5DT2A

Crystal structure of dot1l in complex with inhibitor cpd11 [n4-methyl-n2-(2-methyl-1-(2-phenoxyphenyl)-1h-indol-6-yl)pyrimidine-2,4-diamine]
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
311
Chain Sequence
b'LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 311
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dt2A02
5DRTA 4PYQA 1NE2A 5DTRA 2PJDA 1EJ0A 1YUBA 4E2XA 2P7IA 2PXCA 5GM1A 5K8VA 1DL5A 2EJUA 2ZIGA 2CWWA 4RTOA 1FJXA 2PWYA 4QTUB 3LPMA 5IH3A 1QANA 3VC1A 2AVNA 2PSSA 2B9EA 2WA1A 3KR2A 5T6BA 3REOA 2AVDA 2AN3A 3E23A 3HA5A 4E2ZA 3UJ7A 1B42A 2QRVA 2OXTA 2FRXA 3EVFA 5K0EA 3PS9A 4RVDA 2P1DA 4ISCA 2O0LA 5K0GA 1JTEA 1INLA 3R0QA 5HIJA 2OYRA 5LSAA 1KPHA 4DZRA 5EIFA 4NECA 5GIPE 3B7PA 5BW4A 5K0FA 3A7EA 3CJRA 2JHPA 1SKMA 2OB1A 5HIMA 4RTMA 4RTKA 3EEOA 2BR5A 4EMSA 5EHIA 2EFJA 5E1DA 3FTCA 3LCCA 4AZSA 3P9KA 3T7TA 1OR8A 3ER9A 4MIKA 4RWZA 5FA5A 3O7WA 4R8RA 4BLVA 3ER8A 1XJ5A 1F38A 4C05A 1BKYA 1RJFA 1KYWA 1D2HA 2XVMA 1O54A 2NXEA 4XUDA 4OA8A 4PYIA 5CVUA 3G7UA 4IWNA 3HCFA 4FT4A 4M38A 2BH2A 4YUZA 2LD4A 3CBGA 3I58A 4KDRA 5FTWA 2IH2A 2Z6QA 5FADA 3KPWA 1ZHFA 2PX4A 2IDJA 3H2BA 1QAMA 3LDUA 3FUXA 4LECA 3P2KA 3BWMA 4YMHA 2AOUA 4V0QA 5JUWA 4E32A 2C7RA 4PINA 4ER0A 4OQDA 3FPEA 3TR6A 1QAOA 2PLWA 3LL7A 1Q0TA 4PYJA 2ZZNA 5HOQA 3UJCA 2G71A 4LWOA 5EMKA 2ZBQA 4CKCA 5E1MA 3TOSA 5E8RA 5BW5A 4RTSA 1JTFA 1UWVA 4OBXA 2JHCA 1EIZA 1JSXA 1MJFA 5FQNA 3JWHA 2JJQA 4YMGA 3KPJA 3EGVA 4YUXA 1Q0SA 2G1PA 3FTFA 3SVZA 3FUWA 2IFTA 3FYDA 5EZSA 2NNWB 5H02A 3QV2A 3C3YA 2YQZA 2YUIA 5K0CA 1NW5A 2GAFA 5CM2Z 2GLUA 2PKWA 2OZVA 3HM2A 2AOTA 3I9FA 4EKGA 2VDVE 2O06A 3TM5A 1XTPA 3NTVA 4POOA 4H0NA 3GO4A 1IXKA 1NW6A 4K6MA 3QOWA 4O29A 4HG2A 1PJZA 1ORIA 4PCLA 5DRYA 5DTMA 1VBFA 3CGGA 4FSXA 3OZSA 3DXXA 3KQOA 5E8JA 4DCGA 2HTEA 1VL5A 5G02A 5B1SA 5LQNA 4EKIA 3DH0A 4DF3A 3LBFA 4M37A 2GA9A 5HIIA 2EJTA 1XDSA 4X60A 3LECA 4PYLA 2QE6A 5T67A 3A4TA 3MHTA 2VDWA 1L3CA 4R6WA 4ER7A 2CMGA 2IDKA 4HRAA 1JQDA 3LBYA 4XUEA 4A6EA 5E2AA 2BM8A 3FUUA 5FULA 1RI4A 1UIRA 2ZZKA 3A7DA 5K01A 5ICFA 4UOEA 1NW3A 4ER3A 2JH8A 4HSGA 4YV0A 4Y30A 3M70A 1DCTA 4IV8A 1N7IA 3VYWA 1H1DA 4BLWA 2NYUA 4AZVA 2VS1A 2P3QA 1VQ1A 2I6GA 4ATNA 1KP9A 4BP1A 3AXTA 2N47A 1O9GA 4X63A 5GOZA 4U7TB 2PX2A 4QPPA 3B3FA 4GEKA 4BLUA 1RJGA 4RTJA 3PX3A 2UYHA 4F86A 1JG1A 1ZKDA 4GQBA 3TMAA 3DULA 1EQAA 2AR0A 1TPYA 5EPEA 3DP7A 3O4FA 4M36A 5EC8A 5LR6A 3ELUA 3MGGA 4RV9A 3CKKA 3ORHA 2PX8A 3SSOA 5LQJA 4RX1A 3UFBA 2EG5A 3ERCA 2FCAA 3HNRA 3HVHA 1SVUA 5D1HA 4C06A 4KW7A 1F3LA 2IBTA 4HGYA 4PIPA 2EX4A 3G8AA 3CJTA 3PB3A 3UWPA 4RVGA 3WSTA 3PX2A 3M6UA 3FRHA 3LCUA 1EG2A 4XUCA 3BGDA 3B3GA 2BZGA 2JHAA 1RJDA 5U4XA 2AZTA 3THSA 3DTNA 2C7QA 1N7JA 2P3LA 4CKBA 2XBMA 2ADMA 3HTXA 3BWBA 2PX5A 4FT2A 3NDIA 4R6XA 2VP3A 3E05A 5LQUA 5CCXA 2Z6AA 3P2IA 3ME5A 3IYLW 3TPZA 1XDZA 1NKVA 2DPMA 5EGSA 2QRVB 4DMGA 5K09A 2R3SA 2BR3A 5E1BA 3NW9A 3EVBA 4R8SA 4AX8A 1X19A 5M5BA 4F84A 3FTEA 2NP6A 1VP9A 5EMJA 2CMHA 3I64A 1R8XA 2QY6A 5DM1A 2ZVJA 4C08A 3NJRA 5EEHA 2ZW9A 5K0LA 1D2CA 5P8WA 3EPPA 3OPNA 5DX8A 5CCBA 2OBFA 3ELYA 3FPHA 2Y1XA 3HCBA 3IEIA 3KQTA 3S68A 5KQRA 4Z2YA 3VC2A 1FBNA 3KPVA 2IPXA 2P8JA 4OX9Y 2NXNA 2FYTA 3GRUA 3OE5A 3SXJA 3R9XB 1L3BA 1YFJA 4KRGA 3C6MA 1N2XA 4U7PB 4P7GA 2AOXA 2O05A 1G38A 3UJDA 3R3HA 5E9JA 3P9CA 5DXJA 2ZWVA 1R6AA 4MHTA 1Z3CA 3SX0A 1VE3A 2F8LA 3BWYA 3EVGA 1AQIA 2H00A 4JXJA 2GPYA 2YXEA 3C3PA 4QTTB 3HA3A 3P2EA 4Y2HA 4PYOA 3U81A 5DM0A 5GP1A 3JWJA 3K6RA 5DM4A 1XCJA 4X41A 2G72A 3RW9A 1P1BA 5K0JA 2AOUB 4KVZA 3QOXA 2ESRA 3PFHA 2HR1A 3OZTA 3LDGA 2ZBRA 4P7KA 2HMYB 4IKPA 5CVDA 5K05A 4EK9A 3AWIA 2BR4A 1KPIA 2B25A 4FGZA 4C4AA 3DOUA 3MQ2A 4PGHA 1XVAA 3SGLA 1ZG3A 2GH1A 2AS0A 3EMDA 3EVCA 2HWKA 3GCZA 4QDKA 2G70A 1UFKA 1SQGA 2Y1WA 4R05A 1KR5A 2I9KA 4IV0A 1X1BA 1R8YA 3R6TA 5DLYA 5EMMA 4EVIA 3SSNA 1DUSA 5IKMA 4G56A 4ER6A 2OY0A 1PRYA 1KPGA 1T43A 4GF5A 3A26A 1IY9A 3DMFA 5D1NA 2YTZA 3R24A 1JG4A 2V7EA 2AOTB 3BGIA 3GU3A 3DXZA 3HEMA 3FUTA 3GRRA 1YFLA 3GRZA 3LKZA 5GWXA 4HC4A 3AJDA 3DR5A 1KIAA 1RI1A 3FPJA 1JSZA 1V39A 3O31A 4QPNA 3V8VA 3UA3A 3TQSA 5T64A 5K0BA 3M6VA 4GC9A 4AUKA 3GGDA 4L7VA 2XYRA 3C6KA 3G5LA 1NBIA 1EJ6A 3OFJA 2UYOA 3GWZA 4DCMA 5LQRA 1AQJA 2XYVA 2YVLA 4DKJA 4OQEA 4E33A 2YX1A 5E9WA 2ZFUA 5ERGB 4C07A 4F85A 3CC8A 4P7FA 2ZIEA 5EEGA 3X0DA 2HV9A 2ZSUA 3GRYA 4HTFA 4RVHA 4RTLA 1RI2A 5FHQA 3B89A 2OPBA 5ICCA 3UJAA 3GDHA 3V97A 3OU6A 3LX6A 4RTNA 2O07A 3B5IA 4MWZA 1L9KA 1YF3A 3UZUA 3A25A 5K03A 3MTIA 2WK1A 1XXLA 2P40A 4OBWA 3NWBA 3BKXA 3F4KA 4FS8A 4PWYA 3MERA 8MHTA 2NXCA 4V0RA 3ID6C 4QQNA 4PNEA 3K0BA 1HNNA 1D2GA 1Y8CA 2NXJA 3KQYA 3L8DA 1VIDA 5E2BA 3GIWA 3I53A 3TLJA 3UJ9A 3P9NA 2Z6UA 2BM9A 1G55A 2FPOA 2XVAA 3BWCA 3KU1A 4LG1A 4CKEA 2H11A 2ONYA 3CCFA 1AV6A 4QVGA 4GOOD 3FUVA 2ZIFA 2ZZMA 5DX1A 2IBSA 1P39A 5CIYA 3DMHA 5EVJA 1ORHA 2YXLA 5KQSA 2FK8A 1BHJA 5EZQA 3THRA 2JG3A 2B3TA 5BP7A 3MAGA 1QAQA 2Q41A 5HEKA 3OU7A 5ICGA 4YUWA 2P41A 4YUVA 2AOVA 3TFWA 3G2QA 3MCZA 4B17A 3CVOA 4A6DA 1FPQA 2P35A 1WS6A 4KDCA 5HIKA 3HVIA 5KS2A 4KWCA 3EEYA 3EMBA 4PCAA 3OZRA 4GOLD 3OFKA 4XCXA 5E9QA 5FWAA 4C04A 2R6ZA 1L1EA 1SG9A 1X1AA 1ZGAA 1M6YA 1QZZA 3KPYA 5EIWA 5GIOE 5LQAA 2ZLBA 3I5UA 3UJBA 4FP9A 2OKCA 3KQWA 1IM8A 4QDJA 3AY0A 2GB4A 3DUWA 4GBED 4AZWA 4E2YA 5EMLA 3KQPA 3PLAE 3TKAA 3HP7A 1NW7A 3EVAA 3EVEA 1NT2A 9MHTA 4HH4A 5F2KA 4YUYA 3GJYA 1WG8A 4CTKA 3PTAA 4QQKA 5HILA 2PV0A 3HCCA 2AN4A 2P7HA 3G88A 3HVKA 3M6WA 3GRVA 2UYQA 3HCEA 2ZULA 3EVDA 3AXSA 3M6XA 3NVMB 3P97A 3PFGA 3Q7EA 4M7RA 4MQ4A 5CVJA 3UBTA 2OO3A 3FTDA 1R74A 1M6EX 3DLCA 4GUAA 5FUBA 3ELWA 2QYOA 1JR4A 5DX0A 3UJ6A 3VSEA 4DM3A 4GC5A 4CXMA 4RTPA 1I9GA 5ICEA 3G89A 1YB2A 4GOMD 2ZCJA 5EQJB 2PBFA 5DSTA 4DA4A 3LHDA 3JWIA 3SR4A 2AN5A 5DSXA 4RTRA 3P9IA 3TKYA 3EGEA 1WXXA 1G8SA 2OB2A 3KQVA 2A14A 1ZQ9A 1AF7A 1JQEA 1VPTA 3TRKA 5DM2A 5FQOA 2UZ4A 4PIMA 3GXOA 1RI3A 2DULA 3OE4A 4PYNA 1RJEA 3P71T 5LQCA 1JG2A 3HA7A 3OU2A 3ELDA 5KVAA 4EQZA 5EHGA 3E8SA 1YZHA 1JG3A 3C0KA 1BC5A 4P7JA 3OCJA 3SMQA 3LGAA 3T7RA 5F2NA 4ER5A 1FP2A 2PWPA 3KR9A 5CUQA 5K0NA 2PVCA 1ZGJA 2IIPA 2PY6A 3M4XA 2I7CA 3G5TA 3FYCA 2IH4A 4YV1A 5DPMA 3MCTA 1P1CA 5FHRA 2P3OA 1MHTA 3KPUA 1I4WA 3T7SA 2ONZA 3LDFA 1XDUA 3LSTA 3PT9A 3KHKA 1YZ3A 3NMUF 1R18A 5E1OA 3UJ8A 1XCLA 7MHTA 4PONA 4E70A 1QYRA 3EGIA 1SUSA 2FK7A 4C03A 4X1OA 2PXAA 3B3JA 3EVZA 1VP3A 1BOOA 3LCVB 5LQKA 4HTFB 2I62A 1WXWA 2V74B 2CL5A 3FZGA 3DMGA 1NW8A 1L3IA 2ZTHA 3HCDA 4KIGA 4LWPA 1G6Q1 3UA4A 5KYGA 3Q87B 1EAMA 2ZBPA 3HVJA 4KIFA 3MTEA 4RSRA 4FZVA 4P58A 5CVEA 1O9HA 5DWQA 2G8NA 2QM3A 4E31A 1KYZA 2HNKA 1RI5A 3G2OA 3G8BA 3PVCA 2CKDA 3FRIA 3BKWA 5C0OE 2KW5A 5EKXA 1G60A 4E2WA 4WVLA 3CJQA 3D2LA 3G2MA 1NV8A 3GNLA 2YXDA 1JQ3A 1NV9A 3NWEA 2IP2A 4PYKA 2VZ9A 2H1RA 3KR0A 1HMYA 4E30A 3BT7A 5BXYA 1WZNA 2AOWA 3KQQA 5CD1A 4BY9E 4X61A 1FP1D 5DT2A 1R00A 4RYLA 2IH5A 2ORED 4GOND 3FPFA 4YV2A 2NP7A 5FWDA 3TM4A 10MHA 4PYMA 2FHPA 5FA8A 4RTQA 5JR3A 3HCAA 3P8ZA 4DQ0A 1KHHA 2IGTA 5F2OA 1NBHA 1SUIA 4HGZA 2K4MA 1KXZA 2E5WA 5C1IA 2UYCA 2C7PA 2ERCA 4OA5A 2XYQA 3RODA 2B2CA 5FCDA 2GS9A 5GM2A 3SSMA 1X1DA 5EKUA 5C9ZA 4MTLA 5DXAA 3RIEA 3FPGA 4ZTBA 4CTJA 3G2PA 4QVKA 3BZBA 1G8AA 3M33A 3T0IA 2WA2A 1VLMA 2B78A 3MB5A 3ANXA 5HFJA 2C7OA 1TW2A 5DTQA 1X1CA 2PT6A 3E7PA 1M0EA 5MHTA 3LKDA 5GINE 2YR0A 4BP3A 3BXOA 4FSDA 3KKZA 3IV6A 3DLIA 3NDJA 2O57A 1WY7A 2PT9A 4AZTA 2VDUE 3A27A 4FR0A 4WXHA 3BGVA 2JH9A 3JWGA 4PGGA 2ZWAA 2PGXA 3KR1A 3NVKI 3BUSA 3DXYA 3SM3A 5CVVA 5HZMA 1U2ZA 1TW3A 1P91A 4RVFA 5EG5A 5EOVA 4CWAA 1I1NA 3IHTA 2PXXA 3KQSA 1SQFA 3KQMA
chains in the Genus database with same CATH superfamily
5DRTA 2WOOA 1HL7A 2ZT5A 3N2GB 4RZQA 5ESDA 3S1AB 4HGNA 1AA6A 5JU6A 4MKRA 4IMIB 4CQLB 3CV3A 3E3OA 1HG1A 3HEBA 4U00A 3W8EA 4RTOA 4XIYA 1PEAA 3QKSB 4B4KA 1CK4A 4AMGA 2ZUUA 3EGWA 3CN7A 5FEMA 3A1TA 2B9EA 3RVMA 1LPNA 3REOA 4QUIA 1WX1A 4B7UA 2NZYA 2CJYA 2QD4A 4MRRA 1U0GA 2VC2B 2BP7B 2HA6A 3OZAA 5KQMA 3FAZA 2HMWA 3UGTA 2XIJA 1JN0A 1PKEA 2ZQZA 4N03A 1FFCA 1E5QA 1R6TA 3ETEA 4JOSA 4HF7A 4UVHA 5AM3A 3UCEA 3ZI0A 1X2LA 3RJ9A 5CA0B 5KX5F 5A6SB 3K5HA 3HFGA 5B3JC 1NNSA 2A9VA 2DRIA 4RPIA 1H05A 3DNMA 4XDGA 3T9DA 5CD9A 1ZD8A 4LZLA 2GWHA 3C70A 4HZUA 1K4KA 4IXNA 4OSOA 1SCJA 3HYTA 4FGSA 4HGPA 1S4QA 1CFZA 3HJHA 2CXHA 1SCAA 2QMYA 2XUOA 2CVHA 3RC7A 4RLSA 1PL8A 3ZD8A 3PFNA 3TUJC 3QWAA 4TXHA 3WIBA 1XAGA 4G65A 3ZQUA 4KH1A 2QUIA 4UBIA 2CCJA 3BTSA 4INJA 3CBGA 3D6UA 5FTWA 3IAS1 1PQUA 3O1JC 3N5KA 3N76A 4BRUA 2HA4A 1VYHA 5D5HA 3F6WA 5HMMA 3PUXA 4X4CA 9LDBA 4YCDA 3WB9A 1ZI9A 2A1IA 1H94A 1CZKA 3ADPA 2OD7A 5HF6A 1MGPA 4UM9B 4YMHA 1F2DA 2D00A 3SQLA 1RABA 2JH3A 1GUZA 5G3ZA 2EF8A 1Z82A 4U9HS 4QG3A 1JI3A 3I12A 1A04A 3NBQA 2O49A 2XNKA 3SC2A 3Q72A 3RSSA 1G21B 3O95A 2KEIA 1Q14A 3VSBA 3ZNPA 3I8XA 3II6X 1HYBA 2LCFA 1RHUA 1XCOA 2QRMA 2XR1A 2DQKA 4KSBA 5LB4A 2ID7A 4LVUA 1MO5A 1QUFA 3UAWA 3DWEX 3P20A 3PQFA 2W93A 3Q7RA 1A9XA 4ZPXA 3TZQA 4B6JA 4NMMA 4H27A 2W4QA 2Y4OA 4D74A 5BPFA 2WR8A 4CCSA 1N2CB 4LGVA 4BBPA 2W2KA 4YGXB 3PSHA 5BSVA 3KX2A 1GOTA 2YWHA 5IM4A 2DYKA 3LWBA 4ZODA 3Q15C 4K40A 1FZTA 3DL7A 1RC8A 4OHMA 3GA5A 5FPQA 4N41A 2XKJE 1KO7A 1AGPA 3FJYA 4DC1A 1U0RA 1JIUA 4GMHA 1YA4A 3NGMA 5HA5A 3LI2A 1KQPA 3L4EA 3LG2A 4F60A 4YGYA 4OJNA 4JYMA 1NRJB 4AAYA 1C30B 1SVLA 2NLOA 2ZM6B 4B2LA 2CBGA 3BXGA 1N2BA 3FDJA 3GJ3A 1HZZA 3D43A 1ADYA 3I0MA 4MSUA 1EE2A 4PZZA 2LYQA 2UZ1B 1U8UA 2MIIA 2X4LA 3PDIA 4FDTA 1RI4A 3A2MA 4IM7A 1HQDA 3H5NA 5ICFA 2BM0A 1JHXA 4FSHA 4ZOAA 4MVJE 1NE7A 3IC5A 2WAXA 2VH5R 4PG4A 3VYWA 4JBYA 5BQFA 4AO8A 2RMKA 2LPMA 3KDPA 2P3QA 3I4LA 4OL9A 5T6MA 1W9HA 3RRNA 4X63A 2N47A 5AVRA 1F12A 2IZ1A 3DQQA 3DHYA 3EQ8A 3KKKA 4GEKA 4QLOA 1UBOS 5B1YA 4YAIA 1O7JA 3IE1A 1U4NA 2EKQA 2WZCA 2RGUA 1W5EA 4ITVA 2DSTA 5FI5A 2I65A 3HVRA 2IHJA 3RT7A 4REOA 5EC8A 3B7GA 3F3YA 2JBHA 2ZRCA 5DZSA 1OH7A 1DKPA 1Q2UA 1ZICA 4P5EA 5GVRA 1A97A 1SVUA 3KNZA 4Z2AA 1WKBA 1Q1ZA 4NP6A 3KLOA 3RTCA 3LY9A 4P3NA 3VMFA 2HSWA 1RQNA 2DBRA 3M6UA 5TS2A 3CSUA 3LCUA 1QP7A 4F4FA 1EG2A 1N9GB 2BKLA 2EF0A 3CFYA 1SZCA 4XSHA 5DWVA 4EG3A 4QKQA 3MRXA 1BDBA 4K7JA 3TQQA 1ADCA 3KAJA 2P9BA 4IDFA 4V0KA 4BFSA 5ELXA 3PIDA 3VKHA 5KZMB 3RFXA 4KFTA 4CKBA 3NKVA 1P7WA 1GQ2A 2IYEA 4LRUA 1J0EA 3QU9A 8ADHA 3BHNA 3GEIA 1IB6A 4CMEC 3DJYA 1IXSB 1EFRD 2X8BA 2I3ZA 3FSRA 3PQ3A 2RGEA 3WGQA 1GQYA 2Q6OA 2GN1A 2QRVB 3BWEA 3FNGA 1MO6A 2GTPA 1P1JA 3O3CA 4QQ8A 3RU2A 1NF9A 4ZZ0A 5L9AA 1M5UA 4XB1A 5M5BA 1J2TA 1MH1A 3K31A 4KMOA 2P5UA 1R8XA 2WRZA 2PXFA 4KUGA 1U9IA 4RD3A 2WMNB 4W5WA 5FLYA 5KYWB 4K9PA 3DAPA 4MWCA 1GR1A 4ROSA 1W59A 3KHTA 3FI0A 3ITKA 4FYPA 4YP9A 5MFPA 2BFEA 3BXHA 1A4XA 5K4HA 3FPHA 3RC9A 4DADA 4RULA 3M9LA 1H5NA 3QBEA 2Q6LA 2Z1DA 1E2GA 1QTQA 2VCEA 1M83A 1M8KA 3A4LA 3F4BA 5FL7D 5A3VA 2OPHA 1ZMOA 2PUBA 1S1MA 2J41A 2O8DA 3TW4A 4NHEA 3BBPA 1JSCA 1IHPA 4ZAXA 5FPPA 4INOA 3JD3A 1AG9A 1G8YA 2HZBA 3IRUA 3TIFA 2FZKA 4G9BA 2BUBA 4TTVA 1NRXA 2OXRA 1N2EA 2I78A 4CLDA 6REQB 3TECE 4QOGA 5G1PA 4ZCQA 4OKNA 1G7TA 5TRTA 1QBKC 4HR7A 5CW2A 5GP1A 1LDGA 2PKRA 1A95A 4Q1EA 5AYVA 2G72A 3USZA 1P1BA 1U2GA 1EUYA 4IH9A 1DIGA 2GO1A 4M9UA 1QHXA 3JD1A 3M6AA 5CM9C 3BJRA 4NE7A 4MGHA 2BGIA 4PG5A 2WFAA 1ZGGA 1S8FA 3BGWA 3IO5A 4A26A 1Q1QA 3MD9A 2HM7A 3JQ8B 4GD3Q 4G0ZA 3T1QA 4EDHA 4PGHA 3K2IA 1KK2A 1TT5B 1U8FO 1ZG3A 2WDZA 1AXGA 1XEAA 3HV2A 1LLIA 3R3VA 3QSGA 4EJFA 1OJLA 2QYSA 4JJZA 5KNBD 5KMGB 2BEJA 3TOZA 4A0RA 1C3LA 2WM3A 1IDN1 4PQRA 1OYYA 4R9SA 4ALLA 4GU5A 4BMZA 2QTNA 5KWIA 4HATA 1YL7A 1GXSB 4NAVA 2QHXA 5ALUA 4Y0VA 1J2EA 3VJMA 5IJAA 1Z35A 3L6BA 4F45A 1JV2B 3RV4A 3IP6A 2JLCA 3BA6A 4L4XA 3SOZA 3X44A 1MAWA 2BJWA 1GAWA 2XNDD 3JVUA 4G67A 5B30A 4EHLA 1TE2A 2Q46A 1OFUA 2GEFA 2X8JA 2X1MA 3GG2A 3MUEA 1D8AA 4IDHA 3LT4A 1QTNA 1XT6A 3LYUA 5JZSA 1UMKA 2C00A 2XTMA 4NCIA 2A0KA 3NRBA 4CKXA 2XYVA 5JS1A 1LD3A 1B4DA 1SKYE 2OLKA 3FMFA 1S01A 1XTQA 1XN4A 2AFRA 3KYDA 3LPCA 3Q2IA 1FOEB 1LTHR 2WYVA 4JLKA 1E1QD 1IWOA 3HKEB 3PNKA 5J5AA 5KPJA 4HTFA 3IAUA 2HO5A 4X00A 1GNPA 1DKMA 1MO4A 3QFIA 2GN8A 5KEIA 1AIPA 5SZJA 2IK8A 2SKCA 3I9KA 1DAIA 3K73O 4BFYA 2C0PA 3OCXA 1B3BA 3NC1C 4P4SA 2D2XA 2G3YA 5LB2A 1QQ5A 2R6JA 1EX7A 4M55A 4RCVA 1ISSA 3FF1A 5K7SA 1EJBA 3K0AB 3ZHZA 2M98A 3DZCA 1XTKA 5C7IO 4ZI7B 4KODA 2OV8A 3KKNA 2IY9A 4JBHA 2C03A 1FYVA 2EKPA 3N05A 4LJ4A 2PZAA 4GI2A 4B8ZA 3JZIA 1G3MA 3FUVA 3GLFE 1J7KA 2V9CA 3ZVKA 1G3RA 1E89A 2DLDA 5BQ5A 3S27A 3EA5A 4GBMA 3JSXA 3RVRA 1U5BB 4MLZA 1A76A 2K7ZA 1GRNA 1BMFA 1LV7A 3CUEF 3BJZA 1WUYA 4RLHA 3HL4A 4WJZA 4XLZA 4ZT7A 3QF3A 4YN3A 1YOBA 2IIBA 2AYZA 4OLBA 2R8OA 4EMTA 4J7CA 1H42A 2B1QA 4RXTA 4B17A 1K8YB 3OJXA 3EN0A 3L6OO 1J0AA 2CDCA 2WPNA 2ZJ8A 3BFPA 4TWAA 4QE3A 2LDBA 3EMBA 3CZQA 1QK3A 4DA6A 1HGXA 2QB5A 3FKJA 5FWAA 2YFKA 2ZUSA 2IP1A 3QW4B 3W5JA 3WLLA 3GR6A 4Q01A 3G8DA 4ZANA 4ZK6A 5KNCA 1T8UA 4A3SA 1G2PA 4E4TA 2FZEA 4GGPA 4TYWA 5HUHA 2V7BA 1ATZA 4G5GA 4YACA 4Z9AA 3REGA 5AIBA 2GXAA 3W5SA 1QQAA 2XQVA 3UJHA 2J7WA 1DRJA 4US2R 1UC5B 1G64A 2CWDA 4TWZA 2R8BA 1PLLA 1W48A 5B1IA 2FPKA 1NPDA 3GFGA 3LLUA 3MCWA 3UC9A 4UBNA 2OC9A 1TZ2A 5BY2A 3NXSA 3GZNA 3GEEA 2UYQA 3MAAC 3NU1A 3VPXA 1JLKA 4OY3A 4GR4A 5HVNA 1KH2A 4A1OA 1SWWA 3G0IA 2VJDA 3RYIB 2QAGB 3NNSA 2I76A 1F6DA 5IYZB 1L7RA 1P72A 4FWBA 5DNUA 3QVKA 1D2MA 5I9SA 5JRJA 1CJBA 3OIFA 4JR2A 1EFPB 2BTEA 1O95A 1ZEJA 1O97D 2YZGA 3EZYA 4GOMD 4Q4LA 4RKWA 3OQHA 4PANA 5AIAA 1LPOA 3RWOA 4RL4A 2IX3A 4DA4A 5EESA 3KV3O 4G6ZA 2NSDA 2ZJZA 4KSYA 1OI3A 1U2EA 1WXDA 3KK0A 4E46A 1WDLA 1NEQA 3PTLA 4RE5A 1KWKA 1JIQA 3ESRA 1DBVO 1OVGA 3P9IA 4HBGA 4JB0A 4WAUA 4DNOA 1OB2A 3UGKA 2KWIA 3U1TA 3UV7A 3AI1A 2A14A 3QW2A 4AIIA 1TYDE 1KJ8A 3A6JA 3RTDA 1K9VF 1JIJA 3FCAA 2VTBA 2HDHA 5DBFA 2QTAA 2HT6A 2HBYA 1GTVA 1L5MA 2Q3FA 1XMIA 4NATA 1OV6A 2O3TA 4GRDA 1B8NA 3SBXA 4EJ0A 3QENA 1BC5A 1W5FA 1WHTA 3A1CA 3K0KA 3UG6A 5AKXA 1JWLA 1M76A 3ZZ0A 4CM9D 3TDNA 1U0JA 3NHAA 4HCJA 4WBNA 4JMPA 3IEMA 4KGDA 2B98A 4Q82A 4MUFA 1JFFB 5KHAA 3MCTA 2CBXA 1G5TA 3MWLA 4PO3X 4KPUB 5AI5A 2EIHA 2ONZA 3EZNA 1TXGA 4L6IA 4JWKA 2A58A 4NV3A 3NROA 3TSCA 1YZ3A 3H17A 1XOIA 4MS4A 3W1EA 3UJ8A 3QPBA 3CXRA 3SVLA 4JFAA 3ZY3A 3B6JA 5IZCC 1U31A 1U8EA 2YWFA 4DREA 3H84A 4B74A 3V4SA 1I0ZA 4C4TA 3LDHA 1D09A 5A3JA 3DL4A 2GRMA 2BIFA 2AR7A 3MHPA 4BLSA 3TLAA 2C9OA 3FZGA 4BV3A 4HNQA 4EGSA 2EKZA 1JU9A 4XZ3A 4IHQA 4EF6A 1X86B 2Q2WA 2YJ4A 2BDUA 1DBIA 4G0OA 4KXNA 3VSCA 3S1SA 4WA7A 1E77A 4D3SA 2JKVA 3L1IA 3OAAA 4M1QA 3KAPA 1QQ6A 2BZ1A 4ZO7A 3TB6A 4HADA 1SKAA 2C84A 2FMUA 4OIFA 4K26A 3AV0B 4Y2VA 3ZN2A 1HDZA 2GBLC 2JZOA 2GK3A 4FUTA 2C88A 3RUPA 2Q3DA 3K16A 2Z8ZA 2J9RA 4UPDA 1ICEA 3MBKA 2ZRDA 1L8XA 1SXJB 2FP3A 4X61A 4LYJA 3G9XA 1DOAA 3IQEA 1W6UA 4YO7A 4WQMA 4OQMA 4D7AA 3ND5A 1Y4ZA 4E12A 5KDLA 2OP1A 4LY6A 2XB8A 1C1XA 1IBCA 3AERB 2P78A 4G84A 2QRUA 2JFOA 4N01A 4QXOA 4CCWA 3HCAA 5E2IA 4DQ0A 1GQQA 1JFLA 3CLRD 1PZNA 1UC9A 3WTBA 5HOEA 1X7YB 1NLUA 2RARA 4YEDA 1L7DA 5AUOB 3LPAA 5EP3A 4BEJA 1YNSA 4ZP1A 1DAPA 3PICA 1SUFA 2JLBA 1ADFA 3E70C 4TTPA 3AB8A 1L5LA 3TH5A 4NYIQ 5FCDA 2DB3A 1X1DA 1OLSB 3PXBA 3EAFA 3PXDA 3TL6A 4U2CA 3BMOB 5I01A 3FYSA 5ISMA 3IERA 4GZLA 4AJLA 2WA2A 1XEXB 5ARCA 5JWRA 3DYIA 1JBQA 2EZ4A 3UXHA 4ESHA 4IYRA 1VJTA 1TPZA 1X1CA 4QUBA 4C3ZA 4IP0A 2HWUA 2LYLA 2RHJA 3F5DA 4PG7A 1Z8NA 1EFVA 4BP3A 4X4GA 5B1HA 3O90A 5HJ5A 3JYPA 3BD8A 3LV8A 3TVTA 1C80A 4HWKA 4M83A 3HRKA 5J63A 4B80A 3RBAA 1U02A 3N39C 3FYMA 3GLTA 3IXLA 2OQVA 1UMBA 1U3WA 4LVNA 1TW3A 2QG6A 1NVDA 4KCGA 1O94C 4F97A 3G23A 4OGLA 3F5FA 4W1RA 1PERL 3CB4A 4OATA 3QLVA 4BX3A 3ESAA 3ONFA 1U4OA 1H69A 4QDOA 5D3ZA 3B1JA 2XZLA 2VEDA 4RAOA 4CIWA 1YA6A 4I9NA 2EFHB 2I4OA 4JBGA 1P60A 3FHCB 3L6DA 4KB5A 2P2YA 3FYAA 2CUKA 3RVJA 2V7QA 3U7FB 4URZR 1NVVQ 1IWPB 1SB8A 4RVOA 3BTVA 1VB3A 3SHFA 4RU1A 3VFDA 3I09A 3WBFA 2PXEA 4Y6RA 4YLYA 3S4YA 3W8FA 2BUAA 2O2EA 5ALIA 3CR3C 1O87A 3FGOA 4YCBA 3KKEA 2QLJA 3OM0A 4BLOA 4BU0A 5C81A 4KE6A 4KDFA 4MW9A 4AZSA 5CU7A 3I1YA 3NAQA 3KZVA 1UP4A 2XE4A 4RC9A 5EKSA 4EGFA 2BTQA 2HUPA 2W43A 1P4GA 4I19A 4NEHB 4OJMX 4NCJA 1N8NA 4Q12A 3ZDFA 4DDHA 1WIZA 3N7AA 1VGVA 2DUWA 4J0KA 1EX9A 4FEYA 1E92A 1K89A 3OTQA 4X85A 5K3EA 1OXVA 1LSOA 2Y1EA 2VCYA 1D07A 5DMHA 2Q2QA 4C4OA 5H68A 5BSKA 1EK5A 2QMEA 3ICCA 3H2BA 4FQ8A 5U9CA 1O08A 1PW5A 1W581 3QSYA 1RKBA 4NBKA 3ENWA 4ER0A 3OM8A 3DUFB 2VJBA 4L2IB 2VDJA 4BZPA 2PH5A 3QM1A 1P7YA 2VF5X 4MARA 2P69A 1KGDA 1OILA 1P0FA 3DGEC 3HU2A 3JSAA 2LCQA 2VDMB 3FTPA 4KGVA 1C41A 1P75A 3TOSA 5L4NA 3O92A 2ZVQX 3EUEA 1XTUA 1JTFA 5KX5A 1K86A 2WIAA 3DVSX 4L02A 3MLBA 4A2CA 4NARA 4GLFA 1RLJA 2I03A 1E1CA 1SVSA 1YRQA 5EZSA 1O94D 1T4MA 1W76A 4BGDA 1YCHA 1NW5A 3AIKA 4I1SA 4LF6B 3C3CA 3NBXX 2B5OA 2IUSA 3HHPA 1FPMA 4KJXA 2JI6A 2VK4A 1YDEA 5IF9A 4EKGA 4Q19A 4KQXA 1BIFA 1XTPA 2AXPA 4KQFA 4NMHA 4O4HF 3U1VA 2CFTA 2YOGA 3O3OB 4AQYB 1PZMA 1YASA 3F5SA 2LUOA 4TWIA 3DBIA 4O8CA 3U3KA 2G1AA 1AN0A 3CT6A 1TO6A 3CGGA 3DBRA 3PUIA 4MQFA 3OZSA 4PTZA 1OWMA 3L0DA 5IG2A 3LQFA 1X7ZB 1Q57A 5B1SA 1IFXA 4C6TA 1WCXA 1C1DA 2GA9A 2JBWA 1KDZA 3UTCA 1ML3A 3D2BA 2DHCA 3LECA 1P1RA 2L17A 1TFRA 2PXKA 2NGRA 4IDBA 4FVTA 3I6YA 2HC9A 3CMCO 1A98A 4PC7A 2QX6A 3DNPA 2J87A 3NONA 3ZU6A 4ZT4A 5ARBA 4W5JA 5LQMA 2PV7A 4P2GA 1L6IA 3R6DA 4Q3AA 3WL5A 1IC8A 1KORA 1EP2B 5IXJA 4BV8A 4QUGA 1W7AA 4WZAB 1GU1A 5TNXA 4IV8A 3RFUA 1IOZA 2V7VA 4MRNA 2QQEA 1PBNA 4DBZA 3O8OB 3B70A 2QTFA 3IBTA 1QU3A 2COUA 3NHSA 5ENDA 5J40A 4DB4A 3BBLA 1WE2A 2DPLA 2WIDA 2ZI6A 4ECEA 5I7RA 3E27A 2D59A 3CS3A 1DCFA 4H3KB 4DPMA 3PX3A 2PIDA 1PAUA 2B30A 2AUWA 4U7JA 4F5DA 5G0SA 3MIZA 4RA9A 3ZJ5A 1XRLA 1ETHA 3DTTA 2WM2A 4URXR 1L4FA 1ECCA 1K97A 3CKKA 3ORHA 3FNRA 4HSEA 2KS6A 4HUQB 3ERCA 3QXGA 3V4LA 3A9YA 1W4CA 2EWVA 3EXAA 3L84A 4C06A 1FJ2A 1M34A 1MFQC 3D8TA 2QJWA 3KP1A 4DLXA 1LV8A 3WK9A 1O2DA 3CJTA 1I2BA 4LBZA 1WM1A 5JCOA 2WJYA 4I5FA 3UKDA 2LLWA 3MWDB 3ZHBA 3PDWA 1PQYA 3K09C 5L4SA 2F3RA 2Q7DA 4BGEA 5DP2A 1R16A 2B20A 2RI1A 3CTPA 3OPYA 2G06A 2X4DA 3ITDA 3ZK9A 5MGNA 2PKQP 5CG1A 3G9ZA 5JTTA 4TYMA 3OJEA 4GHJA 1MQ8B 2IELA 1P7VA 3E05A 5CDHA 2Z6AA 1WETA 1FMTA 1J25A 1CY0A 1WEKA 3EEQA 3BTUA 4J16C 3STHA 4EZEA 3ODGA 2QV7A 3IMGA 4DMGA 4B6GA 4UFPA 2HY7A 4MR7A 5I7AA 1UJCA 1I30A 3BFXA 5JCJA 3NIBA 5IK2D 4JI8B 3A6KA 1R4AA 3WLAA 4BNDB 3TZHA 5JECA 5E6SB 1AKYA 2C2XA 3DMYA 4RF3A 3SIXA 3U19A 5J43A 2PEZA 3EPPA 1Y3HA 3WIOA 3LC1O 4JR1A 4AIRA 2VDLB 1W29A 4H15A 3HCBA 5I4KA 3CUYA 3BAZA 3R0VA 2GZSA 3ZDYB 2FRDC 1V41E 1TM4E 4ZVUA 4FCTA 1UPTA 3KCQA 4KXUA 3TIGA 3VHQA 3E7FA 2GJ9A 2GLXA 2ACKA 3O91A 2FLVA 2PSDA 5B58T 4ENTA 4COKA 4OXRA 3HWSA 2DWUA 2CHVA 1VGRA 2VHYA 3PGMA 3KJZA 1CUVA 4REQA 4XQGA 4ZRNA 4JJ6A 5FWXB 4MHTA 3U7QB 1MDBA 3C6QA 3Q9UA 5SV2A 4ZIRA 1J2JA 5ITVA 3MMSA 4M7WA 1TKCA 2BVNA 2I91A 3JWJA 2XA1A 2FN9A 3FVQA 2WE8A 2AQKA 1PWHA 4E5NA 3RW9A 5KO2A 5F9MA 5K0JA 3M83A 2VJAA 2E89A 4NVRA 2I2XB 3LDGA 4ZI7F 4ZK2A 2LE0A 1W4BA 2HMYB 5JXGA 1A88A 4N8SA 1BKDR 4G09A 4LBVA 4ZTZB 1ZRMA 5D7BA 4ZV7A 2C59A 5C3UA 4C4AA 3DOUA 1OU0A 2CJWB 4L27A 4PC6A 2GH1A 2C4KA 3AGPA 4ZQCB 3V3KA 4ACAA 4ZICA 4Q4CA 2Y4NA 4ZJYA 1NJ5A 2X4IA 5DBEX 4JBXA 1HQ1A 4BGVA 3RVLA 3AHEA 4KG7A 3VZCA 4A8JC 1SD1A 5DHTA 4ZMRA 2IPAB 3TNLA 4W82A 2HCNA 4XQEA 5KU7A 2FQ1A 1I2AA 1ZIYA 2AL7A 1SIUA 1KFBB 4A1FA 4D8VA 5A1TA 1OB5A 2OK8A 4BTEA 2E1PA 2VPTA 4ALNA 4EB6B 2HL6A 1YFLA 4DABA 3B6ZA 1QK4A 3AVQA 4NCKA 4EO9A 5ULLA 4W1QA 3E2PA 2LNDA 4RZIA 4EGQA 4LJRA 3E15A 1JDJA 4IHJB 3R2JA 3FMYA 4HB4A 2EWTA 4Q7MB 3TFQA 4DMKA 4Z7OB 4DKJA 3CW2A 2HRZA 2ODTX 1EQUA 4CEHB 3CNLA 1NHGA 4TQAA 2DHEA 4NJMA 4PQGA 3N0TA 5B2ZA 4MR9A 3DTYA 4MZDA 2F90A 2GD2A 3R9KA 1UWKA 3L40A 1P4JA 1ZMTA 1UOOA 2I3BA 3DZ8A 4Q4AB 4QELA 4KIJA 2ORWA 2KX7A 2EGHA 1O4XA 1D7OA 3KWLA 2H6EA 3G68A 1U9YA 2XDAA 5TPZD 3ZIAA 1Q7EA 3B8EA 4AP6A 2IOFA 1MD9A 2IVGA 5CNJA 1K0UA 4H9GA 4Q4HB 1VG9B 2HN9A 4PWYA 1E2IA 1BDHA 3C1TA 2XIUA 4CEJB 1S2LA 4B5KA 1DSSG 1ZGBA 1QK5A 1GA1A 5IYZF 3R7BA 1O0CA 4I8TA 4OM8A 3NDPA 3T1OA 2H54A 4YALA 4CT5A 4P38A 2DXIA 4CLOA 2PKQO 3UHJA 2XAUA 2QJOA 1BGVA 4IQ4A 2A1TS 1EM8B 3EGCA 4D9BA 1AV6A 4DPLA 4R51A 3INNA 3HB1A 3ZVMA 2GJSA 3ZOKA 1N36B 5F73A 1GQRA 3DMHA 5EVJA 3GY0A 3WHKA 4ICIA 1EK1A 1YU9A 1I6LA 3PJEA 5A4AA 4LKRA 2DE0X 2QN2A 2CLSA 1VLQA 3P9SA 2H92A 3RU9A 1DC6A 4XWTA 1N1GA 3IIIA 1Q0HA 2R0QC 4TKLA 2OHOA 6NULA 5BRAA 4FMBB 4UU8A 4DIKA 4A6DA 1L5QA 1OF1A 5EJ6A 4JL6A 5A5GA 3EG9B 5KYKA 3QI7A 3NATA 4UM9D 4M21A 3IMEA 3OFKA 4ZVPA 2B8EA 3Q0TA 1AQ6A 3BB1A 5CFNA 2FWRA 1KAGA 4IIJA 1QZZA 2PWBA 4C7MA 2ZJ1A 1T5HX 3GMSA 4MWOA 2ZWOA 2PMFA 1JLSA 4B4WA 1ZGHA 2GB4A 2RG1A 3ETHA 3THOA 4Q4DA 5U4QA 2J0UA 3RAPR 1L8QA 1NJ8A 1LJUA 2VKQA 2OORA 5CA1A 4CMAA 1Q1NA 2ZROA 3OG9A 1P0MA 1VI5A 2OGTA 3O4IA 4TN1A 5KWSA 1FK8A 3H5IA 4D56A 1IY0A 2QGNA 2XI8A 4F91B 3OLZA 4ZAYA 1K7FB 2AQ8A 3FFBA 3PHHA 4MYTA 4N5MA 3BCHA 1PYOA 2J3LA 4XM2A 4KXYA 4HZUB 5KVQA 4QLAA 4PSUA 1EHIA 1LK0A 1V5FA 2O3SA 4YH1A 1GPLA 5FOUA 3W6UA 1KZGB 2A0WA 4OIMA 4F2WA 2CSUA 4G37A 1EFUA 1XP8A 2VT7A 3IJEB 2PRZA 3D3WA 2C96A 4Q7LA 1YGYA 3CZMA 3GD5A 2PBFA 1TJ4A 3AOEC 3BN3A 2A30A 3OHMA 1TVKB 1HSOA 4KEAA 3RUDA 16PKA 1C4WA 1WQ4A 2O8NA 5AI0A 4C43A 4DV2B 1X6VA 2REOA 1F0PA 4YP7A 4AJ4A 3JD2A 4R7TA 3V8NA 5EJ4A 1U7UA 1WV0A 2HCJB 2OEPA 2XOKA 4BX8A 1E3TA 4LOAA 3QIAA 4D6PA 1Z2AA 5L3VA 1VPTA 3UANA 3BDAA 3HN6A 3VR0A 1G2IA 2HJSA 2NPFA 4X1KA 5F35A 1AB5A 3LXXA 4YRNA 3N87A 1L4BA 3EBPA 3PK0A 3BE4A 3NHFA 4F2DA 4GECA 3LDAA 3UXMA 3WMGA 3OCJA 4JHXA 1SBHA 2QE7D 3P45A 3VU3A 4Z5XA 2COKA 3PGVA 5TQJA 2NN3C 2VP2A 2BBSA 4D8WA 2IH4A 3ISTA 2PQ2A 4L07A 3IAXA 4AY2A 4YJGA 3RSHA 2FP4A 5BV2P 3QFTA 3O5AA 4AF6A 4GMFA 3PXPA 3H2ZA 3I23A 3IURA 1LSJA 1SU6A 2NO0A 2I33A 2V5VA 4PONA 4Q37A 4YQEA 4L8VA 3F96A 4L4UA 3USCS 3GLKA 2WWWA 2W8ZA 5LQKA 1VCIA 4XUGB 1SURA 4L22A 2QRQA 2YBEA 5TQ0A 3HDQA 5AKYA 4C01A 1OFGA 3IHWA 4RDXA 1H0RA 1OWPA 3KOWA 4ZAGA 3JAKA 1DIOB 2LP4Y 2VTVA 1CEXA 4QXQA 3SF8A 1RYBA 2ZB2A 2MINB 4N6NA 4RD4A 3ZQ6A 3ZV4A 3H04A 3TTVA 1G6KA 2DR3A 4BKMA 4IGKA 4DV1B 2D1QA 1QJCA 4CQNA 3O6VA 2L2QA 3KRTA 1Y5LA 1JJIA 1E5DA 1NI3A 2YY7A 4JY7A 2F6RA 3HUTA 1I7PA 3ZHRA 4QOEA 4E2WA 3BSFA 1H2AS 4IFTA 4KI7A 2CSXA 2I2BA 1Y1SA 3AFNA 4DE5A 5JBQA 3JQ6A 1SVMA 1VKRA 2EJBA 2FGKA 1JRLA 2A9JA 4YRQA 2PXVA 2BBTA 3EZFA 1E3DA 1M1YB 1EINA 2XXPA 4URWR 4L3VA 4QJ3A 4HX9A 3WRYA 4DXAA 3NWOA 2C92A 2W11A 4F92B 3TFLA 1JDPA 3EIFA 2N75A 3FBGA 3I0ZA 2I80A 3PFIA 1KH1A 4Y6QA 1Z62A 2NVUB 3RSCA 3HFJA 1ID8A 4OAOA 3GGJA 1CB0A 5F2OA 4HGZA 4PPQA 3ZJVA 1P77A 1QIJA 1QORA 1I5EA 1QV7A 2Q07A 4FHCA 5JVDF 1DC3A 4YPVA 1B0AA 4IOLA 4GPIB 2D74A 2PUHA 3IELA 2J5KA 1USKA 2FFQA 5GM2A 1TMKA 4PBSA 2J4FA 2YXBA 3ROFA 4HEJA 2GZUA 3RFFA 3G0TA 1KZYC 1L7NA 4M53A 3PHGA 1QH8A 5FBHA 1VLHA 2DCUA 4EA8A 1EGAA 1ZINA 3ANXA 3MB5A 4QBHA 3U7JA 3MLFA 2RC5A 3R5SA 5KC9A 2WJVA 3L7JA 4COOA 1F9AA 2GZ3A 4GI5A 2UVPA 5HUJA 1M0EA 3N2YA 4ZCLA 3HK2A 1E18A 2R8YA 3IPCA 3ESBA 1RHRA 4LSZA 3VOSA 2VTEA 3K15A 1E6UA 4BQIA 5AVSA 4ZI5A 1DVRA 4DMMA 4JLPA 2PFKA 1MG5A 3IMCA 4Y42A 2IXFA 2R48A 1QG6A 4HXYA 4LHYA 5K3SA 4A0SA 2VJQA 3PEVA 4P8RA 1HL3A 5TMDA 5HZMA 2FWNA 1P91A 5EG5A 1HT3A 3CA8A 3IDZA 3ANNA 3GLRA 5BYKA 2C2KA 5H0IA 2OO5C 5EUBA 2BJVA 3O82A 2PXQA 4O2AB 2G5TA 4M0EA 3ND6A 3OLXA 4YJ3A 1G2OA 1MOQA 1PR1A 4RHEA 4LIPD 4QUHA 4F3YA 1RRGA 1C3EA 5IH3A 4DUYB 1ADJA 3FXAA 4CLRA 1TQ8A 1YB1A 2BEKA 4TS3A 4BNZA 1KWGA 2DH6A 5T6BA 4NF2A 4KHPB 2OCIA 1V5WA 2QAGC 3EQ7A 4ZN6A 1VE9A 3JQ9C 1PFGA 4Z0HO 4URUR 5IC4A 1SO8A 3L1PA 1INLA 4X45A 3N2NA 2WD7B 3AF4A 3PTZA 4RHXA 1FRNA 4KE9A 3U0BA 5SYAA 4AXXA 3FVWA 4B34A 5BW4A 3SMVA 4PQFA 5K0FA 4ZD6A 2Y05A 3IXQA 3NWJA 1KIFA 3IP3A 4FD2A 4PC1A 4TSFD 4UHHA 5IVIA 3VUEA 4CBVA 1DJLA 4GVXA 4Z8XA 1M10A 2EFJA 5KC8A 1XZKA 4WBSA 3ZBUA 4CI9A 1KAEA 4X93A 3ER9A 3DO5A 1WH8A 1VG0B 3ZWBA 2H7XA 2VQEB 5JDIC 1UJ2A 1YR1A 2DM6A 2GOYA 2HJVA 2KPOA 1K2VN 3NEJA 4KUHA 3FTNA 3QEMB 2F3QA 3VPSA 1TYEB 4CVNA 4OFZA 1CNMA 3LY8A 4QQRA 2Q1WA 1GKLA 2P3SA 3N53A 4ZDKA 4G8DA 5EY5B 3SQDA 4BMDA 3ZKWA 3J81A 5HRAA 1H4VB 3I58A 5DYTA 4EWLA 1JL3A 1JMYA 2JIQA 3MG9A 5AUNB 5LYJF 1HLGA 4YMVA 1GKKA 4DV7B 5AHRA 4JJFA 2AHOA 2W5UA 4IF6A 3HR8A 5FUVA 2J9ZB 3ADKA 2OA0A 1T0JB 1JBKA 1JQLB 2VUTA 2Z95A 3BTOA 1VDMA 2G71A 4OLJA 3UUEA 2P4UA 1DTSA 3V8PA 3AI2A 3MUNA 3O8QB 2EZ9A 4U2BA 4BVGA 2I4MA 4ITUA 3IT1A 2JHCA 1CQJB 1MJFA 1G1MA 3SZLA 2J9YB 1KK1A 2HREA 4X6XA 5DGTA 4D3ZA 3FTFA 3FYDA 1FDUA 3TLYA 4V24A 4C0WA 1R8SA 3IOCA 4EG5A 1IUNA 1KMQA 4F4JA 3HM2A 1SOAA 3IJRA 1Z7YA 1V3VA 4ZCPA 3WK5A 1A8IA 4L9AA 1C1YA 4Z6KA 3ENZA 4LXGA 3O94A 2PNJA 2JAXA 5KYYB 1ESNA 1NW9B 3VX4A 3W2IA 3VHRA 2BCGY 5HJ2A 3IL2A 5F3WB 1X92A 3FROA 2ZJYA 1T6BY 2QM7A 2XE6A 1REQA 3P9QA 4F2PA 2GI4A 3THXA 2O7RA 5B4VA 5T67A 4L3OA 3PGKA 3RS4A 3S8MA 3RYHA 3RUCA 5TF4A 2XDQA 2PZLA 2VT6A 4Q24A 1JQDA 2C07A 5CR9A 3CLSC 3IAFA 2YY6A 4EATA 1ZM4A 3TS1A 3OE7A 2PSEA 2SNIE 4JC4A 3SXUB 3O8RA 2OFXA 4LRSB 2Y93A 1SXJC 3CX6A 1LY1A 4RFSA 3WJ7A 1NOJA 4XLTA 3SF0A 3ZKAA 3ZJ4A 3TN7A 4DA0A 4FYIA 5KBYA 4WLFA 4Y2JA 3TAUA 3C6BA 1QPBA 1T2NA 1TKAA 1E99A 4FNGA 4HZGA 2HJ9A 3WLEA 3NCHA 3WYBA 4TM7A 2OBXA 4CQMB 1ZMXA 4FILA 1V9SA 4E4YA 3DAFA 5H3HA 2N0SA 3O4VA 1ZZGA 4N65A 3QYPA 4KN8A 3GF4A 3IE2A 3QWGA 2X22A 4JUCA 4JAVC 3QXSA 1R69A 1OLXB 3HYNA 5E4TA 2PS3A 4NQRA 1ORDA 1QG4A 1GG8A 5ILGA 3U48A 1JQJC 3B8HA 4HAIA 1GTG1 2QTTA 3D8SA 3ORYA 4YAFA 4ZOBA 5K6RA 4IUYA 1W75A 3KELA 3E5RA 4R7ZA 3X2SA 3GZNB 5H3LA 2PIJA 3C98A 4HGYA 4KXQA 5JNVA 4K1XA 5A4FS 3ZCUA 4G1EB 4KFRA 1B6TA 4LXYA 4QBKA 4H7DA 3REFA 3UUGA 5ICMA 3QE2A 1U65A 1P19A 4NAUA 3BZWA 4C7OA 4EM6A 1GV0A 3VV2A 2BZGA 3RBVA 2B7CA 3N6VA 3QTTA 3KSZO 5KI6A 3JATA 3F8WA 4M88A 4YDSA 5L3SA 2W2PA 2O0MA 3CCBA 3BMQA 1FF9A 1RHMA 3U4QA 1BHQ1 1BN6A 2VP3A 1GU0A 4PFQA 5CLGA 3FZEA 4BJ5A 4Q3DA 1M2KA 3UH1A 2DPMA 3HLTA 5LLTA 1COWA 5DCLA 1GITA 3RVKA 4ZEVA 3BRSA 3FFAA 1T4CB 1XAJA 1Z12A 4J76A 4WNCA 1HQYE 3ZDEA 4D3YA 1N0WA 1T0PA 2ZVJA 4IHJF 4IPTA 4MGEA 1TEZA 1BQ3A 2ZRBA 4L16A 3M6FA 3QITA 4XYGA 3UAGA 5CCBA 3GLGB 1W96A 4DQUA 3SZUA 2PFSA 3KO8A 5IEJA 4B3DA 3D54D 3HDYA 4QUDA 1SXGA 2OQRA 1YI0A 4NU6A 2OD9A 1GEGA 2VTDA 5DYWA 5I9LA 1FS6A 2NXNA 3DHVA 4QUJA 4ZZIA 1IHYA 3O26A 3CLSD 2FWBA 4X4DA 3CPEA 1VKHA 4KRGA 2O0HA 5CB8A 3CLUC 4GFDA 3ZWWA 2PBLA 2XJ3A 2QENA 3FGPA 3H5LA 1Y7HA 4M4SA 3AFGA 3HVUA 2X1VA 2GJ4A 1R6AA 2ZWVA 1SXJD 2WDPA 3AR9A 3BWYA 3M5DA 4GX0A 4WBNB 1YIDA 4IOJA 2XVXA 1W19A 5JRDS 2GPYA 4M87A 3N2KA 5EQTA 4ZI3A 2RI0A 1E7SA 4TX1A 2Y0BA 5DEOA 1ABBA 1XCJA 1CJUC 2B8WA 4BE4A 4YMLA 2DMRA 1E1RA 1JR3E 1JXOA 1NVEA 2C3MA 2AOUB 2JKZA 3G2HA 4G8BA 4P32A 3M2TA 4P54A 4R2MA 3U7HB 1QCYA 1Q1GA 3DLPX 1C4KA 3WWOA 2H9AA 2QJTA 2C0CA 1C9NA 1PJAA 3HUUA 1Y37A 1E63A 4FDUA 5ITSA 5DYGA 5JLJA 4Y1RA 5LA6B 4C5AA 4DRZA 2AW6A 2AD5A 3MT0A 4AY6A 2YW9A 3E6AA 2VYND 3DD5A 2GZMA 2X41A 3GLUA 4Z9BA 4BX0A 1N8SA 3TW8A 2I9KA 2Q45A 1V3QE 3A0UA 4TLCA 4WFIA 1A69A 1YS7A 5EP1A 1K66A 5A7HA 3ZWQA 1PRYA 2ZBGA 3GBVA 3PPYA 4UBLA 4YDQA 1NKSA 1DIAA 1DINA 3IUSA 5GONA 4LOHA 4WCFA 2GN4A 4HUJA 1DT3A 1NF2A 4OB7A 4ZOLB 1NFRA 3WO1A 4ZZ1A 1XHLA 2NUAB 4TSRA 3ROZA 3AJDA 3NYIA 3R6LA 4OYRA 4P83A 3JALA 3OQ1A 1VRVA 3PUYA 3ZZNA 3FWKA 3AFOA 1JEQA 3NDBB 1MB9A 3MWEA 3IRVA 4IDAA 2ATCA 4PGMA 5ETJA 2UYOA 3FPCA 2N1MA 1L1FA 4E33A 2Q2NA 1T8WA 2RAFA 1HLDA 1V16A 4P7FA 5B37A 5K4AA 3WV5A 4B48A 4LUCA 3FI9A 2XWBF 4WNAB 4Z99A 2PZKA 2VSFA 1T5OA 3JYNA 2WUSR 2QTLA 9LDTA 3LX5A 3EB9A 4RGQA 3CZAA 2FW0A 2BFBB 3SYLA 4RY8A 4YJFB 3B5IA 2RGDA 2VP9A 3PC4A 3CROL 1L9KA 2LYRA 1DELA 2HBRA 3I52A 3MTIA 4FOOA 4KLZA 4L4ZA 5ALPA 4D1YA 4OQXA 5E95A 4DCVA 1HQCA 2Z2ZA 3NWBA 1WIWA 3ZOZA 3VQTA 1FTQA 2QNRA 3BKXA 2BJHA 2WIFA 3PKJA 1EM6A 4LSGA 4DLWA 3ISVA 2AW3A 3CLUD 1EGVB 5DV9A 4I5GA 3LYAA 4Q21A 1JA0A 2P4HX 2NAFA 4QQNA 2I0FA 1U8TA 3MCVA 1E2FA 3WJAA 4F56A 2Y77A 1NWHA 3UJ9A 2PD3A 3RVNA 5LP6F 1Z8DA 4HPJB 2R8RA 3H1PA 2IV1A 4ND5A 2Q49A 4FONA 1TUBA 3PNYA 4O63O 5DX1A 3UT5B 2IZ0A 4OJKA 3ZDAA 3S2IA 3G9TA 3PWKA 1QHNA 2ONCA 3PE3A 4TTIA 3V1TC 4FC7A 3JQ7A 3T4PA 5KQSA 2UUBB 3QUAA 2YZNA 2J8ZA 2GBIA 3A32A 3OLYA 3L1KA 4HDRA 3T7DA 1YACA 4XWKA 3UYLA 4BKRA 4V3CA 4U7DA 4YUVA 5AHKA 1L1MA 3MBIA 1D1PA 2HK9A 1YS2X 1T8PA 3QX8A 3QA3E 3RH0A 4B6OA 1EB8A 1ILEA 1S3FA 1FSSA 1TLTA 1TUGA 4DZTA 4IWRA 1Q50A 3EEYA 4XCXA 4BLQA 4R40A 5FR2A 2VRCD 3CE6A 1Q6ZA 4J1TC 1Z7WA 1RP1A 4HH1A 3O84A 4QU9A 5C7LO 2WTNA 4L5AA 1CJGA 2PT7A 3AX6A 5CDSA 1ZIXA 4CM5A 1E3QA 2UXDB 2Q8QA 3HY3A 1JKMA 3TAHA 2Y1FA 2JIDA 5HQJA 3U26A 3BE6A 1PRUA 3UJ3X 2WICA 3S81A 4MI1A 2BC9A 2BFOA 1BRTA 2GRUA 2VNSA 4ECAA 3U40A 2EHDA 2BMDA 2YNMC 4XASA 2VWHA 2IF2A 1RYMA 5FA6A 5AM1A 3UB2A 1TFUA 2PO7A 3GNSA 5FTKA 4ZGWA 3MS2A 5B1EA 1Z2EA 1XTBA 5BWMA 4PLGA 2IEGA 2HJHA 4P1ZA 1ZK0A 3MRTA 4CG2A 3L41A 1UBUS 5K98B 3UBTA 5IN4A 2XQJA 2PVPA 1ISHA 3EXG2 3IIJA 4GSYA 2O2CA 4RQUA 3HZRA 4AKIA 2BI8A 4L57A 4FJ2A 4D97A 3DLCA 4R9NA 4RJLA 5SICE 2NZWA 2WWXA 2WJHA 4WOBA 2CCGA 3CLTC 3F7NA 2ZUTA 4MV9A 3RVPA 1PVOA 4XRRA 2A9RA 2E1RA 4JLJA 2QZSA 3I83A 4A0FA 1R1DA 1NJFA 2W6IA 2NXWA 4JS0A 5T4FA 1NXPA 4H59A 3BIJA 1YQWA 1CRLA 4BXOA 1OYWA 1OTXA 3OFNA 4Q1DA 2DETA 1UBEA 5TGTA 3BC1A 4K9OA 1A8UA 3TKYA 4MICA 1MRNA 2EEZA 1Z8HA 4YA6A 5AJYA 2LWIA 1ZQ9A 4WNIA 1DEKA 4MVCA 4URYR 4LOLA 3UQYS 3H4IA 4UAJA 2B1GA 1RI3A 2BFDA 3MZ0A 2L8NA 4RY0A 1IOWA 1W36B 4WRRA 2ODRD 3CLKA 5AJUA 1YZLA 3IVGA 3P71T 1RQ7A 2X86A 3WWPA 1W0JA 2JJ8A 1KAMA 2YFQA 2IS4A 4K9DA 1F8XA 3RS5A 2ACEA 2ORIA 3HXLA 4YRDA 3T3HA 3K6SA 2Q1TA 3TXAA 4YJ2A 3JQDA 2RKOA 1ZUIA 1FP2A 3FCYA 4QPZA 4P31A 2GZHA 2X1HA 5K0NA 4QTZA 1UOEA 2D2EA 2Z9DA 2OZEA 3GBSA 3K94A 4BFZA 2MYNA 3PEUA 2P3OA 1MHTA 3SJ7A 1P62B 3K53A 3VR3A 3LSTA 2PUFA 1TUIA 1BMQA 1Q3HA 2GLTA 2ZOSA 2G80A 1SNYA 1Q17A 2OVFA 4PC2A 3GDOA 5LIPA 3TI7A 2FK7A 4LF9B 1I4DD 3HY4A 3CH4B 4MUMA 4CW7A 4RORA 2ZU6A 3IJ5A 4FMPA 1H2FA 4YONB 2ICAA 3BD6A 3D7LA 1FP7A 1TNDA 3GPBA 4QNRA 1CP3A 2C94A 2E4ZA 2JPDA 3NTRA 3PIIA 4PAOA 2PIAA 3LFPA 2ZTHA 1KQOA 5CB4A 2YWJA 2DUMA 2M6SA 4E5YA 1Z5VA 2OWDA 1SHTX 3FYTA 3HE3A 4QODA 5HM6A 2KHZA 1E0KA 1UKBA 1YB6A 4MVJM 4YT4A 4UUMA 3G2OA 1QHFA 3FRIA 2HOQA 3RZZA 1E2JA 1X42A 3CLTD 4FCWA 5C0OE 1J06A 2Y27A 3EDMA 4DHWA 4O2AF 4EJSA 1FLAA 5E6UA 1PJLA 3GUCA 3FR8A 3TDKA 4H1UA 5TPWB 2WQ6A 1KQFA 4BZZA 2AFIB 1JDBB 4EH1A 2ZP1A 5K3CA 4O8BA 4E30A 2NV0A 3I37X 3HNPA 1F4VA 5EI5A 1UJ4A 2UZ0A 4S2UA 1ECLA 5G41A 1GZVA 1G2QA 3EDYA 2YJ5A 4YP5A 2IHZA 5T5QA 4D81A 5B2FA 3K4HA 5A7FA 1MV8A 3E22B 4LPKA 3COWA 2I2AA 4MUEA 4DXHA 4BE7B 5K45A 1KDOA 1NUUA 10MHA 2B36A 3JX9A 3NBYC 1N3LA 1K6EA 1DIBA 3E81A 4R83A 4WZBB 1EFCA 1QLWA 1KHHA 2I9PA 2IGTA 2OHIA 1NBHA 1SUIA 1YE5A 1VHDA 3BULA 3GCWA 1D4ZA 2QTHA 3PR1A 3RSGA 4CL0A 3E03A 3TIIA 3AY6A 2MDTA 3BMCB 2C1EA 4LAFA 4B3CA 5JXWA 3I01M 2R7KA 1GARA 3B1XA 3ABQB 1C2TA 3EUAA 2IEZA 3PQ6A 4J49A 4LYEA 4NFYA 4OD0A 3RODA 1L5YA 1A9SA 2J33A 4NONA 4GSKA 1LNQA 3E7WA 1MHPA 3QKRA 4F5EA 4PM4A 3SS9X 3WQHA 4PXSA 3GFTA 1CC1S 5JFTA 1ST3A 1MX5A 2XUQA 1WB9A 1IEVA 2A6CA 1T3ZA 1QVZA 3CYFA 3H83A 3NHMA 2W2LD 3LFTA 1M2GA 1L7XA 5DF1A 3OZEA 3VJKA 1GL6A 2IS1A 3VJLA 1DKLA 3E7PA 4ZT6A 3S7TA 5IFLA 1NG9A 1HURA 1FQWA 4MW6A 2AJ8A 3Q8KA 1NUPA 4RKYA 3KKZA 3IV6A 1P6UA 2PT9A 1Y1PA 3E9DA 5AW6A 4R5HA 3TTYA 3UO8B 4HH0A 3OEWA 4E09A 2IOYA 3JWGA 3B1KA 3LQKA 1J8MF 4JN6B 1ILWA 3BUSA 3QI2A 4QXRA 4QXMA 2XB9A 4L5JA 1XD8A 5EOVA 1DKQA 4KQCA 3WFIA 4J4HA 1JHVA 2FUG1 1ZVJA 2V03A 4OF4A 1Y6JA 4B32A 4KTTE 1B0ZA 1GM5A 2FPGB 1Z18A 4OQZA 1DCMA 4NYIR 2EERA 2BF4A 2V0GA 5EWJA 4FJ1A 4REQB 3U09A 1NL3A 1RPTA 1TJNA 3HFRA 3PG5A 1SOVA 5FNVA 4MV7A 1Z4JA 2GAJA 2W2XA 5DNYB 5B6JA 1S89A 2QLLA 1ZI8A 2JFUA 3C24A 1L7OA 1R4MB 4RD2A 3WGHA 4PS1A 3WHPA 1LK5A 3PQEA 1H9BA 2EBHX 4YAWA 1EEHA 4AN0A 1T9GR 3UJ7A 3KJEA 4RABA 1AHIA 2X2EA 1KI2A 3EWIA 2P91A 2CV2A 3HN2A 3ST7A 4I3HA 3VZRA 3ORFA 2OG1A 1C7QA 2O3QA 3L05A 4V38A 1ZWKA 3VH4A 2ZI3A 2DHQA 3PFFA 3TUZC 4EG6A 1ML4A 1DG3A 1C4XA 5LP6C 3AEQB 1ZUHA 2HIGA 5HHTA 1OAOA 4FGKA 3VAAA 4DSTA 2R1TA 2NPIA 3I5MA 3WFZA 3LCCA 4PU7A 1HE3A 4NULA 1SVKA 1ECPA 2EW2A 2XRFA 2YXPX 2ZRMA 5CLLA 4C0BA 1OA0A 2VYCA 1H8EA 2WJ6A 5LOVA 5JATA 2CYAA 5ED0A 2QAJA 1EA5A 3OQJA 4MUYA 1YO6A 2CB9A 4UVGA 1PKXA 1Y3AA 1DUVG 2PTGA 3CZ4A 2OHGA 1FYFA 4IVQA 1QDLB 3BDIA 4PYIA 4M38A 2LD4A 1KL7A 2Q4EA 5A5VA 3KPWA 3I04M 1QIHA 4JGBA 1VGQA 3LDUA 3U4HA 4BS9A 3FUXA 4LNAA 2UVDA 2XUFA 3BWMA 4MYRA 4WH0A 4B7AA 1WVIA 1TVEA 5JUWA 2I7TA 3BB3A 1DIHA 2J09A 1Z4LA 5B6PA 1PFQA 1ID1A 3MMZA 1W30A 2Z30A 1YZVA 1E98A 1R9JA 4ME6A 2C83A 3FKSD 2QX9A 3GJQA 4MYHA 1VM6A 4B6EA 1JQ5A 3Q1LA 4WOCA 2V6BA 3G6WA 1UWVA 1ONBA 2VSOA 3PPIA 4JL5A 3ULKA 4UDYX 3WSVA 5KKCA 4MAMA 2OZKA 3AR5A 3CVYA 1XNGA 3KLMX 4YUXA 2G1PA 4UD2A 3E7DA 1F7VA 5JJLA 1NM5A 1M5TA 4G9EA 1J9GA 1Z7EA 1K8RA 4J90A 4KFUA 3F8TA 1X7XA 3CN9A 4LDAA 1W4AA 4RK6A 2XOEA 2UZAA 4C2AA 2UXCB 1WZUA 1LBEA 2OZVA 1T5LA 5CJJA 4YJDA 1UM9A 2O8CB 1FA9A 4JI1B 2O6HA 4ANFA 2B94A 5LMCA 1O5TA 2IZ5A 1HZZC 4HX2A 4K6MA 4BNNA 1Q7GA 3ZDBA 1SB9A 2FCRA 4RM2A 5AO9A 1QGDA 4M0DA 4MAAA 1TAHA 2PL9A 3N3AC 4DCGA 2NU8A 3TBHA 3L06A 2P65A 1VL5A 2BD0A 4DF3A 3PNBA 1JS1X 1HQKA 5G4KB 1R6DA 1YI1A 3S5UA 4Z4HA 4MROA 5BW8A 1U04A 1XDSA 4D80A 1NQOA 4HNUA 2EBWA 3KZMA 1QLHA 2VFAA 4P6VF 4TTQA 4FMDB 4F8EA 3MHTA 1S2GA 2YWRA 1NXSA 3L93A 4CMBA 4DSOA 4WKGA 3FOBA 3PFKA 2SHKA 5CPFA 4PTLA 3CEPB 4O8ZA 4TV9A 4FBLA 4DMLA 5ALOA 2P2NA 2Y67A 3L7AA 1GGMA 4BQSA 4YV0A 3BCSA 4BNVA 4YT8A 1ZLXA 2XH8A 3ONVA 2IDZA 3RPEA 4D25A 1PDWA 2I6GA 2ZI4A 3S3TA 3RYFB 5K4GA 1I9CA 3GGOA 4RENA 2REXB 1DQYA 4FCVA 1IWBB 3TBFA 1R5JA 4OHWA 3R3SA 1Y5IA 1GAJA 1RJGA 1Z4NA 5DHQA 4C4ZA 4MV3A 5D8DA 1KZHA 3PHBE 3PXCX 4QGAA 4ARCA 3BIOA 1N77A 2O8FB 3NC0C 3TQIA 4RQBA 3ZGYA 2AR0A 1TPYA 1LNZA 2X58A 4Z3OA 3MGGA 4CLXA 1QH1A 3I92A 1XZCA 1XRMA 3OMXA 5EKDA 1X7GA 4F4CA 1IK4A 5LQJA 4JXZA 2CHFA 2EG5A 2XUAA 3EEFA 2FCAA 4RF4A 4UU0A 2FPIB 5D1HA 1XU7A 3AHCA 4MWBA 5K3FA 1JWBB 4JHLA 3MVEA 2IBTA 4HFRA 2RCYA 3RBXA 2AYYA 2GRJA 3CUKA 2J1LA 3P32A 3TD2A 5LA6F 1LB1B 1DX9A 1T36B 1V0JA 1WUJS 2CJXA 4IZ6A 3NKLA 1LW7A 5IMSA 2AI2A 4PSDA 1IE3A 2IRWA 5IJ0B 4XGQA 1RQGA 2AZTA 2YUTA 3DTNA 3T3IA 2HLDA 2L82A 1Z0FA 3URKA 1O8BA 3E9ZA 3ORSA 3NNNA 1DO0A 2JK0A 2Q62A 4ZVKA 3DVAB 3RADC 4JUDX 1R7RA 4YFYA 4ZOLF 1OXBB 4HVLA 5K09A 2PRKA 3JVIA 2F4VB 4KQ2A 3O73A 2M32A 2BFCA 4F84A 1GILA 3W1VA 4C7KA 2Y66A 3EFOA 1YAHA 4DMFA 2ERYA 3N0VA 3P9ZA 4EPYA 3OPNA 1S3IA 1NPYA 4MLDA 1Y3FE 4L8YA 3FKQA 3SC6A 2CD9A 2Z3VA 3ZE8A 3HJFA 4XB6B 3ZXXA 2XODA 3CH5A 5DN6A 1IPEA 1VMDA 2IEBA 3MAJA 4QWMA 3C39A 3VZDA 3GRUA 1U2GC 2OXFA 1W44A 1BWRA 1R4NA 2GPJA 3AJAA 4P7GA 2A5LA 5JSUA 1HORA 2FSIA 5BUZA 4IJQA 4RHTA 2F8LA 3V4OA 2AMLA 3LF1A 3Q88A 3RVQA 2QXUA 2XUZA 4OHXA 5J2UA 3FNFA 4OHCA 4DQLA 1LBQA 2VQFB 1L7PA 2DLCX 3VHXB 1H1LA 1EBUA 2QX4A 2FRVA 4IG9A 3STXA 2IUYA 3MSCA 3H1BA 2X5JO 4P36A 3GFVA 4QAJA 3UK6A 3HCOA 4P7KA 4UEWA 1AUXA 5C1DA 2HRQA 4UULA 3OJOA 3PA6A 4NHOA 3SYNA 1V1RA 3PUKA 4L6CA 2QT9A 2BRUA 3VISA 3H3FA 5FLEX 3E4CA 1SKYB 4KLCA 4ENVA 1GZ5A 2PCJA 2R47A 1EP1B 1MFPA 3O2NA 4ZVMA 3ZE1B 5ENZA 1GYPA 4MPTA 4B3HA 4ARAA 4B33A 2REBA 4Y6LA 4G0UA 4MMYB 1Z08A 4ZDIA 4CG0A 1LSUA 3R23A 1NF3A 4OK6A 1M7HA 2JD2A 4R8KA 3A9WA 3JQAB 4OQQA 4S04A 1MJGM 4GF5A 3UBMA 2C2OA 2GO7A 1NAHA 2HQOA 2YTZA 3BGIA 4GP7A 1UT8A 5LLDA 5ITZB 4IIBA 4DB2A 2OQ2A 3LE8A 3N86A 3O4HA 5BSUA 4JVOA 3C8ZA 1E62A 3PQ8A 1MEOA 5BQPA 4AO7A 6ADHA 1ENPA 2O2GA 5DIFA 5F2EA 1RIOA 1V45E 2F3SA 3DZBA 3QELB 5JQGB 1ZVVA 2VUUA 4KWIA 1M2NA 3GGGA 1GGJA 1GDDA 1XD9A 3OFJA 3Q3IA 4DCMA 2Z6QA 1DC7A 3D5QA 4HAYA 1GZ7A 3D02A 3E82A 1T0IA 4UMDA 4B81A 2P2SA 5LDHA 4GM4A 1WBBA 1EHCA 1GUYA 1OIXA 1DXOA 2OCBA 4IIGA 1ULZA 2C4TA 5JJ5A 1J09A 4I46A 3X0DA 2BKXA 2YZ2A 3RBZA 4KPGA 3KLBA 3PNLA 5FFFA 2YCLA 1SXPA 4HAVA 4YP1A 2OPBA 2VR1A 2E6KA 2X6TA 2DUNA 1QQ7A 5IKOA 3GJ0A 3V97A 4JXXA 2HZ7A 1SK8A 3K4PA 2FZWA 3VRHA 3WNDA 3C7CB 1PV2A 2PUJA 3HYSA 3P9YA 2EQ5A 1U8YA 2EVWX 3N70A 3DKIA 4O4JB 3L0SA 2JLUA 1MC8A 3E53A 1RYYA 3HKCA 4ZMBA 1YQGA 3MERA 2GXSA 1QZXA 4BKOA 2QTCA 3RU7A 3SIWA 2PTHA 2Y1OA 4V0RA 3FW1A 5C5CA 1BRMA 1M0SA 3U49A 3ZY5A 5GZ1A 5C46F 1ONSA 3AY3A 3NGLA 3AZPA 3M1AA 4ETMA 5TT1A 2D7JA 4CEIB 2EP8A 2AMYA 2I71A 4IUDS 2BM9A 4QGBA 3WSWA 3WGNA 4XWAA 4YRPA 1PNTA 1DLJA 4PFJA 3WZ2A 4OM7A 2IXEA 2N46A 3GZ4A 1UKYA 5UKDA 1N4AA 1QB8A 3VPAA 3TF5A 5CH8A 3JV7A 4FE4A 2BOVA 5G4LA 3R6WA 1FUYB 1ZM9A 2AT1A 5HF9A 1L4NA 3LBHA 4NNPA 1WAMA 2FPXA 3OE1A 3OU7A 3T1NA 1T8YA 2E4AA 4K28A 4ZCRA 1LH0A 3BSWA 1Z5OA 1MKYA 3DHEA 2VF7A 3LUPA 1JW9B 5EWLA 4IKOA 3D9QX 1QFZA 2EDCA 3CZRA 3EXFA 3GWGA 3L8HA 1QR6A 4QTXA 1ZW1A 2IYRA 3PL1A 4J1XA 4GOLD 3B53X 2ZSJA 2C9DA 3RRJA 3S7ZA 3FTQA 1RPEL 1L4GA 3UN1A 1QIKA 1FVHA 1ZGAA 4D0SA 5EIWA 2JIRA 4LRXA 4R98A 4CLRB 2ZS8A 2ZR7A 2C5SA 4M8NE 1L1RA 4PNHA 3ZY2A 4BZXA 5BXYA 4Y9DA 2IEAA 2H65A 1NXQA 3OTIA 4ITRC 4CL8A 5HZGA 3TSOA 3TFOA 1Y1RA 1G8KA 3H0CA 7REQA 3NFYA 3ND7A 2CNNA 2ZYGA 3K1JA 5FUWA 1O03A 4YIKA 5T4BA 4B76A 1K6XA 4EEXA 3PTAA 3M1LA 3D6AA 4D26A 1P2VA 3A2KA 2QP9X 1O95C 4QQKA 1CJKC 1JPVA 4KFSA 1N92A 3C4QA 1E1DA 3M81A 5EP2A 3WGKA 3WYAA 1S02A 4CG3A 2OV3A 4LTDA 2HF9A 4HFMA 1BXRA 2PBZA 4MQ4A 1N2OA 2FG5A 2WFMA 3GJ8A 4UOQA 3R1FA 3RG8A 1II8B 4BNLA 4CETA 1RYNA 4O5OA 2NADA 2QYOA 1Y63A 3GRFA 1JJBA 4HEQA 4O02B 1H6DA 4X44A 5IJ9A 1CDZA 1D5CA 4XX0B 3SC4A 4UTZA 3D6TB 3H42B 4HDKA 4G0NA 4NKRA 2JB9A 4Y9SA 2YS7A 2WKRA 5I47A 1VBKA 1XCGB 4BO0A 2UV8A 4Z51A 3ZHSA 2GILA 2KE5A 1JR3A 4UUAA 3RIMA 4KI0A 4UUNA 3HRHA 2IVFA 2X7HA 1U3FA 5C3MA 3CO5A 2L49A 3JAWB 4XJVA 1Y3BE 1Z2CA 3EXEA 1CQWA 1P2GA 4BNGA 3OA0A 1ZK3A 3RARA 2JBAA 2KEKA 4AJHA 1FFHA 4WEQA 3JYQA 2FLKA 4NPCA 4B71A 3OD1A 2XB4A 3QXHA 1JIIA 2E6UX 4CQMD 4W7IA 4ZYXA 5JYCA 5LXTA 3DKPA 1MXHA 3SMQA 5JSQA 2WJIA 1PJ3A 2XVYA 2VXOA 2JFBA 1JKJA 1K7YA 1M2FA 4ZRMA 1BZYA 1IIBA 3RCBA 4JYAB 3G5TA 3MRVA 2JEYA 4PFKA 1A96A 4HPXB 4ZCIA 3V48A 2MOKA 2SECE 5AQEA 1D8TA 3V1LA 4EHJA 4FN4A 3DT6A 4L9WA 4NPAA 2HJRA 1J99A 2XGMA 3NZLA 2NACA 2ZXEA 3JW8A 4JQOA 1OKKA 3RF6A 3VYVA 1SCBA 1TK2A 2P6NA 3A6PC 2CNBA 2DBVO 3SHWA 1M74A 2JFYA 2IPNA 1FP4B 1ARZA 4MMXB 1XN1A 3PEYA 1S9DA 2JARA 4I3FA 2XXAB 4ENRA 4DV6B 2IGBA 3VKWA 1E2KA 1Y34E 1O95D 3QGMA 4FZJA 3ADCA 3PDHA 1GDTA 5LBIA 3VNUA 5EE5B 3UA4A 4LWPA 3AJ8A 4UDNA 1PNRA 1D6SA 3JPWA 4NMXB 5IDVA 4BFTA 3KU4A 3C8UA 3F51A 4G5QA 1FVOA 2RK6A 1GPWB 1KK3A 1V11B 4QYTA 2QM3A 3C1OA 4Z5HA 3H4MA 3GFQA 5D3MA 3RHTA 1ES9A 1VJ0A 3H75A 1U5CA 5EKXA 1G60A 4CL2A 3PRHA 2D2FA 2I2DA 1TCBA 2D5AA 2NYVA 3BRWD 1VE7A 1E2DA 1JH9A 4D4IA 1R63A 1CNFA 2H0AA 1YB7A 2HHAA 3LT1A 2H1RA 4D9JA 3EULA 1GFZA 5HE9A 1XMQB 3BT7A 3LHSA 2G9ZA 2HMVA 4HPWA 4JU8A 4CIYA 4BY9E 2YJZA 2VP0A 4D42A 3WGZA 2HHJA 1X9GA 4HQLA 4M7OA 3W5BA 3ET5A 3NIWA 3V4VB 3EOZA 3TBKA 2OR1L 2D3TA 5ILOA 3T7KA 4C4RA 2NTJA 3QPVA 1FBTA 4JOQA 4RMIA 4RHYA 4W9NA 3HBJA 5KVVA 1NVKA 3MJCA 2GHTA 3LFHA 4RK4A 4RCYA 3VTZA 1O96A 1LBSA 1W6RA 4LMAA 5IN5A 5AFSA 2UYCA 4X64B 4MKIA 5KTMA 4LMBA 1Q0QA 3A06A 3FZQA 5TQ2B 3HC7A 4IY1A 4LOIA 2PS0A 4QOFA 3RR2A 2VBFA 4YCSA 3JATB 4MV6A 5LFAA 5JASA 4QATA 2EG9A 4M6WA 3U4QB 2AKYA 3W8DA 1IJFA 3T0IA 2WF7A 4L76A 3WLSA 1PRAA 2R44A 5A02A 1E9VA 2HYIC 3KZ3A 4K0KB 5DTQA 4UCQA 2BAGA 3TCXB 1QHYA 1YK1A 3ETLA 3CEHA 4LGMA 2D1YA 5L7TA 1A8QA 2QX7A 3WB0A 1J07A 4TL6A 4UCFA 2B1RA 2NVOA 3P27A 3ZWPA 1PSDA 2I8LA 2GXQA 2Q4OA 3PWTA 2OYCA 1MN6A 1AGNA 3N8NA 1HEUA 2V5AA 1A9PA 3KKMA 2A84A 1ACLA 4G0YA 2F8TA 2ID9A 4LWQA 4ZREA 2C8LA 3E9YA 3AHFA 3MWKA 4FZ3A 3AC0A 2W2OA 1NE2A 4F7WA 2JGKA 2QVCA 5DTRA 1KXJA 5FR1A 2ZBDA 4OJTA 1CUUA 2G1KA 2P7IA 4GKAA 4GNKA 2DGDA 4P5DA 1E6WA 3RRXA 3TRIA 4I55F 3GFRA 4JKIA 4M1OA 2O23A 3TTTA 3MTQA 4JLDA 4NS4A 2GCOB 1W2GA 2AVNA 2IJGX 3S70A 2QSYA 4PZ9A 3SEQA 4MVJF 1T5TA 2AVDA 3EXIB 4CU5A 1YHNA 4WCVA 4A15A 4OLAA 2YHIB 3ZLJA 5GV7A 4TZTA 2Q3JA 5ADHA 1QFMA 5KOJA 1SCUB 3R3JA 3WDSA 4TXNA 5F12A 3R7WA 5IDXA 1JTEA 5K8TA 3A9CA 3LLCA 4G1FA 1KPHA 2AG5A 4KO4S 3VDRA 4A0HA 2WSYB 4EVRA 4HWGA 4UCWA 3ML1A 4F5ZA 2VJCA 1FUUA 2ZRAA 1YKFA 1F2TA 2N1BA 1DHRA 3PNQA 2R86A 4BEBA 2PR2A 3NTXA 1MEJA 3IUEA 3DAGA 3WMRA 2BR5A 3CWQA 3MQFA 4N4AA 3A4YA 1PG5A 4R1UA 5CTJA 3ZHIA 1BHSA 2JL1A 4N3BA 4FMDF 3RSOA 2AXEA 2GARA 2QLFA 3MTDA 5EHQA 3WL6A 4DG8A 1AQYA 4IVPA 4X7RA 5F7XA 2QTVA 3PC3A 1ZITA 4FX2A 4BLVA 1VSVA 2PYZA 4BQRA 5JH7A 5GONB 2Y0PA 3KTAA 1N6PA 3GRKA 3Q7IA 1YQXA 2ASEA 2DKNA 2ZJ5A 3QUCA 1W36C 2HDOA 1QCCA 3RB8A 4GM1A 1G66A 1G18A 3F1LA 4G8CA 3ADOA 3L7KA 1FW8A 4F1KA 3RV3A 3ED1A 2EOAA 3ND8A 4D3DA 3KQHA 1ICIA 1WR8A 5BVHB 3IQWA 4I4NA 2IYNA 2X23A 3QE0A 4FFBB 4RIEA 5HQTA 3UATA 2J7KA 3N9IA 4KAXA 4W7HA 4YP0A 4XCVA 1TZBA 1UZMA 5FF9A 3BAFA 1Y9AA 1IG3A 2RH4A 4PYJA 1DCKA 2VK8A 1T6NA 1NUSA 3CRRA 4U0KA 3PJGA 3WXBA 3ESZA 1OU4A 2JFXA 3O9MA 3HXPA 4MQBA 3TNDA 1GLGA 1KZ4A 4DJFC 5KWJA 1BCRA 4MRMA 3OX1A 3B1VA 2WTXA 2O59A 3JU3A 5AKLA 1PLJA 3UHPA 1W0KA 3EGVA 2FZLA 1R0ZA 4N48A 3W5VA 3KZKA 2EWWA 1UBGA 4FR5A 2FUKA 2ZJAA 5CDFA 5C7YA 3QY0A 2NV6A 3R09A 2GNPA 3RT1A 4L73A 4DY6A 4H0NA 1SKBA 1VA5A 5JJCA 1IXKA 2GEUA 3FDFA 3L7DA 5EIBC 2ISSD 4UUOA 4ND8A 4RTKA 5DTMA 2AKAB 4FSXA 1KI1A 3DOFA 4B9AA 1N6OA 1I4EB 3DH0A 4WOKA 4M37A 5EJ7A 5F77A 5LVAA 2QVXX 3HN7A 4RVSA 3REQB 3SBDA 5B3LA 1ANKA 4WN9A 3GRPA 5LMNB 2VDWA 4F8DA 2ZPUA 1DXQA 2RHMA 3QPDA 4OMFG 4AROA 2OFWA 1WXEA 4J6FA 1Q20A 2H1OA 3M9WA 1UIRA 1JDBC 3CWCA 4N5LA 3V2IA 1QV9A 4DWWA