA 3TLXA 4H7JA 2G4VA 4ANFA 2ZTHA 2QOEA 3E9MA 1ESZA 2Z6VA 3VXKA 1NX6A 4HLCA 4LOKA 4EVIA 1YL6A 2FDRA 3BXOA 4IH1A 4MZDA 3RWMB 4DPKA 2ECQA 4H6WA 1GITA 5A5VA 5BQFA 2XIQA 2IGBA 1PD0A 2NVBA 1UM9A 1E58A 2JH3A 2HJGA 2OC9A 4ZI7F 1YL7A 3QXCA 4YG7B 4P7KA 5HBRA 1QFJA 4MMXB 4DKXA 5LOVA 4LKOA 2VDRB 4K46A 1QTRA 3GLHA 3CURA 3HKDA 4ZQCB 2I2BA 3OU2A 4H15A 4ZMRA 5AXAA 1MG5A 3CW8X 4EGCB 1DBVO 4X92A 3VO9A 3GB9A 5EKTA 2WYWA 3KYCB 2BKAA 2VYFA 3Q3GE 3H11A 1GNPA 4FSDA 1RKXA 5EWJB 1KVUA 2ANCA 1YCHA 2P9TA 3A70A 4F6LA 4FXPA 2WABA 3MT9A 2O8EA 3IVMA 4ARZA 1YZ3A 3V4RA 3GPDG 4I46A 3AIIA 3ORYA 2WB4A 3B7PA 3HJUA 4C30A 4R5MA 4UFNA 4BNDB 4YMSA 1NMEA 4PQYA 1YCGA 3HO1A 1ZNXA 4HKTA 2HPZA 3HDTA 4UHJA 1N0UA 2XCLA 4TGLA 1SVLA 3AVPA 1CIPA 1RIIA 1JHDA 2X76A 4ZA2A 3RUDA 3ICEA 3ZHTA 1ZWLA 3EWAA 4QJIA 5EMLA 3H97A 2GN6A 5D84A 3PHCA 4D74A 2BFBB 5C8DA 4B82A 5HXAA 2NO5A 3MD0A 5BSVA 2FUG6 2G08A 3U7GA 5K0NA 1ZJ4A 1QAQA 1ZVJA 3BS3A 5DTQA 3FTEA 1ADJA 2GX6A 3SS7X 2IITA 4HTFA 4ZAYA 2BFFA 4YO8A 4E1AA 4HI0E 4DDUA 3TIXB 1K4MA 1T4DA 4NTZA 5CB4A 3QY0A 4LZAA 2VNIA 4FONA 4YVFA 1DWQA 3MJEA 4Y1FA 1ECLA 3NIBA 4AUKA 1W2GA 1WLYA 2QLNA 3SWWA 1Y4ZA 4JB2A 1YTUA 2VHEA 3RBAA 3KAQA 1ICIA 2HPAA 1O89A 1NOIA 2IDKA 2WP0A 2YJ4A 4KH0A 1UMCA 2VHCA 2YNMC 1D2NA 4UC0A 1NUHA 1R88A 2BMVA 3UMVA 1W5AA 4MV6A 3WGKA 1RP7A 4MUJA 1HYQA 1MOSA 1ID1A 1M7HA 2NZ8A 1VE7A 4JA2A 4K7JA 1MH1A 1YJ8A 5M5BA 2W2VA 3CB2A 4LNUA 1QS0B 3LG2A 3IO3A 4BTVA 5EN4A 3COPA 3DE2X 3H0EA 4ZCSA 5JD4A 3L18A 2QVXX 1C8KA 1BIFA 1UK7A 2NXJA 1T1GA 3CKYA 2ZSBA 3DYVA 4JI6B 1G3IA 2OWEA 3B13B 3R5HA 4HJXA 2F8MA 3K05A 3MN1A 2XJ3A 3JQQA 3QXGA 1QGZA 2YOHA 2Q5LA 2R3SA 4COOA 5I4KA 4QPCA 4C4OA 1I30A 1EZZA 5HUHA 1NLUA 1BHJA 3AU8A 3ILHA 4GM4A 4HXEB 2WIAA 1B93A 3QX9A 1EX1A 1PG2A 2EP7A 2LR0A 3C24A 3OQ6A 4PNPA 4RYLA 3VSEA 4CN9A 3U0VA 3CGGA 2VWQA 2QV0A 1J0AA 2W2KA 2PA3A 4LE2A 3W5IA 4UTRA 4MRMB 3BH7A 3COWA 2R5FA 3MSCA 3RYFA 3LPCA 4E31A 3HV2A 4H0CA 4KI0A 2R25B 3C1UA 4PRLA 4YS6A 4UEWA 5IBRA 3DKIA 1NVWQ 4K8OA 3PUXA 1GP2A 5FQOA 4YMVA 1ABBA 2OCLA 3ABQB 4Q9LA 1I3KA 4HR7A 5FHQA 3WMFA 3WLRA 1TA4A 2YHIB 4ZJYA 3L41A 4M2LA 1JEEA 5HGXA 3GCXA 4NQZA 2ZE6A 4XIFA 2NV2B 4TLBA 1WY5A 1SKAA 4KACA 5CXXA 4YJFA 3RKSA 4YAWA 3AVVA 3D2BA 1FYWA 3B1YA 3DGEC 4XFDA 4A8JC 2O2JA 4R71A 2YJTD 4L9RA 2WD7B 2C7QA 2PZAA 4EDFA 3L7MA 1NR7A 4MV5A 1G38A 1BA2A 4F91B 3CIOA 2WU4A 3VTFA 3RT1A 4J1NA 3GJ0A 2JBWA 1MTOA 1T8WA 5K0CA 5IC5A 2D2EA 4D57A 1PQ4A 2FKNA 3MD9A 5ABPA 1MH9A 2ZAGA 1L5NA 1Y6JA 3EZ6A 2DAPA 4CUKA 2IXBA 3GH3A 5J2TF 4Q19A 3V00A 2OFPA 4TLLB 4KKXB 3O8BA 5EPEA 1K5PA 5IF3A 1YMUA 1MABA 3H5IA 1K0UA 2AX3A 4H7FA 5HF5A 4JUAA 5KYVA 1G8PA 5CK5A 4LRQA 3KBBA 5J4HA 3H3JA 3D5TA 1XXHA 4Y6LA 2QRZA 2M6RA 3SI7A 5ALNA 2W2MA 2HRRA 3I62A 1AK2A 1HFKA 1P1IA 4MWEA 1BMQA 1OY1A 3KBOA 2FY8A 1QHFA 5DLYA 4DS3A 4BX8A 1ZX1A 1IUPA 2ZU6A 3FR7A 4F5ZA 3M4YA 3ZWNA 4ZI2A 3MXTA 4RHFA 5IARA 4B0PA 4Z5HA 2QAJA 3HYTA 4XSGA 3S68A 4ITRC 4Q21A 3PUKA 3G0TA 1F6WA 5DNCA 2P30A 1N33B 4N5MA 3AEYA 4R05A 2ZI7A 3BMCB 3WL7A 2UXCB 1SUIA 4HVTA 2H2AA 3F6BX 4L8GA 4QBTA 4TYQA 3DL0A 4OREX 3WLEA 1L7QA 2W71A 2ZXEA 4C3VA 4D97A 5JZVA 1NX9A 3BZUA 2RE8A 2LNMA 3C7CB 1TCUA 1L5QA 1MGPA 2BFCA 2CDBA 2EFEB 2FR8A 2FG5A 2G8NA 2ICAA 2PQ0A 3C6KA 4JQOA 4QFCA 3ZX4A 4G0VA 4ZO8A 1ZGCA 1KP3A 5JSQA 1A7AA 3T9FA 5C0OE 3UUEA 4MHTA 5D1NA 4YLGA 1R6BX 2VDNB 4MIYA 3ENQA 3SJAA 3K2IA 1ZXBA 4TS1A 3I4CA 5I8PA 3RF7A 4C07A 2B61A 5FNVF 5JD5A 1ZC4A 3WS7A 3IOCA 5ECWA 1CTQA 2NO0A 3A27A 4CEHA 2BFMA 4PE5B 4ENSA 1YQUA 4D56A 2PZGA 3VNBA 4BKRA 4DQUA 1FTYA 2EFDB 4HZIA 4OKIA 2BDEA 4MYUA 1IPHA 2QRKA 4YG1A 2OP0A 4F5YA 3H4IA 3P71T 4X4GA 1QQ6A 3W2HA 4DA0A 3IA2A 1SBCA 1KP2A 1SCQA 4M1YA 2EP8A 2OBFA 3UJ8A 1NP6A 4UE6A 4OLBA 2YDYA 1J8MF 4YAEA 1W96A 3X1XA 4XB2A 1SKQA 3R0QA 3UFXA 1F2TA 1VHQA 2GLXA 2HDHA 2W4QA 1UKVY 1OU0A 1MP0A 2VPYA 3FMGA 3P32A 2UVPA 4HYEA 4PC3A 4YROA 3O8OB 3EEFA 2P6OA 4XGKA 3T7CA 1DHRA 2AQIA 2CMGA 2HD4A 4HOYA 3IOMA 1VMIA 3NATA 5AXCA 1ZMOA 4TTPA 4DJAA 4LOLA 3DE4X 4HDAA 4QYMA 4ER7A 3KAKA 4G6ZA 4YRNA 3KHUA 1F8YA 4WESB 4YHHB 3LFUA 4B4DA 1ICEA 4XLZA 5HSGA 1Z0FA 4C6TA 3DWIA 2FF5A 2P0EA 2WWFA 1OC2A 4L74A 4TTIA 5C7LO 1G5FA 2HGZA 4HD8A 3RYHB 1R5OA 1YC2A 3GFOA 5DTEA 1BMDA 3HDHA 2OGSA 2NVUB 4ASUA 1JUDA 2C2KA 3KTFA 2QLTA 3B6JA 1Q20A 2WOJA 4FINA 4GNKA 4NFLA 5TB5A 1YFLA 4G1MB 5F3RA 3M6XA 4TVSA 1A8HA 2YWBA 1G7TA 2ZRFA 3KJHA 1XQ6A 2EIXA 2OHGA 3FGZA 1BZYA 2ZATA 3LKBA 4QUKA 1NRXA 3FNGA 4FNGA 2FPRA 2OZLA 4MJLA 5I7HA 4TVKA 4QPDA 3WISA 3KDSE 3F6WA 1LU9A 3UFDA 2Q3FA 1HE3A 2PNFA 2X7HA 4EW6A 2VDOB 1Z39A 2WAOA 1ZU5A 1LRKA 1RJ9A 2PMBA 3IR7A 4HFRA 3JQGB 4XDZA 3ZDBA 3NC4A 4P4NA 1Z74A 2QT1A 2PUCA 3ONNA 1XRQA 2AWIA 4JJ6A 1YF3A 2WT8A 4ZVPA 1ZLYA 1YQEA 2X9NA 5I7UA 1A04A 1U8YA 3C6XA 1UC4B 3LRTA 4KLNA 4QX6A 2AIRA 4CHGA 4LF6B 1A50B 4RSRA 1C9NA 2VJOA 4QBKA 3HBNA 3FYMA 3SR4A 1T5SA 3OTOB 2LUOA 5JZBA 4DA8A 3SGLA 1JL3A 1QORA 3D6UA 1O5TA 3VU3A 4ALJA 5IUNC 3U3JA 2LV8A 4LV8B 4KOAA 5B1YA 4TTSA 3OLZA 1MIOB 3EIFA 2B99A 3LT0A 5JS6A 2VDKB 3JTMA 2RGUA 4E08A 5I48A 1ZHHA 2JFBA 2ZROA 1HSZA 3EAQA 5ADUS 4CT0A 4AY5A 1TYEB 1SD2A 3HM2A 4DNPA 2MDTA 1R37A 4CMBA 1LDNA 4I1SA 3PGVA 5EYPB 5L4SA 3NJRA 3EZ9A 4FE3A 2ZM6B 3NR2A 3WZMA 1RI3A 4M1TA 4BEJA 1YS9A 1RDFA 4K3VA 4NDWA 2INGX 5TQ0A 4OQFA 3RYIB 4QXAA 5COBA 4LCJA 1TZCA 4FUTA 3IO5A 1RAIA 2QM8A 2VQ6A 1YFKA 3FWKA 3WLAA 4B71A 3VR6A 5BV7A 4OHUA 3AO0B 2QGFA 1ZD2P 5IAOA 1G3UA 4M3NA 3EXG1 2PAFA 3V9AA 2PT9A 3BUSA 5B12A 2BE9A 1P74A 2JFNA 3D43A 4A0FA 5JJBA 4AMVA 2H17A 3U16A 3FPHA 4R54A 5FR1A 4KIFA 1RXIA 1QU2A 2JIDA 1U2EA 1FP6A 2QD1A 5EFZA 1T6XA 2VK8A 1SBTA 3L49A 4KPUA 4MR9B 2R62A 5T6BA 1BO6A 3F90A 3S5UA 4EENA 1QUFA 4C7OA 5BRJA 1QDLB 1ADGA 1UM8A 4FNAA 4YALA 121PA 2D1RA 2HREA 2QTRA 2V6GA 3SIXA 721PA 3VR4D 2BYTA 1IBCA 3NAZA 3O83A 4LDAA 3PCRB 1NF2A 1ABEA 3JZFA 2AQKA 1HA3A 3GRZA 5EC8A 4DCJA 2V4UA 3P0FA 2IPAB 3MA0A 1WV1A 5DP1A 2J0EA 3IUNA 2JAHA 4NJOA 3TZQA 3EOBI 1BEUB 4MQ6A 4YRMA 3QKUA 1XMQB 2FUCA 4H6VA 2Z57A 4YDHB 5EESA 3DUFB 3G5LA 1R0BA 3QA3E 3S99A 2R1ZA 4PCAA 3BXFA 4EB0A 1X42A 4MRNA 1NJGA 1CWUA 1ZD1A 5SYMA 1YXMA 4MV3A 4AKTA 1GYQA 5BYAA 3FHCB 5LA6B 4B4KA 1UDBA 2UUPA 4EMBA 5C31A 3O84A 3B82A 2LLWA 4KFUA 6ADHA 4HX2A 4QUAA 4U0KA 2WZQA 3VDNB 4PZPA 1WWKA 4CF4A 1MX1A 1M8PA 3RI3A 4EY8A 4CVNA 1MPXA 1RI5A 3F51A 1ZAYA 4ZVLA 2OHFA 3NBUA 5EHZA 2IXDA 1PJQA 2D5BA 2ZYGA 2QIPA 3RJ5A 1Y3CE 2HNKA 4KXVA 1B6GA 4P93A 2PUJA 5H0IA 3RVDA 5IW8A 3X1JA 1QRTA 1VJTA 3NM4A 5KJEA 3GUHA 1G42A 4RM3A 1HFEL 4Q1AA 4OHOA 4YXFA 3G9TA 1L4YA 1NVEA 2H5JA 1SHKA 2RJ3A 4V2IA 4CODB 1GZVA 2WIGA 2I0FA 2B8WA 1EWVA 3UNXA 5E6SB 3HO6A 4O25A 4BGIA 2ECOA 5CB4F 1CK4A 2DFNA 3S1SA 1I2BA 3THXB 4B1FA 2J59A 2D1FA 3AEUA 4L16A 4M9XA 1G64A 1SBNE 4L6IA 1QAOA 1U3CA 2EOAA 2ZPTX 2R00A 3QVGA 1ULBA 4X54A 1E9DA 3GX1A 1XCBA 3HK2A 3EVNA 1NVKA 5A4IS 1U2GA 1QE0A 4D0SA 3JQDA 3L7OA 3HFGA 1EM8B 4LYFA 4M9QA 2Q1TA 4MCTA 1T13A 1XL1A 2O2ZA 2YWGA 1NUTA 3LCJA 1Z5NA 2CLMB 3UAYA 1WHTA 1YRLA 1IN5A 4ND3A 3KQYA 4QZVA 1OBHA 2SHKA 1K97A 1P3JA 4OH1A 3DBHA 3MWLA 3DEIA 4A26A 4RV4A 4DV1B 3ZCRA 5CHEA 5KS2A 3Q1LA 1S2OA 2BZ0A 2YV2A 2O8NA 3E48A 5EJ2A 1C7EA 1Q1NA 2Q50A 3BBPA 1EWRA 2BGGA 3QELA 5FLYA 2M6KA 2JIQA 4H2DA 3SS8A 2FJPA 4PC6A 1I3MA 4WBNA 6REQB 4HX9A 4KAAA 3TRIA 4B3JA 1TQDA 1ZI6A 1OILA 1G2QA 1TKAA 2R5NA 3VZCA 2BM0A 1Z47A 2VRBA 4S2EA 5THXA 4ZMSA 3OCZA 1N8KA 1EPUA 1TVKB 1B0NA 1J56A 1QNLA 1Z15A 5AVKA 3ZE9A 2HSGA 3E9RA 4AMBA 4BDTA 3AWIA 1JDNA 2E4UA 3LM8A 2JFFA 5ENDA 3GBFA 5D2CA 2WSLA 2V4ZA 1Q5PA 3BH0A 3INGA 4X6YA 4X94A 4FCCA 4FDTA 4FFBB 4EGSA 3TFOA 3PTZA 1ZC3A 2M9MA 1M76A 1GEEA 3KEOA 4F4CA 4QQ8A 4EP1A 2HADA 3DTNA 3CLRD 3FBGA 5LDHA 1ZUD1 3IRVA 2JB9A 4GOMD 4I8XA 3T7AA 5JALA 1LCCA 3FPFA 7MDHA 4MINA 3ICQB 3LISA 1F9EA 3EGOA 2KJQA 3I3OA 2OSBA 3W06A 2QR2A 4LRUA 4A1OA 1JE1A 1H66A 2DPGA 4P86A 3W2GA 3ZOZA 3GIDA 1QVZA 4L8FA 1D0IA 1K7CA 1T5TA 3KWMA 1M10A 2AF3C 1U80A 1GU0A 3FPLA 1SHTX 4KQFA 5G4KB 4Q66C 3MG9A 3AM4A 1OX6A 3SXUA 2R751 2O3RA 2RI0A 1NUSA 2OAEA 1WH8A 2ZBQA 3PFBA 4GEKA 1Q6YA 4NEQA 5FPTA 1A5ZA 4MW1A 3U17A 3UJDA 5B55A 3T3NA 4H35A 2QM3A 1FX1A 1K7YA 3ABRB 5ITWA 2FCRA 2C78A 1W36D 4CCYA 2F8LA 1EUCB 3HB5X 4AFNA 3GZNB 5CIWA 1XT6A 2PH7A 4NJMA 4UPVA 2I62A 2F9FA 2ZIWB 4GC5A 4IHJB 1XZNA 2AN4A 4QDXA 4BTEA 3WGYA 4F4HA 5JFTA 5KJFA 3E7WA 4GMGA 4LQCA 2AQHA 4MUNA 2QVYX 2ADFA 2FRXA 2RHRA 2YXEA 4KQKA 3RTDA 1BGXT 2IUFA 3H5VA 4KR9A 5AJHA 4IDGA 3DBLA 3S2EA 4MUMA 1Z7YA 3FDFA 3T4PA 3KUDA 3WMRA 1SELA 2V5VA 3JTEA 4YJ2A 3PXAA 3KETA 5CJ2A 1KSGA 1L4UA 3N2IA 1E63A 3HVIA 1EVZA 4OO3A 5TS2A 1FFYA 3CRRA 1N77A 2GF9A 3CZ5A 5K8UA 2B6HA 3DBOB 3WLNA 5KSZA 3D8BA 5FB3A 4RE6A 1PT7A 3RTBA 4R3NA 5KSYA 5HFJA 1YDFA 2Q29A 3PXUA 3DMHA 3HM9A 4IVRA 4NMHA 1TDJA 3FOEC 2Y77A 4R7ZA 1E1NA 1YZFA 2RI6A 2WD8A 1UBFA 3W3AA 1NKVA 2D7JA 1T5IA 3AKEA 3KM0A 2LW7A 4FYYA 2HRZA 5DNUA 3OQVA 1XZHA 1GNQA 3TI9A 1R8XA 3I73A 1NBMD 1CEXA 3RS2A 5B5SA 3BMQA 3IJ5A 1TK3A 5TF0A 4XDHA 1ECBA 3MAAC 3GP5A 3U4GA 2NM0A 4Y0AA 1B00A 4RL4A 4C08A 5BR1A 1WMSA 5INTA 2AF4C 3K1ZA 3NAQA 3JD3A 4MB0A 2GVDC 2E4YA 2AC2A 2ZULA 2ZI9A 5AJYA 1ZJJA 4L8LA 2VJYA 2DU8A 4WCVA 2QT0A 4QPJC 2IEIA 2MSKA 3AIMA 1GQFA 3KWLA 5AHXA 3SN6A 1DRJA 1T1JA 3BB1A 3Q5EA 4J3NA 3X3HA 4TS4A 3M6MD 1TO6A 1GG5A 3OZVA 1ILEA 2QU7A 4Z53A 4O4HB 4ZU6X 1FFAA 1YAHA 3H1AA 1D04A 3MSXA 1G4HA 4IGEA 3GA7A 3Q7EA 3N8IA 2FOIA 3AZOA 4IEEA 1U1IA 2PMFA 2C99A 1SOMA 3RIYA 2PX3A 1E92A 1XZAA 4P5DA 3QVJA 5FTLA 3KJFA 5B7GA 1DDOA 3QE4A 4BUJA 1IOZA 3LCRA 4GXNA 5EXDA 2Z98A 1B15A 2Y1GA 4GMHA 1AZLA 1DKNA 2ZJ0A 2ON6A 3CUVA 4RV9A 2QXYA 3UEOA 5DI3A 3WGIA 4DT1A 1A9PA 3BL8A 4JC4A 3C6YA 1NVGA 3M49A 1XNHA 4EX7A 3R5FA 1WETA 1YBAA 1E6LA 1QGYA 1T8YA 2C2HA 3JARB 4L4UA 4ZT5A 3VKUA 3FR8A 3ZE1B 5JT1A 5LD2B 3N9IA 4KBFA 5ISMA 1CUFA 3H1BA 1FDOA 3KWJA 5DISB 4EPVA 2GNPA 3EGCA 1UBUS 4R3UC 4CF7A 5DT2A 2C82A 4GNRA 2GCOB 4M4SA 1KJWA 3GEPA 4OK3A 3SOZA 4C87A 4ZCMA 2RAFA 1IJFA 3I2HA 3I9KA 3W9UA 2VAXA 5IJ9B 3TNLA 1JMKC 4TQAA 2ZOSA 5KI6A 1KYTA 1SWWA 4RJJA 5EE1A 5A3VA 3TZHA 1OFTA 1PR2A 2UKDA 3PU6A 5EXTA 2NZJA 4J07A 3T3HA 5I3ZA 1CJKC 5JBNA 1KA9H 3P0IA 1YDMA 2AFIB 1QC5B 2DKFA 4WINA 1EFVA 3HGTA 3NHPA 4QXRA 4RQAA 3GGJA 3NCTA 4JI7B 5I9LA 1QH1A 2CUKA 3FNQA 4TUYA 2FH5B 5CEEA 2FZWA 3NV9A 2CLLB 3HFJA 3KYBA 1E2PA 2GN0A 2P4EA 4E03A 3BCSA 3EG5A 2L42A 4C7VA 5DASA 3N3AC 4R2KA 3PQ6A 4Q1EA 4UUBA 3T4XA 2VSQA 1E6UA 1ACMA 1NYLA 3V7FA 2CZCA 4PQRA 1VE6A 2REQA 4BNFA 1ZR2A 5L51A 3T0IA 3A4NA 3OJXA 4DILA 4IIJB 3H2YA 4GX5A 4M89A 4N6NA 3V42A 1OH6A 3AMVA 3PFHA 1WULS 4CIXA 4TWAA 4MGKR 4BNGA 4AECA 4QO8A 1IVYA 3E7FA 1DQZA 4L50A 4I6UA 2PZKA 3CH6A 1RPTA 5M29A 1X1EA 1YULA 4EHKA 1OD6A 3WLQA 2JHFA 1SBHA 3UZUA 3W5UA 4FGZA 4OHZA 3CVWA 5KPJA 3ROFA 2P9QA 1OWNA 4ARVA 4BKOA 4JQZA 1TUBA 1KQFA 2XB8A 421PA 1TADA 4ON9A 4V0ME 4EJ6A 4AZSA 4JEIA 2HV8A 4JXJA 1XFDA 4BMDA 4RELA 1Z68A 1J22A 2A0WA 4ZYVA 2FVXA 4JDPA 1TF5A 4KWEA 4EM6A 2O07A 3IR5A 3QYAA 3T35A 3OPQA 2MXDA 1V7CA 2OFOA 2UYGA 2XHZA 2ZB8A 4LBVA 4YBRA 5BN3A 4TMFA 2JLYA 4FB5A 2EXXA 2AS0A 5BNFA 1IBRA 3GLIB 3G6WA 2AN5A 3HVRA 3AHFA 4EY5A 1ADFA 2OCGA 3OQ1A 3LX5A 1A71A 2ISCA 1OGIA 4OB4A 6GPBA 3O93A 2JKVA 3AL2A 5H81A 1AS3A 1DX9A 4EKGA 1FF9A 3EBLA 2X0KA 4M8SA 4N6GA 3SE7A 4QNNA 3W7VA 3HJCA 2HXYA 3PJGA 3UOGA 1BW9B 5K3DA 1MO2A 4MVJM 1JH9A 4F06A 1RHJA 2GXAA 1ZK3A 2HCJB 3PXCX 4INOA 4OQYA 4F8YA 5CLLA 4DCVA 4DZZA 4MLCA 3VYSB 2BKLA 2YKGA 1GAWA 3G9UA 4Q02A 4DM3A 5CM8B 3WKAA 1Z7BA 5D8DA 1P1RA 2FWBA 3P4XA 3UJ3X 1TMYA 3JW8A 3BT7A 1E2EA 2JCSA 3ON5A 5CB8A 4Q34A 3FA2A 1MB2A 1PBNA 2EX1A 1X15A 3N2YA 3NB0A 4GH5A 3ZV5A 3WGQA 4TV9B 3VKHA 4F3YA 1XKXA 1E6EA 3KS9A 1YHNA 1UPFA 2ZJ2A 4AM8A 1L4KA 2YZ2A 2HNBA 4Q9KA 3TB4A 4MQEB 1SG0A 1KI7A 3AI2A 3B51X 1ZUWA 3CW9A 1PJTA 1WF3A 4UUNA 1I5OA 3LC0A 4W7IA 5JV5A 2J5RA 2JFVA 2OXCA 2I7VA 1GCIA 4R16A 1NE2A 2JBHA 1QO0A 1C7RA 4FOSA 5C8VA 4ESEA 3GGDA 3R6LA 3WQBA 3LJKA 2MSNA 3V4OA 4AQ7A 3BKXA 3IMKA 4BVLA 1I2CA 2B1IA 4Y6QA 1QZXA 1T5BA 4X63A 3ZHQA 5FPYA 3NRCA 3IMFA 1K5HA 1Z28A 3T34A 3GLRA 3EGIA 4TYWA 2EKQA 4ASUD 2VXOA 2WM9B 3N8DA 3ZNQA 1E3OC 8ABPA 2YZGA 3LQRA 1V7QA 1I3NA 1AKRA 3CH7A 3O4GA 1UMBA 3ZY2A 4II2A 5CXQA 3DVAA 4O3MA 3K9NA 1BEEA 4HO1X 4PYQA 5GIPE 1GTSA 1WXWA 1F0YA 1N0HA 5HX7A 1UBHS 5U4XA 3CLSD 4KFSA 5DX1A 1KEVA 1U3UA 2HK6A 3EG9B 4L72A 3W8DA 5L6MB 4MVJG 1X1RA 4OUDA 2QRGA 2X1MA 3EWNA 1YJAA 3GPCA 3IPYA 3WDLA 4QD3A 1CCWA 5HZMA 1N3LA 1QR6A 5DLEA 1CYDA 1M2HA 4HNAA 2G9NA 1JKXA 1C41A 4GI3A 1P6XA 5DIZA 2J41A 2A7QA 4WNYA 1E6MA 1D4OA 1U3FA 4J0GA 5F9MA 3VHQA 3ET4A 1YE3A 2GHTA 3Q72A 2OKCA 1JYSA 3I39X 3CX4A 2IBTA 2VC2B 1TM2A 3F96A 4HVCA 2OBLA 2TMYA 1ACJA 3AVTA 1G8SA 3H1GA 1I6LA 3BDIA 4UMFA 3VAYA 1Z08A 5DM0A 4AP6A 1X9GA 4C0BA 4CJXA 4YT2A 2XXQA 1MCZA 1GQOA 1CBUA 1OASA 3KKEA 5EWLA 2H16A 1PTJC 1ATIA 1J90A 4EG1A 1E3EA 3EEYA 2I1LA 3T12A 2O8FA 3JAKB 3KK0A 2HTEA 1AQUA 2Z4RA 1DJPA 4WBNF 1NN1A 3ETCA 3AQIA 5MHTA 1MF7A 1ZIOA 2GF2A 4KQ1A 2EBUA 4U6QA 3TGWA 2NO6A 3IQWA 3NT4A 1PCXA 4UNQA 2J6CA 2KX7A 3EFOA 2ABWA 3FKQA 4PBTA 3VPGA 5DV9A 5J23A 3DE6X 2V0NA 5DVZA 4MCAA 5T67A 2I91A 3L0PA 1K3TA 3W05A 1YZQA 1RPJA 4K86A 1CR4A 3H65A 2VP2A 2C9OA 1RXUA 3PX2A 5LCXA 3S2IA 3VPBA 2FMTA 4RZUA 1I10A 3MBIA 3I61A 3GHYA 4IYRA 4CR8A 1TLTA 1YSCA 3WADA 4JLDA 3BSSA 3RC1A 4YPVA 4A10A 3U0BA 4F8JA 4EYQA 3E5MA 1VC2A 4NYIQ 3V3TA 5K3OA 1N7GA 4MYTA 2O7NA 2XOEA 4QBGB 5IZCA 1REQB 4DCOA 2PJDA 3PI7A 1UBJS 1BKYA 3GNSA 4O1IA 3UV7A 3ZH9B 2ZT7A 1RYDA 2PUDA 3FDXA 1QP8A 2A1UB 2B35A 3L8DA 2OPHA 3QF4A 4YX9A 3MWEA 3TX6A 5IKPA 3GLIE 1R8SA 3FD8A 3NAMA 1L8QA 4M8KA 5IJZA 3A1DA 3IIMA 4CETA 1EE2A 2AW3A 2XQJA 2F4NA 4GMKA 4C4RA 4D81A 3RK0A 3DZ8A 4HDSB 2O19A 4KPEC 4U7HA 1Y5RA 4KP7A 2IUUA 4B3TB 4BNXA 3IKMB 1DDGA 4XQEA 2D7DA 2K2WA 5D5HA 1OIXA 3S2FA 1YSEA 4WK0B 1JWLA 3P7MA 4YQFA 1H2HA 1PQUA 4KQ9A 3KOOA 1ECPA 2YW9A 2JGRA 2GGSA 2W70A 2BH2A 2NMVA 4EFNA 1QVWA 1GRRA 3VRHA 2AE2A 4JGBA 1QU3A 1KVTA 2JIMA 2GT1A 4WLOA 1CY4A 3G0IA 3OPVA 3E18A 3KD2A 3THRA 3HRHA 4PRKA 4GZ5A 2AFIE 2PPVA 4ITVA 4QJBA 5GOZA 4PHHA 1JG6A 2XYQA 2XGGA 4ZKEA 2CNNA 3WI7A 4WVLA 2EQAA 3PZRA 5JC1A 4KGZA 4UTOA 4YJ2F 3D7SA 1BH2A 3BFPA 2YFQA 3PDHA 5LLSA 1GNLA 5FTNA 2EFCB 3KSMA 3KZ1E 5A04A 1AKNA 3VAZA 5MFZA 3IB6A 1BXGB 2W4IA 1I4DD 4L27A 4IKOA 1OWLA 2NU7A 3PRHA 3MWJA 1N2CA 4M54A 5GVSA 1OREA 3V4PB 3HLKA 3ZWWA 2ZIVB 2XNJA 3VOTA 1QP4A 1X0XA 4UMEA 5EP1A 1IBSA 1UF9A 2Q8NA 2PEZA 4AF7A 4LS3A 4REMA 5D1HA 5ALLA 2QW1A 4EMTA 2IWHA 3RV3A 2I6TA 1VCOA 3WHPA 3KCNA 2HU2A 3DB1A 4S05A 5IJWA 4NJEB 4A91A 1IOLA 1N2HA 3OPMA 4OHVA 4GXTA 3PWKA 3VKVA 4YR9A 4QM7A 3G7DA 1V5FA 3A9CA 3L8EA 3EZLA 4KPGA 5CBPB 1Z25A 2QZJA 4PPQA 3T41A 3LCCA 4JD5A 1N2XA 1T36A 2UZAA 4RMJA 2G70A 2G9ZA 2G80A 3G9XA 4J16C 3ZHRA 2B82A 5F7JA 3D4BA 5H16A 2XI8A 1X7WB 3OIVA 2W22A 3RUHA 5HTKA 1PR9A 1DTWA 1AJEA 3MEQA 4U7FA 1HL3A 1RC1A 1XJ0A 2J9FB 3CKLA 3GRCA 1QP7A 5ALSA 5FI0B 4UREA 5HTOA 3PGMA 3RODA 4BRZA 2PYZA 4RMHA 3T9EA 3LCUA 1FFEA 1PYOA 3BERA 4CT5A 5YASA 4CQJA 2XYVA 4KHPB 1NHWA 4NZYA 1HFJA 1SVMA 1AGNA 1RQNA 3VR2A 3V4SA 4M9CA 2CVPA 3AOEC 4XIJA 1UJCA 3UC5A 3UICA 3S2ZA 1UBSB 3QVLA 3MYYA 4N5IX 3TSOA 1OCEA 1ZOOA 3MOGA 3SEQA 2XMPA 3BTOA 2E1PA 4UU7A 4ZAZA 4X97A 4A03A 4DL9A 3PDIB 4KEAA 4DZTA 4YUXA 4DV3B 1JVSA 1GPDG 4H7HA 2EYQA 1PL7A 2MQKA 1U3TA 3KQTA 2WWHA 4Q9IA 4JQDA 1VLVA 1ZM9A 2AMYA 2UZ1A 3DYBA 2WY2D 3TQTA 3ZY6A 5J2UA 3C70A 4Z4CA 5JEEA 3ICCA 3O1LA 3MGAA 3K0EA 3T1VA 4DA4A 3C87A 3RAFC 2NYAA 3NOVA 4U2FA 1LPPA 5DE3A 5K2MA 4DSNA 2PH5A 4URUR 4GU5A 3AHIA 4N0EA 3TRKA 5GQSA 4UD6A 3R3WA 1T8UA 2P1RA 1WABA 4QKQA 3DMTC 4WOJA 5BNIA 1R0SA 1ZA1A 2W8BA 4TUYF 1W87A 1XTJA 3BIXA 3CC8A 1XWWA 3RUAA 2J1LA 1IJBA 3ONDA 4BNTA 2HMYB 2X8AA 1RLOA 3C2QA 4ZCQA 3TLEA 1D3AA 4G5HA 3MB8A 5DEIA 5KTOA 1KQ3A 3NHYA 2DH5A 2YWCA 3QF7A 3CG0A 3RTGA 4TZKA 3WO0A 4MPDA 2ZJ4A 1DAGA 1FW8A 5JFGA 2XMZA 2YOFA 2R66A 3K2QA 4LJ8A 3ZQ4A 2R8YA 4I8TA 3VGPA 1GQYA 1KP9A 3IKTA 2NACA 1XQVA 4D92A 3D8SA 1PK9A 2C4WA 4E2ZA 3FPBA 3PZBA 2BPOA 1NZFA 1V25A 4NNJA 3H4VA 2IU4A 2XCSB 3FSGA 3A7DA 4CL3A 3BIJA 1KBZA 5F76A 4MCXA 2ZIAA 1J0DA 3B7GA 4CQNA 2Z08A 1L5HB 1UEIA 1NA5A 4YV2A 2PBZA 3LT2A 4OMFG 4V1CI 2CLKB 4KFCA 3PPYA 2PXDA 2IVFA 3W2TA 2A7XA 1N5RA 2WTEA 3FYAA 4KYUA 2WG1A 5KOHA 3E3OA 4HRYA 3I2GA 4CMIB 4GQMA 1HL7A 1RIFA 3BRWA 3UJAA 1AQLA 5DRYA 2W6CX 5CYGA 3AR4A 3GFBA 3O9VA 4DR2B 1DBQA 5BQ3A 1E9CA 5SV2A 3EPHA 2IHKA 3VO8A 1GU7A 3FWNA 5G0WA 3NDBB 3ER6A 3ZE8A 3W3AD 1SULA 3B6KA 1KIFA 4KWCA 1JAHA 4QXMA 4A0QA 4E22A 1IMJA 2BHTA 3GW8A 2EF8A 4B6PA 1RXEA 2H2DA 3TBFA 4LRWA 2HBZA 3WL3A 4BN5A 5DP2A 2VP0A 4AXXA 3OP9A 1AN9A 2QN6A 3IP7A 2Y0EA 5GZ6A 3DLIA 2KZ8A 4YAOA 3U7IA 4M86A 1K6IA 1C80A 1X7XA 3OIFA 3RSCA 5K8CA 3O3OB 2ZVDA 1G6KA 6NULA 3NBYC 3NHAA 4LXXA 3UH1A 2R8OA 2ZRGA 3MQ4A 4PLGA 2CFTA 5LNK1 3TMAA 1P1CA 3OMLA 2BJCA 2DT8A 5DMXA 3RBZA 3OT1B 3FGNA 2J31A 1S1CA 4BPBA 2QTMA 3AG5A 1GLVA 1ECCA 3HKEA 3HVHA 2H1SA 4JLVA 1OGYA 1SB9A 5A4JA 1P2BA 4Y2XA 1OAOA 5FWYA 2CXRA 1NJ5A 5AYVA 1H85A 2BE7A 2NIPA 2EF1A 1LNQA 3CF4A 4J0DA 4F1WA 3ONEA 2FMHA 3UJCA 2HK7A 4E3ZA 5FOWA 1QK3A 3L4BC 4RCYA 1BG6A 1ZJ6A 2RHOA 2ZUCA 3FFBA 4H1TA 4CM8B 1WSBA 3BE4A 3TDMA 4EFLA 3GCWA 4N5NA 1NM5C 4M7RA 3GZDA 2ID8A 4LF4B 2G8LA 1K8ZB 2FPIB 5JY6A 4R7TA 2JGIA 2HN9A 4ETMA 1Y33E 1GT6A 3FYUC 2CDNA 4DJDC 4RY9A 3PEWA 4CYMA 1ZSVA 3KEMA 3C7KA 1VECA 4QNMA 4GYWA 2HCRA 3B12A 4MP6A 4P82A 5IH7A 3QQ6A 3LDGA 1TM1E 3GN2A 3BMOA 3HNRA 1HDRA 4HB0A 3C41J 3DQZA 4P38A 4QATA 1YIDA 2ZR7A 3T4UA 1YOVB 2ZDHA 1L8AA 4BUCA 2W98A 3VVCA 4AUMA 5I3CA 4PLVA 1KFBB 3C5HA 4GXQA 3VZRA 2XGOA 2PV7A 3Q87B 3Q6NA 3IQEA 1XTUA 3DHYA 1XDWA 3F6YA 1V8ZA 1URPA 4D9BA 4ZGBA 3BFJA 3REQB 2H8RA 2W48A 3HEMA 4OHRA 3VISA 3FFAA 1Z0ZA 1P9OA 2VS1A 5CDHA 4HC4A 4BMZA 5BMOA 5BSEA 1JB1A 3O4FA 2GFHA 2X0EA 2L69A 2DHRA 5KOHB 3LFPA 4IJUA 3IBFA 2Q2OA 4RPGA 2LCQA 2CBGA 1BX1A 3U4CA 2BEVB 2P7HA 4LKRA 4O4JB 1VB3A 3K4PA 3K09A 5DYTA 2B6NA 3MJRA 4G36A 3O7MA 4GM1A 3SDBA 3AUFA 3KXLA 1W581 3K1TA 1J24A 2PPLA 1EHIA 2PYIA 2W11A 3EQZA 5ILQA 3T1OA 5HOQA 1A9SA 2F43B 4UAGA 1SOVA 5HJ2A 3FCCA 1OXUA 4XB6B 1HT0A 2ZG6A 4IWYA 5HM6A 3LP5A 5B1SA 3VVMA 3OFNA 4BMVA 4R9SA 3QKRA 1E2JA 1PHPA 2SKEA 5LB2A 4D8YA 1FLNA 1Y8RA 3OH8A 5E7IA 5CG1A 2PXHA 1QHIA 1G63A 2BC9A 2R1VB 2OFFA 3VPHA 2CLEB 3RUEA 3IE1A 1YKGA 3HCCA 2NYUA 4D4KA 1UOPA 5THKA 5C7IO 5LQMA 4HGRA 3QVUA 4PYRA 4B3CA 2D1YA 4RIFA 3O74A 2Z0MA 5BR4A 5E6UB 3I30X 1KPHA 4K03A 3K35A 4Y3UA 1R8YA 4MW5A 1NPTO 2OHIA 3QYPA 3G59A 4G5RA 2H1HA 2ZE5A 3OP4A 5ELLA 3OETA 4BFSA 4IG9A 4DLBA 4PNEA 4PYJA 2QBYB 1P61B 1MR3F 3JQ7B 1NGSA 2RMKA 3T3GA 5FOSA 1VSUA 1W88B 1RWNA 3CH4B 1ORHA 2VQ3A 2IF0A 1T9DA 2CXOA 2R7LA 1QO7A 4PC1A 4TLMB 3ZOKA 2NTJA 3ZWVA 4FYJA 3ZJVA 1J21A 1TJYA 4G9BA 1S2GA 4PZAA 4A27A 2OO3A 1I6KA 2IW1A 2Y1XA 4C0KA 3NBFA 2H4JA 4PIVA 2RK4A 3RT9A 4BUZA 4FWTA 1N34B 1OWPA 2CB0A 3C5VA 4J7CA 3UHFA 1K7XB 2JJ2A 5JQWA 1QOPB 3A4YA 4J0KA 3AEXA 3BDNA 3OBBA 5FKJA 3UH0A 3I76A 4BJ3A 3SCHA 5IM4A 1T2NA 1PZHA 4WECA 1HG0A 1LK0A 5FBVB 1Y80A 3NIWA 3DT6A 1ZKDA 2QE6A 5LQJA 4XWYA 1ZNYA 4JYCA 2OUKA 1YHZA 1E1QA 1D1QA 1EEXB 1PYDA 3VR6H 5JSZB 4QHSA 1Z4MA 5K3SA 2Q62A 2XUQA 3FPGA 4G0OA 3G89A 3TOXA 4EX6A 5REQB 3DZCA 2O2DA 2QLJA 3BDVA 1T2FA 1KDVA 1N6OA 2R60A 3A6PC 2C5GA 4PU4C 1MX3A 3PFCA 1OZFA 3U3KA 3W78A 1E5VA 2QRMA 1MW9X 1QO0D 2WJZB 4DCTA 1RRCA 3MRSA 1QP0A 3V7NA 2CJWB 2NZXA 1VZ3A 2UYCA 1B8VA 3QEJA 2QTVA 5HE9A 2WUGA 4FOOA 1YJXA 1CETA 1U8UA 2Z2KA 1Y7PA 3HCDA 3ZK9A 1QH8A 2WQZA 3EK2A 3RGWS 2C4HA 1Z18A 4I19A 4RY0A 1TOAA 1J8FA 4TMVA 3WSTA 4RHTA 3B5IA 3PQEA 3S6JA 4AYXA 1AKQA 3QNUA 3B9RA 1Y8QA 1SZPA 4KXNA 4HMQA 4UQPA 2P9CA 3JATA 5ALYA 5F64A 1EAMA 1Z6AA 2HQOA 5THQA 5CLIA 5ELXA 1G3MA 1ML3A 1GSHA 3FPEA 3A9YA 1NNI1 2DUMA 4UDOA 4XYGA 1E7QA 2JPDA 3JWHA 4B46A 3GLGA 2BFPA 4Q9NA 5CH3A 3R9WA 2WWWA 3TLGA 1Z4NA 4A36A 1NVVQ 3N8GA 4MROA 1LY1A 4X71A 5M7EA 4BLSA 5H59A 1JSZA 1PYGA 4M1MA 4C7XA 4F93B 3I2IA 1EVJA 4D3FA 5FPKA 3DOCA 1NAIA 3ZCTA 5D00A 4Z4QA 3EF3A 1Z06A 3UHPA 5AVTA 3GRFA 3RASA 2EC5A 5CR9A 2QDKA 4ZV4A 3U61B 3H9GA 4FMCB 1ABFA 3LO5A 4J94A 1J39A 1UWLA 4D0GA 1RRGA 3AK4A 3OQNA 4KQIA 1O1YA 1X1SA 1CNFA 2JIZA 3VKFA 3CG4A 1JDTA 4HMPA 1LW6E 3SJUA 2XLCA 2Q2WA 1BS9A 3JYOA 4TT8A 1SRQA 3QFCA 4V0KA 2FWNA 1PR0A 4TOIA 4X1IB 5JH7B 2GPNA 4H6PA 4DR3B 1WCIB 3IQDB 2JLQA 1FFXA 4BFCA 2FMFA 1C3XA 2CYCA 5E3JA 3SNHA 1T43A 1UBLS 4L76A 1WUYA 5F3DA 1KIMA 2PIAA 2Q6LA 3PK0A 1ZLXA 5TQ2B 3T5MA 2ZUFA 3AR5A 4IW3B 3TF5A 3E70C 1U7PA 3KOMA 1ZQ1A 3GXOA 3LC7O 4Z2YA 4KR6A 1P3DA 1R0RE 3U3WA 1GUFA 1W5BA 2POCA 5LC1A 1PQWA 4JYZA 2IHVA 2ODNA 3KKPA 3NYRA 3B1FA 1C8VB 4XQ0A 2XQFA 2HDNB 2QB5A 1Z6TA 3G49A 1QHNA 5HG0A 2OYRA 2XADA 3STWA 5LLDA 2BGIA 2ZETA 5J2UF 2W6QA 4JT2A 1P60A 3QFTA 4GI2A 4BO4A 1JILA 4LYEA 4C01A 1R6DA 4UM9B 4XZ3A 1U7TA 2VLBA 4WNCA 2F3RA 3GAZA 4P7FA 1OSNA 2L82A 4JIGA 5AQEA 3OKFA 1PN3A 5AD1A 1BS1A 3CXUA 4LZLA 5JRJA 3VSDA 4CQMA 2R8PA 5DDIP 1UEJA 5HQ3A 4WLVA 1W59A 1A98A 4K9LA 4U9HS 2OGWA 3QA9A 1ZVVA 2AGVA 1E64A 3PGA1 4G4JA 1P72A 5U1PA 5AVXA 2XT0A 3ZHSA 1JQBA 1QWSA 1TCCA 4R6XA 3I2JA 3ESYA 3G82C 4XYBA 3GNLA 1SQ8A 2ODAA 3AB3A 1PD1A 4X24A 3WK7A 5CCBA 3BDAA 3DAHA 1DAHA 1SVIA 2FLVA 1LI5A 3G0CA 4PHGA 3RIXA 2KQUA 4D9NA 4DLAA 4IIYA 5F77A 4Z0PA 1VQ1A 1SKYE 2PLWA 2VZ8A 2Q7XA 4KAJA 1II9A 4LGCA 3TFWA 3NVKI 8OHMA 4V2UA 1T2UA 2GM5A 2VK4A 3UT5B 4DN6A 2C97A 2JHGA 3W4IA 1U9CA 4YRKA 1BSVA 5HZHA 5T4HA 3G2IA 2DC1A 3TEMA 2NUTB 4UUOA 2J5XA 2Y0BA 1BMTA 3IPLA 3IUBA 2PKCA 2H2WA 3LOQA 5LUBA 1C1DA 2F1HA 1Z0DA 2QZ9A 2E2WA 2XRYA 3P5BA 4O5AA 5I4CA 4AKGA 4ENPA 3A11A 5ICGA 2XX3A 1ISMA 4R2XA 5JADA 3T3MB 1XTZA 4WPGA 3WWPA 3D3EA 4PO9A 2ODQA 3EXAA 4V0NA 2QROA 2X14A 3LV8A 1JQEA 4EG7A 2WJHA 3C74A 4YHBA 3TJMA 1G17A 2WZDA 4DLZA 4QPZA 3PEFA 3RABA 2LDBA 4I08A 3OO1A 1U1CA 2H4WA 3ZWKA 3OHSX 5CLQA 5EAIA 4B43A 3IA7A 2P9EA 1FU8A 2ZIFA 5ECYA 2GASA 5HUJA 2ZYTX 2OZPA 5D3MB 1O9GA 1ZK0A 3PRYA 4H77A 4Z9BA 1EB9A 4D0NA 1PLJA 4EYEA 4FC6A 4CL2A 1W4AA 5LOVB 1DIBA 2H9YA 3SBXA 3LNTA 5JZSA 3DZKA 4Y6RA 3TRHA 1WZCA 2ZRHA 4XB1A 1FMFA 4GT1A 3L06A 2NWQA 4X8MA 1ZCAA 3IVRA 4F4JA 1C81A 1YAJA 1P4JA 1KBOA 3CPHA 2FWMX 2VZ0A 5AHOA 4HV4A 5AESA 2ZT5A 1TYBE 2CHQA 2NU6A 2BFEA 1YB1A 3I8OA 4Q9AA 5DNEA 3SKXA 1NE7A 2D00A 5E3IA 2B4AA 2FKAA 3UQZA 5HIAA 2L2QA 3PVCA 5ALTA 4DDHA 5KYWB 4DM4A 1OI3A 3KB2A 4P5EA 2HLNA 4QSHA 5BWBA 5C32A 1KO8A 3T7SA 3QWGA 1FLDA 1QF9A 13PKA 4OM7A 1KJIA 3TPZA 1U0EA 1XB2A 1ZK2A 2VSNA 4J1TC 1DKUA 4MDHA 1BE6A 3WLTA 4Q3NA 1BCRB 5JI2E 3SC3A 3T0GA 4RZHA 1N78A 1JLKA 5LBUA 2FNAA 2Q9UA 3VR2D 4EFKA 4ZEWA 2GN2A 4AYWA 1Q84A 2QUZA 4HUTA 4CEIA 2HTFA 5FORA 1NU8A 5BW8A 3OE1A 4M0FA 4DTCA 3K1AB 1M5TA 1QNFA 2RCYA 1RYBA 3C15C 5FAKA 3C3KA 1Z6ZA 1D09A 2FCAA 1V1MA 2J8ZA 3NYWA 1DE0A 4G1UC 3HVJA 4I1RA 4R2WA 3F6SA 1UMCB 5IH3A 4K40A 3O92A 1WHSB 2B5WA 1N2JA 1VMAA 3EUWA 3FRHA 1LX7A 3M1IA 5M3BA 3H4TA 3A8TA 3B1XA 5KYXB 3TBKA 2O8DB 1GXSB 1N4DA 1QIJA 1TJNA 3IT1A 4LDRA 2CL0X 4FYHA 1OZHA 1SUDA 4G0PA 4WAUA 5AKEA 2NSLA 1NW3A 1E8NA 4GEGA 2FOXA 4FFVA 4R2HA 4WFJA 4LC0A 2IDZA 2QP9X 4FFSA 2JIRA 4DLRA 2H9AA 3I58A 2GHQA 2Q4RA 4BOYA 3PNVA 3LP8A 2I7TA 3DPSA 2YXPX 3LHKA 1NBOA 2HQRA 2Q3LA 3IELA 4IVZA 2CSXA 1CY6A 4LOAA 4IDPA 3NH9A 4XAQA 1TO1E 4RX1A 3L6CA 4DC0A 3T5CA 3HN7A 3PR2B 5AKGA 2ACKA 1VP9A 2GKOA 2HHLA 1Y9ZA 3D2CA 3HCWA 1J9GA 2PXLA 2B1RA 1R9JA 5BOSA 2YVKA 2FK8A 2QRVB 3DPIA 4U8GA 3LUDA 2XXAB 1J0EA 4YJ3F 1BAPA 5E2IA 2FU5C 4EO7A 1H4QA 3A31A 4EW2A 4XJVA 1XZMA 3ODGA 3GEGA 3JQBA 1EU1A 3TXYA 4CIVA 2Q0XA 3CT4A 5DYNA 5IVKA 1WKVA 3CUUA 5DM70 3THYA 2NTNA 1Z37A 3F98A 3GJQA 1ORIA 4NABA 5C2JB 2EYUA 1FVHA 2VPZA 4LE0A 4MVJH 1N6RA 1FVXA 1QHYA 4KR2A 1Y89A 1C1XA 1CUXA 5K3CA 3CZCA 2V55B 3B3QA 1L8OA 1AUOA 1SQ0A 1PJCA 3FSGD 2PRZA 4AJJA 4C4ZA 4EO4A 1C3JA 3CVVA 3MZ0A 4KAXA 2Q3JA 2C5SA 2HFJA 1DV2A 5FA8A 4EJSA 1OC4A 1P0IA 1U81A 5ES4B 4NENB 4DPLA 5L3SA 1CV2A 3AVOA 3P9SA 1FYEA 2H3HA 4M98A 5H70A 3BWEA 3AJEA 2BI8A 4O2AA 1FFWA 1RMTA 4QGFA 1T9BA 3WICA 4Y30A 3ZU6A 4YMTA 2VZ9A 1QCCA 2IRWA 1ZUGA 5FOXA 2HMUA 5C8YB 1L7AA 2G72A 2HIHA 1WVIA 3OEHA 4BKMA 1EZ1A 4IWXA 4ATNA 3BRWD 1MUUA 2XCQA 4H59A 3IKVA 5D01A 5DNVA 1IOWA 2WDZA 1D2AA 2VR1A 2C5EA 1XFAA 5A71A 3HLTA 1IY2A 2GPWA 3EJ6A 1SUBA 3ASVA 1R0CA 3QWIA 4ZYWA 4M8IA 5JXGA 3DCNA 5LQAA 5K8JB 3VUFA 4UM8B 4ENUA 3AR9A 2VTDA 1ISFA 1J8QA 4RJIA 5C5IA 2W6JA 3U19A 4KKVA 3KR9A 4YRIA 2HI0A 3OO0A 2C20A 2PVCA 1YASA 1L7BA 5CM2Z 3DDWA 2CVZA 5A9SB 3LDFA 3GN5B 2DH6A 4P3PA 3KAPA 2XVMA 1HDZA 4FIDA 1XTPA 2L0XA 3FJOA 5IM4F 1PQPA 1RMYA 4QBHA 5LPNA 4PFKA 4US1R 4CKWB 1SB8A 2O48X 1JPVA 3VYUB 6YASA 1IEVA 4CBVA 5KWJA 2QM0A 5KYKA 1CNMA 4B6JA 2SCUA 1I3LA 3C3DA 4NL4H 2A0XA 1ZCZA 3X1YA 1II0A 1W35A 1RU3A 2A9VA 3B3FA 1MAWA 5I9IA 5E4TA 3JALB 2JLWA 4XJXA 4Q1DA 3RS9A 4RC9A 1MXFA 3BGIA 4G9EA 1RWOA 1I32A 4QA9A 1MPTA 4LRXA 3E9DA 2H1VA 1TMOA 3EUFA 3MAJA 4REOA 4YUWA 1AXGA 2Q0QA 2FW1A 4JH0A 4DARA 1EDDA 1NASA 5IVPA 2ZPUA 4FR0A 2NUAB 2IJGX 4OP2A 1L4LA 1OYVA 3H19A 4MKXA 4HP8A 4NAUA 1Z38A 3ZU4A 2NTVA 3BMNB 1MG0A 3F46A 4KCGA 2JFZA 4O8ZA 1X39A 4P2GA 4UE3S 1P0FA 4GQAA 3V7YA 4EI7A 2OFWA 2WA1A 1E8MA 4GVLA 3DL7A 3DQPA 3T15A 4DCUA 1P33A 3ZKWB 3B3JA 4Z6KA 5CYPA 3C4JA 4H60A 3CCFA 4F6RB 3CIFA 2C3PA 2ZI5A 4JQSA 1UFVA 5JECA 5K99A 3KTDA 3S2YA 4GRAA 4IRUB 5H83A 3VHXB 5LP6C 3HTXA 2HXSA 4EPYA 2WJAA 4JJFA 4CF5A 5EJ4A 2CE7A 4NMMA 2PIDA 3QSYA 3JV7A 1KH3A 3L84A 2BGWA 1JEYA 1QR2A 1ORVA 2I6GA 1EHYA 5EPUA 5TR9A 5A5GA 4RA9B 4RK6A 2WP8J 2XSZA 3JYHA 3L5OA 4NYJR 1R4MA 4X0EA 3S4YA 1TI7A 3IT2A 4OJQA 3OM1A 1NV8A 1CUVA 3EZXA 2V8BA 3L6OO 2OHVA 3HCBA 3LHDA 2VT3A 3OJLA 1N25A 4MWSA 2JLZA 1HDEA 1X94A 3KLMX 3KUXA 2IYAA 1LCDA 1BRTA 3AJAA 2VJPA 4K26A 4AF6A 4EF4A 1QQTA 2QNRA 3GUZA 1C0PA 4OMDA 4Z4HA 3M4NA 3Q1KA 2UZ0A 3DO5A 1G59A 3SYKA 4NARA 4FDVA 5CA1A 2PVPA 4OK6A 5CAEB 5B7PA 4RTLA 2B3TA 4QREA 2NG1A 1A9TA 2D0OB 1O8BA 2X9GA 5BVHB 1OAAA 1IUOA 1ZUNA 4FS3A 4Y2PA 4A0HA 3ESRA 4AZ0A 1CUYA 4HY3A 1WUIS 1Y3AA 4IKEA 5TX7A 4J1WA 2O7SA 2QLBA 1LWOA 4OUKX 5JCPA 1JHYA 2ZYRA 5KVCA 2WHPB 4PANA 3DTVA 4DA9A 2O2CA 2EBYA 2LYLA 3DAOA 2R1TA 5A2GA 3FMOB 1MMFB 5A4FS 3GQVA 3O8NA 5TPWA 2BEKA 4RQUA 4A4DA 5CVCA 2PR2A 3BH6A 3ZD9A 1A97A 1SEVA 4U6SA 4M6WA 1ZGJA 3SMQA 4OXNA 2HOQA 2PQMA 3USCS 3ACDA 3AWDA 2I3GA 5DNAA 4QLAA 1L7XA 5JI3E 1WMAA 2XOXA 2JAOA 3CF6R 4AWAA 4I50A 4Y6SA 1JQJC 4J1XA 1QG4A 2AN1A 2LYKA 3RSSA 3ZGOA 3FLBA 4W5HA 1D6JA 4ZQHA 1PU2A 1E6WA 1WZEA 4LMRA 1K66A 3BKWA 5I9TA 5NULA 1HWYA 1OBOA 1RM4A 2YY5A 2FN7A 3E3NA 2V4MA 3Q88A 1RD4A 4E3WA 3D6AA 4EVRA 3R41A 5KU1A 2J32A 2GFQA 3U5ZB 2EJBA 4QXOA 4HH4A 1YDEA 2JJ2D 1CQXA 2YBEA 4RVGA 4KYTA 4HK4A 3TB6A 2PBRA 3D2LA 2JFOA 4QFBA 4F5DA 3PD7A 2VH1A 2BZSA 3FI0A 1XU4A 2FE1A 3HU3A 1V6CA 4DB2A 3HL0A 1QRDA 1VG0B 2VJMA 3E9QA 2QX7A 4HEA1 2ASVA 3DEJA 5EP3A 2Q28A 4TTRA 3ETDA 2HMVA 5HKOA 1TJ4A 1XZDA 2PTHA 4Y0NA 4TTTS 1FQKA 4MZXA 1E1QD 4UPEA 1NY6A 1DQYA 1KJ8A 1J97A 5FAXA 1AIPA 1JXMA 5ITVA 3V1LA 4ZOEA 3W2IA 1RFLA 3N58A 3TOZA 2DFVA 4FHCA 2XZPA 1JBQA 3D1VA 1K8XB 1SAYA 3SHQA 4R2MA 3QP9A 3NHZA 3MPUA 4JA0A 1Q1QA 4XWTA 2UU9B 2CUNA 2DSTA 3HHPA 2X41A 2O0MA 2Z4SA 2ZP1A 4QUDA 2VDPB 4Z3DA 5EE9A 2HHCA 4EQZA 4RJTA 1AMUA 4ZYZA 3DDHA 3LCMA 3DXXA 3UWOA 4IVQA 4NEHB 3PGLA 2OR3A 3NTVA 1TK9A 4YFYA 4OB6A 4LY6A 3FZEA 4PZ9A 4E5KA 1F8UA 4Z7OB 4E2FA 5FPSA 1SXPA 5A6VA 4LZWA 2TSYB 4OU5A 1VYVA 4L4YA 4KHZA 1SQSA 2WLSA 3LNCA 2P75A 5JY1A 2B25A 2ZCVA 5FULA 3KOZA 3DFUA 1TT7A 2WMYA 3ABIA 3ROTA 5CFZA 1J49A 2M1ZA 1U02A 2LPMA 2Z2JA 3T1QA 3UC9A 3QUSA 4C76A 3OLXA 4YPOA 3ZK7A 3HFRA 3PSAA 5A62A 4J2TA 3UGKA 4N01A 2VLIA 3LGXA 3VTAA 1LCIA 3F6PA 4ETNA 2Y6VA 4AZWA 3FWPA 3F6RA 1K3UB 3N3BC 1YQQA 3QOYA 1KZ7B 2H54A 3QW2A 3UWDA 4BLRA 2C7PA 2AYZA 5CYFA 1JYEA 2Q46A 4ABTA 2IUYA 4IXMA 4DBLC 1Q0PA 3EXEA 2WAYA 5A06A 2AVNA 4X9XA 5CDGA 5JXJA 1XRLA 1S89A 2P6UA 1EH5A 3G8BA 5EE5B 4OYHA 5I7VA 3H99A 1GQQA 2XF8A 1HDCA 2VSXA 3BWYA 3LQYA 4H7DA 4LJ4A 4YLEA 2JIZD 2MINA 1JDBB 3U7QA 3WWDA 3R0JA 4BBJA 1BWPA 2L17A 3HB7A 1S8FA 4D9FA 5EQTA 1R0WA 3V2IA 5E4YA 4MAAA 4BMNA 1BN6A 3IRUA 4B9EA 2DQSA 2QMYA 4NBVA 2WV7A 2ASEA 1WIZA 4A2QA 3QBVA 1P2TA 1U0TA 2GPYA 4W6ZA 1Z2NX 4RVOA 4DE9A 2I4NA 2ZI6A 3L5KA 2ZJ7A 4NR0A 1DRVA 1JJVA 2QV7A 2VHQA 3AUKA 4YCBA 4D6YA 4DB4A 1EUYA 1E99A 1J99A 1KAMA 2Z30A 2EG5A 4Y9SA 3VYTB 4B6OA 2FTKE 4ND8A 3PTLA 1Z3CA 2R85A 5FBWB 3HLYA 1Y8ZA 1RZUA 1DXQA 3LFHA 4QRIA 4CMKA 5CHYA 1S2IA 3AT1A 1EBUA 1IIBA 4ZV9A 1B7GO 1SHLA 3M82A 3X1MA 5FJJA 5DCWA 3F2VA 3PBKA 1R1DA 2O2XA 3W2EA 3N0VA 1MB3A 3LW7A 3GRYA 3QMVA 3H5WA 4MA5A 1ZRMA 4P53A 2BM9A 2Y1DA 1PWZA 5JDIA 2COKA 2W00A 1GDTA 5JCOC 3AHEA 2ZRJA 1QB8A 3VU1A 3GJ5A 4I9UA 3LIIA 3ZHZA 3FZGA 4RYDA 4DSZA 4CQMD 4G0UA 1SZCA 4W63A 5B6IA 2VH5R 5SY9A 3ZYZA 4QBFA 3ZWXA 3NTUA 2VBGA 2CXPA 1HE2A 2C2YA 3QU9A 4KMRA 4I14A 3WLIA 1M1ZA 5ANRB 2ZXUA 3HB0A 3IV7A 3U5TA 1OH5A 3NJ4A 2BM1A 4FD2A 1E2KA 4PXYA 4CTOA 1R8QA 1ZW6A 3CRZA 1IQRA 3QFIA 1ZI9A 2LXNA 2ZGVA 3OZFA 3Q9LA 1TIPA 5BP7A 3C3YA 1NFRA 3G5AA 1ZH6A 3B85A 4DWWA 5FUVA 4EB8A 4ZYUA 2OOSA 1V26A 4WCFB 4A2WA 1AS2A 5BR8B 3EPKA 3Q12A 4F96A 5IT5A 5HZGA 4RD2A 3MEJA 1QLHA 1DEOA 3ZHVA 1SZDA 2AG8A 3FUWA 4V02A 3S8YA 2HA0A 1E5TA 1P45A 2YMQA 3L46A 4MS1B 4XPIB 4B4UA 4BBPA 2BL4A 2EJUA 3C85A 1Y1PA 3L8YA 1IZ8A 1QQ5A 3GJ8A 1CDEA 1BEZA 3PX3A 4FGSA 1XTBA 4MQUA 3U44B 1L5MA 3T1YB 3KYCA 2WJJA 2QORA 4LXGA 4O2AF 5EWJA 2ZIZA 1TA0A 2HJHA 521PA 2C4MA 3D5EA 4HRVA 2IWRA 3U3ZA 4G0NA 1BGVA 1P2DA 2FDXA 1YOBA 1ELOA 2P3OA 4PLWA 3HZOA 2V5AA 4BNDA 4MUEA 2AOUB 5A0TA 3DO8A 4BY9E 1FTSA 1NXOA 2HQBA 4O3FA 1K7FB 4EUSA 5JIBA 1BVRA 1XMXA 2R2AA 2NSHA 4Z5CA 3NDIA 4F71A 1WB4A 3FPKA 2BFBA 4P84A 5MN6A 1BTOA 2R87A 2RGEA 2NZWA 3OAAA 3JRNA 2VI5A 2VEOA 3CECA 3O4VA 3G2OA 4AY2A 1H9BA 3THOA 4FDAA 3QEBZ 4Q1VA 2GAIA 2PMEA 1FLVA 3I9FA 5F35A 5CB0A 1G8GA 5ELMA 2LLVA 1RE1A 1XZGA 2WIUB 5JYDA 4QTXA 3FLAA 2ZREA 1JDZA 4HEQA 4Y42A 2EJWA 2JI4A 1DKLA 3AHCA 3DW3X 3OG9A 3DD1A 4PLCA 1XCOA 3OZXA 1PO7A 1BXRB 1V45E 1NHGA 3A6KA 5DF1A 4B2PA 4AJHA 1G8YA 4YRQA 1YB5A 1N6PA 2ZE7A 2MYNA 4P31A 4L28A 2WICA 5ENZA 4XIYA 3DJFA 3NCHA 2P2GA 3F0TA 3MTBA 5G41A 4B87A 5KIAA 3EZGA 3DLHA 1INLA 1N36B 2PXBA 1XDUA 4C0HA 3SQOA 1CF2O 1C9JA 1UBEA 2C7OA 1YQGA 2FN3A 1B8OA 1QS0A 4JCXA 5LNK6 5B4TA 1RACA 4G8JA 3LKVA 3F5QA 4BVBA 3FLMA 3EPPA 2VCHA 4EPRA 4CL8A 5KSWB 4RDHA 5DTIA 4O02B 4PQGA 1NMQA 4I9HA 1G5TA 1G5HA 1S8AA 2DECA 4G67A 2X4LA 2YZMA 4JEUA 5LZ8A 3L01A 5TNXA 2CZGA 4X8HA 2BTEA 2X6QA 3EOAI 1KKLA 3O7WA 1DINA 2O3SA 3O6VA 4MPRA 2REXB 5HFAA 2O1SA 4C03A 1YVEI 4DR1B 2NAPA 1HNXB 3CWQA 4KDCA 3CVUA 2KPOA 1DX6A 4IINA 4QHYA 2VHJA 2P6NA 2ZZKA 3DONA 2QTWB 1H2YA 4JVNA 5FI5A 1G7SA 1GRCA 2OXEA 4E5MA 1IOVA 1O6FA 3SVZA 4AK9A 2FSPA 2QTCA 1YVPA 2VWHA 5BSGA 1GFIA 2JZNA 1K89A 2XAUA 3INYA 1P8JA 3ONFA 3OZSA 5GWXA 4MRMA 2CROA 5TSDA 1HKHA 3HVUA 3LLUA 1T26A 1Y3FE 3GJ6A 4XYMA 4IUYA 1PV1A 2KW5A 3F8WA 2R79A 3EMBA 2JFUA 2DUUA 3LOPA 4S24A 4Y2UA 4OQXA 3FTCA 2OD2A 2CNLA 4XE5A 3FDZB 2YHIA 3IQGX 2R48A 4MVJP 5EERA 5FFFA 1X2BA 1OXXK 4TRMA 3HEBA 2IEYA 4G5SA 5J47A 3C8DA 2ZIXB 4KITB 3P9KA 1NFFA 3F5SA 2A5GA 3Q7PA 4U4AA 3RV4A 2GSWA 1B41A 2CSFA 1BX0A 4D8VA 1EGMB 4N7BA 5D85A 2FSUA 3M1YA 3UT6A 4BB0A 4CMJA 2WAAA 3AXSA 1AUQA 3WGTA 5BT8A 4M88A 1CDOA 4TWRA 4XD2A 4B3RB 3U3OA 4P0TA 4BQOA 1DIHA 2QM7A 1LBHA 4ND6A 2WD7A 4E51A 4WNAA 2GEJA 3E9ZA 1UBCA 1GL6A 2F4VB 1US8B 2W6PA 1JSLA 1NMYA 3DR5A 4I3FA 2BR4A 5E3HA 1I2MA 3OCJA 4KAFA 3R1IA 1Q83A 4MVXA 5AQ1A 4OGLA 3FYCA 3CO0S 3OVMA 4FBIA 4JLBA 1FC0A 4Q3AA 4U2CA 2P27A 4QRDA 4YBZA