5DTFA

Context-independent anti-hypusine antibody fabhpu98.61 in complex with hypusine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
207
Chain Sequence
b'EESGGRLVTPGTPLTLTCTVSACSLYHCTMNWVRQAPGKGLEWIGDIYTDGNTYYANWAKGRFTISKTSTTVDLKITSPTTEDTATYFCARDSWDASSYYGLDLWGQGTLVTVSSGQPKGPSVFPLAPCSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Hpu98.61 Heavy Chain
publication title Structural Analysis and Optimization of Context-Independent Anti-Hypusine Antibodies.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 41
structure length 207
sequence length 212
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dtfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dtfA01
1DEDA 4LVNB 4PUBL 4WWKA 5E2UH 2DIJA 2PYEE 3KYMB 5HYEA 4Z7VF 3BZEB 5IFAH 5DHVA 3T2PA 2I26N 4NT6A 5IB3A 3D69A 4L4TB 2JCCF 2W65B 5FUCE 4PLNC 2YXMA 3H9SB 3DIFB 2YD4A 4WTZG 4CVZB 3G9AB 2VDMH 3DGGA 2Z31A 3ALXA 3F65A 4XBEH 1OM3L 4R97C 2QKIA 4JGMA 3RNQB 1DFBH 3KPSB 3T0EA 5SV4A 3UP1A 2EXWD 3GSQA 3TBWA 4OM1L 3SDXA 3R8BB 1P9MA 3V6OE 3SO5A 4XH2B 2BC4B 5GRZA 4E42B 3MFGB 3BGMB 2R1YA 3Q0HA 2CK0H 3AREA 5GRXG 3LKSA 4QHNB 5L9DL 2AEQL 3D2UD 5JQHC 3T0EE 5CJ5A 1X5LA 4WEBL 4YHKH 2GW5A 2CKBL 1GOGA 3VXUD 5CIPA 5F21B 3CXHJ 4OQTH 1IZKA 2YS4A 3ES6A 1OSPL 4PJBB 4PS4L 2IQ9L 5D1QB 2GK0B 3ARYA 4N0YL 1QSVA 1CDIA 3D25A 3GSRB 5E8DH 3DGCR 3OG4B 4LLUA 2R69H 3TZVB 1JWUA 5JR1H 2EEBA 3EYVA 3ESVF 3MUJA 1JHKL 4KY1H 3RL2B 3CVHA 5J11B 1MLBB 1Z0MA 2X40A 2ADIA 5T3XH 3M8OL 2DKSA 5F7YC 3I9GL 2C7UB 4JKPL 5DD1L 2CPCA 3E6FB 3NTCL 5HYSB 2ZCLH 2F54D 2OMNA 5E2TL 1WZ1H 2SEBA 3MV01 4OIIH 1IAII 5GISH 1LD9A 3K4DA 4JZNA 2AJVH 4G8GB 1HH6B 4MXVF 4M48H 4XBPB 1AGDB 2Q3AA 4I18A 3IXAB 3IDYB 4MXWL 3STLB 4CW1A 1F4HA 4LRNH 5I8KH 4OBSA 5ENWB 1PY9A 5HY9B 4WWKD 3P4OA 3O2DH 1EFXD 1A4KB 3ZYZA 4JCLA 4AT6B 4YGVB 1KN4L 3KS0H 4P3DA 2RCSH 4LAQH 5TDNA 5IMLB 4J1UB 1W0WB 2DKMA 2VAAB 3C60A 5EOCL 1AJ7H 3WFBL 2B4CC 3QUYC 2Q86B 3K8KA 1DBJH 2P5WB 3MOAH 2DTSA 4NKMB 2AJSL 2GSIA 1RQ5A 4U7MA 1P2CB 2VDNL 3CFKA 4P5MA 4U3HA 3HZYA 3L3JB 1AFVL 4EUPB 4AIZA 1SEQL 4LEXL 1MJUH 3LIZL 4ODWA 2NXZD 5AD0A 5ALBH 4OTXL 3ARED 3I2CH 4OLVL 4H0HB 3QNZA 1DE4A 2E7LA 4RCAA 1X4XA 5HVGB 3IYLW 5I1IL 2DM3A 2DRUA 2J8UA 1G7MA 3VXQB 4JO3L 5B8CB 5J1AA 3BQUA 4JPVL 4XCCL 3RU8H 1BPVA 3MNVA 4LF3A 5DYOB 2VZVA 4M9OA 2R56H 4HIHB 3OKMA 4DJMA 5BO1H 3NFPB 2W9LA 2J8UE 5J57B 3UBXA 1CE1L 2Q7YA 5IBLD 3U1SH 1TLKA 5F6HJ 2UWEB 5IHLB 3PQYB 1TQBB 4N0CD 4AEEA 2EE6A 2EE2A 2E5EA 3NCMA 2J8HA 5F3BA 1CD1A 3TYGH 4LLQB 1KNOA 2A6JB 4QHMA 4XPTL 4ZOAA 2V9QA 1KCSL 5IGXH 4RAVA 3RY6A 4WUKL 2HMIC 5C3TA 4I0PD 4HPOL 2VZ1A 4LP4A 2C3VA 5D72H 4OFYD 1NFDF 4Z7UB 4JPKH 5E1AB 2N7AA 4BKLA 4HV8B 1QFUH 3UJJH 4BK5A 5EOTB 3HAEB 4NQVB 1JZ7A 4CJ1A 1N2RB 2X4TA 1IGTA 4X99B 4NKOB 1CE6B 3NZHL 5AYUH 4ZTPH 3MV8B 4JQVA 2CXKA 2RB8A 5LG1A 2OZ4L 4ODUB 5EU4A 5TQ2L 3T65B 4NCC1 1DBML 4HG4J 4DKEL 4AL8H 1HSBA 3WFEL 2ZCHL 5C6TL 3P30H 1U6AH 2F5AL 4UV4L 3ZYOA 3C5ZC 4L3AA 4J3TA 4N0UE 3CSYB 4JKLA 4M4RA 4AQOA 1XR8B 1C5DB 4Y5YB 1I7RB 5F6IC 1NFKA 2ZSVA 1RZIB 4ENEC 3FB6A 3B2VL 4HS8L 1T89A 2GTWA 4PJDA 5IROC 3PWNA 4MCZA 4HUVA 3E2HB 1ZHKB 4MNQA 3ZSSA 1KXTB 1XCTA 5FIEA 1H5BB 4P5TA 5I30L 3CX5K 4PGCB 2CKBB 4HFUH 3BKCH 2V5RA 1VPOH 3S88H 4PJDE 5HXMA 4A6YL 3LN4B 3HZKA 4KROC 4MNQE 1FC1A 2HP4A 3RZCB 1F11A 3BQUD 1KPRA 4C55A 2EIDA 3RDTD 5D2LA 4ZO9A 2XKUA 4OCMC 5B22A 5C0JB 3IDGB 4I77H 1MCEA 4ZD3L 5I15H 1L7TL 5EUKA 1VFBB 5BS0B 5K59E 5IJKA 3AY4A 3UDWC 1GGIH 1QBLH 4UB0L 4D0CA 3WFZA 4EUPH 4Y4KA 3I6GA 4YHLH 4MA8H 1J9CT 3ILPB 4U6YB 4PJ8A 2XWTA 2OK0L 4U6VH 5D2LE 4W6YB 5B39G 3BUYA 3TO4B 1KLGB 3A6CH 5EIVA 1A1NA 1U92B 1A7RL 4I4WB 3GK8H 2AKRA 4LSPL 2OSLB 1AKJA 4HHAA 4M8VA 1YNTB 4TOYL 2EIZB 4YHML 1RJYB 4FXGB 3U7YL 3VI3E 4KQ3H 4ODSH 4FFVC 3T0BA 3VGEA 4IHOB 3RVWD 3BW9B 4ALAL 2VDQH 4GW5A 4DKAA 2XWJB 3M17A 3SGDI 4JY6A 5KSUB 1JUFA 5IF0B 2UY6A 4XPBL 4WHCA 2J6EA 5I73C 4XAWH 1HHJB 4LQFL 4WW2B 5IQ7L 3VXOA 1OGTA 3D85B 2DL2A 5E8EB 3CVHL 1ZHLA 1DZBA 5DS8B 1ZANH 3H3BC 3PHSA 1XGTA 3SHSA 2BY0A 3QSKB 4XWOD 1LE9A 4NO2B 4QHLB 3ULSB 5AG9A 5GS1B 3HAEH 3WL9A 3OKNA 1YEDB 5H94A 4XAKE 5EC2A 1ES0B 1PX4A 1R3JA 3QO1B 1VDGA 3QUYD 1TQCC 2R2HB 2CLVB 2ZPKH 4PG9B 1WWCA 3DV6A 5K9OA 3Q6GL 4ZXBA 3UJTL 2J8OA 3SGKA 2YD8A 5INCA 3TJHD 1Z9LA 2LTQC 1KIPA 2VN4A 4KH2A 4IBLT 4Q9BA 5TE4L 3VRLF 4XZUA 5LAXB 1F3RB 2DMKA 5FKAB 1QSFE 4U31A 1FGVH 3O6FA 2D9CA 3SDDA 2OLDA 5BRZD 4O58L 2APVA 5CSZB 3TV3H 1P7QD 3QWOB 3AUVA 4KXZI 2Q8BL 4BH8A 4A2LA 1ZAGA 3WNKA 3FQNB 3QJFA 2I9TB 2CKBH 1NJ9B 1EH9A 1WBYB 4GKZB 3QHFL 1OGAA 3PWVA 5FO7A 2G9HA 1OSPH 3PWPD 2IQ9H 3S98A 1NBVL 4N0YH 4ZUUA 1AC0A 1UH4A 3D2UB 5DTFA 4L4VA 2F9BT 3SY0A 3JVGA 4LRIC 2FATL 3VXUB 1OGAE 4I5BB 4WUUA 3WHXB 2NY3D 3HB3D 2HKFH 5F9JB 4J3OC 2XIDA 4WU7B 5HGDB 3ZTJH 3VXNB 2IH1A 4PGDB 2R29L 4WFED 5GS0H 2M26A 2BHYA 4CVXB 3I9GH 3INUL 4N8VA 3SGJC 4L4VE 1K3IA 4JKPH 5DD1H 1GHFL 1RHHB 2C26A 5GGVL 3NTCH 3MLVL 1DVFC 1ZLWK 1NGPL 4MQSB 5B39A 3U9PL 1QFHA 3RA7L 1YC8A 3PDOA 3LRSA 2BNQA 1WFOA 3OWEA 4PRBA 4GRMB 3I75B 2V5TA 4I3RH 4L8CA 1NQBA 2ICEA 1V05A 5F1IA 4LVHB 3JWDL 4MXWH 2F54B 3BZ4A 2A6KB 4DGYL 2GJ6A 4M62L 5EO9B 2BNQE 3DUUA 5GZNC 4IIQC 3HKFA 4PP1D 2DQIL 4AM0B 1I8KA 1I9JH 4LPCA 4S1RL 3C5ZD 3GBNL 1KN4H 3MJ7B 3U30C 4F7MA 3HUJB 3BDYL 1A7OL 1ED3B 1ZK9A 4GW4A 4A6YB 2EC9T 4RGNE 5EOCH 3TESA 3WFBH 2BVPB 1U8QB 2GJ6E 4NBXB 4IRZL 5I1HL 4WWKB 3DSNA 4N1EA 1LEGB 5DVNA 1X6NA 1EHLL 1FV1B 2P49B 3IAQA 1A3RL 2VDNH 3LDBB 4NT6B 1ACZA 5IB3B 3D69B 3W39A 1AFVH 5KS9A 5DGRA 5TF0A 1SEQH 2RGSA 4LEXH 3LIZH 3BOVA 4GQPH 5JDSB 1NL0H 1BGXL 4CGTA 2Z31B 4OLVH 4GXUM 3GHEH 5GRYA 2QKIB 5I1IH 1NCBH 5HDQH 4KROD 4OF6A 3T0EB 5I16A 5F7KC 2AEPL 4HH9A 2YKLL 3GSQB 4LFHG 4JO3H 2BNRD 4QXGL 4UIKL 4WI3A 3IU4L 3SDXB 4JZJA 4YZFE 5KS9E 3ARPA 4POUB 2QSCL 4XCCH 3H9HB 4O2FA 4YHYC 2NXZB 4N1CA 2EICA 3AREB 1L0XA 1FSKC 1ZVYA 1FL6A 5GRJL 3SEPA 1CE1H 1LK3L 5C0BA 1A02N 1NCWL 2P44B 4KDVA 3X13A 3G9VA 3ARFC 4WUUD 5I1CL 4P46D 2AQ3A 4IMKC 3ES6B 3QCUL 5E70A 3IRZA 3NA9L 2F74A 3UMTA 2GT9B 3QXAB 4CNIB 1ROWA 3G5VA 3D25B 4KWUA 1KCUH 4LLUB 3CPLA 2GEEA 1F2QA 3MGTA 1JWUB 3C5JB 3DLQR 3EYVB 5C0BE 4XPTH 1KCSH 1QNZL 1VFOA 1JZ3A 1MCFA 2ADIB 4HPOH 4YX2H 3MROA 2EYRB 4LCYA 3LKPB 3IGAA 4FFVD 4DK6A 1AHWA 5FCUL 1VEPA 1CGWA 1NMCC 4Q97A 1P69B 2BK8A 2ATPB 4OFDA 2FX7H 3NZHH 1ZLSH 2YN5A 3VMPA 5E8OA 5MI0C 5TQ2H 1K4CA 3GJFA 1DBMH 5EFIB 4DKEH 3O6LL 3WFEH 2ZCHH 2F5AH 1C1EL 1CGSL 2EDOA 2HRPL 4CW1B 3QA3A 1IGJA 1G0YR 2Y36L 3P4OB 3O4OB 4WU5A 1YNLH 3B2VH 4HS8H 1Z9MA 2HA1A 1FVEA 5F88A 2VTFA 5KJRL 4F7EA 3W82A 1P1ZB 1JMXA 4ZUTA 1HOCA 1UXSA 5HGHA 2J6EL 2B1AL 2C1OA 4FFWC 1AD9A 5FO9B 1RZJH 4PJXB 2GSIB 4PBXA 5E2VH 4JPWL 4A6YH 1NBYA 4DW2H 4P5MB 3HZYB 4KTEL 4R7NB 5I74B 1UADC 4AIZB 1WZMA 4ODWB 4L9LB 5AD0B 4BSVA 1OTUD 1NLBL 5E5UB 4ZD3H 5JOFA 3G6AA 3QNZB 1L7TH 4L5FH 4OZ4A 4I3GA 1IKNA 4ONGH 1KXQE 4N1HB 2J8UB 1G7MB 4GMTH 5J1AB 3BQUB 3IFLL 1KYOJ 2OK0H 3RDTB 4LBEA 1IC5H 3MNVB 2KKQA 4CU6A 4N90D 2EC9U 5FYJD 1TCRB 2BOBB 3OKMB 4J7RA 1A7RH 2EO1A 1DQJA 4GAYA 4LSPH 5I0ZA 1Q38A 3RBSA 4I1NB 4K71B 2Q7YB 2AS5M 2YOCA 3EZJB 4PRPE 3IDIB 4YHMH 3KPLA 5E08L 3U7YH 5EC1A 3V0VB 3BP7A 4JHWH 1W0VB 5F3BB 1T03L 1AP2B 1H3WM 1ZWIA 4K3JH 4BM7A 4GBXC 3HE7C 5ISZE 4G43A 5HD8D 5CJXA 4MD0A 5DMYA 1RZKL 3RIFF 4XPBH 1U8LA 4QTIL 4LQFH 2X1OA 2X4TB 1IGTB 2VITA 3WO3B 4NN5C 5EU4B 1RUPL 3D0LA 4O51A 2IG2L 4GS7C 3GSWA 3U4EB 2H26A 1FNGA 1J5OL 3MRHA 3P2TA 3G08A 5JOEA 4YPJA 4JFFD 2YUVA 3FB6B 4PRHA 2A74A 4PJDB 4OV5A 4H1LB 2XPGA 3Q6GH 3PWNB 3P9LA 4HUVB 3MBXH 3H3PL 3VFOB 4KK6C 4MNQB 3VWKA 1JI1A 1D5XB 2WIIA 1XCTB 4U1IA 4XT1C 1HXMA 1HHGA 5TE4H 1IQDB 3VFGL 1NEZA 1ZSDA 2V17L 5TGBB 3MR9A 4O58H 3ROOA 1II4E 3HZKB 4NIKB 3ETBF 5D1ZA 1IGIL 4MB5A 4DZBA 4PGEA 3FCTA 3DX7B 1KPRB 4GUPA 1BREA 4NUGL 5EUKB 4G80B 4PY7A 4P59L 5BRZB 1F4YL 1MRFL 5GGRA 5FM5O 5FM8A 1M4KA 3I6GB 1BJMA 3TIEB 3ARFD 5HDBE 3Q1SL 4OT1L 3C6LC 2FATH 3BUYB 3WJLA 5MENA 3UTPE 1AQKL 4HDIA 1ZT7A 1WICA 1A1NB 4C58B 5KVFL 2R29H 2AKRB 5E6IC 3STZA 1AKJB 4ZFZA 4YK4B 1GHFH 1XCQB 1R24B 3MLVH 3TVMA 2YD7A 1T1ZB 1HQ4A 5MENE 4FFZL 5IEKA 2I5YH 2NY3B 4NZTL 3RA7H 4GH7B 4POZD 3BD5A 3PP3K 1R5VA 2DS4A 5JO5B 4UNTA 4X8XA 1T0PB 2HTLD 4QO1A 3FRUA 1TJHH 4NFCA 3JWDH 4CDHA 4UTBL 5GGSA 3M17B 1JUFB 5LBSL 4DGYH 5CGMA 4M62H 5J7CC 3K0WA 4F15B 2ZUWA 2PO6C 4GMSL 2X1QA 1UJ3A 4H20L 3VXOB 1OGTB 4S1RH 1H3GA 3MACL 3BDYH 1U95B 1A7OH 3C87A 3HNVL 4P2RD 4HS6A 1XGTB 3CZFA 2O61B 2AK4A 4PD4K 3D0VA 4TN9A 3QT2A 4PRHD 1E4XH 4IRZH 2YEZA 4RMTA 1J8HA 2VABA 3OKNB 1ZV5A 3O0RL 1GC1L 5H94B 2EDNA 4WTWA 4J2XA 5DJ0B 1A3RH 4WFHE 1K6QL 1R3JB 2AK4E 2JJTA 3BH9A 1A6VL 3N1QC 1HIML 1J8HE 3BX7C 4PJ9D 3DV6B 5K9OB 2FX9L 4N5EC 1BGXH 3O3EA 2LU3A 5EU6D 4ZXBB 5HI5D 1J87A 2IBZX 3AU1A 3ZT6A 4MDIA 1OOAA 4RWYL 4B53A 3G5YB 3UC0L 4HSQA 4PPTA 5CZVL 2VLRA 3QNXA 3IU4H 1R3IL 3W0WA 5D6DC 4FQJL 5BQ7A 2RHEA 2QSCH 3T0XA 2P7TA 3KS0J 4U6TA 3BEVA 5T1LD 2GSGA 3SDDB 3RX8A 5DQ9A 1SEBA 1EDQA 2DLHA 5GRJH 2VLRE 1B9ZA 4EZMA 1NGXA 1NCWH 1RUAH 5I1CH 4M6ML 3VE0A 1OW0A 2G9HB 3NA9H 1KEML 2MKLC 1CD8A 4KKBC 4NN7B 3HHRB 5DTFB 4UT7L 4HUWA 2NX5D 3KGRA 4QCIA 3SY0B 1F6AB 1T22A 4YDVB 2AV1B 4NHUB 4YBLC 1BFVH 3EOBB 4PLJD 3FO9A 4WUUB 4PB9L 1QNZH 2ZG2A 4P46B 4NQTA 4LSVL 4U7KA 2DB8A 1LP9A 3WFHA 5DJ6A 3HG1D 1JMZA 4N8VB 4ZNEE 2IC2A 4NRXA 2GITB 3K2UH 3LKOA 4F37F 2JJSA 3QIBC 3HC3L 1KPUA 1LP9E 3LRSB 3DPBA 2NZ9D 4WFGD 1MRDH 4ZOEA 1YMHA 3TFKD 5J6GA 2ICEB 5HYJA 4F57L 1CGSH 1PKQA 4EIGB 3G6JF 4RGNB 1KTKE 3BZ4B 2DF3A 2GJ6B 3PP4L 4WI5A 3ZKND 5IKCA 2Y36H 4F2MB 3PV6A 3MV9A 3DUUB 2YRZA 4ZS7L 1I8KB 4Q58C 3VH8G 4RGOH 5HYJE 1KN2L 4F7MB 1R5IA 1PKQE 1NC2D 3L3IB 3RY5A 3RQ3A 3H2WA 3CGTA 3P4NA 3AM8C 4CAGA 1HI6B 2N1KA 1Q8MA 2B1AH 2J6EH 2X10A 4ZTOL 3MRRA 4XNMA 3MV9E 5DDHB 4NZJA 1FH5L 3BFOA 5E8NA 4FA8A 3V6OC 1BWWA 4KK6D 1KT2A 5C1MB 4JPWH 5T1KA 4KTEH 3W39B 3W0WD 3KLSA 4NQCA 2ILLA 3WNLA 1ZA6A 1RIHH 3QQ3B 4D0DB 3KPOA 5JPMA 5DJCB 2XV6B 4HKZB 1CDUA 2BVYA 3L3KA 4OAWA 4Q6IB 3RGVA 3MJ9A 1UCBH 5JZ7C 4OB5L 4QTHA 3FQXA 3LPWA 4L3CA 3U79A 2CSPA 2D7MA 2D0FA 4NNPL 3QAZB 1W8NA 3MLTB 4HH9B 5I16B 5D93C 3QDJD 4JZJB 3C8HA 3IFPB 4G6AD 4M7KL 3NMEA 1L9NA 3IFLH 1S7SA 2NNAA 3QXVA 4EEEA 1IRAY 1MY7A 4RGMB 3DTXA 1C5BL 4RFNB 1ZHBA 3V95A 2YSSB 1DQML 2PETA 4HC1H 1E28A 4PLKC 3JWOL 1CGYA 1M6OA 2F74B 1P5UA 2VUYA 3PWLB 4MNGA 2R2BA 2V6HA 3O6ML 4AH2B 1M7DB 1T03H 3MGTB 5B4MC 5C0IA 4Y2DC 1XGPA 1HCFX 4ONFL 3SPVA 5D70L 3C2AL 3HPJB 3G5ZA 4MNGE 5C0CD 4LCYB 4NM8L 3RL1B 1AHWB 1D5ZA 1MCSA 1MFAL 3TBSA 5IM7A 1EEQA 4M4PA 4Y19D 3FQUA 4JRYD 1RD6A 5JXEA 4KK8C 3OG6B 3IU3A 4RISH 5E8OB 1INDL 1K4CB 3GJFB 1RUPH 2PO6D 4I18C 5JLZB 3TH3T 2IG2H 5ACLA 2BHUA 2WWKT 3MOBH 3VWJC 2C3HA 3ARDA 1HWGB 5F70A 3OSKA 1CDYA 3VXMA 2A73A 2WBWB 1F02I 3QA3B 4BSJA 3WUWA 1IGJB 1FP5A 1A4JA 2W0KA 1HKFA 1CFNB 4WHDA 1HH9A 5I75C 3GNMH 5F9WC 4QT5A 1FVEB 4TUJB 5F88B 3FFCA 3MNWA 3C60C 3OL2A 3H3PH 5D7IB 4PJAF 1PGRB 5KBNC 3N85H 1NCNA 3IDNB 1J0HA 4NQCD 4UV7L 3VXME 4ZUTB 3FMGL 1HOCB 3KR3H 1UXSB 4XVSH 4NNYB 3ARGC 3D3VD 3DO3A 2XA8H 1AD9B 3VFGH 4XCFL 4FOMA 3U7WH 2V17H 3IF1A 4NRYB 4K9EH 2FJFA 1DANT 1NBYB 5M95B 2HT2C 1QVOA 4OKDA 4P4KC 4HLZH 3B2UC 5I66A 4M5YL 2Y9RT 5ID1A 4P23A 3O11A 1Q1JL 4MA1B 1CXFA 2EIEA 3B9AA 3UBXI 4HUUB 2ADFL 3G6AB 2VSDA 1U8IB 4OF5A 4P59H 2ATKA 4PJFE 1MRFH 3B4NA 1E6JL 3MRJA 5GSVA 2X2YA 4KRPC 5CP3A 4LSUL 4XCEA 1JZ4A 1XGRB 4OT1H 5H8DA 3B9KC 4RZCA 3P0VH 3GMLA 5HPOA 1K8DA 3B43A 4WI4A 1AQKH 1ZLVH 4G6KL 4Z7VA 5T33H 1TDQA 5KVFH 5E03A 4OFIA 4GAYB 1MVFA 4XP4L 1BLNA 5DFVC 5TDOA 2Y72A 2X4NB 1FLRL 4YHPB 2V9RA 4KZDL 4UIMA 3DBXA 5SX4H 3PUCA 3K80A 3KPLB 4FFZH 5F44A 3FRPG 3GMNA 4NZTH 4ZS6D 4M7LT 2VQTA 1F13A 2O5XH 5D7JC 3CDFA 5EC1B 5IK3A 4DGIL 2VH5L 1BFOB 1XAUA 4PRID 1TETL 1ZWIB 5JXED 4JRXD 2E7MA 2YUZA 4M9PA 1B0WA 2EEDA 5TDPA 3PDGA 4FXLA 1HKLL 1NANH 4G43B 5FYJH 4G9DA 1U2CA 5F96L 3T3PF 5LBSH 5EG6C 1XGQB 3AB0B 1U8LB 1T0MB 2FGWL 4H20H 4G6FD 3P0GB 5DVLA 1ITBB 4PYHA 3MACH 3LS5L 43CAA 3KLHD 3HNVH 3JWNC 4KJPD 4HT1L 1I7UA 8FABB 5I2IB 3D0LB 2YPKA 4O51B 3FFCD 3WLBB 5J06A 1FRGL 4FG6C 4NKDA 3I02B 5KSBF 3S8WA 1GC1H 3O0RH 1DP0A 1QOKA 3G08B 5AZ2H 1T89C 3RIFK 5HHME 1K6QH 4P2RB 4Y5XA 3GJFH 1J0ZA 5B3NA 3GMOA 1A6VH 4PRHB 3RWEA 3KPQA 2FX9H 4OV5B 4P5TC 2XPGB 4Y4HC 4LKXB 5E99H 4X5WA 4AQ1B 3BI9X 2HT3D 4DKFH 2WIIB 5E8PA 2NXYC 2B0SL 2FH6A 4RA0C 5BVPH 4U1IB 5CZVH 2BOCA 1DN0A 1WCBA 3VG9C 1HXMB 4UT9L 1HHGB 1B4RA 4FQJH 1JNNL 5E5MB 1NEZB 4K7PX 3QIWA 2IAND 4XMPH 1ZSDB 1BVLA 4FZ8L 5JZ7D 4PJ9B 3MRNB 5EU6B 3ROOB 5MEOA 1A7NL 4NYLA 5EOCJ 2J4WH 1SBSL 4JVUA 4PGEB 2EIBA 3FCTB 5HSFA 3VU2A 1QFWM 3L5XL 4OCXL 2ITCB 5B21A 1FAIL 2BY1A 1E4KC 1AR1C 4ZUVA 4M6MH 2D31A 3MLSL 1S9YA 2DIAA 5T1LB 4PY7B 5F7DB 1NC4A 5GGRB 4TQEL 4JY5L 2CJUL 2XN9D 1NAKL 4R0LC 4EJ1C 3P73A 6CGTA 3MJ9L 4OZHA 5KAQF 4PB9H 4HDIB 3S37L 2GKIA 5J12C 2WZPD 2EXYC 1FORL 3QI9C 1DUYB 5JIPA 2Y6SC 5E56A 1U8HA 1YPZA 4H25A 1H8OA 4ZFZB 2DWDA 2Z4QA 4Y2DD 3SE3C 2WANA 1MHCB 1HYRC 5E1HB 2CIKA 3TVMB 1I7ZA 2X70A 1DANU 4OZHE 3TA3D 1CG9B 1VADA 5BW7C 3HC3H 3FT3A 5IEKB 4YWGL 1CGXA 2O26U 5IHUL 3G5XA 3V8CA 4GQ9H 5DHYA 1UXWA 1YPZE 1R5VB 1C7TA 4U2ZA 3U6RA 1S5IL 1ZXQA 2ZSWB 1B3JA 4YQXL 3QZWG 5DD5L 4F57H 1KG0B 3BGFB 4XWGL 2R4RL 5GGSB 3HZMA 5T1DL 1PDKA 3U46B 3PP4H 2Z8SA 5GRUL 1KIUA 1KN2H 5HJ3A 5JW4M 2GTZA 4K3DL 1T1YB 2DMBA 1E0OB 1FN4B 3D0VB 3RWDB 3HS0A 2YEZB 1QHOA 2AP2A 1DJSA 1FH5H 5L88L 1DBBL 4N0FB 3X3GL 3DVFA 3ZDZF 3E0GA 3MJGX 4P57B 5IIEB 3H3KA 5D6CB 3ALPA 4MA7L 3ARGD 2E9WA 3RVXD 2AK1L 5CWSB 1OD9A 5DJZA 2YK1H 1R3LA 4HK3J 3MREA 4HJJH 3O3EB 4ODVL 4PP2A 4WV1A 3DMMA 4P9MH 4OB5H 4PRDA 5IFJA 1ZOXA 3IKCA 1SQ2N 3CVIL 4NNPH 5JIKA 4JHZA 2VLRB 4MS8C 3I50L 3QNXB 4P4KD 4FQIL 3W0WB 3O6FC 4ONHB 1VKXA 4M7KH 4GKNA 3R0MA 5BQ7B 1ZGLA 25C8H 2P7TB 4JZOA 4FTVD 1NCCL 4X8JB 4HXBL 2GSGB 1FBIL 2Y06L 3PHOB 1SEBB 3VXPB 2IPUG 5DJ2A 3JUYA 1NGXB 1QSED 2BJML 4JO4H 4KPHH 1KUMA 4UOW0 2MQ0A 1RZKC 2ZUUA 1OAYL 2EDQA 5DMJB 3JWOH 4G5ZL 4X7CC 1Q9WA 1I3RB 4U1GC 4F7PA 4PTUA 3O6KL 4HUWB 1G7PB 5DFVD 4QCIB 3RTQD 5CJ8A 1T22B 1O0VA 3FO9B 4HJGA 4ONFH 2J2ZA 2ZUQB 3C2AH 5D70H 4O5LH 4YDIL 4TYUA 5D7JD 4PR5A 1LP9B 5DJ6B 1IARB 2XWBB 2LQRA 4PJCF 4PJ5A 1MFAH 3W2DL 5EO1A 1WZKA 3EDJA 3LKOB 4ODTL 5HGAA 1VFUA 5ID0A 3DX8A 1MH5A 1INDH 1FDLL 3RZWA 1KPUB 5C0CB 2CLRB 2DLTA 3LRHA 4OGYL 4CKVX 1YMHB 1JGDB 5E9DA 5J6GB 2FO1A 2FHCA 4UQ2A 1NFIA 1T5XB 5HYJB 1YEJH 4Y19B 3C08L 4JRYB 2JIXA 3HNTL 4GSDL 2BVTA 5K9KA 3EW3B 4APQA 5IKCB 4HAFA 4W4OC 3PV6B 3MV9B 3FO0L 4F37K 2NR6C 2O5YL 2OJZL 4MA3A 2HJFB 4WENB 2A6DA 3QZWA 1R5IB 1EO5A 3C5SB 4EVNB 4UV7H 4BSWB 5CBAB 3FMGH 5DZNA 2EDRA 5J56B 3P4NB 1YMMD 3IKKA 4P2YA 3MRRB 1CXIA 4XNMB 1Q94B 3QUXA 5AYQA 1S9KC 1P7KA 2E7BA 4XCFH 3DMMD 5E8NB 4Y4HD 3QHZL 4DN3L 1I9EA 4OZGA 5C0NC 1KT2B 4I13B 5I8OL 2NXYD 2GQHA 4NQCB 3OHXA 1ZA6B 5SX4I 2P8LA 3KPOB 4M5YH 3L3KB 1G7QB 3D3VB 5EBGA 4ZAKA 3CH1A 3RGVB 1MELA 1CICA 1Q1JH 1HK6A 3FQXB 4L3CB 4Q2ZA 2WINA 4OZGE 3EO1A 5IOPA 5F1OB 3WNPA 4R6UA 1PQZB 2X4PB 4NC2B 2YD6A 3QPXH 3PWUA 2HTKC 4LSUH 3NFSL 1AR1D 3ULUE 4M7JH 5FV1L 4OZIA 1S7SB 1JK8A 3L3HA 2DIBA 4G6KH 2FEEL 5IQ9A 3DTXB 15C8L 5FOBB 4HGKC 4OZIE 4HKXA 5A2LH 1CFBA 1IVLA 3EO0A 1M6OB 2V9TA 3QI9D 2Y6SD 2HYMA 1N5AA 4PJ5D 2R1XB 1BQHG 2VH5H 5C0IB 4GKOA 5GGVY 4PJEA 5H37G 3N9GH 3SPVB 1HKLH 3G5ZB 5GPRA 1OTTC 2YXFA 5DJ8B 2BFVL 4XNQA 1JYVA 3C8KA 1D5ZB 2FGWH 3TBSB 4PRIB 3K4AA 1JF5A 3R06A 1PJ9A 1WBZA 3QEHA 4NO3A 4PJEE 1RVFL 5BZDA 3LS5H 3IU3B 5A2FA 3LB6C 2WWMC 4HT1H 4APQD 4TUKL 1D9KA 3IDJA 3FB7A 5BV7L 3QEUB 3U36B 1BOYA 3D5OF 1FRGH 4FQHA 3NCCB 3BZFB 4G6FB 5TFSL 4YFLF 1N4XL 3EO9L 5MERB 5HYFA 3WUWB 4HW6A 1D6EB 3O81A 2CH8A 3QUXD 5I6XC 3JV0A 1HH9B 1IGYA 2J7LA 4D0BA 4GG6F 3RKPA 3FFCB 1F3DH 3MNWB 4X9IA 3KPRA 4MAYA 4QXUL 5EORL 1GIGH 2B0SH 3BWAB 3WHE1 4ZAKD 3BN3B 4DZ8A 1JNNH 1CICD 2VZOA 5A3IC 2DYPA 3IF1B 3MUY1 4TRPL 3KPRE 2IQAA 2I27N 2RBLA 4I2XA 4MS8D 4ZO6A 4WCYL 3L5XH 4LPUA 4OCXH 3WIHA 5A1AA 5GJTH 1FAIH 3S5LA 5ID1B 4P23B 5EIQA 1HQRB 5E7BA 5MHSD 2OMBA 2IANB 3MLSH 3RRQA 1JGLH 3TO2A 2UZXB 4PGJA 3AMKA 1RSFA 4LLVA 3MRJB 1DQQA 5GSVB 4JY5H 1NAKH 4XCEB 3VD3A 3MJ9H 5HHVL 2APBA 3HRPA 2FEDC 4Z7VB 1FORH 3N1MC 4MQ7A 1LEIA 1A9EA 5EBWA 2IADA 2VQ1B 2JCCB 4G3YL 3UPAA 1NMAH 4H8WC 2ERJC 2WUBH 4JM2F 4X5XB 3DBXB 3RKDC 3GMNB 2HLFC 4YWGH 4FS0A 2WUCL 4TNWF 2VE6B 3SDAA 3SE8H 4ELMF 4R7DB 1OP9A 3SCMD 3FO2A 1T3FA 3IFOA 2G60L 2PTTA 4Q7DA 4YQXH 5DD5H 4Y1AD 3OJMB 4JAMB 2B5IB 4N5UA 5IBTL 4XWGH 3TNNA 1JHTB 3REWA 3TA3B 3VFVA 4EOWL 3TWCL 4PJGA 4Y16D 3O4LA 1VSCA 4MCYA 1CFVL 4GRLC 1YDPA 4HUNB 4OFPA 2A9ML 4L8BB 1V3KA 4FP8L 43CAB 3B9DA 2OR8A 4K3DH 4R96A 3M45A 2KZWA 2VR4A 2DQDL 5HI3C 1AO7D 2CDEA 1A6AA 4PJGE 4MQXC 3O4LE 3HMXA 5F9OH 3AAZB 2KQMA 4GFTB 1IQWL 1QD0A 4IRJC 3GI8L 3S9DB 3U82B 3X3GH 5DK0A 2YPLD 4WHYH 1OAZH 5F7LB 4MA7H 1ZLWH 2FIKB 2AK1H 3LAFA 5IMOA 3REVA 5KN5A 3VWKC 3RWEB 3KPQB 4ODVH 1VB9A 1T66D 3NIDE 3KJ4C 4KHTH 2KQNA 5KSVA 1X3DA 2JB5L 4V2BA 5JXAL 5E8PB 1RK0A 1DUZB 2BOCB 1DN0B 3MPCA 1A22B 1WCBB 2XFXA 5CGYC 3QIWB 5D1XA 5D1ZC 1BVLB 1QP1A 4G6JL 4K55A 3VMNA 1EK3A 1FBIH 1N7ML 2RFXB 2DQHL 4PYGA 4NYLB 4ZG1A 4LVOC 4KV5E 3S36X 3UPCA 3CSGA 1P84J 1S3KH 5JMRA 3MXWL 3W11C 4QWWC 1XGUA 4ZUVB 2D31B 3FQRA 2BNUA 3VA2C 4JFOA 5FM4A 4FTVB 4G5ZH 4ESKA 2CRMA 2Q87A 4Z7NF 3ZE1F 5D9SB 3QEQE 3T09A 1NC4B 3VXTA 3QFJE 3WJLC 4RFOL 3ULUL 5IB4A 4P9HH 1QSEB 4OZHB 1KB5A 4DAGL 3LQAH 1OSZB 2UUDK 5HHQA 1U3HA 2C3WA 3SDAD 4YDIH 1TITA 1EAPB 3V7AE 3MV7D 1XF5B 3PL6C 5CP3H 5BV7B 4D9QD 2DWDB 3ARUA 2CIKB 3QHTC 3WCYA 2R15A 2YPVL 2BY2A 3RTQB 5FK9A 5DRWA 1I7ZB 4ODTH 1G7IA 2DLFL 3FT3B 2OTWA 1OTTD 3M1BA 2W0LA 2EYSA 3G5XB 3GO1L 1FDLH 3HNSL 4X98A 1RIUL 5DHYB 1UXWB 3HI5L 3LEVL 1F3JB 5GRVK 3WJJA 3U6RB 1JPFB 1PYWA 4ZPVA 1SY6A 2A2QT 1FIGH 5C0AA 3CAFA 3RWGA 1UJ3C 2WWMD 4GSDH 2V2WB 1INQA 5DMGC 2VAJA 1YEEL 2B8OT 3T1FA 3FO0H 2BSTA 1MCKA 2O5YH 2OJZH 3T3ME 4NUJB 4Z7NE 4D8PA 3RAJL 2BX5A 4HF5L 5HJ3B 5C09A 1PSKH 2IPKA 3UTSA 5C0AE 5IV2B 2GTZB 3A6OA 1RU9H 4JFED 3DXAA 3EOAA 3HS0B 3WNNA 3GB7A 3GIZL 5B38A 1AQDA 1Y6MR 3FT4B 1NH6A 5JUEL 1JCKA 3GI9H 4Y2OA 3QHZH 2XOTA 5LXGL 1BD2E 2JJTC 5C09E 3UTSE 3NIGF 5I8OH 5J8OA 1JWSA 3KWWA 3UZQA 5DQJA 3DXAE 1NFDB 1YMMB 4LCUA 2X5PA 1R3LB 2MPAL 1LO2L 3BAEL 3MREB 2MCG1 5A3ID 3DV4B 4WV1B 4PP2B 3DMMB 3F7RA 4PRDB 1WTLA 4BQ8A 3IKCB 2Y7QA 3O45B 2QHRL 3TIDA 5D5MF 1X9QA 5I8EB 1BZ9A 1G6VK 2H9GA 2HG5A 3ECBA 1VKXB 3NFSH 5BVJB 4XP5L 4DGVL 1CLYH 2E7HA 1JI2A 4W4NA 5IBUG 4F58L 5LQBH 1QBMH 2W9DL 3AC0A 1OW0C 3OKDA 15C8H 5K9JL 3RVVD 1U9KA 4PJHF 1CXHA 2OCFD 5JDJA 5CKGA 1IGFH 1Q9WB 4YXHH 3BKMH 4JE4B 4MJID 1GOFA 1UM4L 4PTUB 4LHUG 3WIHL 1V7NL 2QADC 5ISZD 5EU3A 3TC9A 1U8NB 2C3XA 1FVDA 1GSMA 5GS2D 3Q2CA 1TPXC 1HINL 1I9RL 3RKDD 4HJGB 3CFEB 5ADOL 3WSQL 2HLFD 4DVBB 4PR5B 2BFVH 3ULVE 4AMKH 5JW3L 3L3DA 5L7XL 2JJSC 4PJ5B 2VXQL 3DARA 4FQ1L 3CXDL 4FXKA 3KYOA 2F53A 1S7VA 4LKCA 1RHFA 3GUTA 2IEPA 4JFDE 1T83A 4XNZC 1P4IL 2EH7L 5ID0B 4NPYB 4TUKH 1S9WA 4LNRA 5BV7H 3O2VL 4HGWB 4GRLD 5E9DB 4UQ2B 1NFIB 1SHMA 2PXYA 5TFSH 2F53E 2JIXB 4LLWA 4NN6C 1N4XH 4X6CA 2DBLL 2ZKHL 4O2CB 4U7SA 3MUGA 4PLOB 1KJVA 1G1YA 1YY9C 4U6HB 2FJHA 4APQB 4WJ5B 4DUVA 3QEGL 4FQQB 4BFIA 4IRJD 4MA3B 4HWEL 1I3GL 4QXUH 5EORH 3P11H 1N3NA 1FL5B 1MHHB 4BELD 4X6CE 4P48A 3BMVA 1PLGL 1Z6JT 1JVKA 5HHPA 3QUXB 1P7KB 3RWJA 2BVQB 4X7DC 1K3ZA 4TRPH 3AMLA 4JQXA 4H88H 2X7LA 1ADQA 3F6LA 1JNJA 1MY5A 3UYPA 1ZKAA 3O3BA 2ZOKA 1DL7H 4WCYH 3WIIL 1MCWW 4NZUL 3HMXL 3MBEA 4KI5F 2DICA 2MQ3A 4ZAKB 3CH1B 2A6IA 1CICB 3VGAC 4ZPTB 4MAUL 4LEOB 5EZLA 2Z8RA 3FOLB 1CDGA 2WINB 5IOPB 1AIFB 5JIIA 1G0DA 4QWWD 1JPGA 2VXUH 2X42A 4OZIB 5F7HA 1JK8B 3ORJA 1HEZA 4RMVA 5HHOA 4G9FA 5L2JA 5IQ9B 1MHPL 4LARL 4K94L 1J0IA 1DR9A 4MXQC 2NW3A 3HE6A 3I3EA 4HKXB 5HDOA 2CGRL 3EO0B 3C6SA 1CK0L 5HHOE 3DSFL 4H5SB 4G9FE 2WUCH 4LCCB 4YAQA 1CIUA 1NCDL 4OLUL 3QJHA 2ORBL 2G60H 1A2YA 3TBYA 4MZ3A 2ADGB 1T6VN 2EZ0D 3WMSA 5IBTH 1EO8L 5T5FH 1BZ7B 3L3GA 1RY7B 5DXWA 1IAOA 4M93B 5DMKA 2QQLL 2A0LD 4G42A 4H0GA 4POYA 3ARSA 4JEGB 4XNQB 3C8KB 1RJLB 1DQTA 3GMRA 5DFTA 1CFVH 3R06B 2A9MH 3SCMB 1WBZB 1KB5L 3D87B 1DSFL 3N50A 2ESVA 1RMFL 4FP8H 3IJSA 2NTFB 3IDJB 3FB7B 1VGEH 2DQDH 2NY5L 3ARDC 3I6LD 2HFTA 2VN7A 3EHBD 4OUUB 1JPST 1MCPH 3IAPA 4Y16B 4Z7WF 1HHIA 1I1AA 2IAMC 1SVCP 3GI8H 4EI5C 1OTSD 2ESVE 4KRMB 1P4LA 1PG7W 5C6PB 4WFFD 4TTGA 3MRQA 4D0BB 5L6YL 1LDPL 1SY6L 5FA4A 3KPRB 3PP3H 2CO7B 2JB5H 2D7TL 2X4OA 5JXAH 2YPLB 3L7EA 3ME0A 5T1MA 5J1SC 1EVUA 2FLRT 1YEGH 3MRIA 4TVPD 5GJSL 4DZ8B 1EHXA 5D8JH 2FSEA 4XP1H 5EU7E 4FFYL 3HFML 5KG9B 3X12B 1N7MH 5EZJB 2DQHH 5LWYL 3BHBA 1XFPA 4I2XB 4WIQA 4MB3A 3VXRE 3LD8B 3MXWH 3S5LB 1BM3L 1EJ6A 3CD4A 3VFMB 5D96C 3RUGA 12E8L 1MNUL 4I9WD 3TO2B 3WD5L 4MX7A 2BY3A 4S0TD 4LLVB 2YUWA 1IL1B 3EFFB 4O02L 3C09C 3ULUH 3QDGE 4HIJA 5KVEH 3HE6D 2J5LC 4LSTL 3EYUL 2XXCB 5GSRA 2AABL 4DAGH 2O93L 2WWKO 3CX2A 5DMIH 3WDHA 1WBXA 4MLIA 3RUGE 4BYHA 1GGBH 1I85A 4MQ7B 1A9EB 5EBWB 1FYTA 1UB5A 4LIQE 1YN7A 2FX8L 4O2EB 2PF6A 3RY4A 4HCRA 2ICWJ 2YPVH 3CLFL 4G7VL 4OZFA 2DLFH 5JW4Q 3O9WD 3RWHA 3GSOA 4P2OA 5GGRY 3GO1H 3KLAA 3HNSH 4M00A 1RIUH 3SDAB 1MREH 1FFNA 5H2BA 3FO2B 3MV7B 1Q9OB 3MLZL 2WBJC 2W91A 3NCEB 1INEL 3UO1L 1ORSB 3TNNB 1WC7B 1BF8A 1MCQA 5DHXB 4QRPD 3VFVB 2P43B 2O5ZL 4PJGB 1T21B 4QXWA 4OIAA 1WAAE 4MCYB 1YEEH 1I1AD 3QUKA 3IJHA 4UTAH 4HF5H 1MFCL 1CQYA 4TNWK 1ULVA 5CEZD 2GK2A 3CZJA 3RJQB 1OP5K 5LCVL 4R96B 5TE6H 1WGOA 3GIZH 3V4VL 1A6AB 3MRMA 2E9JA 2FEEI 3IB4A 3LQZA 4UMGA 5JUEH 3DWTA 4Y5XC 3O2WL 3NAAL 5LXGH 5DK0B 3WS6A 3NGBB 3MYJA 5GGSY 1TTGA 2PR4L 1JE6A 3TN0A 1QQDA 3K8LA 3CH8A 4MMZC 3JBG7 4K8RC 1QG3A 3GM0A 3REVB 5KN5B 1F58L 2MPAH 1LO2H 3BAEH 1LO0L 3RVUC 4WNQA 3WEXA 1U8PA 5AAWA 2IFFL 5FGRA 1RK0B 2VLKA 4QNPE 1QR4A 4HIXL 2BMKA 4TNVF 1PAMA 2XFXB 5SWSD 5ESQA 5ESVB 4DTGL 2JTDA 2IGFH 2P8PA 4BZYA 2VLJE 4F58H 1D6VL 1N6QL 4KJQC 2W9DH 3FAWA 5AWNL 4YHIA 2VLKE 5K9JH 2N7BA 1KELL 3UCRA 3FQRB 2GCYA 4OSUH 5IVXF 2RAMA 1ADQL 4C83A 1J7VR 1DLFL 3OAZK 5D7LD 3BP4A 1UM6L 4HK0A 1FYTD 2NYYC 3VG0L 2P45B 5FOJA 4YFEA 2UYLB 3U4BL 1LEKB 3DURA 4JQIL 3WIHH 4YC2C 5IHBA 5HYSG 4MXQD 1MIEL 3OB8A 1I1RA 2X1WL 1KB5B 1HINH 1I9RH 1CD0A 1X5HA 3V0WL 4JFXA 3V4PL 5IB5B 5T3XE 5HHQB 1U3HB 5JTWA 4JM4H 2CR6A 4KAQL 4LMQE 5JW3H 1MJJA 4Y5VA 4FQ1H 1EIBA 1FLTX 2P46B 5DRWB 4HKJA 1G7IB 1HILA 5JHLH 4JHAL 1P4IH 3M1BB 4X6BA 3VGDA 2EH7H 5EBMA 2J3SA 5C70A 1A7QL 1TZGH 5D2NB 3O2DA 2YWZA 3TYFB 3IAGC 3M07A 3CX5J 1J1PL 2D2OA 5B3JE 2PCPB 1S9VA 4ZPVB 4XRCB 2CUMA 4X6EA 4CVUA 4PJ7E 1D5MA 3QXDA 1NDGA 4XMLL 3CDCA 2DBLH 2ZKHH 3RPKA 2X4SB 4WY7L 1EHNA 1INQB 5CS7A 1KCRH 2XRAL 3QEGH 4KVCL 4GG8A 2ADJB 3BPOC 3T1FB 4XXDA 3BGAA 3PIQA 4MWFA 1AI1L 4WI6A 4D8PB 4HWEH 1I3GH 3B6SA 1OB1A 1NCUA 2IPKB 4ZFFB 1DN2A 4EUPG 2OYPA 5T3ZD 1R0AH 3QIUC 4RX4D 4NP4L 4J6RL 1KC5L 3EOAB 3GB7B 4LAJH 3MYZA 3MRLA 1GPOL 2PW1A 3V9FA 2Y25A 4J3SA 4YDKL 3RX7A 5SX5K 3CFDA 3O8XD 5CKAA 2W65A 3DIFA 2VYRE 5DQJB 2VDPH 3WIIH 4JVWA 4KMTL 4LCUB 1NSNL 5FYJU 1F8TH 3NPZB 4U3XA 3OJDB 4L1HA 3W81A 3KPSA 2Y7QB 3LKQA 5CEZL 1WITA 3TT3L 4U0RB 3I85A 1FAKT 2H9GB 2HG5B 3ECBB 1F3DJ 1HYSC 3GRWA 5M7QA 3BGMA 1KEGH 1AY1L 4QHNA 3BD4A 1A1MB 5JHDD 4QKXB 3KPSE 3OPZL 2DI7A 1DQLL 1MHPH 2NY1D 4LARH 4K94H 1GOHA 2MMXA 5J0BA 1A5FL 1JN6A 3K2MC 1T2JA 2CGRH 2FDBP 2GK0A 1CK0H 1X4YA 4LNVA 1AE6L 1BEYL 3GSRA 5KOMC 3HAEG 3TZVA 2B20A 1NCDH 1SVZA 3FQTB 4OLUH 5EU3B 3DUSA 5EUOF 3CK0L 3BIKA 1EO8H 1E4WL 1KACB 1MLBA 4PJBE 4X80H 5MEQB 2NY7H 3OAYK 2YD9A 2QQLH 3KPMB 5F8RC 2H32B 4LIQL 1QRND 3BPNB 5ACMA 3LEYL 4XPAH 2WBJD 4FXKB 5FUOL 3KYOB 3ILQD 2AERT 4WDIA 4KTYA 2JJWA 3CFCL 1KB5H 3QWRD 4R26H 1S7VB 1RMFH 3X3FL 3GUTB 3T0VA 4RMUA 3EIFA 1PZUB 4Z78A 3HC4L 3S4SB 2NY5H 2CDFA 4HJ0C 4HCRL 4Z7QF 4G8GA 1HH6A 4XBPA 1AGDA 3EOTL 2EH8L 1IBGL 4P99A 3NPSB 1QA9B 1ZT4A 5DSCB 1NGYA 1KJVB 3LS4L 5HY9A 4KK9D 5JOPD 2HN7A 5IR1B 5L6YH 4AT6A 4XP6L 4BFIB 1SY6H 2LAGB 5IFHL 4G8GE 5SWZA 1JZ2A 1N3NB 4QOKA 4Z7OF 5IMLA 4J1UA 1C7SA 1ZT1B 2VAAA 4XPGL 2D7TH 1OF2A 1IAKB 2Q86A 2P5WA 4U1LA 1XIWD 5HHPB 1ZA3A 3OKEB 3RVUD 2FECL 4FFYH 3HFMH 3ZTJG 1P2CA 5SWZE 1YUHB 5LWYH 3L3JA 3ULUC 4QOKE 3O3BB 3PF2A 2ZOKB 2UWEF 4LDLB 4U1JB 2P5WE 3MBEB 5CAYB 1OP3K 4H26A 5EZLB 3LCYA 2H41A 1ZLUH 1MNUH 1TVBB 5E5RB 3WD5H 5DUBA 1KULA 1FVCA 4OCRH 1KTLB 3EYFB 3VFRB 4Z7UF 35C8H 3EYUH 2R1WB 2CK0L 1RV6X 4U1SA 1NCAL 3EAKA 4NCC2 5L2JB 3NFPA 4F8QA 3WLWD 1N0XL 1MI5A 3P9MB 5C2UB 2FX8H 3NVQA 4LPTA 4FQXA 2NW3B 3MLYH 3HE6B 4BUGA 3CLFH 3GDBA 4G7VH 1UWXK 4BH7B 4E5XB 4M8QB 2V2XA 4PV9B 3V4UL 4YAQB 1TVHA 3QJHB 2A6JA 4RBPH 1A1OA 1UFUA 3MLZH 1A2YB 4CVWA 2EKSA 4PJIF 3L3GB 5T3XL 3T04D 5ESAA 1IAOB 5DMKB 3NZ8A 5E1AA 3O9WB 4LCWD 2O5ZH 4HV8A 5EOTA 3HAEA 3WNMA 1I8IA 1FE8L 2DQTH 2JE8A 5KSAA 4OLYL 4X99A 1BVKA 1D9KC 1CE6A 2VOTA 3DETC 3MV8A 2I24N 3IJSB 4XB7A 4D2NA 4OIIL 2H32H 1OQXA 5GISL 3T65A 2HH0H 2AJ3A 3UJIH 1K5NA 2VL4A 3F6IA 5F6HI 1H3PL 4M61A 4QRPB 1WIPA 3V4VH 4DVRH 1VEOA 3MLXH 3CNKA 1FFQA 1HHIB 3FN0L 4M48L 4OKVB 1I1AB 3GMPA 2WK2A 3O2WH 4F8TA 4Q9RH 2XG5A 1XR8A 3MV8E 4ZQKA 1I7RA 1P4LB 4KKNA 4YDLC 1X44A 3QIUD 5HTSA 3O2DL 4MAYC 1HN1A 1NKRA 4HAGA 1F58H 1U0QA 2WP3T 1LO0H 1CN4A 1ZHKA 4LHJB 4RAHA 1H5BA 1JTPA 2X4OB 2DQCL 2HLAA 3ZE0E 3WFDH 4NM4L 5T1MB 4HIXH 1QTYT 2DM4A 3BXNB 3MRIB 4Y4FA 2FSEB 2GFBA 4DTGH 1BWMA 5C08A 5L2KD 1JYXA 2DAVA 1UWGL 1D6VH 5CSBA 5IJVA 3BHBB 4YHZH 3ARBA 1CLCA 5AWNH 3G6JB 1AD0B 1MJUL 1RAMA 1KJ3H 1NBQA 4HWZA 3I2CL 5DR5L 2KDGA 4LSSH 5SWSB 5J3HD 4OF0A 4ISVA 3RUGB 1ADQH 1L7IH 1UM6H 3VG0H 1MI5D 1OT2A 3U4BH 4JQIH 4CU7A 4FQXD 4U6YA 3N1PC 4HIJB 1MIEH 4ODHL 4X0KA 4TVPH 3TO4A 5GSRB 4WW2F 1G84A 1WBXB 3V0WH 5BS0E 1I8MA 3AVEA 3V4PH 2Z8VC 4I4WA 5DQDH 5BO1L 3GHBL 4KAQH 1FYTB 2OSLA 1UB5B 4Q74A 1M05A 1UG9A 3I3BA 4TPRH 5D7KD 3GRWL 1C08B 4P3CL 4OZFB 1RJYA 2HFEA 5F7NC 1HSAA 4FXGA 3JV4B 4JHAH 4M1DL 1CXEA 1NGZA 1T1WA 4P2OB 4N68A 4M7LL 3TYGL 2VKWA 1FFNB 5KSAD 4IHOA 4JREC 2EDWA 1PEWA 1J11A 1KF9B 3SQBA 4YEFA 2G5BA 2VLLA 1VGKA 5D72L 5IF0A 4JPKL 1N59A 1ZMYA 3UJJL 4C56D 2XRAH 4HJ0D 4KVCH 4L8SC 3D85A 5ETUA 3QUKB 4BQ9A 5E8EA 3IJHB 4IMLB 5AYUL 4JM2C 2NY2C 4ZTPL 2CMRL 4LQ1A 2P8MA 4NO2A 4M7ZB 3ULSA 2DKUA 5F1NB 4HULB 1G6RA 4U05A 1GPOH 4AL8L 3LQZB 2BRQA 3MRMB 4HWUA 1YQVH 5F9AC 2R2EB 2OI9C 2J1KA 4XP9H 5EBLA 2JB6A 3MYJB 1KLUB 4L8DA 4X6DF 4HEPG 1RFDH 2NMSA 2CLVA 3KXFA 4PG9A 4J4PD 5C08D 4OD2B 3WEXB 1U8PB 1QPXA 5GRVL 5IVOA 3ARBD 4OM0L 3ZE2E 1M7XA 3N06B 4XHQA 5CEZH 3TT3H 3O8XB 5D1XC 2BMKB 5DJXB 2XTJD 1KV3A 1H3TA 3KXFE 4KKCC 1H8SA 5ESQB 1UQSB 1AY1H 3TF7C 3IFNL 3OPZH 3A67L 1LWRA 1DQLH 2E7CA 1DTUA 4JGUA 5I9QC 5CLWA 1C16B 1T20B 1WWBX 4Q0XL 4KJWC 1IKFL 3BP4B 4HK0B 1AE6H 1BEYH 3OQ3B 1GGIL 4TNVK 4U4BA 5JHDB 1MAML 4UDUA 3KJ6L 5GGUA 1U8MA 2NY1B 2Y5TA 3LPGA 3VXUA 3SDCC 1UZ8B 3WHXA 3U0WL 3ISWA 2XZZA 4WU7A 5HGDA 3NIFE 1VA9A 3VXNA 2VC2L 3GK8L 4CVXA 1S7QB 4LIQH 3EJZC 2H8PA 4MB4A 5J6HA 1WWWX 3LEYH 4Y5VB 3SBWA 4F9LA 3T2QA 4WI7A 3VXUE 2HKHH 1GJIA 1W72A 2LVCA 3UPRA 2NY6C 4HKJB 4LU5H 4XBGB 4X6BB 3EJJX 5EBMB 2HFGL 5DEFB 3PHQB 3HC4H 1FNAA 4WEMB 4BFGA 4F9PA 3GBLA 1MCLA 2VDQL 1S9VB 4R3SB 3F5WB 4OZFH 1IBGH 3DETD 1D5MB 1UJTA 2F54A 3QXDB 1NDGB 1QLFA 3TNMA 3S3SA 4RIRA 5EO9A 3VFTB 3WXVH 1RZGB 2AEWA 2ZUYA 3KDMB 4UI2A 1DEEA 3QXWA 4XXDB 3PIQB 5IFHH 3H8NA 5JQ6L 3SN6N 3HUJA 3B6SB 1QHPA 2BVOA 1ED3A 1OB1B 1IEAB 2F54E 3CSPA 5LGHL 2QSTA 1I9IH 4XPGH 4NDMB 3DX6A 3BE1H 3O3AB 1EFXA 3MRLB 3X14B 5HVFB 1LEGA 4JVPA 2PW1B 4S1QL 1K4DA 1FV1A 3HUJE 3CC5B 2H2SC 3U48A 3CFDB 4OJFH 1G9MC 2ZCKH 2AGJH 2CUHA 3OGCB 2E8ZA 2W38A 3VW3H 2ZPKL 2HJLA 5JDSA 5KVDL 1OY3B 3X11A 1XIWB 1MCHA 2DMCA 4NQDD 1XT5A 4WO4C 5DC4B 5EN2A 3UBXG 3LKQB 1KSRA 5A2KH 2A77L 3H9HA 2W60A 3SO3C 2NY4C 4ERSL 1LE5B 1FGVL 5FDWA 4AYFA 1DLHA 2RR3A 3TV3L 1NCAH 4XGZA 3WN5A 3MRGA 4EXKA 1N0XH 4MLSA 3SDXE 5BOPA 4UZGA 1JN6B 5BCAA 3ULVC 1WT5A 2A9NH 4F3FA 1TZHB 2GT9A 3QXAA 2GY5A 4CNIA 4IOFD 3TPUA 3V4UH 2ARJQ 1A7BA 3SKMA 3C5JA 4PD4J 3DUSB 5IESH 1T5WA 3LKNA 3BIKB 2HKFL 4R2GC 3U83A 2EYRA 5FAAA 3LKPA 5GS0L 4XNYL 1CDJA 3IDMA 3JTTB 1N0LA 1OVZA 5T5NG 1CGVA 1FE8H 1T83C 4Y0GA 4CRPA 4OLYH 4DUWA 4WDIB 2NY0B 2ATPA 1EBPA 5TF1L 1FNSL 4I0PA 1BVZA 1GZQB 2A1WL 5CEYB 4OFYA 1YC7A 2D7PA 4Z78B 4S1DC 2PXYC 5I1JH 1HHHA 1H3PH 2CDFB 5EFIA 4I3RL 4LCWB 2R39A 7FABL 4M03A 4U2YA 3FN0H 5IB1B 4JM2D 1Y18B 2OJEA 1ZT4B 1NGYB 4OF8A 2HN7B 2J8UF 1I9JL 1B2WH 1U2HA 5SWZB 1P1ZA 4QOKB 4DWHA 3LN5B 1UKSA 2DQCH 1OF2B 2APFA 4NM4H 2N4IA 4U1LB 4A2MA 5TQ0L 3P9WB 1ZA3B 1H0DA 5FO9A 5FYLD 4PJXA 1GGYA 3P0YL 1YEFH 2DM2A 4TTDD 1UWGH 4LLMA 1CFSB 2XQYK 4R7NA 5DUML 2GUOA 4WW1A 4FQ2L 1R3KA 3ZTNL 3ZDXE 2Y5EA 1G6RL 4L9LA 4YBQC 1NL0L 3SOBL 2QSQA 2BP3A 2PNDA 5E4EB 5DR5H 4H26B 4PJXE 4U1HB 3GHEL 3OAUH 2AV7A 1NCBL 1FZMB 4BK4A 5HDQL 5L2KB 4D3CH 5DUBB 2VJXA 3BMWA 1FVCB 1M71B 3AXLB 5GZOD 4YLQT 4O9HH 4ODHH 4K7PL 4R4NC 4RQQB 1QPPA 3RDTA 4KJWD 4U1SB 3S7GA 3UAJC 1TCRA 2BOBA 2X9WA 4KK5D 2BXZA 4BZ1L 2UZIL 4BQCA 3GHBH 1KCVL 2IH3A 1MI5B 1A8JH 1UZ6E 3RJDA 3BISA 3GRWH 4FQXB 4KI5C 3BDXA 3UZVB 4P3CH 5ELIA 5E4IA 3DVNA 3IDIA 5EH1A 5FEBA 3RP1A 1RIVL 1K9TA 2V2XB 32C2A 5T5NF 3V0VA 4M1DH 1KCUL 4DEPC 3TPKA 3EJZD 1W0VA 2EDDA 3EBAA 1TVHB 4M7LH 1AP2A 4XCYA 2FO4A 1A1OB 4GLRI 2EKSB 2D7NA 2NY6D 3O3DA 4YX2L 1BQLH 4M6OL 5ESAB 4LDEB 4IRSD 4PJDF 3FJTA 4K23H 3NZ8B 3P4LA 2W9EL 1G9NC 1I8IB 2FWOA 5KSAB 4JY4B 3QXUA 1CTNA 1BVKB 2FX7L 1ZLSL 4ETQA 5EIIA 2CMRH 2AJ3B 5FXCH 1K5NB 1UVQA 4M61B 1MJ7L 1YA5A 4GAJL 3ZYIA 3U4EA 5K59F 2IPTH 5IP4A 2Q76A 2AJYL 1W72L 3GMPB 1T7ZA 4OGAC 5D2LF 4ZQKB 1AGBB 1KGCD 5EU7C 4OI7A 3NN8B 4NZRH 4TUOB 1YNLL 1SMAA 1FNHA 4H1LA 2DQUH 3VFOA 4IEFB 2X9YA 2ZNXA 1D5XA 1WFTA 5IUSA 1CQKA 4OM0H 3OJ2C 2HLAB 3B5TA 3V5HA 4IJ3B 1N6UA 4V1DD 1BZQK 1IQDA 3QUYA 3VI3F 3WBDA 3SE4C 5FGCB 4Y4FB 1TTUA 2DD8H 2GFBB 4KKAC 1JV5B 1RZJL 5C08B 5TGBA 3F7YA 4PRAB 5E2VL 4DW2L 3IFNH 4KC3B 5IJVB 3A67H 3ARBB 3DX7A 1G9EA 3RI5F 3S3JA 3UROR 4BQ6A 5JNYB 2F58H 5L0QB 1EA9C 1F90L 3LH2L 3IDUA 3AROA 5DJDA 1IE5A 2XTJB 3MO1A 4HWZB 1MEXL 2UZYB 4L5FL 4Q0XH 4ISVB 1IKFH 4ONGL 4G80A 2CUIA 5BRZA 4N8VG 3VRIB 1P7QA 5I1GL 3OZ9L 2MCPH 1MAMH 1ONQB 4GMTL 3KJ6H 2OXHA 1T6WA 3TIEA 2JKXA 4X0KB 1IC5L 5CEXA 3U0WH 5DD6A 4J3XA 5DWUH 3PWPA 1WV7T 4BA8A 4C57C 1I8MB 2VC2H 5BRZE 1D3CA 4UAOC 5CMAA 1M05B 1UGNA 2W59A 1XCQA 2V7NA 1R24A 4NJ9L 1T1ZA 1U3ZA 2HFEB 4R2GD 2OBGA 1HSAB 1I7TA 2B39A 3PWPE 1MCIA 2HFGH 4JHWL 2FECI 1NGZB 1T1WB 2XQBL 4K3JL 5JO5A 5FGBA 2HFFB 3QQ9C 1MWAA 3MRKA 2G5BB 2VLLB 4P4RB 4P2QD 4B7LA 1VGKB 1SM3L 2MSPA 4HLZG 4WI9A 1F4AA 1N59B 3ZHDA 4S1DD 5F72S 1MCBA 2YZ8A 5CFHA 5F71A 2FLBT 3NCBB 4WFEE 5DURD 4JDVA 5ETUB 5JQ6H 1U95A 1CXLA 2O61A 5LGHH 4F33A 1AH1A 2P8MB 3FN3A 4HQQL 3WS6C 1G6RB 3L1OL 3TN0C 4S1QH 3E1F1 4Z76B 5EBLB 1IZJA 2H45A 2JB6B 3C5ZA 5DJ0A 4LCIL 4L8DB 2FR4A 2XICA 1T0NA 5JMOC 3BPCB 4EN3C 2P24A 4ZFGL 3CU1A 3C9NB 1B4JL 3FO1B 3KXFB 5KVDH 3WO4B 4J3VA 5EB9A 5IROA 3DHJA 4AZ8A 3MBXL 1L6XA 5L8LB 3G5YA 5C7XL 2A77H 4IOIB 4LMQI 4ERSH 3QNYB 2YBRA 3ZDYE 4HC1A 4GRWE 4JN2A 2X9XA 4NQDB 4NZDA 5DGQA 3NCYP 1ZE3C 1QBBA 5GRWA 1IGCL 2BNRA 4LLDA 5EDXA 2YD3A 3WIFA 1HCVA 3MA7A 1Z5LB 2EECA 4ZUSB 3UDWA 5C07D 3EJYC 3BO8B 4UDUB 5GGUB 1U8MB 2Y5TB 2BNRE 3TH2T 1F6AA 4YDVA 2AV1A 4KI5D 4NHUA 3EOBA 4HXAL 2CRYA 4P46A 4NRZA 3L5JA 2P4AB 1FIEA 1T04B 2HWZH 3JV5A 4XNYH 2H8PB 3TBWB 3MJ8B 3BSZH 5J6HB 2CKNA 4LASH 2GITA 2HMID 1MFBL 1W72B 4WUUE 4P3WA 5TF1H 1FNSH 3UPRB 2I5YL 5EZOH 4LHUD 1OAQH 2A1WH 1N26A 4WWID 1MF2L 4CMHC 5CZXC 3V5KA 2NPLX 2XKSA 4TULL 5J13B 7FABH 2P42B 5I71C 4YZFF 5KS9F 1TJHL 5DEZA 3ZKXB 1YJDH 5ECJE 1QLFB 3TNMB 2X89A 3QUZC 4RIRB 4F2MA 3SKNA 5HPMB 1DEEB 2QHLA 1SBBA 2B1HH 3F7QA 3CDGB 4GW1A 5IB2B 4S10A 4XVJH 5KZCD 2BVOB 3L3IA 4OGAD 4LVNC 1GL4B 3IETB 1HI6A 4ENED 3DX6B 5EPMA 1E4XL 3VGBA 4HIEA 1EFXB 5DDHA 5TQ0H 4ELMB 5ANMA 1K4DB 3P0YH 2MWCA 1UYWL 4Q9CA 1A6TB 3UTTD 1JF6A 5DUMH 1PX3A 4FQ2H 3ZTNH 1KTDB 3QQ3A 4D0DA 5DJCA 4HKZA 1G6RH 2HJLB 4Q6IA 3SOBH 3X11B 4KKAD 1GZPA 5ANME 2GHWB 5EN2B 3MLTA 2H3NB 1NKOA 1W2KT 3IFPA 3S34L 2OR9L 2W60B 3OMZA 4XMKL 4K7PH 1IJ9A 5FDWB 3L7FA 1DLHB 5FKPB 3WN5B 4XGZB 1MFNA 3MRGB 3SKUD 4BZ1H 2UZIH 4N8PA 1KCVH 3P4MB 2B4CL 5D1QC 1QFWL 2PUQT 3LSOA 1RUAL 4RRPA 2YSSA 4NFDA 1KJMB 3K46A 3TZVC 3RGHA 4F3FB 1RIVH 3VD9A 3PWLA 1MCWM 1U3JA 2XTLA 3TPUB 1U91B 4JLRA 4AH2A 1M7DA 3F12A 5J11C 1JFQL 3SKMB 2VISB 2DOCA 3KYKH 5IWLC 1T5WB 1BFVL 3LKNB 3HLAA 4CBPA 4CN1A 4M43H 3HPJA 4M6OH 3MRBA 1J1XL 2FJGB 3K8MA 4N90E 5FYJE 3MLRL 3R0NA 3RL1A 1ZTXL 2VL5A 3QDHA 3IDMB 2BRRL 2W9EH 2EEAA 5A40E 3Q5TA 3SGJA 3QQ9D 1CF8L 2WQRA 3K2UL 3BPLB 3V79C 5GQBA 3BRGC 4I0PB 2X89D 1IC4H 1M7IB 4I0KA 2AQ2A 4IRSB 2ZUTA 2DJ4A 5JLZA 1HHHB 3DNKA 2AXFA 1MRDL 1MJ7H 2C4FT 3IDYC 3JV6A 4GAJH 5BXFA 4BFBD 3TCLA 2AJYH 4AENA 1W72H 3NACL 1NEUA 2HVJA 1VESA 2OJEB 1T2QL 3N1GC 1CFNA 1NEZG 2E6QA 1T7VA 4JJ5A 1MVUB 4K07A 4TUJA 1MWAL 1QO3B 4RGOL 2ZUSA 3VXSD 3DO7A 5D7IA 3B9VA 1LK2B 3IDNA 1R5WB 4EN3D 4NNYA 2E9BA 4JFFA 2YC1A 3OV6A 2Z9TA 3EKCA 1H0DB 4NRYA 4BQBA 5D7IE 4LLMB 2VNCA 2GUOB 4WW1B 1R3KB 1RIHL 1Z9OA 1H15B 4L3ED 1EMTL 1F90H 3LH2H 4JFFE 4V1DB 4RFEA 1UCBL 3T77A 1MCOH 5B8CC 1MEXH 4HUUA 3WYRA 1U8IA 2AV7B 3RWCB 4R97B 2M1KA 1EO7A 5I1GH 3IS1X 3OZ9H 5CLTA 1JGUH 4DUXA 1XGRA 1OAKL 2XYCA 5IHZA 4M6AA 4Z5RA 2WSKA 2ED9A 1V3JA 4NQSB 2FHBA 4URTB 3D39D 4MJ6B 3EJYD 2IH3B 1TQBC 2X4NA 4YHPA 5HYQA 1CR9L 1EFQA 3ARFA 4NJ9H 4HC1L 1UKQA 3DVNB 4IMKA 2F19L 5A16A 4BJLA 3Q48A 3GKWL 1N64L 32C2B 1CYGA 2XQBH 2XXMB 1BFOA 4ZDHA 1E27A 5F1SA 5C0EA 4XCYB 2FO4B 4B7IA 3BT2L 1DVFD 3QDMD 3O3DB 4JFHD 1EGJA 1SM3H 2JK5B 1HNGA 4OLEA 1XGQA 4OF3A 5CZXD 1T0MA 3K74B 2FWOB 1MOEA 4JFPB 1JIBA 3BRDA 4RISL 5JORA 4ETQB 8FABA 5EIIB 5I2IA 3QUZD 1QRKA 3QUMA 9CGTA 5FB8A 1UVQB 1S7TB 4HQQH 5GZND 3WLBA 3L1OH 3MOBL 3T0WA 3I02A 4NO0D 4Y5YC 2Q76B 1B90A 5LKNA 1JPSL 5DEGB 5D4QA 3KLDA 5EWIH 5HDBF 2C1PB 2DLGA 3DRQB 3L95A 1CIDA 4LCIH 4P2RA 2IMNA 3B5HA 4ZFGH 1LNUA 3E2HC 1B4JH 3K1DA 3GNML 5ICXA 5MP6L 1H5BC 4L4TD 4LKXA 3H9SD 1VFMA 3MCG1 2ICWA 5EZIH 3N85L 1OCWH 1L0QA 3LN9A 4XTRC 3ZSTA 3KR3L 4XVSL 5C7XH 4P2RE 3V5HB 3BDBA 1FCCA 1CWVA 2XA8L 3QUYB 5E5MA 4L9DA 4PRHE 3U7WL 3RZCC 4PJ9A 2APXA 3MRNA 3F7YB 4K9EL 5EU6A 1UWEL 3OR6A 4PB0L 2C4FU 4CADA 2ITCA 1IGCH 4MVBC 3H7LA 1EEUA 5DJDB 3MO1B 3GSUA 5GS0C 1J86A 1XMWA 5T1LA 5EU6E 3U2SA 2M8XA 5F7DA 1P7QB 3TO4C 1UEYA 5SX5H 4D9RD 5D1QD 3PE9A 3PGDB 3P0VL 4HXAH 5CEXB 1KFAL 4NKQB 5DD6B 3PWPB 1DUYA 5T33L 4X4MA 3RI5K 1NGQL 3OGOE 1MCRA 4OCWL 5CSGA 2NX5A 1MHCA 1DQDL 5CMAB 5C07B 4EDXB 1Z2KA 1SJHB 2V7NB 1EERB 1MFBH 1CG9A 4GJTB 1CLZL 4QRUB 2WP3O 3GIVA 3BN9C 1HXYB 1I7TB 1MF2H 2O5XL 1KCKA 1OPGL 3HN3A 3HG1A 5JA9A 4TULH 4NQXB 2ZSWA 2NX5E 1YYLL 1MWAB 4XVTL 2X4QA 3MRKB 3QFDB 1KG0A 5IEHA 1FC2D 3ARWA 4JFZH 4WW2C 5FYJL 3HE7A 3KPTA 4YDJB 3U46A 4LSDA 2DQEH 3FFDA 4DK3A 3KAAA 1A3LL 3HG1E 3BP6A 4JDVB 3VI4E 2VQUA 2XY1A 2V2TB 5GS1C 2BCKA 3SKJH 3P77B 4EQ3A 1CDBA 4F33B 1T1YA 3RWDA 1FN4A 4RWHA 4AY0A 2GI7A 3LOWA 3OAYH 4G8EB 1CZ8L 2MHAB 1MQ8A 4WFGE 3L3OB 3K3QA 4OD1L 2AJUL 4N0FA 1NPUA 4P57A 5C9KA 3C5ZB 5FA3B 5AZ2L 5IIEA 1UYWH 1TZIB 4Y88A 5D6CA 1NC2A 5EA0H 2FR4B 1KOAA 1T0NB 1NUNB 2P24B 5F6IB 5CWSA 3ARTA 4FFWD 1BFTA 1C12A 3EGSA 4R90L 1OHQA 4GRWB 5FYKD 5DT1L 5E99L 4DKFL 4OD3L 5BVPL 4EI6A 4ONHA 3BVNA 4Y8DC 3UTTB 4X6FA 1IAIH 3G6DL 1J10A 4Z9KB 3S34H 1YNKL 2OR9H 4XMKH 1MFEH 3HCVB 4H1LH 4XMPL 1LP9F 4X8JA 3T4YA 3R8QA 2YBRB 2EXWC 4JN2B 4ZODA 4PGBB 3D9AH 3PHOA 3VXPA 2J4WL 4KROB 2B4CH 3W0WE 2BNRB 4DCQB 4MJ2A 1QFWH 1S7WB 3QDJA 3DHMA 4LLDB 5FF6A 3I3DA 3QPQC 4JG0H 2F15A 2Q7NA 5CCKL 3WIFB 3RPIA 3UZEA 1I3RA 1CFQA 3MA7B 1EUUA 1U8JA 1GGTA 2CIIB 4RDQG 4ACPA 1G7PA 4QF1B 4KFZC 1JFQH 3PQYD 3NOIA 3BEWA 1X4ZA 1U3YA 3QDJE 4X9BA 3SQOL 4WHYG 4NRZB 2FCBA 1EEZA 1J1XH 3SBWC 3MLRH 1OP3H 1U8KB 3KPNA 1ZTXH 3OKKA 2XWBA 5CINL 2BRRH 3SGEH 3ELAT 1CVRA 4CJ0A 1CF8H 4GBXD 4DFHA 1EVTC 2FHFA 1IC7H 1F6FB 3WUWG 3HE7D 4NNXB 3VGGA 5C0DA 3TT1L 2VLMD 2AXHA 1F6LL 4GQ9L 5C0CA 2CLRA 4LVHC 3V5KB 4F80A 3EDDA 1JGDA 5FECA 2C9AA 1CL7L 1T5XA 2E27H 3MRFB 4Y19A 4JRYA 3NACH 1T2QH 2ZUXA 3ARZA 1S7RA 1JGVL 1RZJC 3SKNB 5C0CE 3VDAA 4OQ1A 4UT6H 3KYNA 2PO6A 5I73B 1MWAH 4FZEL 4GW1B 5FUCC 4ORZC 2HJFA 4Y19E 4JRYE 1EGJL 3C5SA 4WWKC 4EVNA 4BSWA 1D5BB 5CBAA 2G75A 4HIIB 5E94A 3WS3A 2EDXA 3E3QE 5INDA 5EPMB 1AGFA 4DQOL 2DJSA 5GIRA 1Q94A 4HIEB 3LDBC 1H3VA 1J12A 1U58A 2OXGA 5ANMB 3MUHL 5DLMH 1CDHA 4NSKA 3VXSB 2JJUA 3K1KC 1ITCA 4XTRD 1PEZA 3QUML 4KUZL 2Z31C 1ZLVK 5HHXL 3ZKMC 1EMTH 1G7QA 3D3VA 2YK1L 1TQCB 3SJVD 3T0EC 3ZYJA 3NH7H 3DVIA 4HJJL 2AQ1A 1GZPB 3FHAA 4P9ML 1S7UB 1P9MC 3KNBB 2YA2A 3MRPA 1PG7X 1R3HA 1PQZA 2X4PA 2NXZC 2YMXL 4NQCE 2LTQB 3U0PA 3AREC 2P5EA 5D6DA 1OAKH 25C8L 2OTUB 3D3VE 4L3EB 4GRWH 3GSXB 3NA4A 2EKJA 3L7FB 2E9IA 4QRRD 3S36H 3VCLA 1WTGT 3MGAA 1WT5C 3NABL 3PXHA 3LSOB 4JO4L 5FOBA 1CR9H 1WVZA 3C6LD 4KPHL 2DQFA 1X5ZA 2F19H 4S11A 4FQLL 3PABB 5HI4C 2EDEA 3GKWH 1N64H 2R1XA 5E6ID 4JLRB 4M5ZL 3F12B 4NQED 5IBLC 3D39B 3WKML 1EV2E 4N0CC 3BT2H 4PBWD 3CFJB 5TJWK 3HLAB 4O5LL 4NOFA 5GGTH 3MRBB 5I1KH 2QLVB 2HT4C 2WV3A 5DJ8A 2NQCA 4OCNC 2VL5B 2MNUA 4PRIA 2ARJA 4UNUA 4JR9L 2XI9A 4JRXA 5C9JB 4YBHA 2APWA 1DVFB 2F8VA 4OGXH 5IVXB 4NQUA 4ZFOA 2PYFB 5JW4R 3H9YA 3QEUA 3U36A 3JV6B 2AXFB 4PJFF 5DD0L 5BXFB 4PRIE 3EUUA 3BZFA 1YEJL 3TCLB 4AENB 2E6JA 1JPSH 4E41A 2YD5A 3O4OC 3HMWH 2HVJB 5MERA 1D6EA 1QLRB 3OKOB 4JJ5B 5MP6H 5IVZA 1LILA 4IIQB 3QB7C 2DI8A 3DO7B 4NO0B 3QWQB 2XG4A 3U30B 5CD5C 1OLZA 4X9GA 3EFDL 3H42L 3BWAA 3AM8A 4JFFB 2YC1B 4ZSOA 1MCDA 2XKNA 4N5ED 1ODAA 1KIRA 3FFCE 1J1OH 2DM7A 5I74C 1XF3A 2Z35A 3V6OA 4AG4H 4N9GB 1BBDH 4L9LC 4Y8AA 1UWEH 4PB0H 3SGDH 4YR6A 2P5ED 2ZNWA 2E7LC 4HEME 3OB0K 4ZSOE 3JZ7A 3PNWB 4RFEB 1HQRA 3T77B 3IVKA 2IANA 2VR9A 3BQUC 3LEXB 1QBAA 2W07A 3VDCA 5F3HB 3QPXL 3RDTC 1RI8A 4YUEH 3QO0A 3T2OA 1B6UA 4M7JL 5IHZB 4YHYB 3QPQD 4Z5RB 1XF4A 4NHCL 1KFAH 2IANE 2KH2B 4K71C 2KUTA 4QHUB 1FSKB 4KKBD 4ETYA 1NGQH 5BZWA 1RZFL 2VQ1A 2D4DA 2JCCA 4OCWH 3JWDC 1DQDH 2XN9A 5HYQB 3ARFB 1YEKH 4X5XA 5ACZA 1E4XI 4HPYL 5DA4A 5A16B 1CLZH 2KL6A 5EULV 4Z7VE 5ABDE 1DBAL 2VE6A 3RY6C 4JFYA 4R7DA 4YE4H 1OPGH 2IALB 4ZDHB 3BZDA 1E27B 2JCCE 1F4WH 5C0EB 2VUOA 1YYLH 2XN9E 4Y2DA 4XVTH 3V52L 2N56A 4JAMA 2Y07L 4M6NL 3QIBD 3VFSA 3N9GL 3DUHA 1JHTA 3TA3A 1QFPA 2XACC 1V5JA 3MZTA 2ZP0T 3KHOA 2VXSL 3RVWC 4KXZH 3GSNA 1A3LH 4HFWB 4JQVC 4E41D 4L8BA 3IJYA 1NMCB 5IW1A 2K3TA 5JORB 1GAFL 2PYED 3HZVA 3QUMB 5MI0B 4KQ4H 5FB8B 4CMMB 1VEMA 1CZ8H 3PG2A 5K93A 1EPFA 1REIA 3AAZA 4DOHE 4OD1H 1FZOB 2AJUH 1G1CA 3VWJA 5EUOB 3DROB 5E6ZA 1QFWI 4XWOC 1TENA 2AEIT 3L95B 4OLWH 3KVQA 2FIKA 4DKDC 1JHLL 1LNUB 4R8WH 1KBGL 5ICXB 4R90H 2ICWB 5DT1H 4OD3H 1GIGL 1DUZA 4OZHF 3ZKMD 2Z31D 1IAIM 4XCNA 3C8DA 1EEYA 1MJ8L 3G6DH 3ARGA 3T0ED 1YNKH 4UUJA 3EZ8A 3PJSA 1YPZF 2RFXA 3SGEI 3TJHC 4M02A 4XNUL 3PWJB 3OR6B 4CADB 2ZG3A 4MD5B 5DA0B 4P4KA 5GJTL 4K7PY 1AXSB 3AY4C 5IJKC 3GSUB 4WEUD 5CCKH 4FTVA 4Y4KC 1JGLL 3U2SB 4MXVE 1Q9KA 4PJ8C 5D9SA 1C5CL 2D3VA 3OX8A 3VFNA 4WTZA 1D5IL 1XR9A 1J0YA 1QSEA 2ED8A 3B9KA 4PLKD 3SQOH 1OSZA 1Q9LA 5BMFL 4FTVE 5AG8A 1X5KA 5HI4D 4YK4C 2V7HA 1EAPA 1XF5A 5CINH 5B4MD 1NMAL 2NX5B 2NY3C 3HB3C 2WUBL 3RTQA 1QSEE 1OL0A 4YNYB 4MHHI 2FZ3A 4NGHL 3GIVB 1H3XA 3TT1H 5FGBC 2HT4D 1BF2A 1JTOA 2FBOJ 3MZGB 3SE8L 1BFSA 5D7JA 4Z77A 4DN4L 3NFNB 1F3JA 3HG1B 5FO8B 5DC9B 3W9DA 1JPFA 5I17A 3B5GA 1CL7H 3QP3A 4JKKA 2X4QB 4KK8D 3UTOA 1ETZB 4GBXB 4F15C 5IEHB 1J0KA 3K4ZA 2V2WA 3HE7B 3MFFA 4S2SA 1JGVH 3FFDB 4KGLA 4N0UA 4FZEH 3BP6B 5EO0B 3VWJD 4NUJA 3HI6H 1FNLA 3MXVH 4FHBD 5CJBA 1ZGLP 1EGJH 5IV2A 1ZS8A 2BCKB 5DD3L 4NN5B 4PP1C 4DQOH 3FT4A 4RMQA 1Q0YH 2ZZUT 5F9OL 2BZDA 4GS7B 2P1YA 3C60D 5C0FB 2WM0A 3DX9A 5A2JH 2BSED 4D9LL 5CD5D 4PJIB 1K2DA 1J0JA 1OAZL 1NC2B 4ZFOL 2V5YA 3QUMH 4KUZH 4ZXBC 5HHXH 5IW6B 1NFDA 4KJYA 2BSSA 1YMMA 3DVGB 3SGKC 4JDTL 1C12B 3LPFA 3EGSB 2ZJSL 3QULB 3DV4A 3LZFL 4FQCL 4Y4HA 4KHTL 3P40A 3O45A 5ALCH 2D7OA 2DI9A 1O5DT 2HT2D 2XZCH 2X1PA 1RJZA 5GS3A 5I8EA 4EI6B 2YMXH 1FZKB 1KJ2A 1FFPB 3B2UD 3BVNB 4X6FB 3SDDC 1NFDE 1YMME 1BP3B 5BVJA 3IDXL 5IT2L 1UKTA 3SJVB 3T4YB 4W81A 4JKWA 3CSBA 4ZYKB 2MOVA 4KRPD 1TIUA 1G7JA 1S3KL 4MNHA 5DRZB 3T2NL 3NABH 3QDJB 3B9KD 3BIAX 5FF6B 1JL8A 4NN7C 1E4KA 3RPIB 4I0CC 4FQLH 2ED7A 1RK1A 5FYKH 2DQJL 1CFQB 3JVGC 1U8JB 3V6ZA 4QRRB 3SDYL 3D18A 4M5ZH 4Q9QL 1MCCA 4P46C 1U8NA 3BEWB 4P9HL 3WKMH 5HGBA 2HVKA 4R0LA 2QR0B 2JLLA 2J88L 3C6LB 3LQAL 4RMRA 3CFEA 3RHWF 1OAUH 4DVBA 1EEZB 5CUSL 1ZHNA 3QI9A 3KPNB 3OKKB 5E6IB 4G8FB 3UTZB 4JR9H 3SE3A 4NQEB 4H0IA 5D7SL 4OV6F 5C0DB 4MQTB 4I48A 2DTML 5BW7A 1NDMA 4NPYA 2R8SL 5DRXA 1LVEA 4XXCA 4OZGF 3MCKA 4HGWA 3ARVA 2QSVA 5FECB 4PJ5E 2PW2A 5DD0H 4RGNC 2F8XC 1FIGL 1JNLL 3ZHKA 4G7YL 3ULUF 4O2CA 5TH2A 1S7RB 1AC6A 1HDMB 4U6HA 1T1XA 4WJ5A 4K9EC 1N8ZB 1X5YA 4FQQA 3KYNB 2PO6B 5E9DE 2MJWA 4FG6D 1PSKL 2WQ8A 1FL5A 1MHHA 4P49A 2JJVA 2G75B 4OZIF 5CD3A 4PUBH 5E94B 1RU9L 3WS3B 1A47A 3EFDH 3H42H 4GKSA 3S5LG 5INDB 1AGFB 3GSNL 5GIRB 4MNQD 3MMEA 3MV11 1U58B 3GI9L 4P5TD 2BVQA 4WGWB 3MLUL 1WFNA 5ITBL 4NSKB 4IOSD 4Q6IC 2L7UA 5J4MA 2GAZB 2VZTA 1QR1B 1QSFA 5E95B 4F7CA 4XI5C 2YD2A 1OM3H 3QAZC 4ZPTA 1FNEB 4LEOA 6FABL 3L9RA 3FOLA 4JZJC 4OM1H 3MRPB 1R3HB 2NW2A 1AIFA 2DDQL 4PJEF 4LP5A 3BYYA 1NANI 1OTUC 4GXVL 3U0PB 2EDJA 2P5EB 5F89A 1GCFA 1CLYL 4EBQL 1PFCA 5L9DH 2AEQH 2ID5A 2XZAL 4RGMC 3UTQB 4WEBH 4Y4KD 4NHCH 3KPPA 1FQ9C 5LQBL 1QBML 4PJ8D 3RWIA 4RFNC 3VCLB 2CDGA 4X6DB 1RZFH 3OR7B 4DFIA 4PS4H 5DRNB 1QACA 2LAAA 2A38A 4ZMAT 1I1YA