5DT2A

Crystal structure of dot1l in complex with inhibitor cpd11 [n4-methyl-n2-(2-methyl-1-(2-phenoxyphenyl)-1h-indol-6-yl)pyrimidine-2,4-diamine]
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
311
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKSWTGKPVSYYLHTIDRTILENYFSSLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Dot1L Inhibitors through a Structure-Based Fragmentation Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 98
structure length 311
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dt2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dt2A02
5ICEA 3ELUA 3RODA 3HCFA 5EHGA 5EKUA 2R6ZA 4E2ZA 3GWZA 3DMFA 4YUXA 3NTVA 3CVOA 3R3HA 1NV9A 1IY9A 5FHQA 3GDHA 2HR1A 3UZUA 2I9KA 1XDSA 1TW3A 3FPEA 4PYMA 3I53A 2WK1A 3DXYA 1T43A 1DUSA 3BKXA 5C1IA 1SQGA 1FJXA 2P7IA 2IP2A 3T7SA 1RJDA 1L3CA 4HH4A 4X61A 4YMGA 3FZGA 1NBIA 5DRTA 3DXZA 3G2MA 3P8ZA 4CKCA 2H1RA 5KVAA 4OA8A 3M6VA 4RV9A 3LBFA 5FULA 5K09A 3ERCA 1AV6A 2E5WA 1O9HA 4PYKA 4L7VA 4Y30A 1RI3A 3GGDA 2A14A 3G2PA 5ERGB 5DM1A 3ANXA 4M38A 1D2CA 5P8WA 5E1BA 5CVUA 1XVAA 2I6GA 3B3GA 5GP1A 3SXJA 3TMAA 5E1OA 1VIDA 2VDVE 2FCAA 3M6UA 3ORHA 1N7JA 5FWAA 3BGVA 2PXCA 5FWDA 1RJFA 1EAMA 2AOWA 2B25A 3MERA 1SG9A 5GIPE 4RTKA 2PX5A 3PVCA 4EKIA 2QE6A 2P40A 1XCJA 1BHJA 1X1BA 5GWXA 4DA4A 2OXTA 3KR2A 3OPNA 1JSXA 2ZIEA 1YFLA 4IV8A 3Q87B 3FPGA 3OFJA 4E30A 3GNLA 1JR4A 4QPNA 2ADMA 3UJCA 4X41A 3REOA 5DT2A 5LQRA 3EVBA 4KIGA 1EIZA 3TRKA 4DQ0A 2C7OA 2YXLA 3BT7A 1RI4A 4ISCA 1QZZA 4DM3A 2AOTA 3EMDA 5DX8A 1HNNA 1G8SA 2PT6A 3DP7A 4Z2YA 5KS2A 2AOVA 1V39A 1M6YA 3HVKA 1JG1A 3TQSA 2NXCA 3EVAA 3KPWA 5C9ZA 3HEMA 1R6AA 5EMMA 4MQ4A 4C04A 3EGVA 2JG3A 3JWJA 5T64A 1UIRA 4LWPA 3T7RA 3LDUA 1WY7A 4DF3A 3E05A 3V97A 1JTFA 4RTNA 3FUWA 1JQEA 3LKDA 4G56A 4PIPA 5EQJB 1PRYA 3DOUA 5EMLA 1AF7A 2IH4A 4RTRA 5KQSA 3MGGA 2G70A 2FYTA 2VZ9A 2UYHA 4XCXA 4YV0A 4POOA 3DR5A 3NMUF 4B17A 5JUWA 5GM1A 5EOVA 5DXJA 3TKAA 5DPMA 5CUQA 5DSTA 5LQJA 10MHA 3KHKA 1R00A 3D2LA 2XYVA 3KQVA 1N2XA 4PYJA 2PWYA 1M6EX 1QANA 2YVLA 2AVDA 2IDJA 2ZLBA 5E9QA 2EJUA 1X1DA 1O54A 1ZGJA 2JH8A 2NXJA 3FPJA 4P58A 4A6DA 1R18A 4BLWA 1XCLA 4RTMA 4RVFA 3UBTA 1SKMA 5D1NA 4R8SA 4YV1A 1JSZA 1P1CA 5EC8A 1JQDA 1L9KA 3LHDA 1BC5A 1VQ1A 1G55A 2OY0A 3V8VA 1XXLA 1QAQA 3C0KA 2Z6AA 4QTUB 2CMHA 3ER9A 2JHCA 3NVKI 5CIYA 4YUZA 2ZSUA 3CC8A 4PYOA 2VS1A 3G8AA 3HVIA 5D1HA 5EKXA 2OYRA 3SX0A 1X19A 3TKYA 5DM2A 1B42A 4XUCA 1G6Q1 2GH1A 1N7IA 2O57A 1FPQA 3I9FA 3OZTA 3CKKA 3GRZA 3LECA 3UJBA 2ZWAA 3UJ8A 2IPXA 3LDFA 3OE5A 1PJZA 2EX4A 4KW7A 4FP9A 1Q0SA 4YUVA 2JHAA 3LSTA 5FTWA 2YXDA 3MQ2A 3EVFA 5CVEA 3GRRA 3CCFA 3NWEA 4AZTA 3HCDA 3MCTA 3OFKA 2I7CA 3BXOA 4KDCA 2VDWA 5K0CA 2PT9A 3M4XA 4OQDA 1QYRA 3HNRA 3LCVB 5DX1A 3DLCA 3HTXA 3HA5A 3PTAA 3HCBA 2YUIA 1X1CA 3SSMA 5BW5A 3FUVA 5B1SA 3GIWA 3R9XB 1TW2A 2XYQA 5K0LA 3LPMA 3M6XA 2JJQA 1QAMA 3K6RA 3Q7EA 5EEHA 5CVJA 4C05A 4FR0A 3PB3A 3PFGA 3SSOA 3FRIA 2HV9A 2YX1A 5EPEA 5E8JA 1G8AA 5E8RA 1XTPA 4RX1A 1AQIA 3KR0A 2Z6UA 1WG8A 4YUYA 3KU1A 3EEYA 4PYQA 5FQNA 1IM8A 3EGEA 4QTTB 3LGAA 2PVCA 4V0QA 4RTPA 2H00A 2BR3A 1WXWA 9MHTA 2B2CA 5K8VA 4GOND 4WVLA 2IBTA 4AZSA 1NW5A 5H02A 2C7RA 2OBFA 3BGIA 3T0IA 4ER3A 5HZMA 3FRHA 5K0GA 5FQOA 4C07A 5DRYA 2CL5A 4QQKA 1UFKA 1KHHA 4OX9Y 1JG3A 2UYOA 1YB2A 3CJQA 3GRVA 5GINE 2PY6A 1TPYA 3DULA 1R8XA 1I4WA 3KKZA 2KW5A 4R6XA 3G2OA 2DPMA 2Y1XA 3BWBA 4HC4A 3M70A 4U7PB 4CKBA 2P3OA 4GC5A 3A7EA 1ORHA 2EG5A 3TFWA 3TM4A 2IFTA 2ZIFA 1RJGA 4QQNA 2BM8A 3C6KA 3I58A 2BR4A 3B3JA 2IBSA 2WA1A 4XUEA 5ICFA 4X1OA 4RTQA 3QOXA 3MTIA 3EGIA 2B9EA 2P1DA 2UYQA 5T67A 5E1DA 2CWWA 3P71T 5BXYA 2OB2A 5CVVA 3VYWA 5KYGA 4FS8A 5DXAA 2YR0A 1U2ZA 2O0LA 2IIPA 4BP3A 5HILA 4HGZA 4EQZA 2JHPA 4DMGA 1NV8A 5ICCA 4KIFA 3A7DA 4LWOA 5LQKA 2AOTB 4FT2A 3QV2A 5GM2A 3L8DA 4RVHA 1BKYA 4ER6A 2QYOA 3UJ6A 1Z3CA 1VLMA 1NBHA 2I62A 1JQ3A 2ERCA 4P7KA 3IEIA 1ORIA 3P9IA 2AR0A 3JWHA 5DX0A 3QOWA 3HVJA 3O7WA 4P7FA 1L1EA 4AUKA 1NT2A 3G7UA 2LD4A 4PYLA 1JG2A 3A27A 3P2IA 3NWBA 4P7GA 4X63A 1KP9A 4BLVA 3B3FA 4UOEA 4M37A 3HCEA 3ME5A 2HTEA 3LCUA 2P7HA 3GU3A 5F2OA 5K0JA 4MIKA 3LBYA 3SMQA 4QDJA 5LR6A 1P1BA 2ZBRA 3THRA 5EGSA 2N47A 3IHTA 5FHRA 1NW8A 2UYCA 4PGHA 4RYLA 5LQUA 3FTFA 5CCXA 2G71A 1ZQ9A 4ER7A 1ZHFA 2ZIGA 3JWIA 3THSA 4PYNA 1RI1A 3KQOA 1KYWA 5CD1A 3EPPA 2H11A 3NDJA 3VSEA 2NXNA 2GA9A 3NJRA 2PLWA 4YUWA 2K4MA 1P39A 3CJTA 3FUUA 4HSGA 4BLUA 3G89A 1VBFA 3R6TA 1SVUA 4OBWA 5HIKA 5LSAA 2UZ4A 5MHTA 3BWMA 3A4TA 4RTLA 4PWYA 4RTOA 1NKVA 3P9KA 3OU7A 4U7TB 4RVDA 3LL7A 3R24A 1VPTA 5E9JA 4LECA 4MHTA 3UJDA 4DCMA 2XYRA 4C06A 3GJYA 2ZBQA 2G8NA 3FUXA 5K0FA 2EFJA 5E2AA 2ESRA 5G02A 3UA4A 5FUBA 2PJDA 1KPGA 2AVNA 3RW9A 3EVDA 3G8BA 3HA3A 3MB5A 3JWGA 2HMYB 5IH3A 4DZRA 5EZSA 3S68A 2PX2A 4IV0A 4CXMA 3KQSA 4YMHA 3UFBA 5CCBA 1HMYA 1M0EA 5F2NA 3E23A 3ELYA 4PGGA 5EZQA 3EMBA 3EVZA 3T7TA 2FHPA 7MHTA 1L3BA 5EHIA 2IGTA 1FP2A 2GS9A 2YTZA 4GF5A 5DSXA 2EJTA 3IV6A 3KPVA 2DULA 3FUTA 1OR8A 4BY9E 1MJFA 1WZNA 5U4XA 3OZRA 5FCDA 1AQJA 4PIMA 1KR5A 1VP3A 4FGZA 1MHTA 3MHTA 3DLIA 2AOUB 2R3SA 4CTJA 3EEOA 2O06A 1I1NA 3DMHA 5DM0A 3H2BA 3G5TA 4LG1A 2FRXA 4RWZA 5E2BA 5LQCA 2PX8A 2HWKA 2NYUA 3KQWA 2ZTHA 3LX6A 4O29A 5BP7A 3PT9A 5FA8A 2ZZNA 4FSDA 3KQMA 1NW6A 2AOXA 2YXEA 3AY0A 5HIJA 4CKEA 2OB1A 3FTDA 1F3LA 3B7PA 3BKWA 3UA3A 2PXAA 2XBMA 4CWAA 8MHTA 3A25A 1EJ6A 3O31A 1RI2A 3LKZA 3PS9A 3SSNA 4RSRA 3DMGA 4AX8A 1D2GA 3GXOA 3BWCA 4RTJA 3EVCA 2VDUE 5T6BA 3TR6A 3GCZA 3GRYA 3K0BA 5EEGA 3TPZA 5K05A 3G5LA 2QRVB 1EJ0A 3ID6C 5DM4A 1KPIA 3DH0A 1DCTA 1VP9A 4R8RA 3UWPA 1FBNA 3CBGA 1YZHA 4GOOD 4IKPA 5EVJA 4RTSA 4KVZA 2ZBPA 3NDIA 3CJRA 3GRUA 3TOSA 1NE2A 5EG5A 3KQTA 3C3PA 2ZFUA 2HNKA 3P9CA 5HIMA 3I5UA 2IDKA 4F85A 2PWPA 4E2WA 3KPUA 1EQAA 1WXXA 5M5BA 1R74A 3MAGA 4PINA 3ER8A 2JH9A 4FZVA 4PCLA 2P3LA 5E1MA 2XVMA 2IH5A 4QVGA 5HEKA 2GPYA 1SQFA 3KR1A 5IKMA 5E9WA 2ZW9A 2PBFA 4FT4A 4DCGA 4AZWA 4QPPA 2QM3A 3KQPA 4ZTBA 2ZULA 2B3TA 3HA7A 3OU6A 3C6MA 3R0QA 3MCZA 4IWNA 2ZZMA 4ER0A 3DTNA 3P2KA 5LQNA 2OO3A 2GAFA 5GIOE 3FPFA 4PCAA 3GO4A 2IH2A 1ZG3A 3AXSA 1X1AA 4EVIA 2FK8A 3DUWA 1P91A 3ELDA 1ZGAA 4GC9A 3P97A 3NW9A 4C4AA 1IXKA 1RJEA 2ZVJA 4KDRA 2P35A 4A6EA 1F38A 2AN5A 2ONZA 1NW3A 3LDGA 4EMSA 1RI5A 5KQRA 1YZ3A 2XVAA 5K0NA 4GBED 4H0NA 4E2XA 4OBXA 4CTKA 2O07A 2AS0A 3KPJA 5F2KA 1JG4A 3VC1A 4EKGA 2GLUA 4K6MA 3P9NA 5LQAA 1SUIA 2G1PA 2O05A 5DTRA 2AN3A 3FYDA 2ZZKA 4PYIA 2OZVA 3TM5A 1Q0TA 2PKWA 4HG2A 4E2YA 3UJ9A 4EK9A 4FSXA 1VL5A 3G88A 1L3IA 2CKDA 3UJAA 3P2EA 3BWYA 4PONA 2FK7A 3OE4A 2ZWVA 4JXJA 3E7PA 5C0OE 4KWCA 4M7RA 4F86A 3M33A 1KYZA 4XUDA 1UWVA 3KPYA 2AN4A 5GOZA 2Z6QA 3M6WA 2P3QA 4OA5A 3VC2A 4HGYA 3SVZA 2NP7A 1INLA 1DL5A 5K01A 2ORED 4MWZA 3LCCA 3FTCA 3F4KA 1NW7A 2WA2A 3EVGA 2PXXA 2BZGA 5DWQA 3AWIA 1YFJA 1YUBA 2OKCA 1G38A 2Y1WA 1WS6A 3RIEA 3PFHA 1BOOA 3PLAE 2P41A 2PSSA 5HOQA 1O9GA 5JR3A 4YV2A 1XDZA 5K0EA 4HTFA 5CVDA 5EMJA 1KPHA 1D2HA 4GOLD 2BH2A 4HTFB 4C03A 4QDKA 1KXZA 5DTMA 3SM3A 3EVEA 4M36A 3WSTA 4NECA 4F84A 2NXEA 3HCAA 4HRAA 3NVMB 3FPHA 5EIFA 1KIAA 1EG2A 3DXXA 3KQYA 1Y8CA 2F8LA 2V74B 3C3YA 2C7QA 3I64A 3OCJA 2NP6A 3E8SA 2PGXA 2BM9A 2OPBA 4QVKA 2PX4A 4KRGA 2GB4A 2B78A 2VP3A 3BZBA 3O4FA 3ELWA 3PX3A 4RVGA 5FADA 2Q41A 4ER5A 3HM2A 3SGLA 3FYCA 5FA5A 2V7EA 5ICGA 4GUAA 1FP1D 1G60A 3SR4A 3CGGA 5EMKA 5DTQA 2NNWB 2PV0A 3HCCA 2ONYA 4GQBA 4E70A 1XJ5A 3G2QA 3U81A 3KQQA 3FTEA 3HP7A 2FPOA 3MTEA 4OQEA 4BP1A 1QAOA 1SUSA 2AOUA 2G72A 3AXTA 3X0DA 3OZSA 4E33A 1VE3A 2AZTA 2YQZA 3A26A 5HFJA 5DLYA 4GOMD 5K03A 3TLJA 4X60A 1JTEA 1ZKDA 3OU2A 4ATNA 1H1DA 1I9GA 4E32A 5EIWA 2CMGA 3HVHA 4R05A 5BW4A 4MTLA 4DKJA 2QY6A 1YF3A 2P8JA 3B5IA 3B89A 5CM2Z 4C08A 2ZCJA 3BUSA 4Y2HA 4AZVA 3AJDA 3KR9A 3IYLW 3PX2A 4V0RA 4GEKA 3UJ7A 2C7PA 4E31A 5K0BA 2QRVA 1R8YA 4P7JA 5HIIA 2BR5A 3BGDA 4WXHA 1XDUA 4PNEA 4R6WA
chains in the Genus database with same CATH superfamily
1HFEL 2I6UA 1KFJB 1XHEA 2N9UA 3EOAI 4EGCB 3MCUA 2IE8A 2X1MA 4RHXA 4Y3UA 5FOTA 5DHQA 3WMWA 4PN3A 3IAUA 5B58C 2Y9PB 2WJWA 4C76A 3DDWA 2HY7A 4RNCA 3WJ7A 4ZU3A 4E6PA 3IUPA 1ZMBA 1LPAB 2I6QA 2W0SA 3PYMA 1SQGA 1E96A 3MJFA 2PUVA 2P7IA 5LJIA 4PCVA 3S8QA 5JE8A 2QYTA 2BGKA 3T34A 3S2EA 3TINA 1AA6A 1MUUA 3G2MA 1CUAA 1LNQA 5E0KB 4QGGA 3UFXA 1NUQA 1TMOA 1XEWX 3LBFA 5DF1A 2BYTA 1YD7A 1YR8A 3AEKA 3E58A 3MGCA 5DW0A 3I8OA 3TOVA 2J7UA 1UPFA 3HN7A 3CLUC 3QKRB 4OYLA 4TM7A 4WGGA 3EY9A 4TKUB 2LGJA 2YHUA 4WNCA 4GE0A 2GAOA 2YVUA 2QMYA 1EVLA 4J1WA 1VFNA 2DM6A 1WDLA 3GCGA 2FGJA 3QEJA 1G21B 4P34A 4L9AA 5DYNA 4LNHA 1C50A 4LBVA 4HDRB 2D2XA 3M6UA 2VQEB 2J9GA 4LMAA 2CWDA 3BMNB 1GA1A 3BTSA 3JWPA 1B2RA 3JYLA 4JQYA 5FWDA 2BFDA 1JIIA 1SG9A 3AOEA 1I8TA 2LDXA 3PVCA 4LHEA 1HT3A 4X4FA 3P20A 1BS9A 1VPLA 4FFWA 3PGA1 4HLUC 4I66A 4IJUA 3UK1A 2Q6IA 3DNFA 1X1TA 1T0PA 5DKFA 4DDUA 3RSOA 1VLVA 2Q2VA 1Q7RA 1RS0A 1JR3D 2VHWA 2XADA 1GY8A 3IUMA 4WWHA 3N39C 1UXIA 3W9BA 4B5KA 2QRJA 3EUFA 5T8KA 4HNVA 4CGZA 3GLFB 1FFHA 3UJCA 1YQEA 2FSPA 2HK7A 1AKRA 4WA7A 3SIWA 4D8UA 5LQRA 1FRNA 1T6BY 1AO0A 1VE7A 4II7A 2I4TA 1GUAA 2FWPA 3F73A 4TZ6A 1P2GA 2YXNA 5J2UF 1YULA 2OAP1 4H7HA 1DIOB 5L45A 2Q46A 4YRRA 2IU0A 4RLHA 5KS2A 3ZVKA 1EK6A 4YMVA 1AKQA 1I5RA 3OECA 2NV0A 1T9AA 4OSPA 2UVPA 4LI3X 3S6JA 5EMMA 3VSDA 4OU5A 1FTNA 1NQXA 2C07A 4G1BA 1O95C 4XTCS 1BWSA 4K9MA 1WVIA 1XRNA 2JI8A 3PPIA 1JQEA 3H3FA 2HA2A 3ESQA 1JQLB 4MYTA 4EHHA 1Q2UA 1WCXA 1GKUB 1T1IA 5FOSA 3GN5A 1KY3A 4F8DA 1NF8A 1Z0UA 3RAJA 4K46A 9LDTA 1FS6A 3CEAA 1XTRA 3LD9A 2ZRPA 4OK5A 3MEQA 4FMDF 1ISRA 4AJEA 2FW7A 4AW9A 1P77A 3CNLA 3GWGA 3BJRA 3PPXA 3V1KA 5B6PA 4O2LA 2RHWA 5JVDA 3PC2A 3D6FA 3K9CA 1SCUB 3L41A 1FTGA 4R54A 3LT5A 4PZLA 1F0YA 2J6IA 1QQ6A 4PG4A 1N2GA 3QWIA 3JQFA 1M2VA 3QA3E 5CNJA 2JLZA 3NUQA 3T9AA 1YRWA 2IBMA 3COZA 4DPLA 1WVGA 1DQNA 1N5DA 4P5EA 2RCYA 1O54A 1JECA 3O0DA 5FI3A 4XQEA 2PS9A 1EFUA 3KB2A 4P58A 3X1KA 4QHYA 4A6DA 1AGXA 4MJ3A 3A2NA 2X86A 1H0SA 4CL2A 1RQRA 2AJTA 4BHTA 2FV8A 1JQDA 4RAQA 2OGZA 4BGUA 5EJ6A 3LTNC 1E6CA 4OMFG 3ZWCA 1V6SA 3LO8A 1RXSA 3CE9A 3LY8A 1U80A 1UH5A 2J5KA 3ODGA 4WAUA 3BICA 3QKUA 4TOIA 5J2UB 4U8GA 2PKQO 4EO9A 1UP7A 1FUYB 2Y71A 3T5DA 3VZDA 2OFOA 1S9DA 2HCJB 5AVZA 1J49A 1W2WB 4UHKA 2OENG 4E5MA 5F3WB 3EPHA 4UXHA 3LRXA 2K7ZA 5LZ5A 2VWGA 1EXWA 3KKLA 2VWHA 3MGBA 4L50A 1J07A 4MLZA 5AXDA 3V34A 2O4UX 4BQPA 2JHAA 1EFRA 4JI3B 4WZAE 3COVA 1KDRA 2HUNA 1MJHA 3MUEA 4KLNA 1EK1A 2PYIA 3GRRA 2PGNA 3RAGA 1R0XA 3SF8A 1Q7CA 4C3OB 3DFFA 1N6RA 1Y7TA 2YCLA 1PBNA 3L8CA 2PT9A 3H1AA 2FXIA 4M9CA 1ZOOA 1H5QA 1SOWA 2HLNA 3HA5A 3HBJA 5LLSA 3PC6A 4DGQA 1FFGA 1JHMA 4DY6A 2J3LA 1OX5A 1KEWA 1EP9A 2Z5GA 3FBGA 3IAS1 5B1SA 5A9SA 4G5RA 5K0LA 1J8YF 3CR8A 1YCFA 1ICIA 4KSBA 1QRAA 3WYBA 4O8CA 1YCGA 1Q14A 1NJSA 2JDID 1G8AA 2D0DA 2VDQB 4Z86A 5BMOA 1QO9A 1IWBB 1LI4A 4U2EA 1Z4LA 3Q1LA 2I2CA 2ENUA 3QX9A 4JLPA 4P32A 4QTTB 3PIRA 2VTBA 3UMYA 4EO7A 2Z8ZA 3SAJA 3ZWYA 4B3JA 1ZRHA 5H02A 2EATA 2J4DA 3P0EA 1WPGA 3EQ8A 5HQTA 3K4QA 1YRLA 3TVTA 2C9ZA 3FRHA 3EXIA 3FF4A 3JQ6A 1WXDA 5HM8A 1QHHA 2R9VA 1UFKA 2DR2A 1IEXA 1G20E 2UYOA 4TS3A 3NGLA 1GPUA 4LK3A 1WOYA 2FWNA 2C2HA 3UK7A 4DUZB 1FDOA 3RFXA 1X42A 3VISA 1S9HA 5B36A 3WGHA 3QHPA 3MT8A 3UJPA 4CL3A 1M1YE 2P6RA 4IQ0A 1UT6A 1DRKA 1W93A 2XQGA 4I55F 1L1MA 2GA8A 3A3KA 3TTWA 1RYEA 3UIEA 3M0EA 4M89A 3R7AA 1CERA 3EZ2A 2BBWA 1EZ4A 1NMZA 1U0FA 4TYNA 2IBSA 4TTSA 4LDPA 2BZSA 4DR4B 2HIAA 1XDGA 4JASB 3ESZA 1P73A 2FW8A 2GCOA 4BZPA 5JY6A 1BXKA 1HYGA 2OWDA 2CDBA 3H16A 3K70D 2CWWA 1NIJA 1LVUA 3K1AA 4NENB 2Z3ZA 1N6LA 2H57A 4C5AA 3MRXA 1NUAA 3HL4A 2YR0A 3ML1A 4Q4LA 1J56A 2PS1A 5CDGA 3ZDFA 1TQDA 2CHUA 1K8ZB 3Q7IA 4Q3CA 4QRDA 1XMJA 3PLRA 5GM2A 1LW7A 1BKYA 3PDIA 1JKXA 2ZJ1A 3N2NA 4XVQA 5JCXA 4DMUB 2V9PA 4P7FA 1UXKA 2A58A 1DKPA 3K1YA 4N9QA 5ALYA 4OLBA 1KI8A 2QW8A 4X63A 4LOHA 4C4ZA 3QM1A 3HO6A 2P6NA 3GVXA 3JQBA 4GMFA 1RLIA 1X14A 4RD2A 4WKPA 1A7KA 2V9ZA 2HWUA 3F6EX 3KX2A 4MA4A 4R2XA 3KL2A 4R3NA 3THRA 2NPIA 2N47A 1Y9EA 1MC4A 5LPNA 3D2BA 1UQTA 3Q9NA 4QQRA 4DLXA 3UOAB 3W6NA 2X42A 4MROA 5BN1A 2G71A 3ZY3A 2ZIGA 4BO3A 2I2AA 4WPGA 4DLTA 1J0BA 1A9ZA 3QQ6A 2QI9C 2WJ6A 2F17A 4D0SA 1W5FA 1PJLA 3PQ6A 1GPLA 1D4ZA 2XLBA 3H7AA 1OGYA 3GNQA 3S1AB 1GQSA 2I2DA 3NH6A 1UZLA 1VRWA 5C8YA 1H4VB 3ISVA 2CBZA 2BFOA 3OEHD 5DFAA 3U2QA 3L4EA 3OU7A 3QQPA 1PIWA 5T4HA 3VVLA 1VHDA 2VTVA 1M1NB 3BWDD 4X85A 1YS6A 2HF9A 3N0TA 4E5KA 3KEFA 1U2DC 4JBGA 4MJLA 4BC1A 2VTDA 4HKTA 3TYXA 1Z5OA 5BWMA 1MO6A 1XQ9A 1U1DA 3AERB 3KKNA 4UJ3A 3Q8WA 3K0HA 4AWBA 4CM3A 1I7NA 2I9PA 2ODNA 2VYCA 4BQIA 3ITNA 3JRWA 4G5QA 4KXYA 3GQBB 1NZJA 1Y5LA 3UFBA 1PEDA 4QXAA 2HXYA 2JFWA 3ELYA 3TQOA 3QOYA 4QUKA 1AHHA 2ZWPA 3AF3A 4K9OA 1YMUA 4ZCIA 3N8NA 2CUKA 2AE2A 1SVMA 4YRGA 1JEEA 1GUBA 1S4MA 3IV6A 4PAWA 3T5BA 1USKA 4MUEA 5LDGA 2I5PO 1HDIA 4HXEB 5DHAA 1KR5A 4L08A 1ISJA 2FMIA 3GDFA 2UZ1A 3DDOA 3DLIA 4GX5A 1GSIA 4NNJA 2ZBGA 3KTDA 5AK4A 1UJ6A 4YJ3A 2HWKA 4P93A 4PZYA 4HDMB 1CDDA 2CNDA 2NUPB 2QMQA 3HDGA 1XBTA 1XCPA 2Y3IA 2ZYDA 3TGWA 4H31A 4P2GA 4ZI5A 5I48A 5C37A 2HHJA 3RVJA 3ZHUA 2PHZA 4BFLA 2PXAA 2C99A 1PDOA 5FRDA 3WK8A 1ZJ5A 1WM1A 2HXSA 3CZ5A 3OE7A 1IB6A 4HRYA 4AY3A 3O3MB 1GL7A 2JAPA 2P9JA 3B78A 3RO7A 4TKUA 3BM5A 1B6RA 1IHYA 3IESA 1GA4A 4YQEA 2FJRA 1VJ1A 2PL3A 4GPIB 4N7BA 2AXZA 1CEXA 2CLMB 2ZT5A 5GV7A 5TR9A 3RB8A 1Q91A 3WYEA 4C7BA 1HLDA 3FTQA 2JH3A 1FBNA 3E35A 1U1FA 3NHPA 4PU0A 2HHCA 2HJVA 2MCFA 4B34A 2OFWA 1PTJA 3H1BA 3EQ2A 1R74A 2Z9CA 3U7JA 2PZLA 1XRPA 1W9MA 2YWHA 3O7MA 4LDRA 4N4AA 3U31A 1N77A 2QSYA 2FDCA 2C96A 2V98A 3N6XA 5K8CA 4YCLA 2AK2A 3QNMA 1QP8A 3AGPA 3KSDO 3MK31 4TS4A 4MP6A 2FWMX 2QENA 3H4IA 4IXMA 3KDAA 2ZUSA 3DE4X 4I5IA 5FPPA 3VH4A 1W4ZA 1A8PA 3EAGA 5DBHX 1ZM2A 2PX6A 3FPSA 5GAJA 2IH2A 4B1FA 3OIVA 4J7UA 1Z63A 3DLBA 2F62A 2VOEA 1W1WA 3LYHA 5F23A 4RKWA 3HVUA 3K9HA 3TDNA 1P19A 1Y9JA 4GZLA 1H66A 1HQKA 1LNZA 1XEXB 1YZ3A 1V9CA 1P0CA 1XPJA 2PU5A 4J0JA 2AYXA 3B6KA 3G59A 3G2LA 4RZIA 3AKZA 1ABBA 3RC1A 2IHBA 3SNKA 2PIJA 2EP8A 2W2KA 2GLUA 2XA2A 4QFBA 4TVKA 4C6HA 2XWQA 3DVLA 4R41A 4Q03A 3GUUA 4BECA 2NUBA 1UJ2A 5DTRA 3ANLA 3USCS 4CT4B 1QTRA 4LA4A 4YAWA 2OZVA 3MSCA 3V2HA 3WNBA 2RBKA 3QFTA 4NV0A 4A10A 2O5VA 4X54A 3VJKA 2CVOA 4BRZA 4ZZIA 4LWZA 2ODQA 5G1OA 3GLFA 2HWXA 5GAGi 1IN1A 5A4IS 1PNQA 4G2NA 3WRYC 2R8OA 1N92A 2IXTA 3DOOA 4FDUA 3LUAA 4O4LB 4S1NA 4XDYA 3BH6A 4KWCA 3N86A 5I7SA 3WLPA 5HRAA 3M6WA 3WA6A 1L8QA 2GM5A 3T0GA 1TK2A 4AY4A 1HRDA 1DWOA 1DG9A 1HDOA 1OXUA 2JAWA 2NLOA 2W2NA 1F6WA 1V11A 1V8BA 2JFBA 4NEHB 4KUGA 2O8CB 1Z6PA 4GI2A 3PP8A 1UDWA 2EEPA 3C5VA 5C52B 3ZY2A 2ORWA 4GSKA 2WF5A 4CMAA 2H2WA 3AI3A 3QVOA 5FPHA 1YFJA 2BD0A 4C2UA 5AK0A 3R40A 5HOQA 2IYPA 1RTTA 3OQ1A 1VL8A 3N7UA 4L8LA 4YV2A 1UKVY 1H2FA 3FDZB 1P6QA 4UNRA 1E0KA 1E1QA 5BXQC 4KN5A 2Q50A 4BUCA 3VPAA 1YH3A 4M36A 1K68A 1ZM3A 4HN2A 4Y2PA 2A88A 1Y3BE 4KLRA 4N3AA 3BIFA 3HXMA 4R7GA 2BEUB 1VMEA 1OSLA 1ZZGA 3CLSC 2XGSA 3L40A 4L5AA 3A6DA 5F7JA 4YRFA 3ZCUA 4FYYA 3N1UA 1UBRS 2IWRA 4IG4A 2Z8YM 4MQFB 3O4FA 2H8RA 1CY0A 2VH2A 3TOZA 5BW8A 4EYGA 1DNPA 4J6EA 3ZY5A 1YJBA 3OZAA 1RWKA 3RQIA 4C43A 2WTNA 3IBFA 4KPUA 1LPSA 3B82A 3IT0A 3RHZA 4BKMA 5JSUA 2EQBA 1LDEA 2HSDA 3FA2A 1E9DA 3QVSA 3U17A 1O4VA 1YS9A 1XU7A 2J9FA 1DBSA 1ZSYA 2V5UA 2TMDA 2WTAA 3PKZA 4G1MB 1FF9A 2RHCA 3HE3A 1XJ5A 1MB0A 3C3MA 4CM8A 4DCJA 1BWRA 5CM9C 3H1PA 3MTEA 1J90A 2YFKA 1CEQA 3DQPA 1J0DA 2AOUA 4AMUA 2OK7A 3ENKA 2DLDA 1ZN2A 5DISB 3U80A 2FR8C 3ICPA 3WLFA 4JQZA 3WVNA 5K03A 4LFAB 3TLJA 4C3UA 3JQGA 1KI9A 5L40A 2GR9A 2KEJA 4FMPA 4KIUA 4DQKA 4F91B 3GVCA 5EIWA 2XB2A 4MW6A 1MB9A 1DMSA 3F5MA 2XTJA 5ARBA 4KXUA 4B40A 1TZKA 1M34E 1OIVA 5KQPA 3FXAA 5L6LB 1D6MA 2IEBA 1ZVVA 1Q77A 4PO3X 5AJTA 3GZNA 1GTMA 2NO6A 1W4BA 4Y6LA 3F3KA 5ESRA 4P0PB 1QQ5A 2POCA 5DEIA 4WXHA 2OFYA 2XVYA 1R12A 4R6WA 4UHFA 3P19A 3RODA 1QWSA 3KXAA 4GMDA 4H16A 1WHSB 1M2JA 2OG1A 4QPJC 4YJ2B 3VPCA 5KJFA 2RHHA 1OBFO 1MD9A 3FLMA 4GM0A 2OYCA 2QM7A 3GZDC 1QGUA 5BN4B 2FSFA 2RAVA 4B6QA 2CFIA 3BJEA 3A06A 4OVKA 4RA9B 1ZK0A 3EIEA 3HCRA 5A62A 1U3TA 1XOIA 2G9ZA 2XNKA 4NBUA 2ZJ5A 3IO3A 3O92A 2OHHA 3OI7A 2H06A 2YMLA 3Q3GE 1RHJA 3AVUA 2Q1YA 4M99A 2RH8A 1ZNXA 2QAJA 2DKOA 3H8SA 3QX7A 2H1RA 3DE5X 3IAHA 1G8MA 1SVNA 4NAHA 1GL9B 3ERCA 3EWSA 5FNVB 3S8MA 1UOOA 4B6OA 4LY0A 3HXTA 3VC3A 3GGDA 3SJAA 3G2PA 5CMLA 1V3VA 4PU3C 3IDAA 3MWJA 3O95A 1ZJJA 4ARUA 1NXSA 4E1BA 4R2MA 2BJWA 4X1IA 3JQGB 1G7CA 4DMMA 3AEQB 5KCZA 3ORHA 4MDFA 2HDHA 4ZOCA 1O96A 4RORA 3WGYA 4BE7B 4GECA 2R7AA 3USES 2OYSA 4TMYA 2CF5A 3AUUA 3CZRA 4MVJE 2QE6A 1G3IA 1EDBA 1L5MA 2WYHA 2JJ8A 4LCBA 4PPNA 3QI7A 3T5GA 2GCGA 4M4SA 2OXTA 5KJ6A 1CFJA 3B51X 3CZPA 4ZT6A 4MW1A 3Q87B 1GPMA 1LPOA 1UC9A 3KKOA 2CJFA 4GGOA 3ZKAA 4ZVOA 1VL2A 3PJFA 3AB3A 4IAOA 4M22A 3VVCA 3HYTA 4CG0A 3W9SA 3DMRA 1ULZA 4PTLA 3AM3A 3PUIA 3KSBC 4A23A 3EF0A 4J1TA 5B7NA 1CVLA 1T8PA 4FDVA 1I6WA 4Q3LA 4XI9A 2Q3JA 2KI5A 1XWWA 4M6WB 2HA0A 2OVBA 2QLNA 2XCJA 1NW4A 4K8RB 4P9NA 3UMCA 3JQ7A 4AG6A 4KQKA 4BNHA 2H31A 3L6OO 3NIFB 3OURA 1KRXA 4MGEA 5TXGA 3CIFA 1II9A 3IAAA 4JY7A 3TB4A 4EHAA 3VR6A 2IUUA 4RGVA 4DF3A 4MVJH 1JTFA 3CLTC 2R1VA 4G56A 1G9XA 2GYWA 4ECEA 4EYOA 4Z7OB 5AH0A 4PHCA 2A0KA 1IQPA 5EJ4A 2ZRBA 3R7FA 1NKSA 1FP7A 1AM4D 1WSDA 4KQGA 5TJHA 5KWJA 4CF5A 4Y2VA 4FFPA 2NVOA 3KVOA 1SZPA 3F4LA 1LSJA 3SF0A 2X9VA 5KVCA 2IPAB 4QICA 1LVGA 1RC1A 3NP7A 4HGQA 5LLDA 5JPCA 2D7DA 2V9CA 4O08A 4RQUA 3TTYA 3DCJA 5K6TA 2B3DA 4ESHA 3HYNA 4H15A 3ZCVA 4AUMA 2PXTA 1YDGA 1W5BA 2YVLA 4DHWA 3OETA 2QTAA 2FW6A 4YDSA 3K1ZA 4TXJA 3QFCA 1WIZA 2B21A 2E89A 3RKUA 3HUFA 2W2VA 4M9SA 4R1TA 1QU2A 1NBEA 5DGTA 1EFTA 3BBLA 3O2SB 4HH0A 1TLFA 2QLMA 4G0ZA 4L5JA 2VXBA 1WXEA 2GBLC 2XE4A 2ZYTX 3QLVA 5DN6A 4Z9XA 4XWKA 3ICQB 3AZQA 4Z54A 1SBZA 2O0MA 3DEFA 1PVDA 2HL6A 4UBIA 3V00A 3I9MA 2FFAA 3LHDA 1G55A 2C2KA 2F1OA 3GK3A 3PIDA 5EUBA 3ZNPA 2PLNA 2CMHA 4GU5A 1J2UA 1E20A 4B3GA 2WI8A 3LZCA 1H2XA 3AWDA 3CC8A 3B2QA 4GKAA 1ORTA 2NTJA 3DUFA 2VDPB 1OI7A 3JQ9A 4FHZA 3MFQA 4RK0A 3TSCA 5CA0F 3A1EA 1GU1A 1N5JA 2NG1A 3KZOA 4M21A 2IYNA 4ZQFA 5FEMA 4DA6A 3T1OA 3E9ZA 1DSSG 4CV0A 3GFFA 3LECA 4IXDA 2FWBA 1CX9B 3AJ9A 1FPMA 2Z2KA 1L4EA 3OE1A 4L8GA 4AIRA 4CHTA 4CKWA 2C5HA 1R0RE 4MUJA 4G0QA 1VG0B 4UKDA 2OA0A 4AWXA 2E2WA 2PNFA 5F7OA 1CRPA 1T1RA 2NAFA 2QM8A 5CB4B 4IG9A 3KLBA 3IA7A 1K0UA 4I5EA 5DGXA 1REQA 3U3ZA 1C1XB 1IAVA 1O6GA 4YDQA 1X1CA 4XJSA 1T6ZA 3FUVA 4JMPA 2QB5A 5EERA 1C9YA 4HHEA 4TTJA 4GAEA 3GW8A 2IOFK 4NXMB 4P0QB 4INZA 2YC2C 1GDDA 4V3BA 4YRNA 4E5DA 2FWJA 4CCSA 2QROA 2HV9A 1W8IA 3AHCA 1LCIA 2EL9A 4ZTZB 2Z6UA 4KN9S 3EGXB 3L01A 4F3NA 1YQUA 3AQIA 1ADBA 5F5NA 5AVTA 3IIMA 3UANA 2YV1A 4DEVA 2Z4SA 4BKRA 2VUHB 2ZJAA 2W9XA 4LJYA 3WGZA 3D4IA 5JDCC 5HMLA 4JQDA 1M1YA 3H5WA 4B6PA 4OHOA 5HE9A 1NW5A 4E5UA 1FDTA 1FTWA 4JLAA 1ZU5A 3EFHA 3SQDA 4RMNA 2LYJA 3IUYA 4RLFA 4L72A 1EUDA 4YASA 3A1DA 1WF3A 3CW8X 4PNPA 3K0SA 4K6CA 3P0FA 1XLUA 1JG3A 4L8YA 4ZQBA 4YCJA 2NO5A 1E4OA 4JC0A 4KO8A 1E2FA 1B16A 3VBEA 1N0VC 2MHCA 4U7PB 4HVCA 4JLOA 4UBJA 3OKZA 3SCGA 2HGSA 2V4ZA 3I83A 4IUDS 1OILA 2D5IA 3KAQA 1D3AA 1RBMA 4I50A 3LMKA 4V24A 2EX0A 2Z1NA 3OEWA 2PUBA 4V1CA 1QYWA 2ISCA 4J3FA 4PV7A 4EUNA 4C7OB 2X8LA 3PVZA 1KJZA 3WWEA 2V6MA 1RFLA 1B74A 3ZU2A 2JIDA 1JAIA 5DIZA 1NDHA 5IG2A 5LWHA 4UREA 2ZIXA 1ZS4A 4Q15A 4BDSA 3HUUA 1BE0A 4BRUA 3JAKA 4BP3A 2Z56A 3ED1A 2PMFA 1ISMA 2R60A 1KYVA 4N5HX 4ZIRB 1KZGB 2P3SA 1M1ZA 5K6RA 1EEXB 3EWIA 2JGEA 1NHGA 3FIUA 3KCQA 3LE8A 3OJWA 4RVHA 5DVZA 3UB4A 3ZTWA 4FEYA 3OM1A 5I6DA 1EGVB 3O1HB 1JEQB 1G42A 2QN7A 2GASA 2ZJZA 1CJGA 2V7UA 3A11A 4FMBB 2ERCA 6ABPA 5IANA 1JJAA 3E48A 3OOYA 1AQUA 3RSCA 2M9MA 2YFHA 3ISTA 3D8SA 4H59A 4RSHA 4RM3A 2C1ZA 3V33A 2ZAIA 5BUZA 4CEIB 3U4HA 2VBIA 4QATA 4RKQA 2WJVA 3IP8A 1Z0JA 4WLVA 3D0OA 5BRNA 3NBAA 2ZJ2A 4BMCA 3RSLA 3X44A 4B4UA 3AVTA 1EXMA 1SBNE 1ZLYA 4JB3A 4QGFA 3RWOA 1P1BA 2IRWA 3ZWBA 4ECAA 1FSZA 4JCYA 1AKEA 2WSSD 5E0OA 4PGHA 1PKXA 2WIJA 4Q4AB 3UTCA 2WHRA 3HEAA 4I7EA 1TM4E 1W44A 3BTUA 4HB2A 2CGEA 2YC4C 1C80A 1M74A 1ZHFA 2W90A 3NG1A 2BFEA 2IOFA 1NR7A 4OI4A 5JTUA 2VXYA 5FI0B 2B5VA 3OKAA 2H11A 4UNSA 3B2NA 2NXNA 1OKKA 4TLAA 1V16B 2K4MA 3PXPA 3EXG2 4JQOA 2VP9A 4MH0R 2B4YA 1JHPA 3ZC3A 5JS8A 4F6CA 4CPDA 3D1JA 3COWA 3LFUA 1IJKA 4WRRA 1US8B 4RTLA 1NJFA 4WY8A 1MIOA 2VSQA 3SE0A 1UPCA 2WVHA 2NU9A 4HUTA 4UBNA 2HRDA 4KGDA 5B12A 4KHPB 1BE1A 3E82A 3NONA 3H5NA 3LFPA 1XHFA 4NNOA 4F3TA 1W4AA 1LSOA 3EN0A 3VO2A 1GGHA 1H2BA 3C6QA 4Z5DA 3J80A 2EHDA 1OVGA 2OO5A 2VK2A 5T57A 4IMPA 2ID4A 1BVHA 3JWGA 2EWMA 4P3KA 3QFIA 3KQSA 1EFHA 3P27A 3W3ZB 4HRXA 2PVSA 3Q9UA 3VMFA 3IMCA 1MGPA 4PX9A 4CKWB 1K0FA 2KSQA 4IM7A 2AQIA 5ALZA 3ROKA 4D8WA 1OV4A 5EQTA 4PZCA 3SHVA 4WLOA 1PHRA 2RGNA 1ZICA 1ZVMA 2YTZA 3C3XA 3PI6A 4HS9A 3NDBB 4JSYA 4P3XA 3G85A 3V2GA 1FA9A 2DULA 4I99A 3LA6A 5EUCA 5U4XA 2H1WA 1XTIA 3QPUA 3UQYS 1N5OX 2P90A 3HKDB 3QY9A 9ABPA 5HYVA 1AQJA 4HYTA 5JFGA 1GEGA 4LHVA 4DSOA 2Y0DA 5KYXB 3QEMB 2AOUB 3DE2X 1KFCB 1I1NA 3QPBA 1T9GR 2FRXA 4M9XA 4IUCS 4RA9A 4DV4B 3VYUB 1EUZA 2H51A 5SICE 2VAXA 3IPCA 4LGCA 2IV3A 4Y2QA 1G63A 2W6CX 4DLBA 4DDTA 3U19A 1YFKA 5TSDA 4UUPA 4GXTA 1EMDA 3B7PA 4BJ3A 1IY8A 2PIDA 3NKLA 4MRPA 3TSZA 4U00A 3GEBA 4RSRA 1N0UA 5HHTA 1EX9A 1QFSA 4HYQA 1HURA 1W34A 5AW8A 1R0LA 2FE1A 3GCZA 3GRYA 4Z8YA 3Q41A 3RS0A 4GWKA 5K05A 5ALLA 3ZK7A 5J59A 2YWFA 4DBLE 1Z39A 3E7XA 5J1SB 3ID6C 1TKRA 4IZHA 5HK9A 5IVPA 1G66A 1DG1G 2RGUA 5LKRA 2O5RA 3NDIA 4XPIB 3SHOA 1RZVA 3FGOA 2QN9A 4NFSA 3B7HA 1A9RA 3O8QB 1V8PA 4YCCA 3QMMA 3UVEA 2O2SA 1RWMA 1C7IA 4NMHA 4QLAA 2J3IA 2H1LA 2K6GA 4M53A 2FZKA 4ZO6A 2Q6OA 1XZJA 1RKQA 3ETCA 1KYYA 1Q0PA 2QG6A 2ST1A 4KV9A 4Z1OA 1GJRA 5DNCA 4PM4A 2JFVA 3R0QA 4TV9A 4D4MA 2C7BA 4RF5A 1LJ8A 1BROA 1G3UA 1CYEA 1ZUD1 1X1AA 3FF1A 4D44A 2C3YA 3DR3A 1MU0A 3HN2A 1H0RA 4FU0A 3U5TA 8ABPA 2O8DB 3VMMA 3ZJVA 3OMXA 3WGKA 4EFNA 4EMSA 1C3OB 2A3NA 1TVKA 3CUVA 2BGGA 3GPLA 4GBED 4H0NA 3KAKA 3UWSA 1Z13A 1N2SA 1CYDA 2UDPA 3BB3A 3I73A 4B6SA 4Q39A 4TL6A 1DEHA 4HI0E 1LDYA 4UOZA 1AQNA 1P7CA 2BGLA 2Y68A 1JEDA 1ZNQO 3P9NA 3LU1A 2YWCA 1OC4A 1T1EA 1VJ5A 4NBTA 5U4QA 5BMVF 3ZWVA 4YCSA 4YJFB 1C3VA 1V0JA 1E9EA 2AN3A 3O8DA 5CDYA 3JATA 3A58B 3TM5A 7ABPA 221PA 2FMHA 3T5PA 3TW8B 3A9SA 3UJ9A 3NHSA 3L6EA 3G88A 4B2YA 3FNGA 5IVDA 3BFPA 2Q1UA 2XECA 4ZOQI 4AI6A 1VL6A 1DAPA 5AW2A 2A1TS 4NBNA 2A5DA 1AURA 1BXRB 2DBVO 1Z29A 2WF9A 4M7WA 2E55A 3L1KA 3CPHA 5C8DA 4L0DA 1Q1EA 2OKGA 4EZBA 5K01A 3F51A 3OLYA 1W9HA 1V6CA 4BBJA 2BMJA 2QX7A 2BMAA 2OD2A 5CLQA 1XMSA 3M6MD 3L8FA 4NJOA 1ACLA 1OX6A 2JI6A 3MMZA 2NVBA 4K6FA 1PT6A 4N6NA 3RV4A 3ZQKA 2YWXA 1ZVKA 3GYBA 1BOOA 4EHLA 3JVEA 5IBRA 5UKDA 3PLAE 2XMRA 5LBIA 4OYHA 4GIBA 3N0XA 3ZCTA 1NQAO 4DMFA 5CVDA 1VKJA 1UF9A 2EBYA 2GSWA 1WW2A 1OASA 1EWYA 3A9RA 1LFAA 3MRSA 4JC8A 3A6KA 4PPQA 3EXHC 1DTWB 2IP4A 2A1UA 4CM9D 3QEKA 4CIYA 1OGIA 3CBQA 4S2EA 2QN1A 2ZYIA 4LYYA 2ZRKA 5EXXA 1Y8CA 3DD1A 1SXQA 3C8UA 1RPAA 4XYEA 4XX0A 1VI5A 1BAPA 1LPMA 4DIDA 5I7AA 5JYBA 2GCPA 5I7RA 2ACKA 3FCEA 2FSVA 3DWGA 3ESBA 3H8JA 1PQWA 3JQAD 4ZI7F 3DL2A 4PR3A 4ESVA 5KYKA 2YVQA 3PX3A 5FADA 4BMDA 1P7VA 2X40A 1PNRA 1PZFA 3DW1X 3PWZA 3OFNA 1QCYA 2AT1A 2G9UA 2XD9A 3ZCSA 4YJ2F 5CFNA 1IL0A 3ZEIA 2NNWB 4F3KA 3STUA 4YJHB 4YUAA 4F4CA 1OLSA 5KEIA 1OFUA 4E12A 3MWFA 3FTEA 2IIQA 4YJKA 2BDTA 4TPKA 4BP1A 5A6VA 2QAGB 1QO7A 4AKSA 4MPPA 4D9GA 5KX5F 5HFJA 3Q9SA 5CG2A 1ZJZA 2BH9A 1ZDMA 1TRKA 3U7IA 1GP2A 3V80A 3MS2A 1PRAA 1GUYA 1CB0A 2A1TR 2ZIZA 5IF9A 4EY7A 3UB2A 4PAOA 2Y27A 3GPBA 3QVMA 4GGMX 4YBAA 4QWMA 4V0MA 4LFCB 3TFOA 4N6GA 1IN4A 2O8NA 3NBQA 3NTLA 5EMNA 4RK4A 2VJAA 1HPLA 4GEKA 1PR4A 2H1VA 4AVYA 1QJCA 2PRIA 3F7OA 3IDZA 5EP1A 1RADA 1BJKA 3EASA 4RXUA 2WIAA 1FMFA 3C6BA 4UBOA 4RVNA 3HFSA 2BEVB 1EFCA 3FZQA 3IQFA 3TAHA 1NV9A 1IY9A 1OWNA 3HJAA 5FHQA 4CQMA 4LTDA 1ECLA 2V55B 1LH0A 4DRXB 2FFQA 4MYCA 5A9SB 1UKEA 2P9GA 1MEOA 2GTHA 4LSMA 4WZBB 1NVMB 3SHQA 5JXGA 2ENWA 1CT9A 3VR4H 4QEZA 3F9RA 4XQGA 1TKCA 2WV9A 4IEFB 4Y42A 3AFMA 4QU5A 4PSKA 4HH4A 3AR9A 3CVUA 5FD8A 3HV0A 3ZWDA 2ZDQA 5KVSA 5INTA 3C3AA 1DCFA 1A8HA 1E0SA 1E4EB 5C1DA 4LFBB 2CLCX 1TT5B 3GFPA 1O9HA 3HXPA 2OV1A 1JLKA 4S1VA 1T2NA 1UCFA 1P0QA 4MDYA 1ULAA 3GRKA 1MEJA 1I94B 1H4TA 2QGNA 2HF2A 3DCYA 4F6LA 2PG3A 1V4NA 1D2CA 3H84A 4KN6A 4W7HA 1HGXA 1HLFA 1EBBA 1K1EA 1YRQA 2RGAA 3ND5A 4AIIA 4R9RA 3FOAA 3TH5A 3ABRB 3OQMA 1X80A 4WK0B 1CV2A 1AKUA 2O2IA 2IS4A 5DBEX 3IAM1 1JFRA 2OXEA 3BGVA 1ZIOA 4ZAZA 1EAMA 3ZGVA 3MERA 3UAZA 3ETNA 2FFRA 3A9XA 4EKIA 4PGFA 4KHZA 4P33A 1BHJA 1FCJA 2QW1A 4QBGB 2MYPA 5ENVA 4YFYA 2ZYRA 1DELA 2PUGA 5DM60 1N7HA 1X9HA 1Z33A 1Q3HA 3NR2A 4FPXA 3PXXA 4HY3A 4LBZA 4Y6GB 4Y7CA 4L1KA 4EDFA 2FETA 3PE6A 4JYBA 1FFXB 3ZV3A 1U1CA 2G5CA 3FMGA 4Q01A 4GD3Q 2QTFA 1CE8A 1Y3IA 3D0RA 3REOA 4CQLA 6AT1A 4JQSA 1BRTA 2C3PA 4JJZA 4LC1A 5DGDA 3S4YA 1X7ZB 4C4PA 4CR8A 4WXRA 2H5IA 3SDSA 1MO3A 4DLYA 4D4HA 5FAXA 1ACMA 2FPGB 1QOPB 2YNMD 3ZK8A 1Y34E 2A7XA 5ILOA 2JLWA 2LYSA 3ABQB 4UBLA 2AOTA 2BKUA 4F2DA 1HNNA 2DSTA 2ZSJA 4L4RA 1JLLB 1ONOA 4H6VA 5DLPA 1V39A 1P80A 2VHVA 2AF3C 1JDJA 4DSUA 3NRCA 1EGQA 1WDTA 2DCUA 1WUYA 1JIQA 2Q5QA 3C6YA 4JQCA 1KIMA 4LWPA 1GQ2A 3UWMA 2JK0A 1PJTA 2L19A 5BV1A 4WK4B 3DOUA 1CD5A 2EGUA 4C2TA 1L1RA 3OEYA 4BV8A 1V1RA 4ZALA 2B2NA 5TMPA 1R9GA 2PFGA 2C8JA 3WSWA 2COUA 1JPJA 2XRMA 3IOMA 3VU9B 1OAOC 4YV0A 4FFBA 4EEZA 1EM6A 4ZAVA 3WGUA 3HACA 3I0ZA 4DC1A 5IYZB 1K88A 1IONA 4UU1A 5J4HA 5DXJA 3TKAA 4UNIA 5KOIA 3V8RA 1I9CA 2BFEB 3D4NA 2HB6A 1JEAA 2BI8A 2GVDC 2ZBEA 4D82A 1FFYA 3D2LA 3I1IA 4MS4B 5DBFA 5TRTA 4N8DA 1RQ7A 1ODIA 3CLUD 4OIFA 2L8NA 1NVKA 2V0CA 3VJMA 4ZO9A 3UHAA 4BXOB 4YPVA 4Z99A 1WZEA 1SUBA 1MXFA 2YINC 1PT9A 1ZGJA 3NHUA 4M0CA 4B8WA 4NKRA 2I6SA 3KEMA 4W5JA 4AX4A 1C2YA 4D6YA 1VLHA 1M6NA 1WU7A 1XLVA 4XASA 3NT4A 4TKVA 1E5VA 2X14A 3KAJA 3PGMA 4A26A 5KDOA 5L9AA 1KZ1A 2IP1A 1DEAA 4G5HA 3ZJ4A 1ISSA 2ODAA 1A3CA 3DZCA 2AMVA 4LC0A 3VVBA 2E4WA 4LKOA 5CA1B 4XE5A 1S2GA 4OGKA 1JG6A 4DV7B 5FFMA 3AHEA 3BMNA 4MWGA 4IH9A 4RULA 4KYTA 2H4WA 2G06A 2A35A 4J0HA 3EK2A 4XUCA 4BUZA 4FW9A 1R3DA 3I9FA 3M1YA 1TE2A 4P84A 4X92A 3WK6A 1G7SA 4N7MA 3WZMA 4DXDA 4JYZA 2DBQA 1VYHA 5I51A 1G6HA 3MN1A 1CS0B 1UMDA 3GUVA 3WLLA 2CXHA 5CGQB 1Q0SA 1GXSB 2PX3A 1II8B 1ZA2A 2VRBA 2AZ4A 4RA6B 4LOAA 3VKUA 3R1FA 1HTWA 3RVBA 5JH7F 4HCJA 2C59A 4OQDA 5DX1A 1O7JA 4EY8A 1U81A 1SCJA 1IRXA 2FSIA 1JQBA 4DCTA 3GIWA 1NBMA 4V0ME 4A8PA 3M6XA 1P2UA 2HI0A 2WNIA 4DNOA 3DKKA 1XCBA 2PUFA 2LCFA 1L8AA 3DEIA 2GEFA 2GN8A 4HK4A 4MX8A 1LLFA 5DNAA 5FBLB 3PKIA 3LWDA 4E0BA 4EG0A 4CUJA 3UHFA 3EEYA 1I3CA 4MDEA 4EKEA 2MXDA 1HE8B 2I6TA 2H00A 2TECE 5AIBA 1DJOA 1FX0B 1WDKA 4RK6A 3OMTA 1JHAA 1VHLA 4EJSC 3KYDA 5CDUA 1QGYA 2QP9X 1OBCA 3C3CA 4BO0A 3U4CA 5ALTA 1A88A 4I1VA 1OB2A 2Q3EA 4M1YA 2PKXA 2QN6A 2IKSA 4NBRA 1UEXC 1LFDB 3CONA 1YS4A 3RKSA 3F6YA 4GI3A 5F7XA 3WHPA 4JHLA 5KNDA 2P9FA 5JIBA 2AFRA 1HKUA 2KW5A 2D4HA 2OESA 1C81A 3NO4A 4HC4A 2W42A 3ECAA 4NG5A 5M2QA 1OIXA 1SCKA 1DCMA 2LP4Y 4GC5A 3BXEA 2QAIA 4CFYA 1TAHA 4HPWA 1JJ7A 4Y0AA 3OCYA 4QNNA 4UTPA 2GHTA 1PWYE 4IX9A 5A3QA 3RUHA 1MOZA 4MQMA 4L4UA 2W6IA 5CHYA 1CULC 4RW0A 1A77A 3W8NA 4BKPA 1N2ZA 3RHSA 4RF4A 5F1PA 4NIMA 4US1R 2EV9A 3QUQA 1DBVO 2P65A 2EVWX 2IVQA 2VHQA 2A78A 2ZKIA 2WOJA 4J4BA 4C0WA 1C1HA 2BEJA 3FI9A 3PNOA 3U09A 4LWOA 1H3NA 3QRWA 4RJ2A 3HJRA 4CG1A 1TCAA 2ZRGA 4DTCA 2ZJ3A 3I2FA 3L8DA 4B3DA 2IV2X 5FUQA 1E99A 2HHHB 1PR0A 4WN3A 3PDJA 1V45E 3N74A 3NBZC 2JGLA 4BXOA 1T5DX 4XSHA 3MS7A 2GJ8A 4B2LA 1TIBA 2H29A 2R00A 3HVJA 3JWHA 4FFLA 2OBYA 3NAGA 5COAA 5H83A 4FB5A 3I8XA 1ZJWA 5LP6C 5HFNA 1DRWA 2JBAB 1E79A 3SHFA 2WWXA 4KXVA 4BMPB 3I05A 4GMXA 2HSGA 1BCRA 2V03A 4HMPA 4KWIA 1JAZA 4ZK2A 2QY9A 3LCUA 3TZBA 1BIFA 3GU3A 3LOQA 2M6SA 4L5YA 3BCSA 3H0EA 2Y4OA 3NOVA 3USZA 1I24A 3LY5A 5KYNA 4COKA 5TQJA 2JA1A 4OMUA 4Q6BA 4D96A 1WW8A 1U31A 3C6ZA 3C7CB 1XXHA 1RKXA 3NIBA 4K3VA 1NF9A 3UAYA 4O8BA 3T38A 1UBFA 3TCNA 5JQGA 1JXOA 5CD1A 4K0KB 4F9FA 1QVAA 2OUKA 1PZGA 1P3Y1 2DPYA 5JEDA 1P1FA 2FLKA 2YN4A 5MHTA 2UZ4A 3E70C 1HZZA 4G9BA 3LL4A 3BH7A 1E1KA 1X2EA 3VJLA 3ONDA 4PU7A 3F7NA 1XN1A 1W0JD 2G83A 2R1VB 2R66A 3IQXA 3KYDB 3LL7A 5D8DA 3ZE9A 1UT5A 4J49A 4F45A 2DGDA 3LGXA 3TGLA 1Y7YA 4LF6B 4REQB 3T3EA 3OM0A 1NI3A 5CPBA 4LE2A 3DWIA 3K9WA 2TMYA 5C35A 5KSWB 1KA9H 3GLGB 3KS9A 3A9WA 2HZBA 1KS2A 4JODA 5BR1A 1SC6A 2J0SA 4PICA 5KTNA 2DYKA 2MIIA 4GDMA 2FRDC 1C5KA 3GQBA 1KE2A 1X1SA 3W6ZA 3N8DA 4MQFA 4XVUA 4X20B 4C1NA 3G5AA 5CTJA 1WB6A 2FEMA 3MG9A 2CVHA 3ANMA 1AKMA 1UDAA 3OJFA 1L5OA 4WFKA 3WGOA 4G01B 4YCMA 2EJTA 2XSZD 1H23A 1DKNA 3QPCA 1U0HC 1LQ2A 4WFQA 3HC7A 4J7XA 2V3CC 4TN1A 3V8NA 4YBRA 1H8EA 2C94A 3OQJA 4H3SA 4MMXB 4ML3A 1CQXA 4PHFA 3KZ1E 4UMFA 2VN8A 1H69A 2BMDA 2Z0MA 4PPGA 5BP7A 1USUA 3LO5A 1YZLA 2Q3DA 5FA8A 3P2MA 4DXAA 4RHEA 2D0IA 4DGSA 1OFTA 3FNRA 4MXDA 4BLQA 5KPJA 2NZVG 1ZIXA 2AFIB 2AW6A 4GXRA 3D4PA 4B74A 4UFPA 2JI7A 5DCWA 4AX8A 4KXQA 2FMUA 2AJBA 4D25A 4C78A 3EULA 3AGQA 5TMDA 5T6BA 1XZEA 3ZG6A 1XTVA 3GZNB 1QF6A 3AW8A 3JAWA 3BFXA 3G8DA 3GVHA 4FILA 3SEFA 4BN0A 2PVPA 2VQ3A 1DCTA 2BKAA 3D8HA 4I1IA 4IWRA 3NFYA 1VHTA 1AGYA 2Z2XA 2W71A 3CLRD 2VWQA 3K9BA 1J7KA 3DAHA 1SVLA 1DXHA 1V4VA 2VP4A 3OJ0A 1ZVQA 2JAUA 3A6PC 1MJ5A 3G23A 4HSEA 3FYUC 2GWRA 2O2HA 3SM9A 1IYZA 2H0AA 4BU1A 4CODB 2QVCA 3AUFA 4EJMA 5HKAA 4YRDA 3UM9A 4JOQA 2DH6A 2GJKA 2ZW9A 3ASUA 3C3JA 5JCJD 1I6KA 4AZWA 2C61A 1IM2A 1ZUNB 1QLWA 4AJOA 3KDPA 5D00A 5EN4A 4I4NA 1T0JB 5LQNA 1KEUA 1ONPA 1KO7A 2GJSA 2EL7A 2GAFA 3BS4A 3OMWA 2Q99A 4AJHA 4ENSA 5A06A 3LLUA 3QF4A 4OV6B 5LD2B 4XFDA 3DUWA 1SXJD 4R2IA 2QTZA 1YDMA 2VDMB 3D2AA 2RGXA 4NZMA 2ONZA 4UEJA 4IJKA 2D6FA 2AJ8A 5E38A 2B8NA 1SHJA 3QWGA 3EOZA 3B5JA 4HVTA 3VZBA 4DCOA 1W6RA 3K05A 2IELA 3VC1A 4AB1A 4KDEA 1ZINA 1GZ7A 1EFKA 4QIHA 1NMSA 2QXTA 3IUQA 4W5HA 5IC5A 5CFPA 2G1PA 1KI6B 3HZRA 3R4CA 4AY2A 1X92A 3GGCA 3MF4A 1W35A 2MJLA 1PT7A 1TO6A 4DR6B 4HG2A 3TQCA 2XOKA 4UTOA 3GJ3A 3VU1A 5E6RA 3STVA 3I23A 4HEA1 3LP8A 4OHZA 4UM9B 4DYDA 1OXTA 1ZK1A 2CKDA 4JU8A 1QORA 1BG6A 2Q1TA 3BWYA 5KJEA 2RI6A 2P67A 2ZWVA 4MIEA 4HX9A 1EINA 4E15A 5BOSA 3ASYA 3LUHA 4GM4A 3HRHA 4U0KA 2CSUA 2PAAA 3RNLA 3QEOA 5FBVB 3L7JA 4KVGA 5AFSA 1I5OA 5AR1A 1A1SA 1WBJB 2WHPB 3BDAA 3GEMA 4FDLA 3S5UA 1YO6A 1E9VA 4IQ4A 4M6WA 2QQGA 3T7KA 3PQ2A 3HYLA 3K4HA 3PUVA 5J2TF 3PQFA 2PFSA 3ZWXA 2WA2A 4M49A 5TVKA 4ZQIA 4Q05A 3GXBA 1YUBA 3UAVA 1HEIA 1WS6A 1Z18A 1X8LA 1Q92A 1PG5A 1NYLA 2PXPA 1K4MA 1QIDA 4MP8A 5K0EA 4URFA 3Q0TA 4GOLD 2QM0A 2D2IA 1W0CA 2X5XA 1KZ4A 1UZMA 2Q6KA 3TE6A 3U4AA 5J4VA 3ZWMA 4D1YA 4MUMA 2R65A 1QS0A 5AW3A 4CDMA 3IVGA 3FLAA 5FO1A 2Y1OA 1E2KA 2PM8A 1UJCA 5I47A 2XNCA 2QF7A 2FEWB 1XFAA 4CLXA 2BIFA 4KIWA 1JHOA 2FDXA 5A4FS 5AVSA 4G86A 4BVEA 4UTVA 1QOZA 1EAYA 1ZMRA 3KD3A 1ABEA 3KETA 2ZVPX 3EPLA 3QEAZ 3PL1A 4M8KA 4FLMA 4WHMA 4XLLA 1UBEA 2WWYA 2V54A 1E2MA 1QIKA 3FIJA 1XCOA 4I50F 1XC7A 2V7EA 4JC4A 3STHA 1GADO 1BD3A 4Z7QB 3CGGA 2GPBA 1YZGA 4ZVKA 4JUIA 4E4TA 1TAUA 4JLUA 1A95A 5ADUS 1GIAA 3G2QA 3W4KA 5A0VA 1T6YA 3B3AA 4REQA 4P38A 3W0LB 1XD8A 4DSTA 2BSQA 4LDNA 3EUSA 2G6BA 1NW9B 1U04A 4B33A 2SCUB 2OAQ1 1K75A 821PA 4RF2A 2BONA 3CZQA 3OU2A 1IBLB 4LIPD 2QMOA 4V0LA 2VHTA 3IDOA 5BW4A 4MTLA 5JJIA 4TTQA 2NIPA 3K09A 3DDNA 4DV5B 4OXRA 1XQ1A 2N1MA 3PA8A 5ANRB 1GXSA 5HKLA 1BGWA 1GPNA 4ZAXA 4D81A 2ZETA 1YVUA 1UMKA 3WKBA 1EHCA 1FTSA 1G291 3CF0A 3JPWA 2EZ8A 3QTLA 5ALOA 1AJEA 2CUNA 4ZAYA 3EYAA 5H59A 1ZONA 3WK5A 1R0YA 3ZQ4A 2ZU6A 1FNCA 3L4SO 2NTNA 1LF5A 3JV7A 3ND8A 4O6VA 3CVOA 2TYSB 3EWNA 2SECE 4ABYA 2BMEA 2FA9A 4LPKA 1GR0A 4K9SA 4E7PA 1UK9A 2BCJQ 2IQ5A 4F1JA 1ID1A 1ZCAA 3KIPA 3BWXA 2PD4A 4UNQA 4BQSA 3I09A 3OX1A 1VFPA 1DIBA 2Z98A 4OA8A 1NLYA 4RV9A 1T5OA 2ZBVA 3K0FA 4TWZA 1VC2A 1NTRA 3F5DA 4IFIA 5CIWA 5K3FA 5HUQA 5ELLA 1RI3A 2ZUFA 4XOUA 5DM1A 5ES3A 1RXWA 5P8WA 1I5EA 4MW0A 1XIVA 4F2WA 2ATCA 2VJKA 2ZK7A 2V4MA 3E3AA 4KRYA 3KJIA 3KTAB 5HX7A 4HQLA 1PWXA 1OH6A 5FWAA 4ZEXA 4N1AA 3FTFA 3WB2A 7GPBA 2OCLA 3KHTA 1DBIA 4JK3A 1V1JA 3BQ9A 3AUKA 1DFHA 1GZSA 2NACA 3CA8A 1C2TA 1PX0A 1ZBDA 3KR2A 4B8ZA 4BMNA 1JFLA 3DZGA 3O3CA 1P9LA 4LX0A 3TBFA 2COKA 2ZIEA 3TIFA 2O49A 4MRRA 5A9RA 5LOVF 1PL6A 3FYAA 3BB1A 2QPOA 4O4IA 2P5UA 2N75A 1I6MA 1GZ4A 4G37A 1ECFA 4M8LA 4W1RA 1E0JA 1P3JA 4EG3A 4LV5B 3ETHA 4WE3A 2V6GA 3TRHA 3IPLA 3LCRA 3MTGA 5A5GA 2OL4A 3BT7A 1ISHA 4ID3A 4U7JA 3NHJA 2SICE 3DS8A 2DTEA 4OQPA 4BVGA 5K2MA 2YV2A 2OFXA 2E21A 4OJQA 2W2XA 4Z2YA 1NN1A 3E4DA 4NHOA 2EX1A 2FUG6 1H2WA 4PHTA 3SQMA 3T8YA 4E3ZA 1GTSA 4C0SA 1JA9A 1SKBA 4MKHA 1U4OA 3HWX1 1UP4A 1J25A 1I14A 1XALA 2JGJA 1KI6A 2J3HA 3U4QB 1G4AE 5FOQA 4IIJB 4LS3A 1ST2A 4HGNA 4EB6A 1XNJA 2X4GA 3AMVA 5EE1A 1UZUA 2VAVA 3I6YA 2EIHA 2PSFA 4JJIA 1F3OA 3RCBA 4N0EA 2WWHA 3PLNA 4AMYA 4OQXA 1E3WB 4UXIA 1Y7IA 1JQAA 3QHQA 4YS6A 4IVNA 2RI1A 3GRCA 3ICVA 2BZ0A 4OB8A 1BX1A 3ZQ6A 3AV3A 4KYVA 2XJ9A 4DBZA 2XNDA 3LWBA 3KQUA 4CMBA 3ANNA 1YK1A 1SXGA 3HKCA 2WC1A 3V9AA 1AY0A 1VL0A 4HLCA 4LZWA 4N0QA 3ZW8A 1R9MA 1Z17A 5IZCC 3FNQA 3P4UA 1L4GA 3C8MA 1QK3A 2AVDA 2A9FA 2XUQA 1F6DA 2LKDA 1Z6ZA 1J9ZA 2XUFA 3EMVA 3WK4A 3REQB 2JH8A 3AZPA 4O4IB 1WSBA 5AKKA 3BVPA 1R18A 2HFZA 1VCMA 3L49A 4KSYA 2F4VB 2M6LA 2Q6VA 1SZCA 3I28A 1E3DA 3BJMA 4MS1A 4W1SA 4BTLA 3L0BA 1GPKA 3LG2A 4G0WA 4DLSA 5BR8B 2CVQA 4EMTA 4HNAA 2I2BA 3ZYZA 2V7BA 4YI3A 1VMDA 1TJPB 1X7WA 2CLKB 2F43A 2VUIB 1ENZA 2Z5VA 3X43A 1PI3A 1W4RA 1PWEA 1YQQA 3SX0A 1RP1A 3OCXA 1FVOA 3O8NA 5K6AA 1RYMA 2YZNA 3ZXIA 4ZYTA 1XZHA 5DOVA 2UZIR 3M49A 3VDQA 5JNRA 2AYZA 3SR0A 1A8SA 3WIEA 4OXXA 1FJGB 3O3OB 3EVNA 3PFKA 2XUOA 4OXYA 4HQOA 2VRCA 4RVSA 1QH1B 5CK5A 3IO5A 1M2KA 4H17A 3JY6A 2XF2A 1XLTA 2O6HA 3MQ2A 4MQ6A 5DHUA 2QZ9A 2P30A 4R0VA 3BK1A 4QPDA 5JS1A 2JC3A 3ZE7A 2PCJA 3V42A 4KGVA 3DLCA 3D3NA 1SXIA 4RY0A 3WGJA 1AVTA 5LM3A 3HTXA 2B1RA 2PXFA 4B9EA 2N1BA 5HA5A 4QM7A 4ZCLA 4MARA 1D04A 3PGVA 3TI7A 2G1AA 2BUCA 2RHGB 4KITB 2JJQA 3CNQS 3K6RA 5EEHA 5DB4A 1Z7EA 4NJMB 1GKYA 4C0LA 1R6DA 3PB3A 3CO5A 4IKOA 3FNHA 1QVZA 1VPVA 3ZI0A 4H27A 5EPEA 1D2NA 1FVFA 3PQ5A 3S28A 3UXEA 1HLPA 1JVNA 3ESDA 5GONF 4Q1BA 3UY4A 1KI1A 1IM8A 3EIHA 2W6PA 4A2WA 4JBIA 1SXJA 3DC7A 3G49A 4JELA 3NC4A 2BFMA 9MHTA 1Y42X 2X41A 2WHYA 3GX1A 3M1AA 2BFFA 3MELA 5KNCD 1XZKA 5K0GA 3RLFA 5C80A 2Z1DA 1SELA 3H2IA 3QOFA 3FMYA 4Q9AA 5F3DA 3S1LA 1OWPA 4PRZA 4JZKA 3IHWA 5GINE 4A7PA 3TZ6A 3OJCA 4INJA 3Q12A 3DKRA 4LBWA 4UXJA 1U1IA 4G09A 4V38A 2JRLA 521PA 3WISA 3B13B 2C98A 3H8WA 3NHYA 3R0XA 4IO0A 4IICA 4DDVA 2VKTA 2R47A 5FLYA 4CKBA 1GAQA 3LPDA 1NBMD 3QWHA 3WR5A 2QNBA 4PSCA 5AUNB 1PFYA 3EOBI 1P0PA 4TSKA 2IFTA 5EJ9A 1JDVA 1UFOA 1UBKS 2QXYA 4ZWNA 5BSVA 1IG0A 1RAEA 2QWXA 2ZDHA 1F2UB 4JI8B 1E9BA 4F38A 3REQA 2UYQA 3TJZA 2IEGA 4ZTUB 1X1EA 2AG0A 2R751 4IHJF 1G1AA 4KH1A 4YHBA 4ZOAA 5FQNA 4F4JA 4PZUA 1WLSA 3PJRA 4GZ3A 3M81A 4F8EA 3PE5A 5E9AA 1ENOA 2QGFA 4KFUA 4A8TA 1VE9A 2FMFA 4CEHA 4EW2A 2PSDA 4DMGA 5DCLA 1ZM9A 1R15A 2NTYC 2YW2A 4L4YA 4LZLA 3W04A 2VQSA 5THQA 1V3TA 2PUJA 2Z9DA 3ZV4A 3AR8A 1DKQA 2ZTSA 3HB7A 4RV5A 1AO3A 5LLTA 1D6SA 1VLMA 1QRRA 1R27A 2B8JA 2PD6A 3ITKA 1KKMA 3JASA 4TTVA 4LXGA 4M1ZA 3GBSA 4DTIA 4XQ0A 1US8A 2E6UX 2X5JO 4JBLA 1HKHA 4Y1EA 4EHIA 3COSA 1M33A 1TADA 2GN9A 2Q2OA 3HZOA 3WLOA 2KX7A 1QHNA 2E18A 5KMGB 1QRSA 1KZYC 2PWZA 3ME5A 4RHFA 1ZZ8A 1XF1A 2HJRA 3KWJA 3ZBTA 3OFSA 1R9NA 3K0AA 1UBHS 1JG7A 4QDJA 3ODPA 3NC0C 3SLKA 2ANBA 5J43A 4AROA 4WLUA 5JAQA 3RVMA 2F1KA 4JCXA 4FVTA 3MMSA 3NH9A 2O8BB 3DB2A 4PAQA 4Q4AA 1ZQ9A 1ZD4A 4ZAWA 3EZYA 1BX0A 2BPOA 3EZFA 3JQAB 1DAEA 4BEVA 1CBUA 4ZK6A 3SIRA 3SE7A 2CEKA 4KEAA 3NDJA 2Q6LA 3P26A 1SBCA 3WX0A 3BXGA 3LHIA 4OK6A 1P39A 3TQTA 4R3WA 1VBFA 4HWSA 2ZPTX 2REBA 4U3JB 4PLCA 1FOEB 1D4OA 4WK2B 4D9EA 2I4LA 5LDDC 2C2ZA 2IC5A 1ZD5A 3F49S 3SC2A 2Z95A 3QYFA 3CB2A 2DXIA 2PEZA 1DIRA 2ECQA 2XCQA 3T3OA 1QS0B 4QFCA 5TGZA 4ZGWA 3A28A 4HZIA 2PQMA 2G8NA 4TZ0A 1DWUA 3KZVA 1M2EA 3BD6A 2H5EA 3O3NB 4RIIA 4UAJA 4YB8A 5EWMA 1S2NA 1E3OC 3V1NA 4CM4B 5EJEA 3N7TA 2P62A 1KPGA 4MR8B 3NDRA 4EATA 2DHEA 3S68A 4KVFA 3G9UA 4MJ7A 4UE2A 1PRUA 5CH3A 4EA7A 3PEYA 2WYVA 1BJTA 1M76A 2IL1A 2XT6A 4JGGA 2FP4B 4UUNA 2SBTA 2ZT6A 3F7MA 5A3RA 2VZ0A 3ECCA 2OHOA 5EHIA 3TG2A 4LJ5A 3SMVA 4V1CB 3LXUX 5CDSA 1CUZA 1C9JA 4IDFA 1DOAA 1SHTX 2DFPA 4U2KA 3ZIAA 1WZNA 4BFUA 1NASA 3U3JA 2IDZA 4ZI7B 1EWQA 3IMFA 2QS9A 4ZO7A 4BS9A 4F9GA 4YAIA 1ZH8A 1JDNA 1QYXA 2IIBA 4EHJA 1IN8A 3DMHA 4TTPA 3RRFA 3G5TA 4CF4A 2P91A 5IHXA 1MEEA 2CJWB 1WXQA 2OV2A 4O3MA 4MPJA 4G41A 4NEGA 3O82A 4NF2A 3VHQA 4FSDA 2HF7A 5B3LA 3FG9A 2I7VA 5LP6A 3BSWA 5GOTA 1BDIA 3BKWA 3PICA 4HFMA 1GT6A 3TIVA 5AK5A 3HU1A 1KF0A 5CFLA 2A84A 1SA0A 1DU4A 3DHVA 2YJ6A 5IUJC 3T3NA 4OFBA 4I6EA 1M9NA 3KYIB 5E3HA 2GPWA 5CB8A 2QRVB 4MRMB 4PFJA 4G67A 2A9VA 1YB5A 1AOXA 1FLNA 4NY1A 3MWDA 4QARA 3DE1X 4G24A 1BCRB 5I9TA 3M89A 2QMZA 2UZAA 4E1VA 4LQDA 3BMOB 3G79A 4PG6A 1NUUA 4N3NA 2HMSA 2OCPA 2VEOA 4M0MA 1QKJA 3F2VA 4EA8A 3JQ8B 3X2FA 2XI8A 2ZRCA 2W4MA 3NKFA 3MEJA 1GUDA 3VM6A 5BMVB 1WCYA 4HDOB 1L5WA 4D4JA 2P3LA 2IH5A 1XVVA 2SKCA 1RZRA 1T9BA 2D1RA 2L17A 5HEKA 3KSMA 2AFVA 1Z0DA 4TKMA 5JATA 1Q1NA 3CR7A 1GGMA 1HQDA 1B6SA 1F2UA 2IEZA 4GBMA 1X74A 1E1LA 4EA6A 1RAHA 2QM3A 2FOXA 1MTOA 2X5KO 3K53A 2L18A 2YUTA 4RQBA 2XMQA 3KJXA 1M2GA 4DARA 3E53A 4YNBA 2B36A 4ER0A 4QASA 4D5GA 3F46A 2Q4EA 1OXSC 2D1YA 3FI0A 3R5XA 4JB2A 3UOGA 3WYFA 1ZW1A 3JD3A 1R4MA 4LCJA 2H7YA 3ZU5A 1Y8ZA 3DVAB 1TO2E 1EFVB 1X2BA 1C4XA 1DEXA 3IPAA 4R8KA 5C34B 1IY1A 4MPRA 5H4GA 5CJ2A 4BNTA 1W25A 2VG8A 3ES9A 4PLGA 4WOKA 3C2QA 4EJSA 3EVTA 4TTAA 2QL5A 4I6RA 1OCEA 4WFIA 5B3AA 5B55A 3S55A 4U2DA 2B0JA 1JGTA 3WTCA 1G20A 2FFHA 1CW2B 3CWCA 4J4TA 1E6UA 3FYDA 3E2IA 3QF3A 2WLTA 3TX6A 2VHEA 4FGUA 3N6RA 3ZLUA 4ZYZA 4EWLA 3E2MA 3AHDA 1SUPA 5BNFA 1U3DA 1SRQA 5B7GA 2GD1O 5C1BA 4PO9A 2Q1XA 3F4BA 3L6RA 4MV0A 1OY1A 3BMOA 3FDIA 3S44A 3QW4B 4PO8A 4H6PA 1W19A 1L5LA 1W1IA 2O2ZA 3PXBA 5AQ1A 4U39A 3NRBA 4DEXA 3X3HA 1KL7A 3AUXA 2ZS8A 2XBUA 4KYUA 4GHJA 3B1ZA 4M9QA 2UZ3A 3K92A 2BJCA 4PGAA 1F5NA 1NFFA 2AWNA 2WAMA 3JALB 4GICA 1KI7A 2A67A 2KM1A 4V02A 5KYYA 4LRWA 3RREA 1U8UA 3ACBA 2AK3A 2BHRA 4FMDB 3LCCA 3PXGA 1PYOA 4QUBA 1WDWB 2O4CA 2A0XA 2LRHA 4RGBA 4G0MA 4R9NA 5IEBA 1O1YA 2R62A 2X4LA 4NABA 2G4CA 2R5FA 3ZNNA 3ZR4B 3I76A 2REQB 3GDWA 5ECWA 5EMJA 4CCYA 5JXIA 2Z8YA 3GN5B 1HT0A 1SOAA 3KZCA 4IVRA 3GDGA 1BFKA 4BLSA 4H77A 4LVNA 1KIAA 1X7WB 1XRJA 4RU1A 1V5GA 4OUKX 1B1CA 1EHYA 3OCJA 3ON5A 1R5JA 2EQ5A 1PZXA 2E37A 5BN5B 3HBNA 3N87A 4HTAA 4MVJD 2GFHA 2PX4A 1Q95A 4UVDA 3QELA 1DPFA 4RVOA 3HJGA 3BZBA 1EFRD 4FM9A 1SBHA 3ELWA 1T8WA 2HT6A 2VRWA 1GRNA 1F9EA 1FLAA 2ZANA 4Y2UA 4QTYA 1KJQA 1K7CA 2X0KA 4UATA 3AIKA 1FDVA 2BAGA 1JKJB 1TZJA 3L1JA 3TL3A 4BLRA 1HWYA 3LKBA 3OZVA 4OUDB 4BNUA 3IEPA 2WE7A 4TKVB 1HY3A 3KQQA 2P1ZA 4UOQA 4DRXA 4OQEA 2C42A 3VSAA 1LQUA 3U4IA 2F7SA 2AW5A 4H2DA 4Q3NA 3BDIA 1F14A 5CX1A 3VPXA 2AZTA 4FFDA 3BE8A 1DS6A 3ZVLA 3ZHQA 1IPFA 4WDRA 1YRHA 3L46A 2HLDD 2E9SA 4U9HS 5JCZA 2QU7A 2WZBA 4C5BA 1UXDA 4QPZA 3GJ5A 4G63A 4QREA 1CJTC 4DKJA 1CK4A 1VRVA 2HU7A 2ZVDA 5CM2Z 5EZYA 1RWXA 4CG2A 3FLEA 4PRLA 4YN3A 4D6XA 4MMYB 1GG8A 4AZVA 5HQ3B 3Q2IA 4H7FA 4S2UA 5JMPA 4WBNA 2HM7A 2NQ2C 4Y9DA 3ZDBA 3DT6A 1ZOPA 4ZZ0A 4E31A 3A6GA 3O4JA 4JEMA 4P7JA 3ITDA 3VHXA 4CCAA 5HJEA 3I5MA 5A04A 4M8NE 1LY1A 3NPMA 1JU9A 5EHGA 2FWRA 5EKUA 4EFLA 4GX0A 2Z2YA 1JFTA 1DX4A 3H5TA 4F06A 4YUXA 3F6SA 3KOOA 4AKGA 3WGGA 3UG7A 3W2EA 3FOWA 5A5EA 3F96A 1XWFA 3DXYA 2I2WA 2OUIA 4CMKA 2D1FA 3Q6MA 4HDSA 1FJXA 3SJUA 4X4GA 3UUWA 4NYMQ 3UGKA 3AY6A 4WJKB 1GG5A 5JRJA 2GO1A 4Q7JB 3N8GA 4S0ZA 3P8ZA 1DV2A 1O6CA 2X9QA 4B3IA 2OHGA 3GPCA 3QPWA 3L4BC 4L3WA 3W05A 4CM6A 3QW2A 2CXPA 2OV3A 5KVAA 5M34A 2VPTA 1GT0C 4ID9A 4G8CA 4PQFA 3WGMA 2W2QA 4GXNA 2NYAA 4G89A 2WWFA 3ADPA 3AEZA 3AONB 1I2DA 3BA1A 3WBKA 2P6PA 3TMAA 5EJ5A 3A1FA 1JR3E 5E1OA 1L9XA 3TLCA 3VNAA 3HM9A 5DHFA 1NN3A 1Y80A 5EXTA 421PA 4N5MA 2CXXA 2H2FA 1TM3E 2DT5A 3UMRA 2I7TA 3KYCA 3P9SA 1ORRA 4H7EA 4J75A 1YQDA 2QR5A 5G0TA 4F12A 4KQ1A 4DIEA 3WJ2A 3EDOA 1I2BA 5C5EA 2PR2A 1EFDN 2QTMA 2JATA 1PW7A 2IYOA 3QU5A 3T1TA 3Q3EA 4QGHA 1EVQA 1AU9A 1QYDA 3HSYA 4PFQA 4BCBA 3QE4A 3F52A 1JSXA 2CYBA 3UV7A 1S8NA 2XGGA 1KK0A 3QY0A 1KJIA 5FOXA 2IOHA 1LA2A 3CNHA 3ZUPA 2NO4A 1IUPA 2VNAA 4N48A 2OCXA 4RZ2A 3JQDA 5HZGA 2QAGA 1ZPDA 4Q3OA 5AW5A 2HSZA 2LLVA 1QX4A 4Q19A 1Z74A 5LQSA 4JJ8A 2DPGA 1Q57A 2P2LA 1T2EA 4LXUA 3OTQA 4NRDA 4Q1EA 4AJPA 3IMGA 3IR5A 4P4LA 1HBJA 1G8SA 2C2XA 2DTDA 2QBYB 1L7RA 1M6YA 5SZJA 1QDLB 1JG1A 3L0OA 1POXA 3SHWA 2GZ3A 4AYTA 3I9V1 3HEMA 5AI4A 5TT1A 5DH9A 5JNWA 2Y93A 1Q7GA 2WIUB 4IL5A 4RH0A 4WJLA 2AFIA 4UVGA 4ITRC 2PPLA 4MDHA 3GEDA 2DF8A 3AI2A 3ADOA 3OKCA 5EMLA 4CF6A 3IUSA 2BGIA 4R7ZA 1E1DA 1ZD2P 4MWOA 2X9LA 3UWKA 4NS1A 3PNSA 4B71A 5JMTA 1QRUA 3DFMA 1R0KA 3EODA 2NT4A 1WP9A 3EWAA 4ZFNA 2JIPA 4DT1A 4BO4A 4INPA 3CIOA 1KJJA 3ASZA 3DR5A 2JGDA 5FWNA 4TLDA 1UP6A 3F6CA 3DXFA 4NBLA 5A7LA 5EESA 4DSAA 2NMVA 4JP2A 4GPBA 3KKQA 3ADDA 3G2HA 3KQVA 1I3MA 2QMEA 1SZDA 3C1TA 4UUQA 4BP9A 1CY6A 3O6VA 4R7TA 2EC5A 1JWBB 4JGBA 2GYYA 1U3WA 1TRHA 4NFHA 3NI2A 1XQWA 4YC7A 1A8IA 1JEYA 1THTA 1UK8A 1NVWQ 1WV1A 1U99A 2C20A 2NXJA 3IE0A 4D45A 1VDZA 2X3FA 1KBOA 5CX4A 1CQJA 4YCBA 1SKMA 3FYHA 1R37A 4YP1A 2RCNA 5FTMA 1VSQA 4WZAA 3VTKA 1WUIS 3I37X 3QU7A 3GAAA 1L9KA 4XM0A 2IXEA 3HGMA 1A9YA 2XQFA 1MGOA 1ZZ7A 1NAIA 3Q98A 1E66A 3EHDA 4G25A 1JHZA 2NGRA 3V2IA 3WLRA 3PSAA 4YUZA 3C74A 2GO7A 4DQVA 2H17A 4RABA 4QYWA 4WNAA 4PC2A 1NLZA 6YASA 4RHYA 4C30A 2ZZNA 2WTBA 5D6OA 3GR6A 3QVUA 1IK4A 1XJWA