5DT6A

Crystal structure of the drosophila glur1a ligand binding domain complex with glutamate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
GSYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKGTPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Functional Properties of Drosophila CNS Glutamate Receptors.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Membrane protein
molecule keywords Glutamate receptor 1
total genus 88
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dt6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dt6A02
3K0VA 4GL8A 5AA2D 2XXYA 1YAEA 2DWHA 3FV1A 4QFLA 3FJ7A 1JEVA 3VLWA 2GFEA 3DP8A 4IY6A 4GLIA 4KHZE 1BIYA 2IEEA 1Z7NE 4QF9A 4E0XA 2XXHA 2H4IA 5I56B 3IOWA 2G93A 4LATA 2O51A 3OSQA 3JZJA 4U1ZA 5FTIA 3I5OA 4G2ZA 1FQBA 3MZBA 5IKBA 1FCKA 2QS2A 2QS4A 3HSTA 4NF8B 3C34A 5CRYA 2O1LA 5DVJA 2DYXA 1D4NA 1MXXA 3S4UA 3UA8A 3QUJA 5HBCA 2RC8A 2QJEA 3KBRA 4JSDA 1H43A 4DIGA 5CM6A 1B3LA 2Y7PA 4WXJA 1MQGA 2OLBA 4G68B 4JWXA 4R73A 3JV9A 5AA3A 1FTMA 2QPQA 1QULA 1VSOA 1B32A 3PUZE 4FECA 1MH4A 3RQTA 2ESNA 4MBPA 4PFTA 4OFJA 3ODBA 4ZZAA 3PUYE 5A5XB 4MF3A 3RT6B 4WEPA 3MVWA 2ZMBA 2XD3A 3FXQA 2AYSA 3T9XB 5I2NA 3SETA 3QIMA 4JSOA 1N04A 1MG1A 2HAUA 1FW0A 3RUMA 4ESXA 3TTRA 4F1UA 3CVGA 4PFWA 2H99A 1BLFA 1QUKA 3H7MA 4U21A 3G3KA 3KN3A 1L5TA 4BDQA 1MY3A 1M5DA 4F3GA 1Y3PA 5AA2A 5KDTA 4LZ5A 3S9LC 5ISUA 1MH3A 3FVNA 1EZPA 1N7XA 4ZEFA 1B4ZA 2XXVA 3O28A 3FXRA 4F3PA 2Q88A 1SW1A 2ZYKA 3EPEA 3OO7A 1MQIA 4F18A 4FATA 2H9BA 3EF7A 4IGTA 4RK9A 5LOMA 3I6VA 2XXUA 4U22A 1N3XA 4X48A 4C1TA 2OK2A 4H6DA 4ZDMA 2DOJA 3C9HA 2ONSA 1IIWA 2O68A 1MDP1 3PMVA 3O9PA 3KGCA 1B3EA 4I9DA 4WKMA 3U72A 1NKXA 1RYOA 4RXLA 1A7LA 3U93A 1UQWA 5AA2B 3G3IA 2NVUB 2ZNUA 4ISUA 3TTKA 1HSJA 1SW2A 4NF4B 1WVJA 3RTWB 4DXCA 4F29A 1A99A 3KOTA 3QXMA 4O3BA 4WEDA 5H8HA 1R9QA 2D21A 4MLQA 3UK4A 2QS1A 5CBRA 3MP8A 3ZKLA 1HSLA 4IO5A 2I3VA 1B51A 2DE2A 4G68A 5I59A 4ZE8A 4ZEBA 2F97A 2Q89A 3EQ1A 3U8QA 3FUZA 2ZXTA 4HTGA 4OVJA 3WAFA 3U1OA 1D9VA 3IJXB 5CMMA 1FTLA 1LAHE 4ELRA 3FZVA 3N6TA 1NMUA 1MXWA 4BDMA 3IAZA 1IQ7A 3QUFA 3TTMA 1H3DA 4JDFA 4ZECA 1F9BA 5F7VA 4QFNA 1NNFA 1O63A 1IZ1A 3S9MC 2B65A 2Z22A 3ONMA 3TODA 5AE4A 3B6WA 5H8NB 3PD9A 4IY5A 4LQ2A 3TYHA 4YAHX 4F2OA 2DXRA 2V25A 2X26A 5CMBA 4TLLB 4XXUA 2VOZA 1AOVA 1NL5A 3FJGA 4GXAA 1IITA 4AQ4A 4F1YA 2O1MA 1SD3A 2NOOA 4TLMB 2VGQA 3HPIA 3IOTA 2ZYOA 4G8MA 3U94A 1QUIA 1P1QA 4F1VA 1JETA 3FATA 2A5TA 4FEDA 4ND9A 1GVCA 1P1OA 4GWOA 1KWHA 3ZKKA 3O2AA 1ELJA 4OZ9A 3VVEA 3UIFA 2I0CA 3K1PA 1SW5A 2F78A 2I49A 4H8JA 5ITPA 3HO7A 4ELQA 2LAOA 4DDDA 1O64A 4KR5A 3HCQA 4GOTA 4ELPA 5L8DA 1MXYA 4GFRA 4LA9A 5KCJA 5KCJB 1UTBB 4ZS9A 3GXAA 3I3VA 1SI0A 3LSXA 2R9JA 3QSLA 1I69A 1OLAA 2H25A 1WODA 3CFLA 1VFEA 5K2YA 3TTLA 5I58B 4IO7A 5EHMA 4LZ8A 4THIA 3K4UA 1MS7A 3H6VA 1N7WA 1O7TA 2DQVA 3CG3A 3K01A 2GH9A 3H6UA 4YKKA 2O7IA 1NH8A 3N26A 3GBBA 4X1BA 1OVTA 2DVCA 1MY4A 2UVHA 4EQ7A 3M3LA 3FVOA 4EDPA 1PB7A 1B0HA 2PMSA 2RC7A 3SESA 3JYRA 1N84A 3CSBA 4KFQA 4QFPA 2XXTA 3CRBA 4DZ1A 4M1VA 3SEVA 1ZJLA 3S9EA 1YTVA 3QYTA 1Q35A 1FTKA 3C4MA 4EXKA 2QMXA 1EZOA 3MVXA 1CB6A 4RJZA 4OWDA 1A8FA 1UTHB 1SW4A 3E13X 1B1HA 1LFIA 1XVYA 3FXUA 3ILUB 3O66A 3PMXA 4UA8A 3T22A 3PPOA 1B46A 3GZGA 2XXXA 5H8FA 4POXA 5TU0A 3T66A 3IB2A 3DP4A 1B7UA 5K2XA 3K2DA 2O69A 4R9GA 3BKIB 1B58A 4PFYA 5FHOA 1D9YA 3OMBA 4ZEKA 3OEMA 4IO4A 3PU5A 5TP9A 4LQ5A 5I58A 2YLNA 4R2BA 1OMPA 1Y1ZA 3IO6A 4GVOA 3H6TA 3G3JA 3U92A 2Z8DA 5I59B 3MQ9A 3BFTA 3H3GA 4RNSA 1Y4TA 4PP0A 3THIA 1DPPA 1BKAA 1H44A 2ZYNA 3H03A 5H8SA 5HPQA 3T9UA 3FV2A 4OQOA 4P11A 3CR9A 4KI0E 4TQUQ 4DE8A 3C33A 2F35A 1HSEA 1Y4CA 4GXSB 2XXQA 5EHSA 3VE1B 3VXCA 3PV0E 5CBSA 1Y3NA 3PPQA 2I6EA 4KYDA 4F2QA 1JVYA 2DVZA 1US5A 2Y7RA 3C31A 2X7QA 3S2VA 4EQ9A 4OENA 2GHAA 2THIA 5DTBA 3LBSA 3OENA 4ZE9A 1JW5A 1GR2A 1DMBA 2E0SA 3MP1A 1N76A 2AL5A 2PX1A 3LSWA 5I2KA 3FVGA 3VFJA 2RCBA 4H67A 5I57A 4F22A 1Y9UA 3UN6A 4C1UA 3Q28A 4OESA 2ABHA 4FAJA 3DLNA 1EU8A 1SBPA 1VE4A 3IL1B 4JB7A 2AIXA 3TCGA 4OYVA 4N13A 3KN8A 4PFUA 5HM4B 3L6HA 1B6HA 4ZZEA 1TFDA 4DCYA 1S9TA 2ZNTA 4LONB 4OMBA 2W7YA 1PC3A 3IK6B 2PT1A 2NXOA 5JTYA 1VR5A 4R9FA 1JVXA 4OFLA 2A5TB 1QKAA 3Q26A 3TCFA 1UTHA 4EQBA 4PQJA 4KYEA 3T96B 2O6AA 2DP8A 3R6UA 2Y7WA 1SQYA 3LC8A 4X9TA 3VXBA 1TWYA 3ZSFA 1S7YA 1H45A 3A3CA 3F11A 1I6AA 2I58A 3OOAA 4OERA 4AB5A 1PDAA 2OCUA 3C32A 4H1XA 3UP9A 5M2VA 1LBCA 3O97A 4YB6A 4HCWA 3A3UA 1N0TA 4F31B 4HW8A 3S9NC 1DTGA 4L17A 2YJPA 4K3FA 5H8QA 3HHFA 3CIJA 4NWDA 1TFAA 3M3KA 4XKPA 1B5HA 1OLCA 1P1UA 2Y7IA 2FYIA 4O3AA 2H5YA 4U4SA 2QRYA 4IGRA 2XXRA 4P0IA 5I84A 2R71A 4GF8A 2DS9A 2GHBA 3L6GA 1LSTA 3FD3A 3LUYA 3O6GA 3O6HA 1A54A 1NNKA 4OETA 2VP1A 3N5LA 4IO3A 1PB9A 4LVQA 2VHAA 2F34A 2NWJA 2RF1A 4QFKA 4MLVA 2F5XA 1B3FA 4BDLA 4E0WA 2O7UA 4HS7A 2FNCA 2ZNSA 3LR1A 4NE4A 1OIBA 2A5SA 1MXVA 3MZ1A 5JEIA 2HFBA 4IO2A 1LAGE 1R1NA 2PBWA 5H8HB 5H8NA 2P1SA 1LCTA 3TQWA 1IEJA 3KZGA 4NF6B 2NUVA 3CFZA 1NFTA 3QK6A 3BBRA 1B52A 2ANJA 2O84X 3PD8A 3CI8A 5I56A 2PVUA 3RGYA 4F39A 2KLFA 1YCJA 4PE5B 4U23A 3KSJA 3TKDA 5AA1A 2HZLA 1URGA 2PYYA 3IOUA 5A5XA 3BFUA 2XXWA 4YU0A 2UVGA 1SI1A 1VFDA 3MC2A 4YKPA 1Y20A 4JWOA 3PGFA 1MQHA 2HXWA 4F3BA 4UACA 1QVSA 3K6XA 1UIUA 4O3CA 5FTHA 2DSFA 3UORA 4FIMA 4NF5A 3H06B 5L9SA 1JNFA 4H0WA 2UXAA 4R75A 2DWJA 1P1NA 4IB2A 1B5IA 4QHQA 3K6WA 4YKIA 2ALUA 5I57B 1B3GA 3VVDA 2V3UA 1B9JA 1RYXA 4QSDA 2Z8EA 1B7HA 3PUWE 4YZZA 3V8XB 1AIVA 3TEPA 3IR1A 4I1DA 1ATGA 5I2NB 3MPKA 1H76A 2Q2AA 1MQDA 4XKRA 4JBZA 1II5A 3IOVA 3Q27A 4RA1A 4H8IA 4F19A 4R72A 2I0BA 1XT8A 2P2AA 3W15C 1XOCA 3D4GA 1SYHA 4U2RA 3B6TA 3T9HB 3V83A 1B05A 5DYHA 1SDXA 1EH3A 3MPLA 4IO6A 5TPAA 1B3HA 5L9MA 4R74A 3FVKA 4GQOA 4BLAA 3PPNA 5CMKA 3DELB 1NH7A 1URSA 1XC1A 4G8NA 3PPPA 4GL0A 1MRPA 2HEUA 4R6KA 3USDA 4BDNA 1AL3A 4YMBA 1MY2A 1ZKBA 3E9XA 2OWSA 3SEXA 4LZ7A 1LB8A 1QUJA 1MQJA 3GLBA 1ZBMA 3IB0A 3OO8A 1LLSA 4H5GA 1JW1A 2RCAA 3KEIA 1TXFA 3KJTA 3DM0A 3E4RA 1M5CA 4G4PA 3FASA 4RYAA 5DEXB 3SEWA 3TDJA 5ICQA 2DWAA 5H8QB 1Y3QA 3PPRA 1QJMA 5KZTA 1CE2A 3HN0A 2V3TA 1B40A 2OZZA 4OXVA 4NF5B 1IXGA 2FA7A 4XKQA 1POTA 3LSFB 3N94A 1UTBA 3PMWA 4KCDA 3K6VA 3TTNA 1ZU0A 3LSLA 4H5FA 3T93B 3E3KA 1FQEA 3CFXA 2HAVA 1M5EA 5FHMA 4OTEA 3PUVE 4H65A 3MAMA 3MJNA 1GTKA 5JK4A 5DT6A 4N6PA 1MM7A 3IB1A 3TFLA 4X1DA 3UGWA 3IO4A 2QMWA 4Z0IA 1DOTA 3SDFA 1LB9A 5B7DA 4EXLA 4FJPA 1Q1KA 1YPNA 4JWYA 3SERA 1SVXB 2X7PA 4FE8A 1IXCA 2ONKE 1P99A 2Z23A 1D3KA 1MPDA 3C36A 4KCCA 2R6GE 3O29A 4EF1A 2QSXA 4ONYA 5AA4A 1WDNA 3QAXA 2RC9A 3MP6A 4HCYA 3TZAA 1URDA 5B70A 5L9OA 2D5WA 1DPEA 2UYEA 3KN7A 4Q8RA 4PETA 4KD5A 5AA4B 1RKMA 3W9WA 2UYFA 3EN3A 3OO6A 1TT1A 3G3FA 4OHNA 2B3BA 1I6QA 3Q29A 4YB7A 4RY1A 2Q2CA 1MXZA 4XKNA 2VD3A 3PUXE 1FQDA 1NNTA 1FQAA 3A09A 4EF2A 4QRZA 1R6ZA 5CC2A 2V93A 4MH5A 3R26A 4RPNA 1FQCA 1A55A 4TOZA 2XXIA 5FHNA 2UVJA 3H6WA 3ILTB 4R6YA 5BUUA 4Z7EA 1LFGA 1OVBA 2B3FA 3TUSA 3RPWA 4KYSA 3R7XA 3Q25A 1PBPA 4QSCA 2ZYMA 3AXFA 2DE3A 2HQ0A 4G77A 2I4CA 2XD2A 4YICA 4POWA 5ELVA 3TELA 4ELOA 1XS5A 1J1NA 1I6BA 4R6HA 5I2KB 5ITOA 3VV5A 1M5BA 4FEBA 3OXNA 3KOSA 3RT8A 2XX9A 1ZTYA 2CZLA 1LGBC 2M8CA 2XX7A 4I8CA 1BP5A 3V5AA 4U1OA 2D3IA 4AB6A 4Q5TA 1PB8A 1FQFA 1Z7ME 5EYFA 3VVFA 4P0GA 4DXBA 1OQGA 4QSEA 2PT2A 3EHUA 1USYH 3K6UA 2H98A 4M4GA 4OFOA 1MY0A 1JQFA 3C35A 4RPOA 3MVZA 3K02A 1IXHA 1USYE 3HV1A 4I62A 4NMYA 4OEVA 4XTCQ 1MPBA 3RNNA 1GGGA 1FTJA 4BDRA 3MBPA 5TP9B 2V3QA 3B7DA 3KG2A 3SEUA 4YMAA 4NF4A 1JEUA 2E1SA 1B0LA 1OQHA 3KFMA 3N6UA 1B7ZA 4G8HA 4NF8A 4R2FA 1P1WA 4U4XA 3TPAA 3VLVA 1AH5A 1ZLQA 3WAEA 3G7WA 2F7AA 3MUQA 2RINA 1POY1 4RK2A 1N3WA 5H8FB 4DXUA 1IUDA 3OSRA 2I4BA 2IA4A 1B4HA 2DE4A 3DP6A 3K00A 3O6IA 1ANFA 3B6QA 4GIZA 4GRKA 1T0KA 3M8UA 4GD5A 3MZ9A 2F36A 4NEDA 3RY3A 1M5FA 3SKPA 5IAIA 1B5JA 3FGSA 4ESWA 5BWJA 1A8EA 2QS3A 1JW4A 3HHGA 4NWCA 1MXUA 1QKBA 5F1QA 5DEXA 5ICTA 4DLDA 3V89B 4ZEDA 3P7IA 1LFHA 2G29A 3RLFE 3TCHA 3G3GA 4G68C 2HZKA 1DTZA 2DWIA 1GV8A 3RTFB 3TQLA 5CMCA 1IXIA 3FJMA 1PEBA 4LP2B 3EHTA 2YPNA 2WKYA 1QW0A 3IORA 2ONRA 2REJA 3TMGA 4KQPA 2Z8FA 4EUOA 1FTOA 1S50A 3FIRA 5DVIA 2OJTA 2RKMA 4BDOA 1R9LA 3KJ7A 1SYIA 1BTJA 4Q0CA 1LAFE 5KDTB 2XX8A 2Y7KA 2F6GA 2OBGA 3MW0A 2REGA 3M3FA 2F7BA 3W9VA 2I3WA 3GBAA 5CI5A 4ZEIA 2V84A 2QL3A 2BJJX 2XXPA 5J1DA 5DVFA 2HCAA 3G3HA 2Y84A 1AMFA 3ECRA 4F3SA 2VD2A 2F8DA 3MWBA 3MVYA 5JTYB 3D4CA 1MY1A 4C0RA 2AL4A 4FORA 3H4ZA 4ECFA 2F7CA 1XVXA 2UVIA 1MM6A 3OEKA 3K1MA 3CG1A 3IX1A 2DXYA 1Y1MA 1MPCA 3VDFA 3OO9A 3T9VA 3TAJA 2F6PA 4N07A 1NNPA 1ZMGA 2XHDA 4KPTA 4Q30B 4DCXA 1ZIUA 2Q9TA 1LAXA 1PBQA 3K1NA 3KSXA 3EHSA 4LUBA 4YKJA 4NTLA 4MFIA 4YB5A 1XHYA 4JXIA 4XIGQ 3OD7A 3SEYA 1B2HA 2P0SA 3ZS6A 4NF6A 4QFOA 3VLUA 1MDQA 2I48A 3RN8A 2CMOA 3OELA 1B1XA 1UIVA 2Q8JA 2GRVA 1LCFA 3IJOB 1US4A 1A40A 4OEUA 1DSNA 1LBBA 1EZ9A 3CSGA 2OWTA 5TPAB
chains in the Genus database with same CATH superfamily
3K0VA 4HE1A 2XXYA 3FJ7A 3MYUA 1BIYA 1Z7NE 2H4IA 3IOWA 2G93A 4U1ZA 3HSTA 2O1LA 2QJEA 4DIGA 2Y7PA 5T3JA 3PUZE 3RQTA 1B32A 4ZZAA 4NAPA 4OFJA 3PUYE 5A5XB 3RT6B 5I2NA 3T9XB 4JSOA 4ESXA 1FW0A 4PFWA 3G3KA 4BDQA 5ISUA 1MY3A 1M5DA 1MH3A 1EZPA 1RDZA 1B4ZA 3O28A 3FXRA 2ZYKA 1MQIA 2H9BA 4IGTA 4ZDMA 3S9NC 3C9HA 4I9DA 3PMVA 3U72A 3O9PA 3KGCA 1B3EA 4RXLA 3U93A 3TTKA 1SW2A 4NF4B 4AS4A 3UK4A 3MP8A 3ZKLA 2I3VA 4ZE8A 4ZEBA 4N17A 4HTGA 3WAFA 1D9VA 4PCDA 1NMUA 4ZECA 4JDFA 1NNFA 2B65A 3B6WA 2CZIA 4XXUA 1IITA 5LTCA 4TLMB 2VGQA 1LBZA 3HPIA 3U94A 1GVCA 3ZKKA 1KWHA 1ELJA 2I0CA 2F78A 2I49A 5ITPA 4P47A 1O64A 3HCQA 5L8DA 5KCJA 3B50A 3I3VA 1SI0A 3QSLA 3KC1A 4PBQA 1SPIA 5I58B 1YXIA 4X04A 2DQVA 2GH9A 2O7IA 2UVHA 1B0HA 2PMSA 2RC7A 4M1VA 3SEVA 1YTVA 3C4MA 3MVXA 3ILUB 4MNIA 1B1HA 3T22A 4OVQA 5K2XA 4X8RA 3OEMA 1OMPA 3U92A 3IO6A 3H6TA 3G3JA 5I59B 2P3VA 3BFTA 3H3GA 4RNSA 3THIA 2ZYNA 3H03A 4TQUQ 4P11A 3CR9A 3VE1B 1HSEA 4GXSB 2I6EA 3C31A 3S2VA 3LBSA 4ZE9A 2E0SA 1N76A 2PX1A 3LSWA 5EQ8A 5I2KA 3VFJA 2RCBA 4H67A 4LN5A 4PFBA 3DLNA 4JB7A 1FBPA 4PFRA 3TCGA 4OYVA 5IZ3B 5HM4B 2ZNTA 4OMBA 4P8BA 2PT1A 2A5TB 4PQJA 3T96B 2O6AA 3VXBA 3LC8A 1H45A 4OERA 1PDAA 2OCUA 5M2VA 1LBCA 4PDHA 1N0TA 5H8QA 5TU0A 2YJPA 2Y7IA 3HFUA 1LSTA 4IO3A 5ET8A 4LVQA 2VHAA 2F34A 3E78A 4MLVA 2F5XA 4BDLA 3LR1A 2HFBA 1LAGE 1R1NA 2PBWA 4EQBA 2P1SA 1IEJA 2NUVA 1NFTA 2ANJA 3PD8A 2O84X 1NV6A 4F39A 1YCJA 4PE5B 4U23A 2HZLA 2Y5LA 2UVGA 4UACA 1QVSA 5I7IA 4O3CA 5L9SA 4H0WA 2DWJA 4DI4B 4N91A 2V3UA 2Z8EA 3PUWE 4XKRA 1DBZA 1II5A 3IOVA 1FPBA 1SYHA 2FBPA 4PTKA 4U2RA 3T9HB 3V83A 1B05A 4BLAA 4IO6A 5CMKA 1MRPA 1ZKBA 4NQ8A 3IB0A 5EYHA 4H5GA 1LLSA 4HE2A 2RCAA 2HXRA 1TXFA 3E4RA 4PAKA 1M5CA 4RYAA 3TDJA 2VPNA 5LOMA 4NF5B 4XKQA 4YMBA 3TTNA 4H5FA 3T93B 3CFXA 4MX6A 4OTEA 4H65A 5JK4A 3MJNA 5F24A 3IB1A 5B7DA 2QMWA 1DOTA 2QFLA 2X7PA 1IXCA 2ONKE 3O29A 4ONYA 3MP6A 4HCYA 5B70A 1URDA 1DPEA 2UYEA 3KN7A 4Q8RA 5A5LA 4PETA 4N15A 3Q29A 2FIXA 2VD3A 4GWUA 1FQDA 2R8TA 4JVDA 1XI6A 1A55A 4GX3A 4TOZA 2UVJA 3H6WA 1KA0A 2KQZA 5ET7A 1OVBA 3TUSA 1PBPA 4EQ7A 4OVRA 4YICA 5ELVA 5I2KB 4FEBA 2CZLA 2XX7A 2D3IA 4OVPA 4P0GA 1OQGA 2PT2A 3K6UA 4OFOA 1MY0A 1JQFA 3MVZA 3K02A 1IXHA 3HV1A 4OEVA 1GGGA 1FTJA 3MBPA 4OHNA 4NF4A 4R2FA 1B0LA 3N6UA 4G8HA 4QBAA 4U4XA 3IFAA 1POY1 4GBVA 3NOHA 3M8UA 4H46A 5BWJA 5DEXA 4DLDA 5LDZA 1VDWA 2DWIA 1GV8A 3RTFB 1IXIA 1PEBA 1QW0A 5EQ7A 2ONRA 2REJA 2Z8FA 4EUOA 2OJTA 2RKMA 4BDOA 1IMFA 2Y7KA 2F6GA 2OBGA 3GBAA 4ZEIA 1FPEA 2V84A 2XXPA 2Y84A 3ECRA 4F3SA 3MWBA 4C0RA 1MPCA 3OO9A 3T9VA 2F6PA 1NV4A 1ZMGA 4I3YA 2Q9TA 4LUBA 3EHSA 3ZS6A 1FPGA 2FVZA 4NF6A 3VLUA 4NF0A 3RN8A 2Q74A 2Q8JA 2GRVA 1A40A 4OEUA 1DSNA 4GWYA 5AA2D 4GWZA 2Q8MA 1JEVA 3BIGA 3DP8A 4KHZE 4XEQA 2XXHA 4LATA 2O51A 5I3SA 5IKBA 4NF8B 2QS2A 2QS4A 3S4UA 3UA8A 3QUJA 5HBCA 2XWOA 5CM6A 1B3LA 4WXJA 1MQGA 2OLBA 4JWXA 2QPQA 1MH4A 4GWSA 2ESNA 4PFTA 3ODBA 3FXQA 3SETA 3QIMA 1MG1A 4F1UA 4U21A 1QUKA 1Y3PA 5KDTA 3S9LC 4LZ5A 4OANA 1EYJA 3FVNA 4ZEFA 2XXVA 4F3PA 4RK9A 4C1TA 4H6DA 5I56B 5AA2B 3G3IA 2ZNUA 3RTWB 4WEDA 5H8HA 1R9QA 1B51A 2DE2A 2Q89A 3U8QA 4OVJA 3IJXB 1LAHE 3IAZA 2WEFA 3TTMA 1H3DA 5F7VA 3KBZA 3ONMA 3TODA 4IY5A 4YAHX 4F2OA 2DXRA 2X26A 5CMBA 2VOZA 1NL5A 3FJGA 4AQ4A 2O1MA 2NOOA 3SZPA 1QUIA 1IMBA 2FHYA 4ELQA 2LAOA 4GOTA 1NUZA 1UTBB 3EKIA 1WODA 3CFLA 5EHMA 4LZ8A 4THIA 1NUXA 1N7WA 3V89B 2XXKA 3N26A 3GBBA 1OVTA 3FVOA 2OX3A 1N84A 1ZJLA 1FTKA 2QMXA 1CB6A 4OWDA 2VPOA 4ND9A 3O66A 3PMXA 1XVYA 3PPOA 2XXXA 4POXA 3BKIB 3OMBA 1Y1ZA 2Z8DA 1Y4TA 1BKAA 3LUZA 4OQOA 5CBSA 1Y4CA 3PV0E 1Y3NA 2MKZA 4EQ9A 5DTBA 1JW5A 1GR2A 4OESA 2DDKA 3KN8A 1S9TA 4LONB 3RYDA 2NXOA 5JTYA 1VR5A 3Q26A 1TWYA 1S7YA 3F11A 3OOAA 4AB5A 3O97A 4F31B 4HW8A 1DTGA 4L17A 4K3FA 3CIJA 1TFAA 3M3KA 2FYIA 2QRYA 4P0IA 2R71A 3UORA 3LUYA 3FD3A 4OETA 4GWWA 1PB9A 2O7UA 3D1RA 2ZNSA 4NE4A 1OIBA 2P3NA 4IO2A 3W15C 4NF6B 3CFZA 4N6DA 2PVUA 3KSJA 3IOUA 2XXWA 1FBCA 3MC2A 1FRPA 4F3BA 1MQHA 2HXWA 1FPJA 1UIUA 4FIMA 3H06B 1JNFA 2UXAA 4P3LA 4QHQA 5I57B 2ALUA 3VVDA 1B9JA 1RYXA 3V8XB 1B7HA 1LBWA 4MNCA 1ATGA 1H76A 4RA1A 4H8IA 5DYHA 1SDXA 3ISPA 1B3HA 4GQOA 3DELB 1NH7A 3USDA 2HEUA 3E9XA 3T1BA 5EQ9A 3OO8A 1FPFA 3KEIA 3DM0A 3FASA 5DEXB 3SEWA 4O8MA 5H8QB 3UN6A 1IXGA 3N94A 3PMWA 1UTBA 4KCDA 3K6VA 5FHMA 3PUVE 5IZ1A 5ICQA 3SDFA 1Q1KA 4JWYA 1SVXB 2Z23A 3C36A 5AA4A 3TZAA 2HHMA 4O7IA 3W9WA 2UYFA 3EN3A 3G3FA 4N8YA 1NUWA 4UABA 4XKNA 3A09A 4EF2A 4QRZA 4MH5A 4NX1A 4RPNA 3ILTB 1LFGA 2B3FA 3RPWA 4KYSA 1FPKA 3AXFA 2DE3A 4ELOA 2XD2A 3TELA 4POWA 1XS5A 1J1NA 3RT8A 1YZ0A 4U1OA 3VVFA 4RPOA 4XTCQ 1MPBA 3RNNA 2V3QA 2E1SA 3LV0A 1OQHA 4NF8A 1P1WA 1AH5A 3G7WA 2F7AA 4RK2A 5H8FB 4N81A 2I4BA 2DE4A 3DP6A 3K00A 1T0KA 2F36A 3RY3A 1M5FA 3SKPA 3FGSA 4ESWA 1A8EA 3HHGA 1QKBA 1FSAA 3TCHA 1LBYA 3TQLA 5CMCA 2JJKA 3FJMA 3TMGA 1FTOA 3KJ7A 2PFZA 1SYIA 4I3EA 5J1DA 2AL4A 2F7CA 3IX1A 1Y1MA 1JP4A 1G0HA 1NNPA 4DCXA 1LAXA 1PBQA 4YKJA 2CEXA 4YB5A 4XIGQ 2CZHA 3OD7A 4OVTA 2CMOA 3OELA 1LBBA 1EZ9A 2OWTA 4GL8A 1YAEA 3FV1A 4IY6A 4GLIA 4MHFA 3OSQA 4G2ZA 1FQBA 1EYKA 5CRYA 3C34A 1DCUA 1MXXA 4JSDA 1H43A 4G68B 1QULA 1VSOA 4FECA 1QGXA 4MF3A 4WEPA 3MVWA 1N04A 2HAUA 2WX9A 3RUMA 1NV2A 3TTRA 3CVGA 2H99A 1BLFA 3H7MA 1L5TA 4F18A 3KN3A 2OWZA 2Q88A 1SW1A 4FATA 4NG7A 4PGNA 1FBHA 4X48A 2DOJA 1IIWA 2XWKA 1RYOA 1UQWA 1HSJA 1WVJA 1BK4A 1A99A 3KOTA 3QXMA 4O3BA 4MLQA 3GYYA 5CBRA 1IMCA 1HSLA 3RPLA 4G68A 4PAIA 5I59A 2F97A 2ZXTA 3U1OA 5CMMA 3CHGA 1FTLA 4ELRA 5EQAA 1IQ7A 1O63A 1IZ1A 3S9MC 2Z22A 5H8NB 3PD9A 3TYHA 2V25A 3B8BA 4TLLB 4N4UA 1SD3A 4F1VA 1JETA 4FEDA 1AWBA 4GWOA 4OZ9A 3VVEA 3UIFA 4NHBA 3K1PA 3HO7A 4DDDA 4P9KA 4GFRA 4LA9A 5KCJB 4MIJA 3GXAA 3LSXA 3TTLA 5K2YA 2H25A 2L5VA 1VFEA 5DVIA 3H6VA 3K01A 3CG3A 4YKKA 3H6UA 4X1BA 2DVCA 1MY4A 3SESA 4QFPA 3S9EA 3QYTA 1Q35A 1EZOA 1IMAA 1A8FA 1NV7A 1UTHB 1SW4A 3E13X 3FXUA 5IZZA 1G0IA 3IB2A 5FHOA 2O69A 4R9GA 4ZEKA 1D9YA 4IO4A 3PU5A 4PGPA 5TP9A 2YLNA 4R2BA 1NV3A 1IMEA 5HPQA 5H8SA 3FV2A 2VT5A 4KI0E 4DE8A 2XXQA 2HPGA 4I40A 4GX4A 2DVZA 2Y7RA 4OENA 2GHAA 2AL5A 1FPIA 3FVGA 2XWVA 4F22A 2V4CA 2ABHA 3IL1B 2AIXA 2B4LA 4PFUA 3L6HA 1B6HA 4DCYA 1TFDA 1EYIA 3IK6B 1FBDA 1JVXA 3TCFA 4GWXA 4KYEA 3R6UA 2Y7WA 3ZSFA 3A3CA 5ET6A 2I58A 5FBPA 4YB6A 4HCWA 3A3UA 5J16A 4NWDA 4XKPA 1OLCA 1P1UA 4O3AA 4U4SA 2WBDA 2XXRA 4IGRA 2DS9A 3O6GA 4XFEA 1NNKA 3N5LA 5IZ3A 1FBGA 2NWJA 2RF1A 4E0WA 2FNCA 2A5SA 1MXVA 4ELPA 5H8HB 1LCTA 3KZGA 4XF5A 5I56A 3TKDA 5AA1A 4P1EA 3BFUA 3PTYA 1VFDA 4YKPA 1Y20A 3FXBA 5FTHA 2DSFA 2BJIA 1P1NA 3K6WA 1B3GA 3IR1A 3MPKA 2ZZVA 4JBZA 3Q27A 4F19A 4R72A 2I0BA 1XT8A 1XOCA 3B6TA 1EH3A 3MPLA 4R74A 3FVKA 4R6KA 4G8NA 1URSA 1XC1A 3U65A 4LZ7A 4AS5A 1LB8A 1ZBMA 4P1LA 1JW1A 2DWAA 1Y3QA 1QJMA 4MJOA 5KZTA 1CE2A 3HN0A 2V3TA 1B40A 4OXVA 3ROJA 1POTA 3LSFB 3LSLA 3E3KA 1M5EA 3MAMA 1GTKA 5DT6A 4N6PA 1MM7A 3TFLA 3UGWA 3IO4A 4Z0IA 4EXLA 4FE8A 4KCCA 2R6GE 4EF1A 2QSXA 3QAXA 4JVCA 5L9OA 5IGAA 4KD5A 5AA4B 3OO6A 1TT1A 2B3BA 2Q2CA 1MXZA 3PUXE 1FQAA 1R6ZA 5CC2A 2V93A 2XXIA 5FHNA 4R6YA 1DK4A 4N6KA 4MEVA 4QSCA 4G77A 4NN3A 4R6HA 5ITOA 3OXNA 3KOSA 4PDDA 1ZTYA 1LGBC 1KZ8A 5ESYA 1BP5A 3V5AA 4AB6A 4OA4A 1FJ9A 4QSEA 1USYH 2H98A 4M4GA 1LBVA 4I62A 1USYE 1LBXA 5TP9B 3KG2A 1JEUA 1B7ZA 3TPAA 1ZLQA 3MUQA 2PCRA 3OSRA 4GX6A 4MNPA 1ANFA 4GIZA 2B4MA 3MZ9A 5IAIA 1FTAA 2QS3A 1MXUA 1NV0A 3P7IA 3RLFE 3G3GA 4G68C 2HZKA 1DTZA 3EHTA 4KQPA 3FIRA 4Q0CA 1BTJA 1LAFE 5KDTB 2F3BA 1CNQA 1KA1A 2XX8A 3MW0A 4P56A 3M3FA 2F7BA 2QL3A 2BJJX 5DVFA 1AMFA 2F8DA 3MVYA 2UVIA 1MM6A 5IM2A 3VDFA 4OVSA 2PFYA 2WYPA 2XHDA 4Q30B 1ZIUA 4EDPA 3KSXA 4MFIA 1D9QA 4O94A 1B2HA 2P0SA 4QFOA 1MDQA 2I48A 1LCFA 1US4A 2DWHA 4QFLA 3VLWA 2GFEA 2IEEA 4QF9A 4E0XA 3JZJA 5FTIA 3I5OA 3MZBA 1FCKA 4QXDA 5DVJA 2DYXA 1D4NA 4JVIA 2RC8A 3KBRA 4KXPA 4R73A 3JV9A 5AA3A 1FTMA 4MBPA 2ZMBA 2XD3A 2AYSA 4F3GA 1N7XA 1IMDA 3EPEA 3OO7A 3EF7A 3FBPA 3I6VA 2XXUA 4U22A 1N3XA 2OK2A 2ONSA 2O68A 1MDP1 4WKMA 3UP9A 1NKXA 1A7LA 3BIHA 2NVUB 4ISUA 4F29A 4DXCA 2D21A 2QS1A 4IO5A 4PE3A 5EYGA 3EQ1A 3FUZA 3FZVA 3N6TA 1MXWA 4BDMA 3QUFA 1F9BA 4QFNA 4PBHA 5AE4A 5ET5A 4LQ2A 5I5PA 1AOVA 4GXAA 4F1YA 2XA5A 3IOTA 2ZYOA 4G8MA 1P1QA 3FATA 2A5TA 1P1OA 3O2AA 1SW5A 4H8JA 4KR5A 1MXYA 4ZS9A 2R9JA 4G61A 1I69A 1OLAA 1NV5A 4IO7A 3K4UA 1MS7A 1O7TA 1NH8A 1RDYA 3M3LA 1PB7A 3JYRA 4KFQA 3CSBA 2XXTA 3CRBA 4DZ1A 4EXKA 4RJZA 1LFIA 4UA8A 2CEYA 1B46A 3GZGA 5H8FA 3T66A 3DP4A 1B7UA 4PC9A 3K2DA 1B58A 4PFYA 3E79A 4LQ5A 5I58A 1NI9A 4GVOA 2QVUA 3MQ9A 4PP0A 1YYZA 1DPPA 1H44A 3T9UA 3C33A 2F35A 3VXCA 5EHSA 4PAFA 3PPQA 4KYDA 4F2QA 1JVYA 1US5A 2X7QA 2THIA 1FBFA 3OENA 1DMBA 3MP1A 5I57A 1Y9UA 4C1UA 3Q28A 3QMFA 4FAJA 1EU8A 1SBPA 1VE4A 4MMPA 4N13A 2WYKA 4MCOA 4ZZEA 4DI3D 2W7YA 1PC3A 4R9FA 4OFLA 1QKAA 1UTHA 2QVVA 4PF6A 3T0JA 2DP8A 4X9TA 1SQYA 4NGUA 3KC0A 1I6AA 3C32A 4H1XA 1K9ZA 4PFIA 3HHFA 1B5HA 2H5YA 4O7MA 5I84A 4GF8A 2GHBA 3L6GA 3O6HA 1A54A 4FBPA 2VP1A 2WBBA 4QFKA 1B3FA 2ZZXA 4HS7A 1FBEA 3MZ1A 5H8NA 3TQWA 2QVRA 3QK6A 1INPA 3BBRA 1B52A 3CI8A 3RGYA 2KLFA 2XWIA 1URGA 2PYYA 5A5XA 4YU0A 1SI1A 4JWOA 1NUYA 3PGFA 3K6XA 4NF5A 5DW8A 4R75A 4YKIA 4IB2A 1B5IA 4QSDA 1AIVA 4YZZA 3TEPA 4I1DA 5I2NB 2Q2AA 1MQDA 2GQ1A 2P2AA 3D4GA 1NV1A 5TPAA 5L9MA 3MSTA 3PPNA 4BDNA 3PPPA 4GL0A 1AL3A 1MY2A 3SEXA 2OWSA 1FPDA 1QUJA 1MQJA 3GLBA 3KJTA 4G4PA 3PPRA 2OZZA 2FA7A 2KR0A 1ZU0A 1FQEA 2HAVA 4X1DA 2Y5KA 1LB9A 4FJPA 1YPNA 3SERA 1P99A 1D3KA 1MPDA 1RDXA 1WDNA 2RC9A 1LEVA 2D5WA 2ZZWA 4N8GA 1RKMA 1FJ6A 4GBWA 1I6QA 4YB7A 1K9YA 4RY1A 1NNTA 3A29A 3R26A 1FQCA 5BUUA 4Z7EA 2FIEA 3R7XA 3Q25A 2ZYMA 5JEIA 2HQ0A 2I4CA 3VV5A 1I6BA 1M5BA 4H45A 2XX9A 2M8CA 4I8CA 4Q5TA 1PB8A 1FQFA 1Z7ME 5EYFA 4DXBA 3EHUA 3C35A 4NMYA 4BDRA 3B7DA 3SEUA 4YMAA 3KFMA 3WAEA 5AA2A 4PF8A 3VLVA 2RINA 4HE0A 3IFCA 1N3WA 4DXUA 1IUDA 2IA4A 1B4HA 3O6IA 3B6QA 4GRKA 4GD5A 4NEDA 1B5JA 1JW4A 4NWCA 5F1QA 1Q9DA 5ICTA 4ZEDA 1LFHA 2G29A 1FPLA 4LP2B 2YPNA 2WKYA 3IORA 1S50A 4HXVA 1R9LA 2CZKA 2REGA 3W9VA 2I3WA 5CI5A 4MAGA 2HCAA 3G3HA 2VD2A 5JTYB 3D4CA 1MY1A 4FORA 3H4ZA 4ECFA 1XVXA 3OEKA 4IR8A 3K1MA 3CG1A 2DXYA 3TAJA 3RPLB 4N07A 4KPTA 3K1NA 4NTLA 1XHYA 4JXIA 3SEYA 2F3DA 1B1XA 1UIVA 3IJOB 3CSGA 5TPAB
chains in the Genus database with same CATH topology
3K0VA 4GL8A 5AA2D 2XXYA 1YAEA 2DWHA 3FV1A 4QFLA 3FJ7A 1JEVA 3VLWA 2GFEA 3DP8A 4IY6A 4GLIA 4KHZE 1BIYA 2IEEA 1Z7NE 4QF9A 4E0XA 2XXHA 2H4IA 5I56B 3IOWA 2G93A 4LATA 2O51A 3OSQA 3JZJA 4U1ZA 5FTIA 3I5OA 4G2ZA 1FQBA 3MZBA 5IKBA 1FCKA 2QS2A 2QS4A 3HSTA 4NF8B 3C34A 5CRYA 2O1LA 5DVJA 2DYXA 1D4NA 1MXXA 3S4UA 3UA8A 3QUJA 5HBCA 2RC8A 2QJEA 3KBRA 4JSDA 1H43A 4DIGA 5CM6A 1B3LA 2Y7PA 4WXJA 1MQGA 2OLBA 4G68B 4JWXA 4R73A 3JV9A 5AA3A 1FTMA 2QPQA 1QULA 1VSOA 1B32A 3PUZE 4FECA 1MH4A 3RQTA 2ESNA 4MBPA 4PFTA 4OFJA 3ODBA 4ZZAA 3PUYE 5A5XB 4MF3A 3RT6B 4WEPA 3MVWA 2ZMBA 2XD3A 3FXQA 2AYSA 3T9XB 5I2NA 3SETA 3QIMA 4JSOA 1N04A 1MG1A 2HAUA 1FW0A 3RUMA 4ESXA 3TTRA 4F1UA 3CVGA 4PFWA 2H99A 1BLFA 1QUKA 3H7MA 4U21A 3G3KA 3KN3A 1L5TA 4BDQA 1MY3A 1M5DA 4F3GA 1Y3PA 5AA2A 5KDTA 4LZ5A 3S9LC 5ISUA 1MH3A 3FVNA 1EZPA 1N7XA 4ZEFA 1B4ZA 2XXVA 3O28A 3FXRA 4F3PA 2Q88A 1SW1A 2ZYKA 3EPEA 3OO7A 1MQIA 4F18A 4FATA 2H9BA 3EF7A 4IGTA 4RK9A 5LOMA 3I6VA 2XXUA 4U22A 1N3XA 4X48A 4C1TA 2OK2A 4H6DA 4ZDMA 2DOJA 3C9HA 2ONSA 1IIWA 2O68A 1MDP1 3PMVA 3O9PA 3KGCA 1B3EA 4I9DA 4WKMA 3U72A 1NKXA 1RYOA 4RXLA 1A7LA 3U93A 1UQWA 5AA2B 3G3IA 2NVUB 2ZNUA 4ISUA 3TTKA 1HSJA 1SW2A 4NF4B 1WVJA 3RTWB 4DXCA 4F29A 1A99A 3KOTA 3QXMA 4O3BA 4WEDA 5H8HA 1R9QA 2D21A 4MLQA 3UK4A 2QS1A 5CBRA 3MP8A 3ZKLA 1HSLA 4IO5A 2I3VA 1B51A 2DE2A 4G68A 5I59A 4ZE8A 4ZEBA 2F97A 2Q89A 3EQ1A 3U8QA 3FUZA 2ZXTA 4HTGA 4OVJA 3WAFA 3U1OA 1D9VA 3IJXB 5CMMA 1FTLA 1LAHE 4ELRA 3FZVA 3N6TA 1NMUA 1MXWA 4BDMA 3IAZA 1IQ7A 3QUFA 3TTMA 1H3DA 4JDFA 4ZECA 1F9BA 5F7VA 4QFNA 1NNFA 1O63A 1IZ1A 3S9MC 2B65A 2Z22A 3ONMA 3TODA 5AE4A 3B6WA 5H8NB 3PD9A 4IY5A 4LQ2A 3TYHA 4YAHX 4F2OA 2DXRA 2V25A 2X26A 5CMBA 4TLLB 4XXUA 2VOZA 1AOVA 1NL5A 3FJGA 4GXAA 1IITA 4AQ4A 4F1YA 2O1MA 1SD3A 2NOOA 4TLMB 2VGQA 3HPIA 3IOTA 2ZYOA 4G8MA 3U94A 1QUIA 1P1QA 4F1VA 1JETA 3FATA 2A5TA 4FEDA 4ND9A 1GVCA 1P1OA 4GWOA 1KWHA 3ZKKA 3O2AA 1ELJA 4OZ9A 3VVEA 3UIFA 2I0CA 3K1PA 1SW5A 2F78A 2I49A 4H8JA 5ITPA 3HO7A 4ELQA 2LAOA 4DDDA 1O64A 4KR5A 3HCQA 4GOTA 4ELPA 5L8DA 1MXYA 4GFRA 4LA9A 5KCJA 5KCJB 1UTBB 4ZS9A 3GXAA 3I3VA 1SI0A 3LSXA 2R9JA 3QSLA 1I69A 1OLAA 2H25A 1WODA 3CFLA 1VFEA 5K2YA 3TTLA 5I58B 4IO7A 5EHMA 4LZ8A 4THIA 3K4UA 1MS7A 3H6VA 1N7WA 1O7TA 2DQVA 3CG3A 3K01A 2GH9A 3H6UA 4YKKA 2O7IA 1NH8A 3N26A 3GBBA 4X1BA 1OVTA 2DVCA 1MY4A 2UVHA 4EQ7A 3M3LA 3FVOA 4EDPA 1PB7A 1B0HA 2PMSA 2RC7A 3SESA 3JYRA 1N84A 3CSBA 4KFQA 4QFPA 2XXTA 3CRBA 4DZ1A 4M1VA 3SEVA 1ZJLA 3S9EA 1YTVA 3QYTA 1Q35A 1FTKA 3C4MA 4EXKA 2QMXA 1EZOA 3MVXA 1CB6A 4RJZA 4OWDA 1A8FA 1UTHB 1SW4A 3E13X 1B1HA 1LFIA 1XVYA 3FXUA 3ILUB 3O66A 3PMXA 4UA8A 3T22A 3PPOA 1B46A 3GZGA 2XXXA 5H8FA 4POXA 5TU0A 3T66A 3IB2A 3DP4A 1B7UA 5K2XA 3K2DA 2O69A 4R9GA 3BKIB 1B58A 4PFYA 5FHOA 1D9YA 3OMBA 4ZEKA 3OEMA 4IO4A 3PU5A 5TP9A 4LQ5A 5I58A 2YLNA 4R2BA 1OMPA 1Y1ZA 3IO6A 4GVOA 3H6TA 3G3JA 3U92A 2Z8DA 5I59B 3MQ9A 3BFTA 3H3GA 4RNSA 1Y4TA 4PP0A 3THIA 1DPPA 1BKAA 1H44A 2ZYNA 3H03A 5H8SA 5HPQA 3T9UA 3FV2A 4OQOA 4P11A 3CR9A 4KI0E 4TQUQ 4DE8A 3C33A 2F35A 1HSEA 1Y4CA 4GXSB 2XXQA 5EHSA 3VE1B 3VXCA 3PV0E 5CBSA 1Y3NA 3PPQA 2I6EA 4KYDA 4F2QA 1JVYA 2DVZA 1US5A 2Y7RA 3C31A 2X7QA 3S2VA 4EQ9A 4OENA 2GHAA 2THIA 5DTBA 3LBSA 3OENA 4ZE9A 1JW5A 1GR2A 1DMBA 2E0SA 3MP1A 1N76A 2AL5A 2PX1A 3LSWA 5I2KA 3FVGA 3VFJA 2RCBA 4H67A 5I57A 4F22A 1Y9UA 3UN6A 4C1UA 3Q28A 4OESA 2ABHA 4FAJA 3DLNA 1EU8A 1SBPA 1VE4A 3IL1B 4JB7A 2AIXA 3TCGA 4OYVA 4N13A 3KN8A 4PFUA 5HM4B 3L6HA 1B6HA 4ZZEA 1TFDA 4DCYA 1S9TA 2ZNTA 4LONB 4OMBA 2W7YA 1PC3A 3IK6B 2PT1A 2NXOA 5JTYA 1VR5A 4R9FA 1JVXA 4OFLA 2A5TB 1QKAA 3Q26A 3TCFA 1UTHA 4EQBA 4PQJA 4KYEA 3T96B 2O6AA 2DP8A 3R6UA 2Y7WA 1SQYA 3LC8A 4X9TA 3VXBA 1TWYA 3ZSFA 1S7YA 1H45A 3A3CA 3F11A 1I6AA 2I58A 3OOAA 4OERA 4AB5A 1PDAA 2OCUA 3C32A 4H1XA 3UP9A 5M2VA 1LBCA 3O97A 4YB6A 4HCWA 3A3UA 1N0TA 4F31B 4HW8A 3S9NC 1DTGA 4L17A 2YJPA 4K3FA 5H8QA 3HHFA 3CIJA 4NWDA 1TFAA 3M3KA 4XKPA 1B5HA 1OLCA 1P1UA 2Y7IA 2FYIA 4O3AA 2H5YA 4U4SA 2QRYA 4IGRA 2XXRA 4P0IA 5I84A 2R71A 4GF8A 2DS9A 2GHBA 3L6GA 1LSTA 3FD3A 3LUYA 3O6GA 3O6HA 1A54A 1NNKA 4OETA 2VP1A 3N5LA 4IO3A 1PB9A 4LVQA 2VHAA 2F34A 2NWJA 2RF1A 4QFKA 4MLVA 2F5XA 1B3FA 4BDLA 4E0WA 2O7UA 4HS7A 2FNCA 2ZNSA 3LR1A 4NE4A 1OIBA 2A5SA 1MXVA 3MZ1A 5JEIA 2HFBA 4IO2A 1LAGE 1R1NA 2PBWA 5H8HB 5H8NA 2P1SA 1LCTA 3TQWA 1IEJA 3KZGA 4NF6B 2NUVA 3CFZA 1NFTA 3QK6A 3BBRA 1B52A 2ANJA 2O84X 3PD8A 3CI8A 5I56A 2PVUA 3RGYA 4F39A 2KLFA 1YCJA 4PE5B 4U23A 3KSJA 3TKDA 5AA1A 2HZLA 1URGA 2PYYA 3IOUA 5A5XA 3BFUA 2XXWA 4YU0A 2UVGA 1SI1A 1VFDA 3MC2A 4YKPA 1Y20A 4JWOA 3PGFA 1MQHA 2HXWA 4F3BA 4UACA 1QVSA 3K6XA 1UIUA 4O3CA 5FTHA 2DSFA 3UORA 4FIMA 4NF5A 3H06B 5L9SA 1JNFA 4H0WA 2UXAA 4R75A 2DWJA 1P1NA 4IB2A 1B5IA 4QHQA 3K6WA 4YKIA 2ALUA 5I57B 1B3GA 3VVDA 2V3UA 1B9JA 1RYXA 4QSDA 2Z8EA 1B7HA 3PUWE 4YZZA 3V8XB 1AIVA 3TEPA 3IR1A 4I1DA 1ATGA 5I2NB 3MPKA 1H76A 2Q2AA 1MQDA 4XKRA 4JBZA 1II5A 3IOVA 3Q27A 4RA1A 4H8IA 4F19A 4R72A 2I0BA 1XT8A 2P2AA 3W15C 1XOCA 3D4GA 1SYHA 4U2RA 3B6TA 3T9HB 3V83A 1B05A 5DYHA 1SDXA 1EH3A 3MPLA 4IO6A 5TPAA 1B3HA 5L9MA 4R74A 3FVKA 4GQOA 4BLAA 3PPNA 5CMKA 3DELB 1NH7A 1URSA 1XC1A 4G8NA 3PPPA 4GL0A 1MRPA 2HEUA 4R6KA 3USDA 4BDNA 1AL3A 4YMBA 1MY2A 1ZKBA 3E9XA 2OWSA 3SEXA 4LZ7A 1LB8A 1QUJA 1MQJA 3GLBA 1ZBMA 3IB0A 3OO8A 1LLSA 4H5GA 1JW1A 2RCAA 3KEIA 1TXFA 3KJTA 3DM0A 3E4RA 1M5CA 4G4PA 3FASA 4RYAA 5DEXB 3SEWA 3TDJA 5ICQA 2DWAA 5H8QB 1Y3QA 3PPRA 1QJMA 5KZTA 1CE2A 3HN0A 2V3TA 1B40A 2OZZA 4OXVA 4NF5B 1IXGA 2FA7A 4XKQA 1POTA 3LSFB 3N94A 1UTBA 3PMWA 4KCDA 3K6VA 3TTNA 1ZU0A 3LSLA 4H5FA 3T93B 3E3KA 1FQEA 3CFXA 2HAVA 1M5EA 5FHMA 4OTEA 3PUVE 4H65A 3MAMA 3MJNA 1GTKA 5JK4A 5DT6A 4N6PA 1MM7A 3IB1A 3TFLA 4X1DA 3UGWA 3IO4A 2QMWA 4Z0IA 1DOTA 3SDFA 1LB9A 5B7DA 4EXLA 4FJPA 1Q1KA 1YPNA 4JWYA 3SERA 1SVXB 2X7PA 4FE8A 1IXCA 2ONKE 1P99A 2Z23A 1D3KA 1MPDA 3C36A 4KCCA 2R6GE 3O29A 4EF1A 2QSXA 4ONYA 5AA4A 1WDNA 3QAXA 2RC9A 3MP6A 4HCYA 3TZAA 1URDA 5B70A 5L9OA 2D5WA 1DPEA 2UYEA 3KN7A 4Q8RA 4PETA 4KD5A 5AA4B 1RKMA 3W9WA 2UYFA 3EN3A 3OO6A 1TT1A 3G3FA 4OHNA 2B3BA 1I6QA 3Q29A 4YB7A 4RY1A 2Q2CA 1MXZA 4XKNA 2VD3A 3PUXE 1FQDA 1NNTA 1FQAA 3A09A 4EF2A 4QRZA 1R6ZA 5CC2A 2V93A 4MH5A 3R26A 4RPNA 1FQCA 1A55A 4TOZA 2XXIA 5FHNA 2UVJA 3H6WA 3ILTB 4R6YA 5BUUA 4Z7EA 1LFGA 1OVBA 2B3FA 3TUSA 3RPWA 4KYSA 3R7XA 3Q25A 1PBPA 4QSCA 2ZYMA 3AXFA 2DE3A 2HQ0A 4G77A 2I4CA 2XD2A 4YICA 4POWA 5ELVA 3TELA 4ELOA 1XS5A 1J1NA 1I6BA 4R6HA 5I2KB 5ITOA 3VV5A 1M5BA 4FEBA 3OXNA 3KOSA 3RT8A 2XX9A 1ZTYA 2CZLA 1LGBC 2M8CA 2XX7A 4I8CA 1BP5A 3V5AA 4U1OA 2D3IA 4AB6A 4Q5TA 1PB8A 1FQFA 1Z7ME 5EYFA 3VVFA 4P0GA 4DXBA 1OQGA 4QSEA 2PT2A 3EHUA 1USYH 3K6UA 2H98A 4M4GA 4OFOA 1MY0A 1JQFA 3C35A 4RPOA 3MVZA 3K02A 1IXHA 1USYE 3HV1A 4I62A 4NMYA 4OEVA 4XTCQ 1MPBA 3RNNA 1GGGA 1FTJA 4BDRA 3MBPA 5TP9B 2V3QA 3B7DA 3KG2A 3SEUA 4YMAA 4NF4A 1JEUA 2E1SA 1B0LA 1OQHA 3KFMA 3N6UA 1B7ZA 4G8HA 4NF8A 4R2FA 1P1WA 4U4XA 3TPAA 3VLVA 1AH5A 1ZLQA 3WAEA 3G7WA 2F7AA 3MUQA 2RINA 1POY1 4RK2A 1N3WA 5H8FB 4DXUA 1IUDA 3OSRA 2I4BA 2IA4A 1B4HA 2DE4A 3DP6A 3K00A 3O6IA 1ANFA 3B6QA 4GIZA 4GRKA 1T0KA 3M8UA 4GD5A 3MZ9A 2F36A 4NEDA 3RY3A 1M5FA 3SKPA 5IAIA 1B5JA 3FGSA 4ESWA 5BWJA 1A8EA 2QS3A 1JW4A 3HHGA 4NWCA 1MXUA 1QKBA 5F1QA 5DEXA 5ICTA 4DLDA 3V89B 4ZEDA 3P7IA 1LFHA 2G29A 3RLFE 3TCHA 3G3GA 4G68C 2HZKA 1DTZA 2DWIA 1GV8A 3RTFB 3TQLA 5CMCA 1IXIA 3FJMA 1PEBA 4LP2B 3EHTA 2YPNA 2WKYA 1QW0A 3IORA 2ONRA 2REJA 3TMGA 4KQPA 2Z8FA 4EUOA 1FTOA 1S50A 3FIRA 5DVIA 2OJTA 2RKMA 4BDOA 1R9LA 3KJ7A 1SYIA 1BTJA 4Q0CA 1LAFE 5KDTB 2XX8A 2Y7KA 2F6GA 2OBGA 3MW0A 2REGA 3M3FA 2F7BA 3W9VA 2I3WA 3GBAA 5CI5A 4ZEIA 2V84A 2QL3A 2BJJX 2XXPA 5J1DA 5DVFA 2HCAA 3G3HA 2Y84A 1AMFA 3ECRA 4F3SA 2VD2A 2F8DA 3MWBA 3MVYA 5JTYB 3D4CA 1MY1A 4C0RA 2AL4A 4FORA 3H4ZA 4ECFA 2F7CA 1XVXA 2UVIA 1MM6A 3OEKA 3K1MA 3CG1A 3IX1A 2DXYA 1Y1MA 1MPCA 3VDFA 3OO9A 3T9VA 3TAJA 2F6PA 4N07A 1NNPA 1ZMGA 2XHDA 4KPTA 4Q30B 4DCXA 1ZIUA 2Q9TA 1LAXA 1PBQA 3K1NA 3KSXA 3EHSA 4LUBA 4YKJA 4NTLA 4MFIA 4YB5A 1XHYA 4JXIA 4XIGQ 3OD7A 3SEYA 1B2HA 2P0SA 3ZS6A 4NF6A 4QFOA 3VLUA 1MDQA 2I48A 3RN8A 2CMOA 3OELA 1B1XA 1UIVA 2Q8JA 2GRVA 1LCFA 3IJOB 1US4A 1A40A 4OEUA 1DSNA 1LBBA 1EZ9A 3CSGA 2OWTA 5TPAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0V A;  4GL8 A;  5AA2 D;  2XXY A;  1YAE A;  2DWH A;  3FV1 A;  4QFL A;  3FJ7 A;  1JEV A;  3VLW A;  2GFE A;  3DP8 A;  4IY6 A;  4GLI A;  4KHZ E;  1BIY A;  2IEE A;  1Z7N E;  4QF9 A;  4E0X A;  2XXH A;  2H4I A;  5I56 B;  3IOW A;  2G93 A;  4LAT A;  2O51 A;  3OSQ A;  3JZJ A;  4U1Z A;  5FTI A;  3I5O A;  4G2Z A;  1FQB A;  3MZB A;  5IKB A;  1FCK A;  2QS2 A;  2QS4 A;  3HST A;  4NF8 B;  3C34 A;  5CRY A;  2O1L A;  5DVJ A;  2DYX A;  1D4N A;  1MXX A;  3S4U A;  3UA8 A;  3QUJ A;  5HBC A;  2RC8 A;  2QJE A;  3KBR A;  4JSD A;  1H43 A;  4DIG A;  5CM6 A;  1B3L A;  2Y7P A;  4WXJ A;  1MQG A;  2OLB A;  4G68 B;  4JWX A;  4R73 A;  3JV9 A;  5AA3 A;  1FTM A;  2QPQ A;  1QUL A;  1VSO A;  1B32 A;  3PUZ E;  4FEC A;  1MH4 A;  3RQT A;  2ESN A;  4MBP A;  4PFT A;  4OFJ A;  3ODB A;  4ZZA A;  3PUY E;  5A5X B;  4MF3 A;  3RT6 B;  4WEP A;  3MVW A;  2ZMB A;  2XD3 A;  3FXQ A;  2AYS A;  3T9X B;  5I2N A;  3SET A;  3QIM A;  4JSO A;  1N04 A;  1MG1 A;  2HAU A;  1FW0 A;  3RUM A;  4ESX A;  3TTR A;  4F1U A;  3CVG A;  4PFW A;  2H99 A;  1BLF A;  1QUK A;  3H7M A;  4U21 A;  3G3K A;  3KN3 A;  1L5T A;  4BDQ A;  1MY3 A;  1M5D A;  4F3G A;  1Y3P A;  5AA2 A;  5KDT A;  4LZ5 A;  3S9L C;  5ISU A;  1MH3 A;  3FVN A;  1EZP A;  1N7X A;  4ZEF A;  1B4Z A;  2XXV A;  3O28 A;  3FXR A;  4F3P A;  2Q88 A;  1SW1 A;  2ZYK A;  3EPE A;  3OO7 A;  1MQI A;  4F18 A;  4FAT A;  2H9B A;  3EF7 A;  4IGT A;  4RK9 A;  5LOM A;  3I6V A;  2XXU A;  4U22 A;  1N3X A;  4X48 A;  4C1T A;  2OK2 A;  4H6D A;  4ZDM A;  2DOJ A;  3C9H A;  2ONS A;  1IIW A;  2O68 A;  1MDP 1;  3PMV A;  3O9P A;  3KGC A;  1B3E A;  4I9D A;  4WKM A;  3U72 A;  1NKX A;  1RYO A;  4RXL A;  1A7L A;  3U93 A;  1UQW A;  5AA2 B;  3G3I A;  2NVU B;  2ZNU A;  4ISU A;  3TTK A;  1HSJ A;  1SW2 A;  4NF4 B;  1WVJ A;  3RTW B;  4DXC A;  4F29 A;  1A99 A;  3KOT A;  3QXM A;  4O3B A;  4WED A;  5H8H A;  1R9Q A;  2D21 A;  4MLQ A;  3UK4 A;  2QS1 A;  5CBR A;  3MP8 A;  3ZKL A;  1HSL A;  4IO5 A;  2I3V A;  1B51 A;  2DE2 A;  4G68 A;  5I59 A;  4ZE8 A;  4ZEB A;  2F97 A;  2Q89 A;  3EQ1 A;  3U8Q A;  3FUZ A;  2ZXT A;  4HTG A;  4OVJ A;  3WAF A;  3U1O A;  1D9V A;  3IJX B;  5CMM A;  1FTL A;  1LAH E;  4ELR A;  3FZV A;  3N6T A;  1NMU A;  1MXW A;  4BDM A;  3IAZ A;  1IQ7 A;  3QUF A;  3TTM A;  1H3D A;  4JDF A;  4ZEC A;  1F9B A;  5F7V A;  4QFN A;  1NNF A;  1O63 A;  1IZ1 A;  3S9M C;  2B65 A;  2Z22 A;  3ONM A;  3TOD A;  5AE4 A;  3B6W A;  5H8N B;  3PD9 A;  4IY5 A;  4LQ2 A;  3TYH A;  4YAH X;  4F2O A;  2DXR A;  2V25 A;  2X26 A;  5CMB A;  4TLL B;  4XXU A;  2VOZ A;  1AOV A;  1NL5 A;  3FJG A;  4GXA A;  1IIT A;  4AQ4 A;  4F1Y A;  2O1M A;  1SD3 A;  2NOO A;  4TLM B;  2VGQ A;  3HPI A;  3IOT A;  2ZYO A;  4G8M A;  3U94 A;  1QUI A;  1P1Q A;  4F1V A;  1JET A;  3FAT A;  2A5T A;  4FED A;  4ND9 A;  1GVC A;  1P1O A;  4GWO A;  1KWH A;  3ZKK A;  3O2A A;  1ELJ A;  4OZ9 A;  3VVE A;  3UIF A;  2I0C A;  3K1P A;  1SW5 A;  2F78 A;  2I49 A;  4H8J A;  5ITP A;  3HO7 A;  4ELQ A;  2LAO A;  4DDD A;  1O64 A;  4KR5 A;  3HCQ A;  4GOT A;  4ELP A;  5L8D A;  1MXY A;  4GFR A;  4LA9 A;  5KCJ A;  5KCJ B;  1UTB B;  4ZS9 A;  3GXA A;  3I3V A;  1SI0 A;  3LSX A;  2R9J A;  3QSL A;  1I69 A;  1OLA A;  2H25 A;  1WOD A;  3CFL A;  1VFE A;  5K2Y A;  3TTL A;  5I58 B;  4IO7 A;  5EHM A;  4LZ8 A;  4THI A;  3K4U A;  1MS7 A;  3H6V A;  1N7W A;  1O7T A;  2DQV A;  3CG3 A;  3K01 A;  2GH9 A;  3H6U A;  4YKK A;  2O7I A;  1NH8 A;  3N26 A;  3GBB A;  4X1B A;  1OVT A;  2DVC A;  1MY4 A;  2UVH A;  4EQ7 A;  3M3L A;  3FVO A;  4EDP A;  1PB7 A;  1B0H A;  2PMS A;  2RC7 A;  3SES A;  3JYR A;  1N84 A;  3CSB A;  4KFQ A;  4QFP A;  2XXT A;  3CRB A;  4DZ1 A;  4M1V A;  3SEV A;  1ZJL A;  3S9E A;  1YTV A;  3QYT A;  1Q35 A;  1FTK A;  3C4M A;  4EXK A;  2QMX A;  1EZO A;  3MVX A;  1CB6 A;  4RJZ A;  4OWD A;  1A8F A;  1UTH B;  1SW4 A;  3E13 X;  1B1H A;  1LFI A;  1XVY A;  3FXU A;  3ILU B;  3O66 A;  3PMX A;  4UA8 A;  3T22 A;  3PPO A;  1B46 A;  3GZG A;  2XXX A;  5H8F A;  4POX A;  5TU0 A;  3T66 A;  3IB2 A;  3DP4 A;  1B7U A;  5K2X A;  3K2D A;  2O69 A;  4R9G A;  3BKI B;  1B58 A;  4PFY A;  5FHO A;  1D9Y A;  3OMB A;  4ZEK A;  3OEM A;  4IO4 A;  3PU5 A;  5TP9 A;  4LQ5 A;  5I58 A;  2YLN A;  4R2B A;  1OMP A;  1Y1Z A;  3IO6 A;  4GVO A;  3H6T A;  3G3J A;  3U92 A;  2Z8D A;  5I59 B;  3MQ9 A;  3BFT A;  3H3G A;  4RNS A;  1Y4T A;  4PP0 A;  3THI A;  1DPP A;  1BKA A;  1H44 A;  2ZYN A;  3H03 A;  5H8S A;  5HPQ A;  3T9U A;  3FV2 A;  4OQO A;  4P11 A;  3CR9 A;  4KI0 E;  4TQU Q;  4DE8 A;  3C33 A;  2F35 A;  1HSE A;  1Y4C A;  4GXS B;  2XXQ A;  5EHS A;  3VE1 B;  3VXC A;  3PV0 E;  5CBS A;  1Y3N A;  3PPQ A;  2I6E A;  4KYD A;  4F2Q A;  1JVY A;  2DVZ A;  1US5 A;  2Y7R A;  3C31 A;  2X7Q A;  3S2V A;  4EQ9 A;  4OEN A;  2GHA A;  2THI A;  5DTB A;  3LBS A;  3OEN A;  4ZE9 A;  1JW5 A;  1GR2 A;  1DMB A;  2E0S A;  3MP1 A;  1N76 A;  2AL5 A;  2PX1 A;  3LSW A;  5I2K A;  3FVG A;  3VFJ A;  2RCB A;  4H67 A;  5I57 A;  4F22 A;  1Y9U A;  3UN6 A;  4C1U A;  3Q28 A;  4OES A;  2ABH A;  4FAJ A;  3DLN A;  1EU8 A;  1SBP A;  1VE4 A;  3IL1 B;  4JB7 A;  2AIX A;  3TCG A;  4OYV A;  4N13 A;  3KN8 A;  4PFU A;  5HM4 B;  3L6H A;  1B6H A;  4ZZE A;  1TFD A;  4DCY A;  1S9T A;  2ZNT A;  4LON B;  4OMB A;  2W7Y A;  1PC3 A;  3IK6 B;  2PT1 A;  2NXO A;  5JTY A;  1VR5 A;  4R9F A;  1JVX A;  4OFL A;  2A5T B;  1QKA A;  3Q26 A;  3TCF A;  1UTH A;  4EQB A;  4PQJ A;  4KYE A;  3T96 B;  2O6A A;  2DP8 A;  3R6U A;  2Y7W A;  1SQY A;  3LC8 A;  4X9T A;  3VXB A;  1TWY A;  3ZSF A;  1S7Y A;  1H45 A;  3A3C A;  3F11 A;  1I6A A;  2I58 A;  3OOA A;  4OER A;  4AB5 A;  1PDA A;  2OCU A;  3C32 A;  4H1X A;  3UP9 A;  5M2V A;  1LBC A;  3O97 A;  4YB6 A;  4HCW A;  3A3U A;  1N0T A;  4F31 B;  4HW8 A;  3S9N C;  1DTG A;  4L17 A;  2YJP A;  4K3F A;  5H8Q A;  3HHF A;  3CIJ A;  4NWD A;  1TFA A;  3M3K A;  4XKP A;  1B5H A;  1OLC A;  1P1U A;  2Y7I A;  2FYI A;  4O3A A;  2H5Y A;  4U4S A;  2QRY A;  4IGR A;  2XXR A;  4P0I A;  5I84 A;  2R71 A;  4GF8 A;  2DS9 A;  2GHB A;  3L6G A;  1LST A;  3FD3 A;  3LUY A;  3O6G A;  3O6H A;  1A54 A;  1NNK A;  4OET A;  2VP1 A;  3N5L A;  4IO3 A;  1PB9 A;  4LVQ A;  2VHA A;  2F34 A;  2NWJ A;  2RF1 A;  4QFK A;  4MLV A;  2F5X A;  1B3F A;  4BDL A;  4E0W A;  2O7U A;  4HS7 A;  2FNC A;  2ZNS A;  3LR1 A;  4NE4 A;  1OIB A;  2A5S A;  1MXV A;  3MZ1 A;  5JEI A;  2HFB A;  4IO2 A;  1LAG E;  1R1N A;  2PBW A;  5H8H B;  5H8N A;  2P1S A;  1LCT A;  3TQW A;  1IEJ A;  3KZG A;  4NF6 B;  2NUV A;  3CFZ A;  1NFT A;  3QK6 A;  3BBR A;  1B52 A;  2ANJ A;  2O84 X;  3PD8 A;  3CI8 A;  5I56 A;  2PVU A;  3RGY A;  4F39 A;  2KLF A;  1YCJ A;  4PE5 B;  4U23 A;  3KSJ A;  3TKD A;  5AA1 A;  2HZL A;  1URG A;  2PYY A;  3IOU A;  5A5X A;  3BFU A;  2XXW A;  4YU0 A;  2UVG A;  1SI1 A;  1VFD A;  3MC2 A;  4YKP A;  1Y20 A;  4JWO A;  3PGF A;  1MQH A;  2HXW A;  4F3B A;  4UAC A;  1QVS A;  3K6X A;  1UIU A;  4O3C A;  5FTH A;  2DSF A;  3UOR A;  4FIM A;  4NF5 A;  3H06 B;  5L9S A;  1JNF A;  4H0W A;  2UXA A;  4R75 A;  2DWJ A;  1P1N A;  4IB2 A;  1B5I A;  4QHQ A;  3K6W A;  4YKI A;  2ALU A;  5I57 B;  1B3G A;  3VVD A;  2V3U A;  1B9J A;  1RYX A;  4QSD A;  2Z8E A;  1B7H A;  3PUW E;  4YZZ A;  3V8X B;  1AIV A;  3TEP A;  3IR1 A;  4I1D A;  1ATG A;  5I2N B;  3MPK A;  1H76 A;  2Q2A A;  1MQD A;  4XKR A;  4JBZ A;  1II5 A;  3IOV A;  3Q27 A;  4RA1 A;  4H8I A;  4F19 A;  4R72 A;  2I0B A;  1XT8 A;  2P2A A;  3W15 C;  1XOC A;  3D4G A;  1SYH A;  4U2R A;  3B6T A;  3T9H B;  3V83 A;  1B05 A;  5DYH A;  1SDX A;  1EH3 A;  3MPL A;  4IO6 A;  5TPA A;  1B3H A;  5L9M A;  4R74 A;  3FVK A;  4GQO A;  4BLA A;  3PPN A;  5CMK A;  3DEL B;  1NH7 A;  1URS A;  1XC1 A;  4G8N A;  3PPP A;  4GL0 A;  1MRP A;  2HEU A;  4R6K A;  3USD A;  4BDN A;  1AL3 A;  4YMB A;  1MY2 A;  1ZKB A;  3E9X A;  2OWS A;  3SEX A;  4LZ7 A;  1LB8 A;  1QUJ A;  1MQJ A;  3GLB A;  1ZBM A;  3IB0 A;  3OO8 A;  1LLS A;  4H5G A;  1JW1 A;  2RCA A;  3KEI A;  1TXF A;  3KJT A;  3DM0 A;  3E4R A;  1M5C A;  4G4P A;  3FAS A;  4RYA A;  5DEX B;  3SEW A;  3TDJ A;  5ICQ A;  2DWA A;  5H8Q B;  1Y3Q A;  3PPR A;  1QJM A;  5KZT A;  1CE2 A;  3HN0 A;  2V3T A;  1B40 A;  2OZZ A;  4OXV A;  4NF5 B;  1IXG A;  2FA7 A;  4XKQ A;  1POT A;  3LSF B;  3N94 A;  1UTB A;  3PMW A;  4KCD A;  3K6V A;  3TTN A;  1ZU0 A;  3LSL A;  4H5F A;  3T93 B;  3E3K A;  1FQE A;  3CFX A;  2HAV A;  1M5E A;  5FHM A;  4OTE A;  3PUV E;  4H65 A;  3MAM A;  3MJN A;  1GTK A;  5JK4 A;  5DT6 A;  4N6P A;  1MM7 A;  3IB1 A;  3TFL A;  4X1D A;  3UGW A;  3IO4 A;  2QMW A;  4Z0I A;  1DOT A;  3SDF A;  1LB9 A;  5B7D A;  4EXL A;  4FJP A;  1Q1K A;  1YPN A;  4JWY A;  3SER A;  1SVX B;  2X7P A;  4FE8 A;  1IXC A;  2ONK E;  1P99 A;  2Z23 A;  1D3K A;  1MPD A;  3C36 A;  4KCC A;  2R6G E;  3O29 A;  4EF1 A;  2QSX A;  4ONY A;  5AA4 A;  1WDN A;  3QAX A;  2RC9 A;  3MP6 A;  4HCY A;  3TZA A;  1URD A;  5B70 A;  5L9O A;  2D5W A;  1DPE A;  2UYE A;  3KN7 A;  4Q8R A;  4PET A;  4KD5 A;  5AA4 B;  1RKM A;  3W9W A;  2UYF A;  3EN3 A;  3OO6 A;  1TT1 A;  3G3F A;  4OHN A;  2B3B A;  1I6Q A;  3Q29 A;  4YB7 A;  4RY1 A;  2Q2C A;  1MXZ A;  4XKN A;  2VD3 A;  3PUX E;  1FQD A;  1NNT A;  1FQA A;  3A09 A;  4EF2 A;  4QRZ A;  1R6Z A;  5CC2 A;  2V93 A;  4MH5 A;  3R26 A;  4RPN A;  1FQC A;  1A55 A;  4TOZ A;  2XXI A;  5FHN A;  2UVJ A;  3H6W A;  3ILT B;  4R6Y A;  5BUU A;  4Z7E A;  1LFG A;  1OVB A;  2B3F A;  3TUS A;  3RPW A;  4KYS A;  3R7X A;  3Q25 A;  1PBP A;  4QSC A;  2ZYM A;  3AXF A;  2DE3 A;  2HQ0 A;  4G77 A;  2I4C A;  2XD2 A;  4YIC A;  4POW A;  5ELV A;  3TEL A;  4ELO A;  1XS5 A;  1J1N A;  1I6B A;  4R6H A;  5I2K B;  5ITO A;  3VV5 A;  1M5B A;  4FEB A;  3OXN A;  3KOS A;  3RT8 A;  2XX9 A;  1ZTY A;  2CZL A;  1LGB C;  2M8C A;  2XX7 A;  4I8C A;  1BP5 A;  3V5A A;  4U1O A;  2D3I A;  4AB6 A;  4Q5T A;  1PB8 A;  1FQF A;  1Z7M E;  5EYF A;  3VVF A;  4P0G A;  4DXB A;  1OQG A;  4QSE A;  2PT2 A;  3EHU A;  1USY H;  3K6U A;  2H98 A;  4M4G A;  4OFO A;  1MY0 A;  1JQF A;  3C35 A;  4RPO A;  3MVZ A;  3K02 A;  1IXH A;  1USY E;  3HV1 A;  4I62 A;  4NMY A;  4OEV A;  4XTC Q;  1MPB A;  3RNN A;  1GGG A;  1FTJ A;  4BDR A;  3MBP A;  5TP9 B;  2V3Q A;  3B7D A;  3KG2 A;  3SEU A;  4YMA A;  4NF4 A;  1JEU A;  2E1S A;  1B0L A;  1OQH A;  3KFM A;  3N6U A;  1B7Z A;  4G8H A;  4NF8 A;  4R2F A;  1P1W A;  4U4X A;  3TPA A;  3VLV A;  1AH5 A;  1ZLQ A;  3WAE A;  3G7W A;  2F7A A;  3MUQ A;  2RIN A;  1POY 1;  4RK2 A;  1N3W A;  5H8F B;  4DXU A;  1IUD A;  3OSR A;  2I4B A;  2IA4 A;  1B4H A;  2DE4 A;  3DP6 A;  3K00 A;  3O6I A;  1ANF A;  3B6Q A;  4GIZ A;  4GRK A;  1T0K A;  3M8U A;  4GD5 A;  3MZ9 A;  2F36 A;  4NED A;  3RY3 A;  1M5F A;  3SKP A;  5IAI A;  1B5J A;  3FGS A;  4ESW A;  5BWJ A;  1A8E A;  2QS3 A;  1JW4 A;  3HHG A;  4NWC A;  1MXU A;  1QKB A;  5F1Q A;  5DEX A;  5ICT A;  4DLD A;  3V89 B;  4ZED A;  3P7I A;  1LFH A;  2G29 A;  3RLF E;  3TCH A;  3G3G A;  4G68 C;  2HZK A;  1DTZ A;  2DWI A;  1GV8 A;  3RTF B;  3TQL A;  5CMC A;  1IXI A;  3FJM A;  1PEB A;  4LP2 B;  3EHT A;  2YPN A;  2WKY A;  1QW0 A;  3IOR A;  2ONR A;  2REJ A;  3TMG A;  4KQP A;  2Z8F A;  4EUO A;  1FTO A;  1S50 A;  3FIR A;  5DVI A;  2OJT A;  2RKM A;  4BDO A;  1R9L A;  3KJ7 A;  1SYI A;  1BTJ A;  4Q0C A;  1LAF E;  5KDT B;  2XX8 A;  2Y7K A;  2F6G A;  2OBG A;  3MW0 A;  2REG A;  3M3F A;  2F7B A;  3W9V A;  2I3W A;  3GBA A;  5CI5 A;  4ZEI A;  2V84 A;  2QL3 A;  2BJJ X;  2XXP A;  5J1D A;  5DVF A;  2HCA A;  3G3H A;  2Y84 A;  1AMF A;  3ECR A;  4F3S A;  2VD2 A;  2F8D A;  3MWB A;  3MVY A;  5JTY B;  3D4C A;  1MY1 A;  4C0R A;  2AL4 A;  4FOR A;  3H4Z A;  4ECF A;  2F7C A;  1XVX A;  2UVI A;  1MM6 A;  3OEK A;  3K1M A;  3CG1 A;  3IX1 A;  2DXY A;  1Y1M A;  1MPC A;  3VDF A;  3OO9 A;  3T9V A;  3TAJ A;  2F6P A;  4N07 A;  1NNP A;  1ZMG A;  2XHD A;  4KPT A;  4Q30 B;  4DCX A;  1ZIU A;  2Q9T A;  1LAX A;  1PBQ A;  3K1N A;  3KSX A;  3EHS A;  4LUB A;  4YKJ A;  4NTL A;  4MFI A;  4YB5 A;  1XHY A;  4JXI A;  4XIG Q;  3OD7 A;  3SEY A;  1B2H A;  2P0S A;  3ZS6 A;  4NF6 A;  4QFO A;  3VLU A;  1MDQ A;  2I48 A;  3RN8 A;  2CMO A;  3OEL A;  1B1X A;  1UIV A;  2Q8J A;  2GRV A;  1LCF A;  3IJO B;  1US4 A;  1A40 A;  4OEU A;  1DSN A;  1LBB A;  1EZ9 A;  3CSG A;  2OWT A;  5TPA B; 
#chains in the Genus database with same CATH topology
 3K0V A;  4HE1 A;  2XXY A;  3FJ7 A;  3MYU A;  1BIY A;  1Z7N E;  2H4I A;  3IOW A;  2G93 A;  4U1Z A;  3HST A;  2O1L A;  2QJE A;  4DIG A;  2Y7P A;  5T3J A;  3PUZ E;  3RQT A;  1B32 A;  4ZZA A;  4NAP A;  4OFJ A;  3PUY E;  5A5X B;  3RT6 B;  5I2N A;  3T9X B;  4JSO A;  4ESX A;  1FW0 A;  4PFW A;  3G3K A;  4BDQ A;  5ISU A;  1MY3 A;  1M5D A;  1MH3 A;  1EZP A;  1RDZ A;  1B4Z A;  3O28 A;  3FXR A;  2ZYK A;  1MQI A;  2H9B A;  4IGT A;  4ZDM A;  3S9N C;  3C9H A;  4I9D A;  3PMV A;  3U72 A;  3O9P A;  3KGC A;  1B3E A;  4RXL A;  3U93 A;  3TTK A;  1SW2 A;  4NF4 B;  4AS4 A;  3UK4 A;  3MP8 A;  3ZKL A;  2I3V A;  4ZE8 A;  4ZEB A;  4N17 A;  4HTG A;  3WAF A;  1D9V A;  4PCD A;  1NMU A;  4ZEC A;  4JDF A;  1NNF A;  2B65 A;  3B6W A;  2CZI A;  4XXU A;  1IIT A;  5LTC A;  4TLM B;  2VGQ A;  1LBZ A;  3HPI A;  3U94 A;  1GVC A;  3ZKK A;  1KWH A;  1ELJ A;  2I0C A;  2F78 A;  2I49 A;  5ITP A;  4P47 A;  1O64 A;  3HCQ A;  5L8D A;  5KCJ A;  3B50 A;  3I3V A;  1SI0 A;  3QSL A;  3KC1 A;  4PBQ A;  1SPI A;  5I58 B;  1YXI A;  4X04 A;  2DQV A;  2GH9 A;  2O7I A;  2UVH A;  1B0H A;  2PMS A;  2RC7 A;  4M1V A;  3SEV A;  1YTV A;  3C4M A;  3MVX A;  3ILU B;  4MNI A;  1B1H A;  3T22 A;  4OVQ A;  5K2X A;  4X8R A;  3OEM A;  1OMP A;  3U92 A;  3IO6 A;  3H6T A;  3G3J A;  5I59 B;  2P3V A;  3BFT A;  3H3G A;  4RNS A;  3THI A;  2ZYN A;  3H03 A;  4TQU Q;  4P11 A;  3CR9 A;  3VE1 B;  1HSE A;  4GXS B;  2I6E A;  3C31 A;  3S2V A;  3LBS A;  4ZE9 A;  2E0S A;  1N76 A;  2PX1 A;  3LSW A;  5EQ8 A;  5I2K A;  3VFJ A;  2RCB A;  4H67 A;  4LN5 A;  4PFB A;  3DLN A;  4JB7 A;  1FBP A;  4PFR A;  3TCG A;  4OYV A;  5IZ3 B;  5HM4 B;  2ZNT A;  4OMB A;  4P8B A;  2PT1 A;  2A5T B;  4PQJ A;  3T96 B;  2O6A A;  3VXB A;  3LC8 A;  1H45 A;  4OER A;  1PDA A;  2OCU A;  5M2V A;  1LBC A;  4PDH A;  1N0T A;  5H8Q A;  5TU0 A;  2YJP A;  2Y7I A;  3HFU A;  1LST A;  4IO3 A;  5ET8 A;  4LVQ A;  2VHA A;  2F34 A;  3E78 A;  4MLV A;  2F5X A;  4BDL A;  3LR1 A;  2HFB A;  1LAG E;  1R1N A;  2PBW A;  4EQB A;  2P1S A;  1IEJ A;  2NUV A;  1NFT A;  2ANJ A;  3PD8 A;  2O84 X;  1NV6 A;  4F39 A;  1YCJ A;  4PE5 B;  4U23 A;  2HZL A;  2Y5L A;  2UVG A;  4UAC A;  1QVS A;  5I7I A;  4O3C A;  5L9S A;  4H0W A;  2DWJ A;  4DI4 B;  4N91 A;  2V3U A;  2Z8E A;  3PUW E;  4XKR A;  1DBZ A;  1II5 A;  3IOV A;  1FPB A;  1SYH A;  2FBP A;  4PTK A;  4U2R A;  3T9H B;  3V83 A;  1B05 A;  4BLA A;  4IO6 A;  5CMK A;  1MRP A;  1ZKB A;  4NQ8 A;  3IB0 A;  5EYH A;  4H5G A;  1LLS A;  4HE2 A;  2RCA A;  2HXR A;  1TXF A;  3E4R A;  4PAK A;  1M5C A;  4RYA A;  3TDJ A;  2VPN A;  5LOM A;  4NF5 B;  4XKQ A;  4YMB A;  3TTN A;  4H5F A;  3T93 B;  3CFX A;  4MX6 A;  4OTE A;  4H65 A;  5JK4 A;  3MJN A;  5F24 A;  3IB1 A;  5B7D A;  2QMW A;  1DOT A;  2QFL A;  2X7P A;  1IXC A;  2ONK E;  3O29 A;  4ONY A;  3MP6 A;  4HCY A;  5B70 A;  1URD A;  1DPE A;  2UYE A;  3KN7 A;  4Q8R A;  5A5L A;  4PET A;  4N15 A;  3Q29 A;  2FIX A;  2VD3 A;  4GWU A;  1FQD A;  2R8T A;  4JVD A;  1XI6 A;  1A55 A;  4GX3 A;  4TOZ A;  2UVJ A;  3H6W A;  1KA0 A;  2KQZ A;  5ET7 A;  1OVB A;  3TUS A;  1PBP A;  4EQ7 A;  4OVR A;  4YIC A;  5ELV A;  5I2K B;  4FEB A;  2CZL A;  2XX7 A;  2D3I A;  4OVP A;  4P0G A;  1OQG A;  2PT2 A;  3K6U A;  4OFO A;  1MY0 A;  1JQF A;  3MVZ A;  3K02 A;  1IXH A;  3HV1 A;  4OEV A;  1GGG A;  1FTJ A;  3MBP A;  4OHN A;  4NF4 A;  4R2F A;  1B0L A;  3N6U A;  4G8H A;  4QBA A;  4U4X A;  3IFA A;  1POY 1;  4GBV A;  3NOH A;  3M8U A;  4H46 A;  5BWJ A;  5DEX A;  4DLD A;  5LDZ A;  1VDW A;  2DWI A;  1GV8 A;  3RTF B;  1IXI A;  1PEB A;  1QW0 A;  5EQ7 A;  2ONR A;  2REJ A;  2Z8F A;  4EUO A;  2OJT A;  2RKM A;  4BDO A;  1IMF A;  2Y7K A;  2F6G A;  2OBG A;  3GBA A;  4ZEI A;  1FPE A;  2V84 A;  2XXP A;  2Y84 A;  3ECR A;  4F3S A;  3MWB A;  4C0R A;  1MPC A;  3OO9 A;  3T9V A;  2F6P A;  1NV4 A;  1ZMG A;  4I3Y A;  2Q9T A;  4LUB A;  3EHS A;  3ZS6 A;  1FPG A;  2FVZ A;  4NF6 A;  3VLU A;  4NF0 A;  3RN8 A;  2Q74 A;  2Q8J A;  2GRV A;  1A40 A;  4OEU A;  1DSN A;  4GWY A;  5AA2 D;  4GWZ A;  2Q8M A;  1JEV A;  3BIG A;  3DP8 A;  4KHZ E;  4XEQ A;  2XXH A;  4LAT A;  2O51 A;  5I3S A;  5IKB A;  4NF8 B;  2QS2 A;  2QS4 A;  3S4U A;  3UA8 A;  3QUJ A;  5HBC A;  2XWO A;  5CM6 A;  1B3L A;  4WXJ A;  1MQG A;  2OLB A;  4JWX A;  2QPQ A;  1MH4 A;  4GWS A;  2ESN A;  4PFT A;  3ODB A;  3FXQ A;  3SET A;  3QIM A;  1MG1 A;  4F1U A;  4U21 A;  1QUK A;  1Y3P A;  5KDT A;  3S9L C;  4LZ5 A;  4OAN A;  1EYJ A;  3FVN A;  4ZEF A;  2XXV A;  4F3P A;  4RK9 A;  4C1T A;  4H6D A;  5I56 B;  5AA2 B;  3G3I A;  2ZNU A;  3RTW B;  4WED A;  5H8H A;  1R9Q A;  1B51 A;  2DE2 A;  2Q89 A;  3U8Q A;  4OVJ A;  3IJX B;  1LAH E;  3IAZ A;  2WEF A;  3TTM A;  1H3D A;  5F7V A;  3KBZ A;  3ONM A;  3TOD A;  4IY5 A;  4YAH X;  4F2O A;  2DXR A;  2X26 A;  5CMB A;  2VOZ A;  1NL5 A;  3FJG A;  4AQ4 A;  2O1M A;  2NOO A;  3SZP A;  1QUI A;  1IMB A;  2FHY A;  4ELQ A;  2LAO A;  4GOT A;  1NUZ A;  1UTB B;  3EKI A;  1WOD A;  3CFL A;  5EHM A;  4LZ8 A;  4THI A;  1NUX A;  1N7W A;  3V89 B;  2XXK A;  3N26 A;  3GBB A;  1OVT A;  3FVO A;  2OX3 A;  1N84 A;  1ZJL A;  1FTK A;  2QMX A;  1CB6 A;  4OWD A;  2VPO A;  4ND9 A;  3O66 A;  3PMX A;  1XVY A;  3PPO A;  2XXX A;  4POX A;  3BKI B;  3OMB A;  1Y1Z A;  2Z8D A;  1Y4T A;  1BKA A;  3LUZ A;  4OQO A;  5CBS A;  1Y4C A;  3PV0 E;  1Y3N A;  2MKZ A;  4EQ9 A;  5DTB A;  1JW5 A;  1GR2 A;  4OES A;  2DDK A;  3KN8 A;  1S9T A;  4LON B;  3RYD A;  2NXO A;  5JTY A;  1VR5 A;  3Q26 A;  1TWY A;  1S7Y A;  3F11 A;  3OOA A;  4AB5 A;  3O97 A;  4F31 B;  4HW8 A;  1DTG A;  4L17 A;  4K3F A;  3CIJ A;  1TFA A;  3M3K A;  2FYI A;  2QRY A;  4P0I A;  2R71 A;  3UOR A;  3LUY A;  3FD3 A;  4OET A;  4GWW A;  1PB9 A;  2O7U A;  3D1R A;  2ZNS A;  4NE4 A;  1OIB A;  2P3N A;  4IO2 A;  3W15 C;  4NF6 B;  3CFZ A;  4N6D A;  2PVU A;  3KSJ A;  3IOU A;  2XXW A;  1FBC A;  3MC2 A;  1FRP A;  4F3B A;  1MQH A;  2HXW A;  1FPJ A;  1UIU A;  4FIM A;  3H06 B;  1JNF A;  2UXA A;  4P3L A;  4QHQ A;  5I57 B;  2ALU A;  3VVD A;  1B9J A;  1RYX A;  3V8X B;  1B7H A;  1LBW A;  4MNC A;  1ATG A;  1H76 A;  4RA1 A;  4H8I A;  5DYH A;  1SDX A;  3ISP A;  1B3H A;  4GQO A;  3DEL B;  1NH7 A;  3USD A;  2HEU A;  3E9X A;  3T1B A;  5EQ9 A;  3OO8 A;  1FPF A;  3KEI A;  3DM0 A;  3FAS A;  5DEX B;  3SEW A;  4O8M A;  5H8Q B;  3UN6 A;  1IXG A;  3N94 A;  3PMW A;  1UTB A;  4KCD A;  3K6V A;  5FHM A;  3PUV E;  5IZ1 A;  5ICQ A;  3SDF A;  1Q1K A;  4JWY A;  1SVX B;  2Z23 A;  3C36 A;  5AA4 A;  3TZA A;  2HHM A;  4O7I A;  3W9W A;  2UYF A;  3EN3 A;  3G3F A;  4N8Y A;  1NUW A;  4UAB A;  4XKN A;  3A09 A;  4EF2 A;  4QRZ A;  4MH5 A;  4NX1 A;  4RPN A;  3ILT B;  1LFG A;  2B3F A;  3RPW A;  4KYS A;  1FPK A;  3AXF A;  2DE3 A;  4ELO A;  2XD2 A;  3TEL A;  4POW A;  1XS5 A;  1J1N A;  3RT8 A;  1YZ0 A;  4U1O A;  3VVF A;  4RPO A;  4XTC Q;  1MPB A;  3RNN A;  2V3Q A;  2E1S A;  3LV0 A;  1OQH A;  4NF8 A;  1P1W A;  1AH5 A;  3G7W A;  2F7A A;  4RK2 A;  5H8F B;  4N81 A;  2I4B A;  2DE4 A;  3DP6 A;  3K00 A;  1T0K A;  2F36 A;  3RY3 A;  1M5F A;  3SKP A;  3FGS A;  4ESW A;  1A8E A;  3HHG A;  1QKB A;  1FSA A;  3TCH A;  1LBY A;  3TQL A;  5CMC A;  2JJK A;  3FJM A;  3TMG A;  1FTO A;  3KJ7 A;  2PFZ A;  1SYI A;  4I3E A;  5J1D A;  2AL4 A;  2F7C A;  3IX1 A;  1Y1M A;  1JP4 A;  1G0H A;  1NNP A;  4DCX A;  1LAX A;  1PBQ A;  4YKJ A;  2CEX A;  4YB5 A;  4XIG Q;  2CZH A;  3OD7 A;  4OVT A;  2CMO A;  3OEL A;  1LBB A;  1EZ9 A;  2OWT A;  4GL8 A;  1YAE A;  3FV1 A;  4IY6 A;  4GLI A;  4MHF A;  3OSQ A;  4G2Z A;  1FQB A;  1EYK A;  5CRY A;  3C34 A;  1DCU A;  1MXX A;  4JSD A;  1H43 A;  4G68 B;  1QUL A;  1VSO A;  4FEC A;  1QGX A;  4MF3 A;  4WEP A;  3MVW A;  1N04 A;  2HAU A;  2WX9 A;  3RUM A;  1NV2 A;  3TTR A;  3CVG A;  2H99 A;  1BLF A;  3H7M A;  1L5T A;  4F18 A;  3KN3 A;  2OWZ A;  2Q88 A;  1SW1 A;  4FAT A;  4NG7 A;  4PGN A;  1FBH A;  4X48 A;  2DOJ A;  1IIW A;  2XWK A;  1RYO A;  1UQW A;  1HSJ A;  1WVJ A;  1BK4 A;  1A99 A;  3KOT A;  3QXM A;  4O3B A;  4MLQ A;  3GYY A;  5CBR A;  1IMC A;  1HSL A;  3RPL A;  4G68 A;  4PAI A;  5I59 A;  2F97 A;  2ZXT A;  3U1O A;  5CMM A;  3CHG A;  1FTL A;  4ELR A;  5EQA A;  1IQ7 A;  1O63 A;  1IZ1 A;  3S9M C;  2Z22 A;  5H8N B;  3PD9 A;  3TYH A;  2V25 A;  3B8B A;  4TLL B;  4N4U A;  1SD3 A;  4F1V A;  1JET A;  4FED A;  1AWB A;  4GWO A;  4OZ9 A;  3VVE A;  3UIF A;  4NHB A;  3K1P A;  3HO7 A;  4DDD A;  4P9K A;  4GFR A;  4LA9 A;  5KCJ B;  4MIJ A;  3GXA A;  3LSX A;  3TTL A;  5K2Y A;  2H25 A;  2L5V A;  1VFE A;  5DVI A;  3H6V A;  3K01 A;  3CG3 A;  4YKK A;  3H6U A;  4X1B A;  2DVC A;  1MY4 A;  3SES A;  4QFP A;  3S9E A;  3QYT A;  1Q35 A;  1EZO A;  1IMA A;  1A8F A;  1NV7 A;  1UTH B;  1SW4 A;  3E13 X;  3FXU A;  5IZZ A;  1G0I A;  3IB2 A;  5FHO A;  2O69 A;  4R9G A;  4ZEK A;  1D9Y A;  4IO4 A;  3PU5 A;  4PGP A;  5TP9 A;  2YLN A;  4R2B A;  1NV3 A;  1IME A;  5HPQ A;  5H8S A;  3FV2 A;  2VT5 A;  4KI0 E;  4DE8 A;  2XXQ A;  2HPG A;  4I40 A;  4GX4 A;  2DVZ A;  2Y7R A;  4OEN A;  2GHA A;  2AL5 A;  1FPI A;  3FVG A;  2XWV A;  4F22 A;  2V4C A;  2ABH A;  3IL1 B;  2AIX A;  2B4L A;  4PFU A;  3L6H A;  1B6H A;  4DCY A;  1TFD A;  1EYI A;  3IK6 B;  1FBD A;  1JVX A;  3TCF A;  4GWX A;  4KYE A;  3R6U A;  2Y7W A;  3ZSF A;  3A3C A;  5ET6 A;  2I58 A;  5FBP A;  4YB6 A;  4HCW A;  3A3U A;  5J16 A;  4NWD A;  4XKP A;  1OLC A;  1P1U A;  4O3A A;  4U4S A;  2WBD A;  2XXR A;  4IGR A;  2DS9 A;  3O6G A;  4XFE A;  1NNK A;  3N5L A;  5IZ3 A;  1FBG A;  2NWJ A;  2RF1 A;  4E0W A;  2FNC A;  2A5S A;  1MXV A;  4ELP A;  5H8H B;  1LCT A;  3KZG A;  4XF5 A;  5I56 A;  3TKD A;  5AA1 A;  4P1E A;  3BFU A;  3PTY A;  1VFD A;  4YKP A;  1Y20 A;  3FXB A;  5FTH A;  2DSF A;  2BJI A;  1P1N A;  3K6W A;  1B3G A;  3IR1 A;  3MPK A;  2ZZV A;  4JBZ A;  3Q27 A;  4F19 A;  4R72 A;  2I0B A;  1XT8 A;  1XOC A;  3B6T A;  1EH3 A;  3MPL A;  4R74 A;  3FVK A;  4R6K A;  4G8N A;  1URS A;  1XC1 A;  3U65 A;  4LZ7 A;  4AS5 A;  1LB8 A;  1ZBM A;  4P1L A;  1JW1 A;  2DWA A;  1Y3Q A;  1QJM A;  4MJO A;  5KZT A;  1CE2 A;  3HN0 A;  2V3T A;  1B40 A;  4OXV A;  3ROJ A;  1POT A;  3LSF B;  3LSL A;  3E3K A;  1M5E A;  3MAM A;  1GTK A;  5DT6 A;  4N6P A;  1MM7 A;  3TFL A;  3UGW A;  3IO4 A;  4Z0I A;  4EXL A;  4FE8 A;  4KCC A;  2R6G E;  4EF1 A;  2QSX A;  3QAX A;  4JVC A;  5L9O A;  5IGA A;  4KD5 A;  5AA4 B;  3OO6 A;  1TT1 A;  2B3B A;  2Q2C A;  1MXZ A;  3PUX E;  1FQA A;  1R6Z A;  5CC2 A;  2V93 A;  2XXI A;  5FHN A;  4R6Y A;  1DK4 A;  4N6K A;  4MEV A;  4QSC A;  4G77 A;  4NN3 A;  4R6H A;  5ITO A;  3OXN A;  3KOS A;  4PDD A;  1ZTY A;  1LGB C;  1KZ8 A;  5ESY A;  1BP5 A;  3V5A A;  4AB6 A;  4OA4 A;  1FJ9 A;  4QSE A;  1USY H;  2H98 A;  4M4G A;  1LBV A;  4I62 A;  1USY E;  1LBX A;  5TP9 B;  3KG2 A;  1JEU A;  1B7Z A;  3TPA A;  1ZLQ A;  3MUQ A;  2PCR A;  3OSR A;  4GX6 A;  4MNP A;  1ANF A;  4GIZ A;  2B4M A;  3MZ9 A;  5IAI A;  1FTA A;  2QS3 A;  1MXU A;  1NV0 A;  3P7I A;  3RLF E;  3G3G A;  4G68 C;  2HZK A;  1DTZ A;  3EHT A;  4KQP A;  3FIR A;  4Q0C A;  1BTJ A;  1LAF E;  5KDT B;  2F3B A;  1CNQ A;  1KA1 A;  2XX8 A;  3MW0 A;  4P56 A;  3M3F A;  2F7B A;  2QL3 A;  2BJJ X;  5DVF A;  1AMF A;  2F8D A;  3MVY A;  2UVI A;  1MM6 A;  5IM2 A;  3VDF A;  4OVS A;  2PFY A;  2WYP A;  2XHD A;  4Q30 B;  1ZIU A;  4EDP A;  3KSX A;  4MFI A;  1D9Q A;  4O94 A;  1B2H A;  2P0S A;  4QFO A;  1MDQ A;  2I48 A;  1LCF A;  1US4 A;  2DWH A;  4QFL A;  3VLW A;  2GFE A;  2IEE A;  4QF9 A;  4E0X A;  3JZJ A;  5FTI A;  3I5O A;  3MZB A;  1FCK A;  4QXD A;  5DVJ A;  2DYX A;  1D4N A;  4JVI A;  2RC8 A;  3KBR A;  4KXP A;  4R73 A;  3JV9 A;  5AA3 A;  1FTM A;  4MBP A;  2ZMB A;  2XD3 A;  2AYS A;  4F3G A;  1N7X A;  1IMD A;  3EPE A;  3OO7 A;  3EF7 A;  3FBP A;  3I6V A;  2XXU A;  4U22 A;  1N3X A;  2OK2 A;  2ONS A;  2O68 A;  1MDP 1;  4WKM A;  3UP9 A;  1NKX A;  1A7L A;  3BIH A;  2NVU B;  4ISU A;  4F29 A;  4DXC A;  2D21 A;  2QS1 A;  4IO5 A;  4PE3 A;  5EYG A;  3EQ1 A;  3FUZ A;  3FZV A;  3N6T A;  1MXW A;  4BDM A;  3QUF A;  1F9B A;  4QFN A;  4PBH A;  5AE4 A;  5ET5 A;  4LQ2 A;  5I5P A;  1AOV A;  4GXA A;  4F1Y A;  2XA5 A;  3IOT A;  2ZYO A;  4G8M A;  1P1Q A;  3FAT A;  2A5T A;  1P1O A;  3O2A A;  1SW5 A;  4H8J A;  4KR5 A;  1MXY A;  4ZS9 A;  2R9J A;  4G61 A;  1I69 A;  1OLA A;  1NV5 A;  4IO7 A;  3K4U A;  1MS7 A;  1O7T A;  1NH8 A;  1RDY A;  3M3L A;  1PB7 A;  3JYR A;  4KFQ A;  3CSB A;  2XXT A;  3CRB A;  4DZ1 A;  4EXK A;  4RJZ A;  1LFI A;  4UA8 A;  2CEY A;  1B46 A;  3GZG A;  5H8F A;  3T66 A;  3DP4 A;  1B7U A;  4PC9 A;  3K2D A;  1B58 A;  4PFY A;  3E79 A;  4LQ5 A;  5I58 A;  1NI9 A;  4GVO A;  2QVU A;  3MQ9 A;  4PP0 A;  1YYZ A;  1DPP A;  1H44 A;  3T9U A;  3C33 A;  2F35 A;  3VXC A;  5EHS A;  4PAF A;  3PPQ A;  4KYD A;  4F2Q A;  1JVY A;  1US5 A;  2X7Q A;  2THI A;  1FBF A;  3OEN A;  1DMB A;  3MP1 A;  5I57 A;  1Y9U A;  4C1U A;  3Q28 A;  3QMF A;  4FAJ A;  1EU8 A;  1SBP A;  1VE4 A;  4MMP A;  4N13 A;  2WYK A;  4MCO A;  4ZZE A;  4DI3 D;  2W7Y A;  1PC3 A;  4R9F A;  4OFL A;  1QKA A;  1UTH A;  2QVV A;  4PF6 A;  3T0J A;  2DP8 A;  4X9T A;  1SQY A;  4NGU A;  3KC0 A;  1I6A A;  3C32 A;  4H1X A;  1K9Z A;  4PFI A;  3HHF A;  1B5H A;  2H5Y A;  4O7M A;  5I84 A;  4GF8 A;  2GHB A;  3L6G A;  3O6H A;  1A54 A;  4FBP A;  2VP1 A;  2WBB A;  4QFK A;  1B3F A;  2ZZX A;  4HS7 A;  1FBE A;  3MZ1 A;  5H8N A;  3TQW A;  2QVR A;  3QK6 A;  1INP A;  3BBR A;  1B52 A;  3CI8 A;  3RGY A;  2KLF A;  2XWI A;  1URG A;  2PYY A;  5A5X A;  4YU0 A;  1SI1 A;  4JWO A;  1NUY A;  3PGF A;  3K6X A;  4NF5 A;  5DW8 A;  4R75 A;  4YKI A;  4IB2 A;  1B5I A;  4QSD A;  1AIV A;  4YZZ A;  3TEP A;  4I1D A;  5I2N B;  2Q2A A;  1MQD A;  2GQ1 A;  2P2A A;  3D4G A;  1NV1 A;  5TPA A;  5L9M A;  3MST A;  3PPN A;  4BDN A;  3PPP A;  4GL0 A;  1AL3 A;  1MY2 A;  3SEX A;  2OWS A;  1FPD A;  1QUJ A;  1MQJ A;  3GLB A;  3KJT A;  4G4P A;  3PPR A;  2OZZ A;  2FA7 A;  2KR0 A;  1ZU0 A;  1FQE A;  2HAV A;  4X1D A;  2Y5K A;  1LB9 A;  4FJP A;  1YPN A;  3SER A;  1P99 A;  1D3K A;  1MPD A;  1RDX A;  1WDN A;  2RC9 A;  1LEV A;  2D5W A;  2ZZW A;  4N8G A;  1RKM A;  1FJ6 A;  4GBW A;  1I6Q A;  4YB7 A;  1K9Y A;  4RY1 A;  1NNT A;  3A29 A;  3R26 A;  1FQC A;  5BUU A;  4Z7E A;  2FIE A;  3R7X A;  3Q25 A;  2ZYM A;  5JEI A;  2HQ0 A;  2I4C A;  3VV5 A;  1I6B A;  1M5B A;  4H45 A;  2XX9 A;  2M8C A;  4I8C A;  4Q5T A;  1PB8 A;  1FQF A;  1Z7M E;  5EYF A;  4DXB A;  3EHU A;  3C35 A;  4NMY A;  4BDR A;  3B7D A;  3SEU A;  4YMA A;  3KFM A;  3WAE A;  5AA2 A;  4PF8 A;  3VLV A;  2RIN A;  4HE0 A;  3IFC A;  1N3W A;  4DXU A;  1IUD A;  2IA4 A;  1B4H A;  3O6I A;  3B6Q A;  4GRK A;  4GD5 A;  4NED A;  1B5J A;  1JW4 A;  4NWC A;  5F1Q A;  1Q9D A;  5ICT A;  4ZED A;  1LFH A;  2G29 A;  1FPL A;  4LP2 B;  2YPN A;  2WKY A;  3IOR A;  1S50 A;  4HXV A;  1R9L A;  2CZK A;  2REG A;  3W9V A;  2I3W A;  5CI5 A;  4MAG A;  2HCA A;  3G3H A;  2VD2 A;  5JTY B;  3D4C A;  1MY1 A;  4FOR A;  3H4Z A;  4ECF A;  1XVX A;  3OEK A;  4IR8 A;  3K1M A;  3CG1 A;  2DXY A;  3TAJ A;  3RPL B;  4N07 A;  4KPT A;  3K1N A;  4NTL A;  1XHY A;  4JXI A;  3SEY A;  2F3D A;  1B1X A;  1UIV A;  3IJO B;  3CSG A;  5TPA B; 
#chains in the Genus database with same CATH homology
 3K0V A;  4GL8 A;  5AA2 D;  2XXY A;  1YAE A;  2DWH A;  3FV1 A;  4QFL A;  3FJ7 A;  1JEV A;  3VLW A;  2GFE A;  3DP8 A;  4IY6 A;  4GLI A;  4KHZ E;  1BIY A;  2IEE A;  1Z7N E;  4QF9 A;  4E0X A;  2XXH A;  2H4I A;  5I56 B;  3IOW A;  2G93 A;  4LAT A;  2O51 A;  3OSQ A;  3JZJ A;  4U1Z A;  5FTI A;  3I5O A;  4G2Z A;  1FQB A;  3MZB A;  5IKB A;  1FCK A;  2QS2 A;  2QS4 A;  3HST A;  4NF8 B;  3C34 A;  5CRY A;  2O1L A;  5DVJ A;  2DYX A;  1D4N A;  1MXX A;  3S4U A;  3UA8 A;  3QUJ A;  5HBC A;  2RC8 A;  2QJE A;  3KBR A;  4JSD A;  1H43 A;  4DIG A;  5CM6 A;  1B3L A;  2Y7P A;  4WXJ A;  1MQG A;  2OLB A;  4G68 B;  4JWX A;  4R73 A;  3JV9 A;  5AA3 A;  1FTM A;  2QPQ A;  1QUL A;  1VSO A;  1B32 A;  3PUZ E;  4FEC A;  1MH4 A;  3RQT A;  2ESN A;  4MBP A;  4PFT A;  4OFJ A;  3ODB A;  4ZZA A;  3PUY E;  5A5X B;  4MF3 A;  3RT6 B;  4WEP A;  3MVW A;  2ZMB A;  2XD3 A;  3FXQ A;  2AYS A;  3T9X B;  5I2N A;  3SET A;  3QIM A;  4JSO A;  1N04 A;  1MG1 A;  2HAU A;  1FW0 A;  3RUM A;  4ESX A;  3TTR A;  4F1U A;  3CVG A;  4PFW A;  2H99 A;  1BLF A;  1QUK A;  3H7M A;  4U21 A;  3G3K A;  3KN3 A;  1L5T A;  4BDQ A;  1MY3 A;  1M5D A;  4F3G A;  1Y3P A;  5AA2 A;  5KDT A;  4LZ5 A;  3S9L C;  5ISU A;  1MH3 A;  3FVN A;  1EZP A;  1N7X A;  4ZEF A;  1B4Z A;  2XXV A;  3O28 A;  3FXR A;  4F3P A;  2Q88 A;  1SW1 A;  2ZYK A;  3EPE A;  3OO7 A;  1MQI A;  4F18 A;  4FAT A;  2H9B A;  3EF7 A;  4IGT A;  4RK9 A;  5LOM A;  3I6V A;  2XXU A;  4U22 A;  1N3X A;  4X48 A;  4C1T A;  2OK2 A;  4H6D A;  4ZDM A;  2DOJ A;  3C9H A;  2ONS A;  1IIW A;  2O68 A;  1MDP 1;  3PMV A;  3O9P A;  3KGC A;  1B3E A;  4I9D A;  4WKM A;  3U72 A;  1NKX A;  1RYO A;  4RXL A;  1A7L A;  3U93 A;  1UQW A;  5AA2 B;  3G3I A;  2NVU B;  2ZNU A;  4ISU A;  3TTK A;  1HSJ A;  1SW2 A;  4NF4 B;  1WVJ A;  3RTW B;  4DXC A;  4F29 A;  1A99 A;  3KOT A;  3QXM A;  4O3B A;  4WED A;  5H8H A;  1R9Q A;  2D21 A;  4MLQ A;  3UK4 A;  2QS1 A;  5CBR A;  3MP8 A;  3ZKL A;  1HSL A;  4IO5 A;  2I3V A;  1B51 A;  2DE2 A;  4G68 A;  5I59 A;  4ZE8 A;  4ZEB A;  2F97 A;  2Q89 A;  3EQ1 A;  3U8Q A;  3FUZ A;  2ZXT A;  4HTG A;  4OVJ A;  3WAF A;  3U1O A;  1D9V A;  3IJX B;  5CMM A;  1FTL A;  1LAH E;  4ELR A;  3FZV A;  3N6T A;  1NMU A;  1MXW A;  4BDM A;  3IAZ A;  1IQ7 A;  3QUF A;  3TTM A;  1H3D A;  4JDF A;  4ZEC A;  1F9B A;  5F7V A;  4QFN A;  1NNF A;  1O63 A;  1IZ1 A;  3S9M C;  2B65 A;  2Z22 A;  3ONM A;  3TOD A;  5AE4 A;  3B6W A;  5H8N B;  3PD9 A;  4IY5 A;  4LQ2 A;  3TYH A;  4YAH X;  4F2O A;  2DXR A;  2V25 A;  2X26 A;  5CMB A;  4TLL B;  4XXU A;  2VOZ A;  1AOV A;  1NL5 A;  3FJG A;  4GXA A;  1IIT A;  4AQ4 A;  4F1Y A;  2O1M A;  1SD3 A;  2NOO A;  4TLM B;  2VGQ A;  3HPI A;  3IOT A;  2ZYO A;  4G8M A;  3U94 A;  1QUI A;  1P1Q A;  4F1V A;  1JET A;  3FAT A;  2A5T A;  4FED A;  4ND9 A;  1GVC A;  1P1O A;  4GWO A;  1KWH A;  3ZKK A;  3O2A A;  1ELJ A;  4OZ9 A;  3VVE A;  3UIF A;  2I0C A;  3K1P A;  1SW5 A;  2F78 A;  2I49 A;  4H8J A;  5ITP A;  3HO7 A;  4ELQ A;  2LAO A;  4DDD A;  1O64 A;  4KR5 A;  3HCQ A;  4GOT A;  4ELP A;  5L8D A;  1MXY A;  4GFR A;  4LA9 A;  5KCJ A;  5KCJ B;  1UTB B;  4ZS9 A;  3GXA A;  3I3V A;  1SI0 A;  3LSX A;  2R9J A;  3QSL A;  1I69 A;  1OLA A;  2H25 A;  1WOD A;  3CFL A;  1VFE A;  5K2Y A;  3TTL A;  5I58 B;  4IO7 A;  5EHM A;  4LZ8 A;  4THI A;  3K4U A;  1MS7 A;  3H6V A;  1N7W A;  1O7T A;  2DQV A;  3CG3 A;  3K01 A;  2GH9 A;  3H6U A;  4YKK A;  2O7I A;  1NH8 A;  3N26 A;  3GBB A;  4X1B A;  1OVT A;  2DVC A;  1MY4 A;  2UVH A;  4EQ7 A;  3M3L A;  3FVO A;  4EDP A;  1PB7 A;  1B0H A;  2PMS A;  2RC7 A;  3SES A;  3JYR A;  1N84 A;  3CSB A;  4KFQ A;  4QFP A;  2XXT A;  3CRB A;  4DZ1 A;  4M1V A;  3SEV A;  1ZJL A;  3S9E A;  1YTV A;  3QYT A;  1Q35 A;  1FTK A;  3C4M A;  4EXK A;  2QMX A;  1EZO A;  3MVX A;  1CB6 A;  4RJZ A;  4OWD A;  1A8F A;  1UTH B;  1SW4 A;  3E13 X;  1B1H A;  1LFI A;  1XVY A;  3FXU A;  3ILU B;  3O66 A;  3PMX A;  4UA8 A;  3T22 A;  3PPO A;  1B46 A;  3GZG A;  2XXX A;  5H8F A;  4POX A;  5TU0 A;  3T66 A;  3IB2 A;  3DP4 A;  1B7U A;  5K2X A;  3K2D A;  2O69 A;  4R9G A;  3BKI B;  1B58 A;  4PFY A;  5FHO A;  1D9Y A;  3OMB A;  4ZEK A;  3OEM A;  4IO4 A;  3PU5 A;  5TP9 A;  4LQ5 A;  5I58 A;  2YLN A;  4R2B A;  1OMP A;  1Y1Z A;  3IO6 A;  4GVO A;  3H6T A;  3G3J A;  3U92 A;  2Z8D A;  5I59 B;  3MQ9 A;  3BFT A;  3H3G A;  4RNS A;  1Y4T A;  4PP0 A;  3THI A;  1DPP A;  1BKA A;  1H44 A;  2ZYN A;  3H03 A;  5H8S A;  5HPQ A;  3T9U A;  3FV2 A;  4OQO A;  4P11 A;  3CR9 A;  4KI0 E;  4TQU Q;  4DE8 A;  3C33 A;  2F35 A;  1HSE A;  1Y4C A;  4GXS B;  2XXQ A;  5EHS A;  3VE1 B;  3VXC A;  3PV0 E;  5CBS A;  1Y3N A;  3PPQ A;  2I6E A;  4KYD A;  4F2Q A;  1JVY A;  2DVZ A;  1US5 A;  2Y7R A;  3C31 A;  2X7Q A;  3S2V A;  4EQ9 A;  4OEN A;  2GHA A;  2THI A;  5DTB A;  3LBS A;  3OEN A;  4ZE9 A;  1JW5 A;  1GR2 A;  1DMB A;  2E0S A;  3MP1 A;  1N76 A;  2AL5 A;  2PX1 A;  3LSW A;  5I2K A;  3FVG A;  3VFJ A;  2RCB A;  4H67 A;  5I57 A;  4F22 A;  1Y9U A;  3UN6 A;  4C1U A;  3Q28 A;  4OES A;  2ABH A;  4FAJ A;  3DLN A;  1EU8 A;  1SBP A;  1VE4 A;  3IL1 B;  4JB7 A;  2AIX A;  3TCG A;  4OYV A;  4N13 A;  3KN8 A;  4PFU A;  5HM4 B;  3L6H A;  1B6H A;  4ZZE A;  1TFD A;  4DCY A;  1S9T A;  2ZNT A;  4LON B;  4OMB A;  2W7Y A;  1PC3 A;  3IK6 B;  2PT1 A;  2NXO A;  5JTY A;  1VR5 A;  4R9F A;  1JVX A;  4OFL A;  2A5T B;  1QKA A;  3Q26 A;  3TCF A;  1UTH A;  4EQB A;  4PQJ A;  4KYE A;  3T96 B;  2O6A A;  2DP8 A;  3R6U A;  2Y7W A;  1SQY A;  3LC8 A;  4X9T A;  3VXB A;  1TWY A;  3ZSF A;  1S7Y A;  1H45 A;  3A3C A;  3F11 A;  1I6A A;  2I58 A;  3OOA A;  4OER A;  4AB5 A;  1PDA A;  2OCU A;  3C32 A;  4H1X A;  3UP9 A;  5M2V A;  1LBC A;  3O97 A;  4YB6 A;  4HCW A;  3A3U A;  1N0T A;  4F31 B;  4HW8 A;  3S9N C;  1DTG A;  4L17 A;  2YJP A;  4K3F A;  5H8Q A;  3HHF A;  3CIJ A;  4NWD A;  1TFA A;  3M3K A;  4XKP A;  1B5H A;  1OLC A;  1P1U A;  2Y7I A;  2FYI A;  4O3A A;  2H5Y A;  4U4S A;  2QRY A;  4IGR A;  2XXR A;  4P0I A;  5I84 A;  2R71 A;  4GF8 A;  2DS9 A;  2GHB A;  3L6G A;  1LST A;  3FD3 A;  3LUY A;  3O6G A;  3O6H A;  1A54 A;  1NNK A;  4OET A;  2VP1 A;  3N5L A;  4IO3 A;  1PB9 A;  4LVQ A;  2VHA A;  2F34 A;  2NWJ A;  2RF1 A;  4QFK A;  4MLV A;  2F5X A;  1B3F A;  4BDL A;  4E0W A;  2O7U A;  4HS7 A;  2FNC A;  2ZNS A;  3LR1 A;  4NE4 A;  1OIB A;  2A5S A;  1MXV A;  3MZ1 A;  5JEI A;  2HFB A;  4IO2 A;  1LAG E;  1R1N A;  2PBW A;  5H8H B;  5H8N A;  2P1S A;  1LCT A;  3TQW A;  1IEJ A;  3KZG A;  4NF6 B;  2NUV A;  3CFZ A;  1NFT A;  3QK6 A;  3BBR A;  1B52 A;  2ANJ A;  2O84 X;  3PD8 A;  3CI8 A;  5I56 A;  2PVU A;  3RGY A;  4F39 A;  2KLF A;  1YCJ A;  4PE5 B;  4U23 A;  3KSJ A;  3TKD A;  5AA1 A;  2HZL A;  1URG A;  2PYY A;  3IOU A;  5A5X A;  3BFU A;  2XXW A;  4YU0 A;  2UVG A;  1SI1 A;  1VFD A;  3MC2 A;  4YKP A;  1Y20 A;  4JWO A;  3PGF A;  1MQH A;  2HXW A;  4F3B A;  4UAC A;  1QVS A;  3K6X A;  1UIU A;  4O3C A;  5FTH A;  2DSF A;  3UOR A;  4FIM A;  4NF5 A;  3H06 B;  5L9S A;  1JNF A;  4H0W A;  2UXA A;  4R75 A;  2DWJ A;  1P1N A;  4IB2 A;  1B5I A;  4QHQ A;  3K6W A;  4YKI A;  2ALU A;  5I57 B;  1B3G A;  3VVD A;  2V3U A;  1B9J A;  1RYX A;  4QSD A;  2Z8E A;  1B7H A;  3PUW E;  4YZZ A;  3V8X B;  1AIV A;  3TEP A;  3IR1 A;  4I1D A;  1ATG A;  5I2N B;  3MPK A;  1H76 A;  2Q2A A;  1MQD A;  4XKR A;  4JBZ A;  1II5 A;  3IOV A;  3Q27 A;  4RA1 A;  4H8I A;  4F19 A;  4R72 A;  2I0B A;  1XT8 A;  2P2A A;  3W15 C;  1XOC A;  3D4G A;  1SYH A;  4U2R A;  3B6T A;  3T9H B;  3V83 A;  1B05 A;  5DYH A;  1SDX A;  1EH3 A;  3MPL A;  4IO6 A;  5TPA A;  1B3H A;  5L9M A;  4R74 A;  3FVK A;  4GQO A;  4BLA A;  3PPN A;  5CMK A;  3DEL B;  1NH7 A;  1URS A;  1XC1 A;  4G8N A;  3PPP A;  4GL0 A;  1MRP A;  2HEU A;  4R6K A;  3USD A;  4BDN A;  1AL3 A;  4YMB A;  1MY2 A;  1ZKB A;  3E9X A;  2OWS A;  3SEX A;  4LZ7 A;  1LB8 A;  1QUJ A;  1MQJ A;  3GLB A;  1ZBM A;  3IB0 A;  3OO8 A;  1LLS A;  4H5G A;  1JW1 A;  2RCA A;  3KEI A;  1TXF A;  3KJT A;  3DM0 A;  3E4R A;  1M5C A;  4G4P A;  3FAS A;  4RYA A;  5DEX B;  3SEW A;  3TDJ A;  5ICQ A;  2DWA A;  5H8Q B;  1Y3Q A;  3PPR A;  1QJM A;  5KZT A;  1CE2 A;  3HN0 A;  2V3T A;  1B40 A;  2OZZ A;  4OXV A;  4NF5 B;  1IXG A;  2FA7 A;  4XKQ A;  1POT A;  3LSF B;  3N94 A;  1UTB A;  3PMW A;  4KCD A;  3K6V A;  3TTN A;  1ZU0 A;  3LSL A;  4H5F A;  3T93 B;  3E3K A;  1FQE A;  3CFX A;  2HAV A;  1M5E A;  5FHM A;  4OTE A;  3PUV E;  4H65 A;  3MAM A;  3MJN A;  1GTK A;  5JK4 A;  5DT6 A;  4N6P A;  1MM7 A;  3IB1 A;  3TFL A;  4X1D A;  3UGW A;  3IO4 A;  2QMW A;  4Z0I A;  1DOT A;  3SDF A;  1LB9 A;  5B7D A;  4EXL A;  4FJP A;  1Q1K A;  1YPN A;  4JWY A;  3SER A;  1SVX B;  2X7P A;  4FE8 A;  1IXC A;  2ONK E;  1P99 A;  2Z23 A;  1D3K A;  1MPD A;  3C36 A;  4KCC A;  2R6G E;  3O29 A;  4EF1 A;  2QSX A;  4ONY A;  5AA4 A;  1WDN A;  3QAX A;  2RC9 A;  3MP6 A;  4HCY A;  3TZA A;  1URD A;  5B70 A;  5L9O A;  2D5W A;  1DPE A;  2UYE A;  3KN7 A;  4Q8R A;  4PET A;  4KD5 A;  5AA4 B;  1RKM A;  3W9W A;  2UYF A;  3EN3 A;  3OO6 A;  1TT1 A;  3G3F A;  4OHN A;  2B3B A;  1I6Q A;  3Q29 A;  4YB7 A;  4RY1 A;  2Q2C A;  1MXZ A;  4XKN A;  2VD3 A;  3PUX E;  1FQD A;  1NNT A;  1FQA A;  3A09 A;  4EF2 A;  4QRZ A;  1R6Z A;  5CC2 A;  2V93 A;  4MH5 A;  3R26 A;  4RPN A;  1FQC A;  1A55 A;  4TOZ A;  2XXI A;  5FHN A;  2UVJ A;  3H6W A;  3ILT B;  4R6Y A;  5BUU A;  4Z7E A;  1LFG A;  1OVB A;  2B3F A;  3TUS A;  3RPW A;  4KYS A;  3R7X A;  3Q25 A;  1PBP A;  4QSC A;  2ZYM A;  3AXF A;  2DE3 A;  2HQ0 A;  4G77 A;  2I4C A;  2XD2 A;  4YIC A;  4POW A;  5ELV A;  3TEL A;  4ELO A;  1XS5 A;  1J1N A;  1I6B A;  4R6H A;  5I2K B;  5ITO A;  3VV5 A;  1M5B A;  4FEB A;  3OXN A;  3KOS A;  3RT8 A;  2XX9 A;  1ZTY A;  2CZL A;  1LGB C;  2M8C A;  2XX7 A;  4I8C A;  1BP5 A;  3V5A A;  4U1O A;  2D3I A;  4AB6 A;  4Q5T A;  1PB8 A;  1FQF A;  1Z7M E;  5EYF A;  3VVF A;  4P0G A;  4DXB A;  1OQG A;  4QSE A;  2PT2 A;  3EHU A;  1USY H;  3K6U A;  2H98 A;  4M4G A;  4OFO A;  1MY0 A;  1JQF A;  3C35 A;  4RPO A;  3MVZ A;  3K02 A;  1IXH A;  1USY E;  3HV1 A;  4I62 A;  4NMY A;  4OEV A;  4XTC Q;  1MPB A;  3RNN A;  1GGG A;  1FTJ A;  4BDR A;  3MBP A;  5TP9 B;  2V3Q A;  3B7D A;  3KG2 A;  3SEU A;  4YMA A;  4NF4 A;  1JEU A;  2E1S A;  1B0L A;  1OQH A;  3KFM A;  3N6U A;  1B7Z A;  4G8H A;  4NF8 A;  4R2F A;  1P1W A;  4U4X A;  3TPA A;  3VLV A;  1AH5 A;  1ZLQ A;  3WAE A;  3G7W A;  2F7A A;  3MUQ A;  2RIN A;  1POY 1;  4RK2 A;  1N3W A;  5H8F B;  4DXU A;  1IUD A;  3OSR A;  2I4B A;  2IA4 A;  1B4H A;  2DE4 A;  3DP6 A;  3K00 A;  3O6I A;  1ANF A;  3B6Q A;  4GIZ A;  4GRK A;  1T0K A;  3M8U A;  4GD5 A;  3MZ9 A;  2F36 A;  4NED A;  3RY3 A;  1M5F A;  3SKP A;  5IAI A;  1B5J A;  3FGS A;  4ESW A;  5BWJ A;  1A8E A;  2QS3 A;  1JW4 A;  3HHG A;  4NWC A;  1MXU A;  1QKB A;  5F1Q A;  5DEX A;  5ICT A;  4DLD A;  3V89 B;  4ZED A;  3P7I A;  1LFH A;  2G29 A;  3RLF E;  3TCH A;  3G3G A;  4G68 C;  2HZK A;  1DTZ A;  2DWI A;  1GV8 A;  3RTF B;  3TQL A;  5CMC A;  1IXI A;  3FJM A;  1PEB A;  4LP2 B;  3EHT A;  2YPN A;  2WKY A;  1QW0 A;  3IOR A;  2ONR A;  2REJ A;  3TMG A;  4KQP A;  2Z8F A;  4EUO A;  1FTO A;  1S50 A;  3FIR A;  5DVI A;  2OJT A;  2RKM A;  4BDO A;  1R9L A;  3KJ7 A;  1SYI A;  1BTJ A;  4Q0C A;  1LAF E;  5KDT B;  2XX8 A;  2Y7K A;  2F6G A;  2OBG A;  3MW0 A;  2REG A;  3M3F A;  2F7B A;  3W9V A;  2I3W A;  3GBA A;  5CI5 A;  4ZEI A;  2V84 A;  2QL3 A;  2BJJ X;  2XXP A;  5J1D A;  5DVF A;  2HCA A;  3G3H A;  2Y84 A;  1AMF A;  3ECR A;  4F3S A;  2VD2 A;  2F8D A;  3MWB A;  3MVY A;  5JTY B;  3D4C A;  1MY1 A;  4C0R A;  2AL4 A;  4FOR A;  3H4Z A;  4ECF A;  2F7C A;  1XVX A;  2UVI A;  1MM6 A;  3OEK A;  3K1M A;  3CG1 A;  3IX1 A;  2DXY A;  1Y1M A;  1MPC A;  3VDF A;  3OO9 A;  3T9V A;  3TAJ A;  2F6P A;  4N07 A;  1NNP A;  1ZMG A;  2XHD A;  4KPT A;  4Q30 B;  4DCX A;  1ZIU A;  2Q9T A;  1LAX A;  1PBQ A;  3K1N A;  3KSX A;  3EHS A;  4LUB A;  4YKJ A;  4NTL A;  4MFI A;  4YB5 A;  1XHY A;  4JXI A;  4XIG Q;  3OD7 A;  3SEY A;  1B2H A;  2P0S A;  3ZS6 A;  4NF6 A;  4QFO A;  3VLU A;  1MDQ A;  2I48 A;  3RN8 A;  2CMO A;  3OEL A;  1B1X A;  1UIV A;  2Q8J A;  2GRV A;  1LCF A;  3IJO B;  1US4 A;  1A40 A;  4OEU A;  1DSN A;  1LBB A;  1EZ9 A;  3CSG A;  2OWT A;  5TPA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...