5DTMA

Crystal structure of dot1l in complex with inhibitor cpd1 [4-(2,6-dichlorobenzoyl)-n-methyl-1h-pyrrole-2-carboxamide]
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
328
structure length
319
Chain Sequence
LELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSWTGKPVSYYLHTIDRTILENYFSSLKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a Fragment-Based Screening Hit toward Potent DOT1L Inhibitors Interacting in an Induced Binding Pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase, H3 lysine-79 specific
total genus 102
structure length 319
sequence length 328
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08123 DOT1 Histone methylation protein DOT1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.60 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 5dtmA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5dtmA02
2V7EA 3FRIA 1Z3CA 2BR5A 1SQFA 4DKJA 1DCTA 2IDJA 5CM2Z 2AOTA 5E2BA 5KQSA 1EJ6A 3G88A 4QVGA 4R6WA 4YV2A 5LQRA 3DMFA 3I9FA 1R00A 1UFKA 4P7JA 5EVJA 2NYUA 3WSTA 1D2GA 1XVAA 3MCTA 3EVZA 2BM8A 4PYMA 5F2NA 2Z6UA 4PWYA 3TFWA 2HR1A 3SSMA 1D2CA 3D2LA 3H2BA 1EJ0A 4HSGA 3DMHA 3UJCA 4R05A 2ORED 3CJQA 1BKYA 4GOMD 4KIFA 1O54A 3QOXA 3MERA 4BLVA 4IV8A 3UJBA 2VP3A 4YUYA 3UWPA 3NDJA 3TM4A 4MTLA 4OQEA 5FQNA 2ZVJA 3PB3A 2IGTA 5HIIA 3EEOA 4PCAA 3B7PA 1M0EA 2JHCA 2ONYA 3ANXA 3BGVA 1AV6A 1RJEA 4QTTB 3JWGA 4L7VA 5ICFA 3HM2A 3A25A 3JWIA 1WXWA 3OU7A 2H1RA 3VC2A 2OB1A 2GH1A 5EZSA 4U7PB 4RTLA 3M6UA 2GA9A 3ID6C 3LECA 2CL5A 4RTPA 5DTQA 2IBTA 2QRVA 3OU6A 4Y30A 3BZBA 1G38A 1NKVA 3CC8A 4AUKA 4X61A 3THRA 3O7WA 3M4XA 5GOZA 4C03A 2XBMA 4PGGA 4HTFB 4GOND 3KQWA 3OE5A 4C07A 1WZNA 1V39A 5EMKA 1JG3A 1XTPA 3KQPA 3RW9A 3GJYA 3LHDA 2A14A 3NVMB 1VE3A 3B3FA 4PCLA 1M6YA 1JR4A 3ER9A 5DM4A 5T67A 3KR2A 4X41A 5KS2A 2PT9A 5DSXA 2FRXA 1JG4A 5H02A 3LSTA 1SUSA 4RVHA 4E2WA 1P39A 3BWCA 3PFHA 4K6MA 5K0CA 4QPNA 2XYQA 4KVZA 5EHGA 4AZSA 2ADMA 4E30A 3LGAA 1KIAA 3AWIA 1QAMA 1VP3A 4QDJA 2QE6A 4E2YA 4UOEA 3FUVA 2ESRA 2AS0A 4PYIA 3NWBA 3HCCA 2I7CA 1NE2A 2B25A 2HV9A 2ZZKA 3FUWA 3PVCA 4OA5A 2K4MA 3OPNA 5F2KA 3FTCA 1NW8A 3TM5A 2OPBA 3ORHA 1XCJA 2PX2A 3HVJA 2AOUB 3P2EA 4JXJA 2VDWA 1KYWA 3P9IA 5ERGB 2NNWB 3NWEA 3Q7EA 3VSEA 2NP7A 1FP1D 3NTVA 3O4FA 1NBIA 4OQDA 5EOVA 3V8VA 1L3IA 3GRVA 5FTWA 1X1AA 1ZG3A 5K0FA 3QOWA 1RI4A 3UJAA 2G8NA 3TOSA 2UZ4A 1XCLA 2JHPA 4GEKA 5EPEA 3TKAA 5DX1A 3C6KA 3IYLW 1VLMA 2PX4A 2XYRA 4ATNA 4FP9A 4MQ4A 4WXHA 3KPUA 3V97A 4HGZA 2P3LA 3EVEA 3KU1A 3R9XB 3PX2A 3HCAA 1G60A 2P35A 2CMHA 3KR1A 3P2KA 1RI1A 5BW4A 1HMYA 2AOTB 3GWZA 2EJTA 1QANA 2G72A 1YUBA 3C3YA 3KR0A 3KQOA 4RTNA 1TW3A 4FSDA 1TW2A 2P3QA 2ZBRA 3F4KA 4B17A 5DX0A 2JJQA 1P1CA 3G2MA 4PINA 4QTUB 1WG8A 2OO3A 4RWZA 5U4XA 4CXMA 3MHTA 1DUSA 4P7KA 2PBFA 3FPJA 3QV2A 5E8RA 3UA4A 4QPPA 4YUZA 3OFJA 2IBSA 3CGGA 2NXEA 1KPGA 3G8AA 5MHTA 4C04A 2O07A 3KQQA 3MB5A 2IP2A 4LWPA 4EKGA 2ZW9A 4ZTBA 3UZUA 4F85A 2AN4A 3E7PA 5HIKA 2CWWA 4EQZA 3LDGA 1JG2A 2WA2A 1I9GA 3BGIA 2NXCA 4AX8A 4E2ZA 3X0DA 3TR6A 1L9KA 5LQKA 4GUAA 4BY9E 5E8JA 2IH2A 3PT9A 3C0KA 5HIJA 5K0LA 5GM1A 3UJ7A 3EVGA 2YXEA 5DSTA 4HTFA 3ELUA 1QZZA 4LWOA 4QQNA 5CVEA 4EVIA 5D1HA 2P7HA 4PYQA 4PIPA 3HCDA 2OYRA 1YB2A 3E8SA 4FZVA 1WY7A 3I53A 2ERCA 2GS9A 3CJRA 4DZRA 2R6ZA 2FYTA 4C4AA 3DH0A 4EK9A 3LBFA 1DL5A 3EEYA 2AOVA 3HVIA 3L8DA 3OU2A 4P58A 5FCDA 2P1DA 3PTAA 2H11A 1RI5A 4A6EA 3GU3A 2V74B 5HEKA 3HA3A 2PXXA 3UJDA 4BLUA 3SSOA 4YV0A 2FCAA 5K0NA 3GRRA 5EEHA 1KPIA 3GRUA 3BT7A 3SVZA 2GPYA 5C1IA 3SM3A 4A6DA 3SMQA 2DPMA 3EVCA 5EKXA 1I4WA 4CKCA 1VIDA 4KDCA 5FWDA 4POOA 7MHTA 3P8ZA 1NW7A 5FA8A 3U81A 3PLAE 4PNEA 2OZVA 1XDUA 3GIWA 2YUIA 5GWXA 5C0OE 3MQ2A 1ZKDA 3A4TA 3G8BA 2BZGA 3KQMA 5GM2A 1ORHA 5EIFA 3TLJA 5CVDA 4E31A 5KQRA 2AOUA 5K0EA 4QVKA 3IHTA 3TMAA 1INLA 2P7IA 5GP1A 4C06A 4GC5A 4XCXA 4RYLA 3UA3A 1YFLA 2ZBPA 1R6AA 1FP2A 1JTFA 3TPZA 3P9NA 4YV1A 4YMGA 2EJUA 5F2OA 1VL5A 2Y1XA 2BR4A 4FT4A 3FPFA 5E1BA 2YTZA 3BWYA 4GOLD 5CVVA 3BKWA 2WK1A 2PSSA 3E23A 4OA8A 4PGHA 2VDVE 3AXSA 3DULA 1BC5A 4FGZA 3UJ9A 4CKEA 5DRYA 3ELDA 3ELYA 4DF3A 4OX9Y 2ZIFA 4P7FA 3NW9A 3KHKA 4M7RA 4E32A 3O31A 5DXJA 3HVKA 4M38A 1SG9A 3AXTA 3CCFA 8MHTA 1WXXA 5LSAA 1AF7A 2GB4A 2AR0A 1L3CA 4GQBA 3P2IA 2HWKA 4R8SA 1XDZA 2H00A 3G2QA 4BLWA 4X63A 4FS8A 2JH8A 3FYCA 3B89A 5DM0A 2AVDA 4AZWA 5EG5A 3DTNA 2N47A 3EMBA 3B3GA 2HMYB 3GXOA 1G55A 4KDRA 2QY6A 5K0GA 1KP9A 3AJDA 3SXJA 2GAFA 4YUWA 4ER5A 4RTOA 5DRTA 3HNRA 5DM2A 4E2XA 1N2XA 5FHQA 2FPOA 4XUEA 3IV6A 4RSRA 2AZTA 1YFJA 1X1DA 1FBNA 1Q0SA 4M37A 2G71A 1R18A 5D1NA 3DOUA 4IWNA 5EC8A 2EX4A 5GIPE 2CMGA 3VC1A 2C7QA 4ER0A 1KPHA 2FK7A 3OE4A 4QDKA 2PX5A 5EEGA 2O0LA 5E1MA 1ZHFA 2ZCJA 1OR8A 1P1BA 5EMMA 1AQJA 3DMGA 1EQAA 4OBXA 1U2ZA 5LQAA 2OKCA 3GGDA 5BXYA 1R8XA 3TKYA 1RI3A 5B1SA 3SGLA 1B42A 3G5LA 3GNLA 4MHTA 2PY6A 2ZLBA 3EVAA 3DP7A 1FPQA 1L3BA 3A27A 3DLCA 4CWAA 5DPMA 2Z6QA 3M6XA 4RTJA 5E1DA 4DA4A 3HVHA 1JQDA 3I5UA 4IKPA 5FUBA 1SUIA 2KW5A 1WS6A 3K0BA 3LBYA 4LG1A 1G8AA 3LKDA 2ZZMA 2HNKA 2ZZNA 4NECA 4DQ0A 2AOXA 3GRZA 3MAGA 4YUVA 3RIEA 5LQJA 1EG2A 3FRHA 3P97A 3A7EA 3PS9A 5K0BA 3S68A 1N7IA 4DMGA 2P41A 1MJFA 2YR0A 3SX0A 2WA1A 3G2PA 3KQSA 4R6XA 4RTSA 2PKWA 4RVGA 3FUTA 1RJFA 4F84A 1MHTA 5K01A 3KPYA 3ER8A 4YMHA 1D2HA 1JQ3A 2UYOA 3HTXA 3DLIA 3T7RA 2JH9A 3T0IA 1EIZA 1JTEA 1YF3A 1F3LA 3G2OA 4GC9A 3FTEA 1UIRA 2UYHA 3I58A 1R74A 4HC4A 1I1NA 1YZHA 2E5WA 3GRYA 2YXLA 4AZVA 3P9KA 1VBFA 1X19A 3LL7A 5EIWA 3TRKA 1F38A 5K0JA 5DWQA 2IH5A 4PYLA 3FZGA 3TQSA 5IKMA 3GCZA 4G56A 5CD1A 2VZ9A 1NW3A 5DT2A 5EGSA 4FSXA 4PYNA 2Y1WA 2ONZA 4ISCA 4XUCA 5T6BA 3CVOA 3GDHA 5FQOA 5CIYA 3CJTA 3C6MA 3CBGA 5DLYA 1UWVA 3A7DA 1JG1A 4GBED 3R6TA 2PLWA 4QQKA 1JQEA 3DXXA 3HA7A 1JSXA 5BW5A 3FTDA 3EVDA 1X1BA 1ZQ9A 2BR3A 2G70A 3EVBA 3SR4A 5E1OA 4PYOA 3K6RA 1O9GA 5DTRA 3G89A 1RJDA 1XJ5A 3Q87B 5EMJA 3HCFA 3I64A 3G7UA 3OZRA 5HFJA 4KW7A 5CCBA 1Q0TA 5CVJA 1H1DA 3HCBA 5FULA 1SQGA 4EKIA 1VP9A 2OY0A 5CCXA 3OFKA 3OCJA 4V0RA 3NDIA 1FJXA 3EGVA 3BGDA 4P7GA 2LD4A 2ZFUA 3LDUA 5EKUA 2YXDA 4F86A 2FHPA 3PX3A 2I62A 2OBFA 3MTEA 5FWAA 4GF5A 5T64A 2O06A 3T7TA 1IM8A 5ICEA 3LCCA 5DTMA 1IY9A 3DR5A 3ME5A 2DULA 4RV9A 2OB2A 4ER3A 5E9WA 2O57A 1TPYA 1NW6A 4MIKA 3UJ6A 3DXZA 2GLUA 2PXCA 4KRGA 5LQNA 2YVLA 4CTJA 3NJRA 3LDFA 3NVKI 4E70A 4BP1A 2IDKA 4Y2HA 3LKZA 4E33A 5P8WA 4RVFA 2PGXA 1HNNA 3P71T 1XXLA 5LQCA 3LX6A 1Y8CA 2AVNA 1KHHA 5C9ZA 1QYRA 1VPTA 1ZGAA 3FYDA 2JHAA 1NBHA 1G6Q1 1NV9A 1O9HA 2Q41A 2PWYA 3MTIA 3FUXA 3B3JA 5JUWA 5JR3A 1BOOA 2PVCA 2XYVA 3HCEA 3MGGA 5EQJB 2IFTA 4CTKA 4RTKA 3FPHA 1QAQA 2PJDA 2XVAA 3GO4A 5K03A 3KQVA 3R24A 3DXYA 5ICCA 4RX1A 3EGEA 3R0QA 3EVFA 4H0NA 2C7OA 4RTRA 3M33A 1JSZA 3RODA 3REOA 3KQYA 2P8JA 2YX1A 4YUXA 2BH2A 1KR5A 1VQ1A 4M36A 2UYQA 4C05A 2BM9A 3BXOA 3KPWA 5E9JA 5HOQA 5HILA 3KPJA 3PFGA 3KR9A 2ZSUA 5FHRA 3LCVB 3IEIA 2PV0A 2PX8A 3E05A 5DM1A 3M70A 4PIMA 5KYGA 4C08A 3A26A 4BP3A 4PYKA 2CKDA 4OBWA 5K09A 1SVUA 3DUWA 5DXAA 1EAMA 2FK8A 2PWPA 5EHIA 2AN3A 3FPGA 3BWMA 1NW5A 3LPMA 4HG2A 4LECA 2JG3A 2NXJA 3ERCA 5CUQA 2NXNA 3HA5A 2NP6A 1XDSA 3JWJA 5LQUA 2ZTHA 4V0QA 1PRYA 4AZTA 2I6GA 3KQTA 5LR6A 3FPEA 3UBTA 3FUUA 1KYZA 4Z2YA 3FTFA 2IPXA 3UJ8A 4WVLA 5EMLA 2G1PA 2I9KA 4HGYA 3HEMA 4HH4A 3C3PA 4X1OA 3BWBA 2ZBQA 4EMSA 3NMUF 4KIGA 3UFBA 3M6WA 1T43A 3KKZA 5DX8A 2C7PA 3THSA 4O29A 5HIMA 3OZSA 2F8LA 4KWCA 5E2AA 2P40A 5IH3A 4PYJA 1L1EA 2PXAA 3B5IA 3LCUA 1NT2A 5E9QA 5G02A 2HTEA 4RVDA 4DCMA 5K05A 2O05A 1IXKA 2ZULA 4DCGA 1BHJA 3VYWA 2R3SA 2UYCA 2B9EA 3HP7A 1RJGA 1AQIA 2AOWA 2QYOA 4PONA 2C7RA 3P9CA 2QM3A 2ZIEA 2QRVB 1NV8A 2B3TA 2AN5A 4XUDA 1G8SA 1R8YA 3AY0A 1SKMA 2B2CA 4FT2A 4R8RA 5EZQA 4RTQA 5FADA 4DM3A 3OZTA 1RI2A 3JWHA 3MCZA 4HRAA 1P91A 1ORIA 4GOOD 5BP7A 3G5TA 4ER7A 1KXZA 4ER6A 3CKKA 3EGIA 4FR0A 4U7TB 5ICGA 2VS1A 9MHTA 4MWZA 3ELWA 5KVAA 4IV0A 1PJZA 2PT6A 2XVMA 1YZ3A 1M6EX 3EMDA 5FA5A 2P3OA 4RTMA 2Z6AA 1ZGJA 5GINE 3R3HA 2VDUE 1N7JA 4CKBA 2IIPA 3BKXA 2IH4A 2EFJA 5HZMA 3BUSA 3KPVA 2ZWAA 2B78A 5GIOE 2ZIGA 3M6VA 5M5BA 2YQZA 10MHA 3EPPA 1X1CA 4X60A 5CVUA 2OXTA 2EG5A 2ZWVA 1QAOA 3SSNA 3T7SA 5K8VA
chains in the Genus database with same CATH superfamily
2G06A 2VR1A 4JP3A 3HFJA 2PMEA 4CMGA 2AOTA 3VR5D 2E6KA 1SBCA 1RMYA 2B69A 3LLMA 3PXXA 3D7LA 2ECKA 1PQYA 4F3YA 2X8AA 1M10A 5CYGA 4QBGB 3U16A 2ZOSA 3EEIA 1A0OA 5KEIA 2I7DA 4Q9DA 3UW1A 4CMKA 4PBTA 1YMVA 3MERA 1NVVQ 1QGED 3DEHA 1SFRA 1NPTO 1KEUA 1QZTA 4RWEA 4S1NA 5DYWA 5FTJA 3UMBA 4CPDA 5E7IA 2IEGA 1DRJA 2RH8A 1M1YA 2DPXA 2PJZA 2AL7A 1R5NA 3PQ4A 5FBLB 2PUEA 4Q24A 3LQRA 3JWGA 1KY3A 3F5MA 1T15A 2JFXA 2V45A 2C31A 4Q03A 4NS1A 2JI9A 3Q6NA 5DTJA 2Z08A 1SHZA 1RTKA 2QNIA 2ZUSA 1R9JA 4KN8A 3M6UA 4FEEA 3W2FA 4CTNA 1E9FA 1G9TA 4RTLA 2LYJA 3PUKA 3W4JA 1XE3A 2HD4A 3PXAA 4L85A 4YG4A 1WHSA 1UBMS 3LA6A 3VMFA 2E1PA 3VYSB 1BOFA 2NWQA 1FLAA 2QT1A 4RZQA 5GOZA 3RFVA 4B09A 4CFZA 5LLSA 1Z2DA 3SFTA 5TX7A 3G2JA 2J4CA 4II2A 4P08A 3RW9A 5IARA 4JOBA 1WD5A 3FETA 5JSHA 4NQRA 3UPUA 4OMUA 4S12A 1AXEA 1OZHA 4EBFA 5L7WA 5EIEA 2LZ0A 1X8JA 5DM4A 1N8NA 4ZC8A 4CCSA 3IAS1 4EW2A 3GJ5A 1E3OC 2FRXA 2UZ1A 2QN9A 1C9JA 1H3NA 3GMTA 3ZCPA 2I1WA 1ULZA 5FFFA 5JJ5A 2HF8A 2JVKA 3EIUA 4IOJA 1PT6A 2HPVA 1JSRA 1T34A 3IQIX 3AWIA 3P27A 5ELMA 3I72A 1TTTA 1YUNA 5GGYA 5TF0A 1B23P 4G89A 4E07A 3WRXC 3ZNOA 3IAS6 2VJOA 1EM8A 3SC2A 4PU8A 3ITNA 1S9DA 1LKZA 1ND6A 2VWQA 1EDBA 3K7EA 5FEMA 1W29A 3ZDZB 2AOUB 4JXJA 1LU9A 2P6NA 4ZA2A 1WY5A 3T12A 1I10A 4IKOA 1N2BA 1NQVA 1T6ZA 3LPCA 3TX6A 3HEAA 1AKEA 3DYBA 1MG5A 4FOOA 4DSUA 1JR6A 1P2UA 4LN1A 2AZ4A 4JT8A 3T4EA 4B40A 3LIIA 3M6MD 1XPOA 1DSSG 3GFPA 1QZXA 4FJ1A 4URUR 4I55A 4W6QA 5JZVA 3JZMA 4Z7NB 3LHIA 2OE2A 4RMJA 4JI6B 3EAGA 3QWHA 3MWLA 4JBGA 1QGZA 4CL2A 1I3LA 3F49S 4X95A 3IIKA 2WR8A 3A4IA 3FJ1A 4GPIB 3OC0A 4WXHA 3RYFA 4DA0A 1OH7A 5FBQB 1ISGA 1FDUA 2Y92A 3HJAA 2HCRA 4UE6A 4JQDA 2HSWA 3H5OA 2OV3A 2J4FA 3O2SB 4IMIB 3SEAA 3C3YA 1TQDA 3FH0A 1N0VC 1NUHA 3L7JA 3QLVC 3GVHA 5BMVA 2IY8A 3OAAD 4M0UA 2XXAB 4KPGA 4GKAA 4QTUB 3VKGA 1H4VB 3JQAD 5JANA 5BY2A 421PA 4INPA 2HQSA 1X7YB 5IG2A 1A9QA 2WSYB 2I67A 3RBAA 4ZCPA 1FMCA 2X4IA 4YAUA 2Z1DA 1FW8A 5ALGA 3L49A 4ZVVA 2AI3A 4KV9A 4OEHA 4OQXA 3D7KA 1RACA 5JAOA 2PQMA 1OH8A 4TMWA 3ZXXA 4QGFA 4FMCF 3W05A 4KXMA 4C7BA 2ZUBA 4ZV4A 4ZYUA 1JTVA 3HKCB 2PPVA 3TR6A 5CDHA 4BNNA 4MPJA 2REOA 4D8UA 1KHTA 3CLTC 4MQBA 4Q9JA 1ZUD1 5GM1A 3DZHA 3EDMA 1V2GA 4V0SA 5BV7A 4LWOA 4W5HA 2GPWA 5EIXA 4C1NA 1I6MA 2ALJA 4REMA 1VECA 3T7AA 2PM8A 1YB2A 2Y76A 1NNSA 3U3DA 4MWDA 4J0IA 2ZYAA 2B5WA 1AO3A 1SK8A 2PMCA 3R3XA 5LXTB 3LBFA 3CH4B 2WTNA 3B6IA 2GZ3A 2H11A 2WJ6A 4GRDA 3UMVA 4ZWNA 3KUUA 4IIXA 4MYDA 3A32A 3GCGA 3ZKCA 3UFDA 4YV0A 3GIDA 3TSZA 5KWEA 3K0SA 5D6NA 2H9AA 1VA4A 2E87A 5EKXA 4MR9B 2CXNA 5C8DA 1RYHA 5I5GA 3RS0A 3S2GA 3KEQA 1S3SA 3H2SA 1E9CA 4GR9A 2K87A 2XBLA 2XBUA 1ZKDA 1O6ZA 4Z5XA 5EIHA 5KQRA 2BJVA 4NENB 4M1ZA 1G0NA 5IU6A 5J2UA 4KSCA 3H9GA 5C52B 1B73A 3L77A 1FW6A 3MAAC 4U00A 5A7HA 2X0FA 2O3JA 2ENWA 3CR7A 3V2IA 5L3SB 4LFBB 3TW8A 1G0OA 1POXA 4JGGA 2BUAA 1NC3A 2DWPA 2ZBPA 2B7BA 4DANA 3HCPA 1CF9A 1YXMA 3LZDA 4EVRA 1PGPA 4G5HA 2WVGA 1E5QA 1A5BB 2R85A 1VL5A 2Y1DA 2KPJA 2P68A 2Y1XA 5KSPA 2OBBA 1G5PA 3J7TA 3RD5A 3DWGA 3UGTA 4ZV9A 2HINA 5FTMA 5JH7A 2O1SA 3VTFA 1KVTA 4L7QA 2B98A 2LKDA 1S7GA 4JR1A 3EEQA 4JLAA 1KEZA 5B1HA 1I7QB 3AF2A 4G5XA 4J07A 3RVRA 2YNMA 3COYA 5CAEB 2OFPA 4BMVA 3UV6A 2EQBA 1DLIA 2NQ8A 4E32A 4KYVA 1SG9A 1RQPA 1GUBA 3FGOA 4DIEA 4G07A 5LSAA 1FSSA 3WDMA 1DXYA 2PS9A 4GKJB 3O2NA 1VTKA 1U3GA 1NVXQ 2ZIUB 2NM0A 1R5BA 3GZ4A 2H00A 4YX9A 1NATA 3V2GA 2CNBA 5ARBA 2BCJQ 3UMCA 5DBFA 4JB3A 4Z6KA 1D5WA 3Q85A 2HV8A 5TMDA 4Y2XA 5LUAA 4ZGGA 2ZB2A 4BN5A 3UIEA 1NVVR 4LBZA 1WIWA 1YQQA 4NCBA 2XQFA 1G55A 1KI7A 2GCNA 3F90A 5CX1B 2LR0A 2XPCA 3EIHA 1H0RA 5FHQA 3L4BA 1E9VA 2WVAA 3RRZA 2J0VA 3KM0A 3QVJA 4U8HA 2BNMA 1SCJA 3EZXA 5JROA 3LP6A 2RBGA 4PG5A 3DFMA 2AKEA 4HQKA 4AMYA 4BO8A 5E6RB 3OUUA 3A37A 1UEJA 5CLGA 3ZCVA 4GKBA 5JS2A 1T5TA 2OUKA 4NI5A 2PZ8A 4O1MA 2C29D 2FK7A 4CKEB 5CFLA 4DUYB 2XXAA 3I1FA 1QOPB 4P38A 2ILVA 3OM0A 5AJVB 5JAPA 3PKIA 3GGDA 1HFWA 5HQTA 1TZMA 1QO0D 3CSDA 4FPXA 3OBBA 2H06A 1FPQA 1E20A 1Y4SA 3OY7A 4MIEA 5FDFA 5JTTA 3O8CA 3IBFA 2C2KA 2B20A 1DIOB 2OQ2A 4ND5A 1EVYA 4HDSB 2LWIA 2O6HA 2QAGC 3JQ8B 4WD3A 1YS7A 2YWRA 5EYPB 5D7NA 4OHUA 5MN4A 1QV9A 1ZWLA 2AW3A 3ZKWB 2OHVA 3D3KA 1MEEA 2BBOA 4OOFA 1KIMA 3IEXA 1Q7CA 1W2WB 1SUPA 1Z5WA 3VYUB 1OFGA 3RIEA 4CLRB 2Q5QA 2VK4A 3FRHA 2ZS9A 1WUYA 1EUDB 3V4OA 1X15A 2VHJA 3PYMA 3CLHA 1SIWA 2XGGA 3QVWA 1EFCA 3M49A 3HXOA 2WJVA 4CMEC 3FUTA 4IXDA 5F5XA 1SBQA 4UMEA 4DW8A 4QYTA 1PR5A 2PDAA 1OH6A 3AEZA 4YH1A 3AHGA 5EPOA 1JQ3A 1LZLA 3EMVA 4HRXA 1FXWA 2E1RA 4TTAA 3L4SO 1MIOB 3IQWA 1RCFA 5CH8A 2XCLA 4HC4A 1VIAA 7YASA 1JALA 3B6EA 3H11B 4HAVA 1CJTC 2BELA 5SZIA 3BB3A 1QH9A 4G5GA 5AM4A 4DSZA 5BN3B 3EA5A 1VBFA 4KLCA 2BWJA 4NOLA 1PBNA 1ISFA 3EZNA 1HE8B 1T3TA 2ZSKA 4OUKX 5JO9A 2FDCA 2TRSB 2M98A 4C7OA 1XCPA 3KO8A 4IEFB 1EVIA 4F9TA 2DC1A 3DD1A 3QJGA 4QM6A 4EVQA 1MBZA 3AVUA 5DT2A 1LLCA 3FZQA 2JFHA 2JF0A 1HE3A 3KHTA 3SHTA 5JDIA 2IHUA 2YDYA 3JR7A 5DLYA 3GDWA 2SKEA 3GFOA 4U5QA 5K0TA 1X80A 1B6TA 2PLWA 3NGXA 1SVKA 3D4PA 3VBCA 4JY7A 4AKHA 3RHTA 1FC0A 2C7BA 3R7LA 4Z4CA 3AFNA 3O95A 4V38A 4AKSA 1W4BA 4B35A 1ENYA 4WFKA 1ULHA 3F6EX 1ZD1A 2VPPA 1SQSA 4DMRA 2BGKA 2PZMA 2WLTA 5GAJA 4EHDA 4MQMA 2B1JA 1RAFA 3TDKA 4TSRA 2E5LB 3OEHD 4ND1A 2HT1A 4Q1CA 1FF9A 2IS4A 2GZSA 2Q4EA 4R1LA 4EUNA 5I01A 1TYAE 2X2FA 1V7PC 3ABSB 2OY0A 2AEJA 2GJ8A 2I4LA 1BXKA 2O2DA 3DAOA 3FCEA 2NTEA 1MF7A 3CURA 3QLUA 4ZVNA 4DMFA 3K71B 2H7YA 2X5JO 1G8KA 2HHCA 3PNYA 1R10A 1HDRA 1UKZA 2Q5LA 2YJGA 4IG9A 4I3GA 4KV7A 1EMDA 4UPEA 3ML1A 1RWNA 4JC5A 1QORA 5BT8A 1FBTA 5TQVA 2LP4Y 1KO1A 4FFBB 4BFUA 2Q49A 4F0JA 3CZ5A 1FSGA 2YJZA 4MOWA 3RS9A 3V00A 4KYIB 1L5SA 1SXIA 3VKHA 1H6AA 2FSIA 3UJ6A 3LX5A 4FDAA 1DP4A 3VV2A 4KSBA 4EUKA 2CLKB 3RTBA 1G3MA 3TMKA 4G1BA 4UBMA 3AUXA 1W4CA 2MSCB 5CXQA 1A9OA 1LK7A 2Q07A 2IUFA 3H87A 1CCWA 2CYCA 5BN1A 1ARZA 3AV0B 4I4IA 3FRJA 4P36A 3V55A 2DFVA 4IXWA 4X92A 5DHQA 2X5NA 5FLEX 4G6ZA 1H4TA 1ZINA 4K6OA 1V8OA 2Q9UA 1K0FA 2C98A 4R1TA 2NSDA 4C0XA 2PMFA 1FDIA 4JI3B 1P5JA 1JHQA 2ZSHA 5JUWA 3P9XA 5IKOA 4CQLA 1ONPA 4CTKA 1DQZA 4LZLA 4CHGA 1CJGA 1EPUA 4BKOA 1G4UR 1PL7A 4RTKA 2K7FA 2XVAA 4GU5A 1D3AA 1VJRA 2IXGA 4II3A 5AUNB 3WK5A 1LPMA 2XAUA 4OFWA 5IK2A 3R0QA 2RFLA 3EVFA 2CFTA 1A9PA 3MINA 5UKDA 4N18A 4LOAA 2Q99A 1FA9A 3KC2A 4GMXA 3IKTA 3H8VA 5A5EA 1Y5MA 4S04A 2JHFA 1AUOA 2UYQA 1EWKA 1NVDA 2ZYHA 4BJ3A 5KTOA 5A7GA 3ILSA 2K7ZA 2G80A 3OMXA 5AI6A 4YDSA 1TL7C 1FRQA 3O0TA 3DL7A 3GVPA 1SRQA 3B1KA 3JQ8A 4ZVMA 4B31A 3W2TA 4CKXA 1P2BA 2ERYA 4L22A 3GP8A 2BGLA 3WRYA 5DXAA 5ALWA 5LOVA 4MUBA 1IL0A 2I6TA 2L17A 4HG2A 5AM0A 2GM5A 2NXJA 3DZCA 3NBQA 3O9VA 3R6DA 4BDTA 1JT2A 2NXNA 2FPPA 1BDBA 3M5WA 1WWKA 2KX7A 4B87A 1QXSA 1U3CA 3NBXX 4MQLA 3ODGA 4HGYA 1HEIA 5JVDB 1FU4A 2Q8PA 4L4YA 1NQWA 4A2CA 4JLSA 1GLNA 3R7WB 4LXXA 4W9NC 4O5AA 3HNPA 2P40A 1T1SA 1YK0A 1L1EA 3WX0A 1SBIA 5G02A 3ZC3A 1Z5OA 3TQTA 3AI2A 2IQIA 2JGFA 2O05A 2ZULA 1EHCA 4MRMA 5HA5A 1IEQA 2V3VA 3PNVA 4WXYB 3S7ZA 3FOBA 4QELA 4ZYLA 3EG9B 1QDLB 1KOLA 2B1IA 3HFSA 3P52A 2ZIEA 2BMWA 3PR1A 4DYVA 4ICIA 3PC7A 4RPKA 1OLOA 3QM1A 3V7UA 3PEUA 3OHMA 2A9VA 4O6VA 1YE5A 2RGDA 1XVTA 4LK2A 4ZAZA 1UBEA 2JIOA 1NBEA 5BUQA 3II6X 1Y98A 2E9SA 2WYIA 2V54A 3I28A 1X80B 4K9PA 4LYHA 3A9YA 1Z4PX 5FA5A 4EG7A 2HBZA 4OKNA 4MGHA 1UKBA 1XQYA 3KJGA 4M6WA 4A5SA 3VU1A 5AXAA 2QTMA 3TEJA 4E22A 2VNKA 1H94A 4XYEA 2J30A 2QRQA 1B2LA 2YZGA 2ZP1A 2VJCA 2ZTLA 3B1WA 5JHHB 1IK4A 4MVJF 2HMSA 2W6PA 5BN3A 3PNOA 2DYKA 2QVGA 1MFPA 2FPIB 1X1CA 2CL6X 4I14A 1K06A 5E95A 3AM4A 2W2KB 1ADJA 3ROEA 1FLVA 3SF8A 3EOZA 4MGKR 3ZY5A 1EFRA 1M1NA 1JXMA 3KTFA 3RVOA 3B60A 2XRMA 3FYUC 3N2ZB 4LJ7A 5T4HA 4U2EA 5CM2Z 3KYDB 2D5LA 1I4DD 1EJ6A 4GMGA 3PWTA 3DKRA 3F96A 1IC8A 3RYHA 4K6FA 4HDKA 5J2UF 5ES3A 3FHLA 4I1SA 4N3GA 3O82A 4PAGA 4MDEA 4O1IA 4EB3A 4XD7A 3E6AA 4HFJA 1W7AA 4G0UA 1EEHA 1JXQA 5KTSA 3L0BA 4FK8A 2PE5A 4R9VA 1M0SA 1VL8A 2PGNA 1NMZA 3O8QA 2RCNA 3PB3A 1UKCA 4YJGA 2OCBA 2P4EA 1L1MA 1SULA 2P65A 3IPRA 4R5HA 1LLFA 2IYQA 2ONYA 4D3FA 4QG3A 4CV1A 2QVBA 1PFKA 1ZUNB 4L7VA 4CKBB 1UQTA 2W5UA 3T15A 1ZBDA 2R6DA 4M1YA 3SOPA 3TBHA 4HNUA 1ZH6A 2OKGA 3VDRA 5CCEA 3ZI7A 2PUHA 3H4TA 2VOJA 3O7MA 4IY1A 4PG4A 2BDEA 4RLHA 5DI3B 3RLFA 1N2HA 3ASVA 4O8CA 4XLTA 4LNUA 2QN7A 1N6KA 3CC8A 4AUKA 4F9EA 1JT9A 3MJCA 1E63A 2QKYA 4CM4B 4F6RA 3DKPA 2QN3A 4F1JA 2ID7A 3HA2A 5TEVA 1YA8A 1YASA 3ZV6A 4DUGD 2ZRDA 1RJWA 2ZKIA 4C4ZA 2OOKA 2YRXA 4XFDA 4XI9A 3OFND 5BNTA 2Q5OA 3AL2A 3K0AB 1KH1A 3MNFA 1M6YA 2X2OA 2QE7A 4L0DA 3SR0A 4EB8A 1UKEA 5F5NA 5CDFE 4OLJA 4EHJA 6REQA 3LVQE 4AF8A 1RJ9A 1V4NA 2EGGA 3L46A 3MUNA 4QBIA 5A4IS 1S1MA 3KKMA 4HLDA 1P39A 2K6GA 1ZIOA 4BO1A 4I8TA 4LHXA 3KBOA 2A84A 3CNLA 4LOHA 5TQ0B 3WQQA 1ECPA 3L93A 1YQ9A 5C1DA 4U7DA 1KSGA 4HMOA 4L28A 1PNVA 1GVNB 1W8DA 3FAZA 4UW9A 1UZAA 2YHIA 3FAKA 3NWBA 5LDHA 5AQ1A 5A03A 1C3XA 4MZDA 2JAWA 1OY1A 3INNA 5BPHA 3ESAA 1NJGA 5JH7F 4W5OA 1PQ4A 1UBRS 1XYGA 1BHO1 1QIHA 1M2HA 4L9WA 4HFMA 5G0SA 1I2AA 5IBPA 5D85A 2PVPA 4KU4A 1I0IA 1G21B 4UHJA 1AK1A 1REQA 2WAOA 3Q7EA 4YS6A 4ZVUA 4FILA 5BURA 5JSZB 2YV5A 1GV0A 3KFVA 4JJKA 4NFLA 1NJ8A 3ZCQA 1L3IA 4ECAA 2QLJA 3LTNC 4MQEB 1KAHA 4PPYA 2B4TO 3PI7A 3GFGA 1FJ2A 1TKBA 3HJGA 2BFMA 1C3JA 3C6KA 1U1FA 3KYBA 2CFSA 4MPRA 3T7KA 1ST3A 2IYUA 5JH7B 2PX4A 3P19A 4ML3A 3KSDO 4YJ3A 5HMLA 5TS2A 2X6RA 3A6KA 4GUDA 3RYIB 1HKUA 4O63O 4B6GA 5HRCA 1M1XB 3IKMB 3PX2A 4N7MA 1D2MA 3PK0A 3T35A 5DNUA 4QRIA 2WQ7A 1ENOA 3SS9X 2VHVA 3D8UA 3KQOA 3OQIB 5CIQA 5AQEA 2GM3A 3RT7A 1V3UA 4CDNA 4C7VA 1ZIDA 4FGKA 4RENA 2O3UA 1IN6A 2AD5A 3AO0B 1CDOA 3FPCA 4LY9A 3RABA 3S8MA 3UAYA 3VV3A 4BGIA 5CYOA 2DR2A 4D9NA 2POCA 5BYBA 2WUSR 1V48A 4GPEA 2R0QC 3NOQA 1II9A 1RU3A 3HY4A 2R1VA 2XB9A 3MHTA 2CLOB 4P0TA 4DC1A 5TS3A 1OI7A 1N32B 4ZJYA 3A1TA 4UUOA 1D07A 2IBSA 2XB8A 2QUIA 3SCGA 4LS3A 1QE0A 5ABPA 2IEBA 3L82B 3M9XA 4LWPA 1LRLA 1OFHA 4JBLA 2UZ1B 4AKTA 1J8DA 1HDOA 3BH0A 4RVNA 3RJTA 1H3FA 5HIKA 1EKXA 2BTOA 5M29A 3K9NA 3B6JA 3NHRA 2ID4A 1ZITA 3E82A 3QKWA 4NJMA 4HGNA 4YEDA 5DBEX 3ZHMA 3X0DA 4B85A 2XCQA 4BNXA 5AW5A 2ANBA 1KNQA 1RHKA 3JZAA 1Z4QA 4OYLA 3TLZA 1XROA 1ZISA 2C9DA 1ZOOA 5KYYA 3GEHA 4M54A 5G1OA 3USCS 4UNRA 2Q3DA 4EB6A 3Q3GE 4Q4JA 4HUJA 1OYWA 3FCUB 3ZWMA 3KDAA 4TTRA 1YJXA 3O03A 1WQ1R 5CJPA 2LXNA 2PMBA 2WAAA 3BULA 3OZ7A 4H7IA 5DH9A 5B64A 4BB6A 3LMKA 1KQOA 2IKSA 1DL5A 2BONA 3UT5A 2CXTA 4B0PA 4FB5A 1Z26A 1QMGA 3R74A 1RS0A 1CUYA 1C1HA 3UGKA 5CBPA 1UXHA 1BGWA 4HGQA 2HXGA 4XYBA 3IUSA 4BWVA 4F6LA 1P6XA 3N0RA 3MS7A 1QTQA 1YACA 3SXPA 1T8RA 3MMNA 5FBZA 4RANA 1F0KA 3EF0A 2IUOA 3SM3A 2ZSEA 3ST7A 5BR4A 1LPBB 1VLJA 4BEJA 1L4BA 1VMDA 3JZDA 3ZXSA 1FS5A 2VSQA 3A1VA 3PL1A 4WNIA 5KQPA 2N1BA 3ACBA 4RU1A 3U81A 3PWZA 3FCCA 4FBGA 2QTVB 5EHZA 1C2YA 1JYSA 3GIWA 2W0MA 5KVVA 3K0KA 2ODAA 3HH8A 3ZWBA 3AV3A 3UC9A 2Q1YA 2H4HA 4MIOA 1OU4A 3SLGA 2BZGA 3M4NA 1ZMXA 4M21A 3V1YA 2O5VA 5PNTA 1P3Y1 3H9BA 3L18A 4IZIA 3STXA 2VQSA 3DKIA 2P7IA 3N86A 2B9VA 4WNYA 3FPAA 1WSAA 3FDFA 3HYSA 2WTMA 1U99A 1MT3A 4AJKA 3DEJA 4XFJA 4E6PA 3DFUA 3I39X 2V0CA 2EJUA 2HN9A 1AE1A 2R44A 3M2PA 4K6HA 2XKKA 2CHUA 4GOLD 4H0CA 4XGNA 4G8BA 3H6HA 2EIXA 4OYYA 4IUCS 1H2HA 4MS3A 4GR5A 3CUEF 2PSSA 2JATA 4PS0A 1XQ6A 3LY8A 3UENA 1M7BA 2GO1A 2IHVA 1BC5A 2IXFA 3AXSA 3CE9A 3EIWA 3O47A 3WDLA 2J59A 1QQTA 1YZLA 1SVMA 3FMOB 4RZ2A 3HDVA 1LFDB 3JVDA 3ZV7A 4AYXA 4BBZA 2IX3A 5GJBA 4ESEA 3KHKA 3INYA 4I4TF 1FQWA 1Y9DA 5LUBA 1F4PA 3B38A 2OC9A 2VJQA 3R0IA 1L7EA 3EY9A 3I2HA 4ZKDA 1A8UA 3QEBZ 4PFQA 2XIJA 1UDRA 2EXXA 4HDQB 1QU3A 1W46A 4IRUB 4QFBA 2KPOA 3AGQA 4LC1A 1DC5A 1RLMA 3SBEA 5JBIA 1CHDA 1D9ZA 1OROA 1VCMA 2H7XA 1T4GA 4FHDA 4C21A 1R37A 1VRCA 2GEBA 2HMYB 3C6XA 5K3EA 3BJZA 3TRJA 3LWNA 4ZAXA 4I1PA 1V95A 1N6RA 3AX6A 4IDGA 1XZKA 3UTDA 1GA6A 2NN3C 4NZOA 2XNCA 2X86A 4L3WA 2FSVA 1LBEA 3QVMA 3O8BA 4OJQA 4PRYA 4Z9AA 4GBJA 2C5BA 4A8JA 3B6ZA 3PL5A 3SPXA 4MARA 3CF4G 4ZEVA 4MCXA 5BN4B 2IYXA 2V8OA 2F4NA 2PN1A 2QK4A 3B2EA 3MJTA 2JJMA 5D1NA 4XGIA 4AUNA 1FVOA 3EFEA 1E1RD 3HWSA 2GZRA 2QG9A 3DM5A 1E0KA 5KDLA 3Q11A 3BX1A 3DLPX 4C4XA 2GAJA 1XTTA 3EASA 3U7HB 2BV3A 4BP8A 3HZHA 4OM7A 3E58A 4BB5A 1OR8A 4UAGA 5EMMA 1YU9A 4OHVA 2QSYA 1Z2EA 1TQ8A 1EWTA 2KHZA 1G8MA 2X0DA 3ND8A 4I9HA 3GNLA 5K99A 3B9BA 1NERA 2E37A 3ZI4A 4YJ3F 5JAMA 1B1CA 2J7PD 2Z8YA 4QAQA 1A97A 6PFKA 4DR7B 3TRBA 1J24A 1E1YA 1GL3A 4B3BA 4DA4A 3TJRA 2GKSA 2KW5A 3BD6A 5H9WA 2W37A 4ACBA 3BN3A 4JI8B 1BHSA 1SCQA 1SCDA 2DBRA 2OD2A 3LWZA 3OLWA 4LXHA 2X0EA 3W6UA 1PJCA 2PK3A 4X0EA 4Q3CA 3GRZA 1XD2A 1KNXA 4BKPA 4JSTA 1JBEA 5KSOA 5TPZA 2C4TA 1AKMA 3RRBA 4EQ6A 1B41A 3ZDEA 1D6NA 3FOAA 4OB8A 1HYQA 2XEDA 4WASA 4E5VA 1E3MA 2HMWA 1RLUA 2V7XA 4O1HA 2YR0A 1XRMA 3K0FA 2HCBA 3KQSA 5GVRA 1P33A 3NM4A 3DKVA 3HYLA 4OU5A 3S0JA 2I0FA 3IT2A 3T54A 1MQ9A 1ORDA 1Y7TA 2OCAA 3QSYA 3FYTA 5HCUA 4I1VA 1I0ZA 2HZBA 1SKYE 2IXAA 4L95C 1F3LA 4GKVA 2JLUA 1IJKA 4CV2A 4E21A 3O90A 1DMSA 1C5KA 1OGYA 4TT3A 4FN5A 1KOJA 4PSCA 3EXEA 1BA3A 4G1UC 4NX2A 2RG1A 4B8YA 2LDXA 4K0RA 1BW9B 4I1YA 3PVSA 3K8ZA 4JELA 4K40A 4PYLA 4BL5A 4TPKA 4FB4A 2BF7A 2Y4NA 2W22A 1JZTA 2DBYA 4OJNA 4PV7A 1F1JA 4ZQCB 1QLWA 5KKNB 1F2TB 3TW0A 1LPPA 2VZ9A 2J31A 2H0RA 2CXQA 1RHJA 2Y1WA 4D6PA 3CX3A 5JVDA 3GDHA 4IMPA 4LNHA 2PRSA 4HMQA 4QZVA 3K0EA 5DNAA 5BW5A 1JQEA 3BIXA 1YDHA 4YCNA 3CUYA 4RD0A 3WK4A 1U7DA 3CS3A 2NUPB 1XDWA 2F7SA 3ZZMA 3EVBA 4KE8A 1W0CA 4MKRA 4QFCA 3RLIA 1KJ9A 3Q9SA 1KI4A 4RZIA 1DXHA 5EMJA 3HCFA 3TUZC 1KI2A 3EFHA 1JA9A 4FYMA 4DCJA 2AB0A 2F62A 3O74A 4C7KA 3DBHB 2EX0A 4D9JA 4KX5A 3C3BA 3F2IA 2FOLA 1UXDA 1FRNA 2OLEA 1YC5A 3BDVA 3BGDA 3NBYC 1Q83A 3PXEA 3RBVA 1SCUA 5EUQB 5AIAA 1C1XB 4XWGA 2KI5A 5TRTA 2AKYA 5ICEA 3HQ4O 4HLCA 1BKDR 3N7UA 3MOIA 1FFEA 2PG3A 1JH9A 2EJBA 3P4YA 4JKYA 4Z86A 5E9WA 4ZIRB 2C3UA 3L6EA 1CQJB 1Y3CE 2GLUA 2I4IA 1PRUA 1FPMA 3OKFA 2GXSA 3ROXA 2EKQA 4KQ9A 3JVVA 4E70A 1WB5A 3LKZA 3DBOB 4D4KA 5IULC 3A11A 3SBXA 4XTRA 3JXBC 4YIKA 4DARA 1KHHA 1ZR2A 4JX8A 1L5NA 3P0IA 1P2FA 2NV0A 5J5AA 4CIDA 3UWKA 4YRKA 4U5XA 1QS0A 5I3CA 1XOIA 4I6EA 3W7AA 1Z0JA 2XYHA 1QYVA 2D0IA 3JQGA 1Y5LA 4QUBA 4KRXA 2RJNA 3LF2A 2FWRA 2NZVG 3AERB 4EFNA 1Y5RA 3NONA 4JH0A 1RLOA 1O4VA 5CLHA 3JD1A 2ZBVA 3T9FA 3GPIA 2V9CA 1VJDA 4BEBA 4L4SA 5IAJA 4BUZA 4BVGA 4RX1A 3HUEA 1QF6A 1LLDA 3L8EA 5HRAA 4YJGB 5FI5A 4CMBA 1XFAA 2FMHA 1J2JA 1Y7YA 1KY4A 1W581 2QMYA 4QATA 5EI5A 4R69A 1Y9AA 3EPLA 4DQLA 4IDDA 4LCBA 2ZAOA 3LUDA 5KTKA 3V4VB 4C22A 4RS4A 1Y3AA 2QI9F 3X1WA 1P1RA 3GK3A 1T6BY 1OW3B 4NPAA 2H2DA 3IEIA 4AJEA 3E05A 2Y0CA 5DLPA 3G1UA 3A26A 1KZ7B 1P7VA 2WICA 5DMHA 2GARA 3PUWA 5AKYA 2O54A 3ZWYA 2YJNA 5JDCC 4DAOA 2PWPA 3PDCA 2AN3A 2QRGA 1EFKA 3KXAA 2V6GA 3B78A 2BC9A 4UXHA 4Z9FA 3BTOA 3KX2A 1QHSA 4D41A 1EXNA 1U94A 4QBKA 3HY3A 2XUQA 1H2EA 3U3WA 3U4GA 3T38A 2C3OA 1XZNA 4TROA 4XLZA 3W8EA 4O25A 3P5SA 2ZJ4A 1XMXA 3PFFA 1NDQA 3W8RA 2HUNA 2Z56A 2V7UA 1A9SA 5JLAA 4DLZA 3RU2A 2G63A 1JGTA 1X1EA 4BVAA 3DTTA 1N7GA 1GN8A 1OLXB 1PZMA 4A23A 2BD0A 4MS1B 4OHPA 2H8GA 5E6SB 3VKWA 2ILTA 4JYCA 1NT2A 1CIPA 2HTEA 4W8GA 1NU8A 4ZT7A 1N3IA 2QUJA 4KI7A 3ZTYA 6LDHA 4YG7B 4I5DA 4K9LA 3PD0A 3X2FA 3A10A 4C0BA 3BH6A 3OF2A 4NAHA 3ZS8A 4D4JA 1HLPA 5KDOA 4LZWA 1F17A 3EQ8A 4RESA 1DDIA 2Q8NA 4C4SA 4WBNB 1TFRA 2W6JA 1SCKA 1S4QA 3OTOB 3A3KA 4FYJA 4R1UA 4FT2A 1M9NA 4HLQB 3AY3A 5DVZA 3UXEA 1XR3A 1PQPA 2F9LA 1N9ZA 3X1KA 1ZZBA 2H7CA 1GT0C 3V4PB 2RHOA 3DTVD 4EGSA 1VHWA 4MWZA 4B5KA 5EPUA 1WQ3A 4ARZB 1R0XA 2B8EA 4RPIA 1KY5A 1RLIA 3QMWA 3EC1A 3EGOA 4JL8A 2R1UA 1UMCB 2CF5A 1IOLA 3MHPA 4HRVA 4ALLA 3BMCB 2W93A 2YVUA 4HWSA 4MW2A 3E2PA 2FWBA 4AZ3A 2EFJA 1QQAA 4EKYA 3JARB 3KOWA 3QITA 4YWJA 3K9GA 3L41A 1GZ3A 1QTIA 2JGNA 1BW9A 1ATZA 1N4DA 1Z5UA 3K16A 4WAUA 2ZREA 4ASUD 1LWOA 3RH0A 1Y1RA 5FTKA 5ALXA 1AA9A 5HYVA 1D09A 2FKAA 4PTLA 3VR4D 1PX0A 5BSUA 2IA5A 2OZEA 3GGPA 3AR4A 3V8EA 1WXIA 3ABOB 5AICA 1ACJA 1LPAB 3K73O 3MCTA 1G6OA 2VYVD 4DUPA 4OQFA 5BUSA 2FI1A 3SZGA 2WB4A 4QECA 2IOQA 2J48A 2RSLA 3U3KA 5JAHA 2G76A 3BMOB 1O03A 2I9PA 1BKYA 3E1KA 4H2DA 5G53C 1O54A 2B5AA 1W34A 1DXQA 1IUKA 3NDJA 3TM4A 3FOEC 1QO7A 2Z58A 5E6UA 3D5TA 3DTYA 3ZX5A 3RUCA 3R2JA 2ZYSA 3OJWA 5IJ9A 3A6GA 3UXHA 2CUZA 1M8JA 2I8LA 2ZEJA 3D8BA 1WW8A 5ALLA 2IP4A 3BD1A 2IV3A 4E3ZA 5IKXA 1L4YA 3A1CA 4KODA 3ZWKA 3TTYA 1ZSVA 1MEOA 4J29A 5HGJA 3TAHA 3VM6A 4DMCA 3GOQA 2GH1A 3HB9A 5JLJA 1E5VA 1W35A 3EZLA 3FSJX 5KJEA 5EWJB 1L7VC 3ENWA 1HDYA 2QM7A 3EWIA 4F5WA 3EA0A 4MLPA 4DYHA 2SECE 5HJEA 3SX2A 4DHWA 4C03A 4GVLA 1YJAA 4UM5A 3VOSA 1K08A 3ESDA 2XZTA 2PS1A 1E7SA 1XTPA 2LIVA 3IQGX 3KQPA 2WU1A 4WNAB 4BECA 5HE9A 4UNNA 3HBFA 1QHXA 1TM4E 3X44A 5HR5A 1GTRA 1RHRA 4QFDA 2YXPX 2WIKA 1GN9A 1PV1A 3I9V1 4WOPA 4QRDA 2J7WA 4X41A 1E99A 5ALOA 1NULA 5EJIA 3TX2A 3PQDA 1DZ3A 1PV2A 5KQGA 1OV4A 5ADVA 1I7PA 2VYNA 1JHYA 2ETXA 3QEMA 1B14A 2QOEA 1MVLA 1PFGA 1QS0B 1G18A 4KQXA 2B36A 1EX9A 4LSGA 4ETWA 1VP3A 4B3JA 4XGKA 3FUVA 5G41A 5EJGA 4BVFA 4D92A 4QC2A 4EIWA 1LCCA 4M86A 2K4MA 3DV0A 1QH8A 3UV7A 1ZJ6A 1RQ2A 1ZESA 5F98A 4NENA 1VXRA 3PC8C 2FWIA 1DRKA 3TS1A 1GKUB 1BE6A 1GPWB 1ETUA 2QTBA 1QGOA 4LVNA 4U39A 4TTVA 1T5SA 1Y1PA 2R87A 3HB1A 3LA8A 3P9IA 3WL3A 4OQDA 5B7GA 4KQEA 2YZ7A 4PLGA 4UU7A 2Q6OA 1U2PA 3DUFA 1QB2A 1D04A 3C2QA 3GRVA 3INTA 2VDOB 1K9SA 2VFAA 4MWCA 4MW7A 5IZCC 2QS9A 4X54A 2GZAA 4BV8A 4BQEA 4GEKA 1X1SA 1F7VA 4MQ5A 5I3ZA 2O8VA 5KHOC 2BMFA 1FMFA 3YASA 3CLUD 3OKAA 5BWMA 2L1PA 3U31A 4KWEA 1MEJA 2YW9A 4DLYA 3IL2A 4V2UA 4Z3DA 3H2YA 3V7FA 2ABWA 4WMLA 1PWHA 3UHPA 3C7TA 1IVSA 1BU5A 2HUPA 4MB6A 4MR8A 1XPUA 1HMYA 1MDBA 1TJ3A 5ALKA 2G72A 1YUBA 3DEIA 3LY9A 1XDGA 3QKRA 4DDVA 5H81A 4HQRA 2D5BA 5IJZA 2ODTX 3NC4A 2CCJA 3L05A 1ST2A 2XQJA 3MJDA 4LK3A 4MVJM 4MLZA 1VB3A 2QYSA 4XQCA 5ALQA 3W9BA 4ETMA 2Z4SA 3S44A 3VAZA 5JZSA 1Z0KA 3HKDB 1JR3D 3Q9NA 4RWZA 4BGVA 4C88A 5JZBA 1U5CA 1HURA 1VLVA 3VTKA 3RWBA 2G9NA 4JI7B 4WLFA 3DE2X 2OG1A 4DPLA 1PGJA 3B7WA 3QE9Y 3DMRA 1R1DA 3B9PA 5ITWA 2W00A 2GBLA 5IZCA 2EFCB 3MLEA 4KK3A 4MGIR 2IL1A 3UG6A 3ASUA 4JJ7A 4F85A 5FNVB 1TAUA 1QZUA 4E5DA 3M34A 2VT2A 4EQZA 4NMWA 4PLVA 4AY5A 4DIUA 3AUKA 4LI3X 4A8JB 3CRRA 3WLJA 2R86A 4CM3A 2WD9A 5AO9A 2NIPA 1OBHA 4YQYA 4BY9E 3PCRB 4WINA 1IQUA 1N25A 4W9NA 4YQFA 2GMWA 4PPGA 1MTZA 3ETEA 3PQEA 1WDKA 1RD4A 1NWCA 1Q0LA 2JH3A 1XMSA 4I5IA 3UAZA 3VO2A 2H1SA 4DCTA 2ORWA 4G9EA 3M6AA 1S9HA 2VT6A 1Y48E 3O8NA 1TE2A 3T5PA 2O52A 3L8MA 1W4LA 3KYJB 3KVOA 2PRZA 1ZUGA 2QZ9A 1ZI6A 2C3PA 3UUFA 4YT4A 2E7ZA 1FDWA 1E3LA 3HA3A 5FAXA 1NJ6A 3UHJA 1YS2X 2FPGA 3GRRA 3W2GA 1YSEA 1RYBA 3VR2D 4GOJA 2CUKA 3VU9B 2ZJ7A 2DPMA 3CZMA 1EVLA 4CKCA 5L3VA 1WMDA 2VUUA 4KDCA 4UAJA 3L6DA 7MHTA 2HWUA 2L69A 1CLUA 3IUJA 2ZUUA 4D6XA 2X13A 1VCOA 4WIAA 4MVJH 3O3OB 1NJ2A 3IDZA 3O9MA 1L5QA 1Q22A 3DBLA 2QLFA 3RRYA 1KDOA 3UJHA 4FM9A 2R4QA 3C48A 3L1HA 2AOUA 4IX1A 9LDBA 3I9KA 3OG9A 2O2ZA 1HI9A 3E4DA 3G6KA 1J8VA 4Q1AA 1R6XA 3D0RA 2BSAA 4WLEA 2P2CA 3JRNA 1EQ2A 1VPLA 4N5DA 3UQZA 4WXEA 5DTEA 4D8WA 4EENA 3P9NA 4RKFA 4TXHA 3G7SA 4YMGA 1G5IA 2JJ8A 2X7JA 3NEAA 1TMOA 4ZZ1A 3C39A 4MDHA 1M73E 1OBCA 1WL8A 4TWIA 3V46A 2GWRA 1R9MA 4M8KA 4J0HA 1DQRA 3OCVA 2XTJA 3PG5A 1LQTA 3ZYCA 1KZHA 2QRNA 1MJ5A 1N6PA 1NVEA 2PKQP 2Q5FA 3EUWA 2LDBA 2RGNC 2ZIFA 2AJBA 4HWTA 1U98A 4M7RA 4ZCTA 1C1YA 3ZHIA 1OAOC 3IA2A 4RD2A 2FMTA 2O50A 2VXCA 4NXMB 4QBHA 1M76A 3C5EA 2FP4B 3WJ2A 3QA9A 3QKTA 3RSFA 1J39A 3I6YA 1R4MB 5JRJA 1T2CA 4KPUB 1CQJA 3HXMA 2VP0A 3QFFA 3ZCUA 1V8BA 2I6SA 3O8OA 3TD9A 1JQLB 1GRVA 5JCOC 3AJDA 4YUWA 3WJ7A 3SJZA 5BXQC 1N2OA 1QNFA 3AT1A 1MX9A 4IJWA 2MXDA 2QJTA 3MPUA 5KNLA 3OQMA 5T4BA 2RG7A 2VQ3A 4BLSA 4RPHA 3IAUA 3B36A 2BY4A 2ZSBA 2RBEA 3OP1A 4DWJA 1FDVA 1OREA 1NUQA 1TTQB 3I0ZA 1V11A 3ICPA 4UOQA 2EX4A 5EC8A 1U90A 4DR3B 1FVHA 5B2FA 4J0JA 4JWKA 2YDXA 2DY0A 4M1TA 5HRUA 2IOYA 2BEUB 4GDMA 4AB1A 2QMHA 4FYHA 3FHOA 1XZHA 1C8VB 2C4WA 3B53X 5IAGA 3ZZTA 4B3CA 2MYTA 4BMCA 3UH1A 2QPOA 1RKQA 4ECEA 2WU0A 1ZGCA 1CY1A 1IHYA 1CQTA 1FFBA 2ZBFA 2GZHA 3BRSA 3MRSA 1VJ5A 2R8PA 4N5NA 4EPYA 1T0PA 1ZN7A 3TGLA 4B3MB 1NMYA 3OQVA 5ALMA 1ZN9A 1E6WA 1BKSB 2Q3FA 3PZRA 1XTZA 2AJCA 2AMVA 2D7JA 1CVLA 2PHZA 4JODA 4PLHA 4WKCA 3R9XA 3UAXA 1UAGA 2QJRA 4QOEA 1TM2A 1XXHE 3DM9B 3OX1A 4LXIA 3IVAA 4PPFA 1YL7A 4MR9A 1E4VA 4WK2B 4GPD1 4XM1A 5ALNA 2E2WA 1T3LA 3D6TB 3N2LA 2R11A 3AB3A 1X7WB 4KR6A 3BIWA 1QPZA 3NGMA 3UMRA 2XCRB 1JR2A 3HBLA 2HSGA 1O95D 1PYOA 3E8XA 3IP8A 4GM1A 4RDCA 3OIVA 3UUEA 4IP0A 4AQ7A 2AZXA 3S27A 5AP9A 5ULLA 2Q29A 4MSUA 4NHOA 1M2GA 5IZ4A 1SXJD 1C7ZA 2CLLB 3ENVA 1GL7A 1NVBA 1JZSA 1G7TA 3GV0A 4P53A 1D2HA 1Y3HA 2WQ6A 3R8FA 1P6UA 1D4OA 2W6JD 2ZRQA 4FQ8A 4DEYA 1CUDA 2EG9A 2D2IA 3N2NA 4E15A 5JEEA 1QFJA 2FWJA 2J0UA 3E5MA 5GONA 2NU8A 3KLMX 3MTDA 2O2HA 4NF2A 1GY8A 1PX2A 3FVRA 5TXGA 2XWJI 2OOSA 3LL7A 3GI1A 4GI5A 4FFPA 3VPCA 1PLKA 3LFHA 2JLCA 3GJSA 3H3XA 5LN1A 2HI0A 1V26A 3SKVA 2FCRA 1JHZA 5H59A 1T0JB 4UPVA 4CQMA 3ZNPA 4H7HA 4XUCA 3L7CA 3PHLA 4REOA 2BFFB 2LNDA 3OQHA 4UM8B 4TYMA 1O58A 2VXBA 2WABA 3A9CA 3HA7A 2XUJA 3BK1A 3G13A 3RVNA 3RSCA 3CPJB 1X1BA 1KDYA 3E3NA 2FEWB 2QD4A 3H2JA 5AJXA 2TMGA 2LBPA 3IEPA 1VMKA 5FO0A 4HDMB 2R2GA 2NTVA 4YRQA 5FUXA 2QJOA 4EJSA 1T4CA 4JJGA 1A27A 4AL4A 1VZ2A 3I37X 3FPLA 5TMPA 4NOKA 4KW7A 4WSOA 1FUYB 5GV7A 2WT4A 3RWMB 5ELXA 4IILA 3OCJA 1ECLA 5JI3E 4M60A 4BUCA 4LQ4A 1NU6A 1ZFNA 5KAMA 5EKUA 4IEIA 1CJVC 2ATCA 3CT4A 5AI8A 3TIGA 2CVZA 3UMSA 2Y0BA 3EGCA 1U0BB 4MAMA 2HA4A 4GX2A 2R68A 3MTEA 3C6BA 4GF5A 2ZCUA 4HAXA 5BNFA 4D4HA 1HNXB 3L7MA 3E2IA 4IXMA 4MWTA 3B12A 2Z8ZA 2ZJAA 3F67A 1OD6A 2XX3A 1SGWA 3BGSA 3L1JA 2H1FA 2QDXA 3UVEA 4DZTA 1NW6A 4Y1FA 3GLIB 2CW5A 2QSUA 3MCWA 1OGJA 3VVBA 8LDHA 3ISVA 1U7TA 3MWYW 4Y6OA 3W2IA 4DLNA 3C16C 9LDTA 3GVXA 4X3CA 1RC1A 1EFPB 4D0GA 2HA7A 1KQGA 3BIJA 3DZKA 4Q3AA 5C51B 3BVPA 4NU6A 2HEIA 3IE1A 5FL7D 3OJ0A 2JLBA 3WTBA 5JSUA 1HNNA 3L1UA 3SHOA 4OIFA 1HPLA 2NZYA 3H8WA 5EVCA 5B6PA 1UBNA 3E9EA 2TSYB 4FD2A 1CUEA 2GVNA 3FGPA 5BSTA 2W90A 2PWYA 3F7TA 3FUXA 1E60A 1E9DA 1QUFA 1UIMA 3GUHA 3LO5A 2W2VA 4G26A 4YJ2F 3T1HB 1RVDA 1DU4A 5FPTA 2PJDA 3BXHA 5A6SB 2A9FA 1X0VA 4EF4A 1Z45A 1XBTA 3D8NA 1ZN8A 3BK7A 4XAQA 1JSZA 3AU9A 2YHBA 3UANA 1NHWA 5IJ9B 1A5SB 4YUXA 5B3AA 4DBLC 4MJLA 2R79A 3KPJA 3PFGA 4PZDA 3ZW8A 4TMXA 1YHZA 1WH6A 3A6ZA 2WY2D 2O2GA 1LQCA 1HE2A 1OXMA 1TVMA 1YT5A 3H2IA 5I9BA 4IWXA 1P2GA 1AUXA 5KYGA 1J2RA 4PYKA 3ESYA 3GB9A 2FN9A 1S8FA 1RRKA 1ZHHA 2EW8A 4V1CA 2X6QA 2FK8A 4MV9A 3T0GA 1OFTA 2COEA 2QWXA 2PGLA 3NBKA 4Y8VA 3UXYA 4OB4A 1DJOA 4MB2A 3RYTC 1SBTA 1WVGA 3TNDA 1LW7A 3KQTA 4NHEA 3PFIA 3QPBA 2F48A 3G0DA 1XAJA 1XMIA 2P3SA 4A0QA 2H1LA 5E0KB 3DBIA 4IDNA 1HF0A 4AQDA 4PU0A 4D98A 5BPFA 1KWGA 5IH3A 5DP1A 2FEMA 16PKA 4JKOA 4KFRA 4NCHA 4DCMA 2J3EA 2D59A 3PLNA 4OL9A 1ZIPA 1U1EA 3KOZA 5K3OA 3A3OA 4P32A 5J5CA 3U9TA 4ENRA 3T3GA 5K4HA 1I7DA 3DL0A 2PZBA 2Q1TA 1ID1A 1U04A 2P2YA 2R5WA 3UYLA 3Q8LA 1UPAA 1CFZA 1IHXA 1HQYE 1Q15A 1VSQA 2GHIA 1IN4A 3KTAB 3Q3JB 2F59A 1O96A 2FZ4A 2R9VA 2YHIB 1MOSA 3EQ6A 4FJ0A 1U65A 2B2CA 4OQMA 4R8RA 3IT1A 4NFSA 4X44A 4HVCA 2V96A 5C7LO 4AWXA 3GZCA 1PGQA 3U5ZB 2Y05A 3VR4A 5AKXA 4Z4HA 3CKKA 3DMPA 2LNMA 2R6R1 4QDTA 4KQ6A 3EMDA 1Y34E 1W52X 4GP7A 3TI9A 2SHKA 2P4QA 3BMQB 1S7EA 5JD3A 1KDPA 4FSHA 5SY4A 4A4DA 2XE6A 1KH2A 2QT9A 3OFSA 4H08A 4KEAA 5AI4A 1DJNA 1XWIA 1G8GA 2ZR9A 3OJEA 3WO1A 1UOQA 2EX1A 3L2OB 2X0NA 4UDXX 2FQYA 4H0FA 5HZMA 3OM8A 1MC8A 3KEOA 3NIWA 4X1KB 5AYVA 5EQFA 3S2ZA 5AW6A 10MHA 2H1HA 1JDNA 1BEUB 1DG1G 1TF5A 2DH6A 3KFLA 2G0AA 4ND6A 4Y7DA 1OI2A 5AR1A 3PXPA 2GCGA 1SXJA 2V7EA 1EVKA 4LOIA 4Y1GA 2PZGA 1YJCA 3AF5A 3N2EA 2TS1A 5BSKA 5CEJA 1SR8A 4BCCA 5BWNA 4YBZA 4Y6PA 4WEQA 1EFAA 3E81A 4GWGA 4RNDB 1HE5A 2G5PA 1HMPA 3RFUA 1G5QA 2OHXA 1TEXA 2NZ8A 4O8ZA 1GZVA 5F2NA 3FWKA 4Z53A 3A1WA 2Y71A 1GR1A 1VE6A 2J1LA 2QLMA 4DWOA 1AO0A 4GEGA 2HHAA 3IAEA 5J4HA 3UJBA 3QU7A 4TTPA 3CTMA 1IE3A 2QTHA 2V7TA 4OQEA 3FOZA 1MRSA 3ISTA 1FIUA 2J6HA 3PJRA 3OIYA 2ZRMA 5G4KB 2A5YB 2VH5R 3KJNA 4WFQA 3GAAA 2H5JA 3MC1A 4NABA 1J07A 4G0MA 3B7PA 5H82A 4L8VA 3ANXA 1XMOB 1DEAA 3A2LA 2B1QA 4FXOA 2VXOA 1MU0A 3WYDA 13PKA 3F47A 3FSRA 1XZLA 2V8BA 1J70A 3HM2A 3IVXA 1HOXA 1UCFA 4HN9A 4XQGA 5EZSA 2XI8A 3DAGA 2GILA 1DOZA 4ZO8A 2F9FA 4NATA 3ZVMA 4CGZA 5DTQA 5EZ5A 3A9WA 1D1PA 3O2JA 4BZPA 3ZE1B 2C96A 4W99A 1IXSB 4XYLA 3FHJA 4YWHA 3OE5A 1XDDA 2NT4A 2Y8EA 3ANYB 4ZN6A 1MIHA 2AR9A 4B73A 1PJSA 2OO7A 2Q46A 1XHEA 4UTXA 3E9ZA 3URKA 3ZBQA 3LX8A 3ON5A 4NG5A 1MW9X 3AVOA 3SC6A 3UUWA 1SC1A 2QQ5A 3WV4A 5A9SB 3CNHA 4MVJP 5LJLA 2GYUA 2YHSA 1SXPA 1TQ6A 5KC9A 2FDRA 1IMOA 3M5PA 2VBCA 4DJFC 1AF4A 4F5DA 2PO7A 5A0VA 4LZNA 4KQIA 1D6SA 2O7QA 2GQ0A 4BZQA 1C14A 3VH2A 1OYYA 1E7QA 1LPOA 2OBMA 3KXDA 1MG0A 3VPBA 4OI2A 1S7CA 3SZLA 4D43A 2H4ZA 2IYVA 2ZXEA 3DZJA 5FP0A 1JRLA 3PQ3A 2HV9A 4ZI5A 3CRMA 2ZWOA 1YS1X 3V3KA 3FTCA 3VHLB 1SUWA 2QG4A 1Z4LA 5JVDF 4L8WB 3TN7A 4H60A 3QUCA 3V4FA 4DV6B 4QARA 2XOXA 3LP8A 4LGVA 3FCSB 1PWEA 3CUSA 1GG8A 1ZGHA 4B8WA 2QMUA 3GLIE 1QIEA 1V47A 1ADFA 2FSUA 1TJYA 3EOBI 1FTSA 1P0PA 3EWAA 4HQ0A 3SC4A 4F1KA 4Z1MD 3QOWA 3KKNA 5K0FA 4FX5A 2Y9MB 1GTVA 3M4JA 3HKCA 3LX4A 1KFBB 1CR6A 5L6LB 1G8HA 4DJAA 3MCAA 4H4CA 1WJGA 5SICE 2XYRA 2QLLA 2VP9A 3LW8A 4E4YA 1WDLA 1ZRMA 3ZKAA 1KFEB 1WCIA 1PAUA 2VJKA 4IBOA 1UOPA 2UXBB 4ERNA 4R0MA 4PFSA 2OXFA 4MB0A 3RHZA 3I76A 2AXPA 3CVYA 3AILA 2ZUCA 5DU2A 1KYIA 3LP5A 2YFYA 4TSKA 1GDTA 2G9UA 2HBQA 3A2MA 1WSDA 1AGYA 1RWPA 2GDJA 4KXXA 4R1QA 3FM9A 2XZOA 4B4OA 2RAUA 4IWRA 1KC1A 1PGNA 2V7BA 4ZCRA 5TT1A 5KB3A 1KVRA 2VSNA 5TJHA 4A2QA 5U4XA 5JSQA 1YB5A 2CUNA 4G23A 1DUSA 5ESWA 4HDOB 1SHUX 1M34B 3EQ2A 3T7CA 1IATA 4JEUA 3VH4A 3CLKA 4RKRA 5C7YA 3G8AA 5KOJA 2Q1SA 3LK7A 4JEMA 1TAGA 3EXFA 1MPTA 1GPBA 4XWAA 3IELA 4G0YA 4C04A 5JXHA 2HGSA 4MS4B 4QEZA 4W9RA 4XSVA 1HFJA 5KNCA 4IFIA 4AX8A 1LLQA 2ZE6A 4H3VA 4IRXA 5COAA 1PR4A 3VVLA 4P0PB 4CV0A 4LPKA 4D0LB 3WGQA 3C0KA 1XEAA 5JV5A 3ZGNA 1ZY2A 1N2JA 3U1VA 2A59A 1KFJB 5AW3A 4C0QC 1Q0UA 1SMKA 3DCJA 1XNQB 4ALNA 2JFFA 3WBBA 2XXBA 1A4XA 1WVMA 1BO6A 4HJXA 4HPXB 4WLNA 3VPSA 3W3AH 4EK9A 1OI3A 5I9IA 1R0LA 1F2UB 1HT2E 1BAPA 2Z43A 4NFYA 3I32A 5MN5A 4UCFA 4XPZA 4CEJB 4RY9A 2GK7A 2VJLA 2BI4A 2P6RA 4O8BA 5BOVA 4OQPA 4ZYZA 1P5FA 1QR2A 1K5PA 1C0EA 1OX4A 2WKSA 4D25A 5B1DA 5JECA 5BQ3A 4G4JA 4K9QA 2GRMA 4HH1A 2GPYA 4CQMD 2OZLA 1BGXT 2AYXA 3GZJA 3K31A 5TGTA 3CX4A 4K8RB 3WV5A 2HK6A 3LOQA 4MAAA 3QVGB 5EEHA 4POOA 5C8YF 4KDFA 1UPUA 1GGHA 3P8ZA 2ZIAA 2IYTA 1MW8X 3KSUA 1Q7BA 3CVXA 2YUIA 3HADA 5F35A 1B6GA 1S01A 1B0ZA 3DDZX 1RWBA 4P3OA 4EX7A 4ZEXA 4BHTA 2ZYIA 3I1YA 4RKEA 1TEHA 4DJTA 3B8HA 4CKWA 1H2ZA 3BD7A 2JAUA 1LSOA 1QRAA 3OIWA 4GC5A 5AOVA 2J5RA 3SQXA 2C20A 3IGFA 1OAKA 2F4VB 2O59A 3QQ5A 1W1WA 1F0YA 3TPZA 3SU8A 1U7OA 1ZD2P 3IUQA 4HDMA 3UAWA 3TZBA 4BBJA 2FZVA 1Y5IA 3HR7A 2MYPA 2HFKA 1JDBB 5IAAA 2C94A 1EFHA 1Y4DE 3OX3A 4CMIB 3VU0A 3E23A 2AWOA 2A4KA 2HPZA 4HNTA 3OURA 3GNQA 3WR5A 3AM3A 4EQ6B 1LPSA 4QYMA 1TUBA 2YN0A 1YR8A 3TUJC 3FYAA 5AKGA 5DK4A 2XMCA 5REQB 3JD3A 4RLQA 3UT6A 4D9IA 4JJ6A 2VYCA 4OLBA 3HBNA 4BNZA 1KMNA 4HGPA 1AKVA 3BFJA 3F97A 2Y3IA 1T2NA 1R0WA 2V4ZA 3EQ7A 4HH3C 1SOAA 2XOKA 4J1XA 3Q5DA 4IIDA 4QGSA 1W2GA 2YVKA 1E9BA 3C1UA 4AECA 4BLWA 3LUAA 4WKNA 4RL4A 2BGUA 3FF4A 1RXYA 3AUSA 2PPLA 4C7OB 4W5JA 2OVFA 2OCPA 1O5TA 2WHYA 4P33A 4X7PA 2JCGA 3PBKA 5DEOA 2J32A 2PT5A 1W4RA 3BJEA 3IQDB 4YFYA 5H0IA 1T8PA 2I7TA 3DL2A 3BZWA 1N2XA 2XDAA 3H8SA 2AR7A 3C7DB 2VHCA 1ISHA 1JVBA 1Y9JA 4TLCA 4EHKA 2VWGA 2PUFA 1EGHA 4OLHA 4RSRA 1JWLA 5IMBA 3V1LA 4FKZA 1FNDA 4YRPA 4AD8A 1YFJA 1G19A 3TD6A 1DG9A 5J2UB 2G71A 1R18A 3N8KA 2OR1L 4TZ0A 1UBHS 3N9IA 2HYDA 1B8VA 1AGPA 4XVRA 4EW1A 3NGLA 4IXNA 4IVRA 4Q4AB 4F4CA 3S2UA 1X9HA 2O0LA 1E2UA 3IUEA 4M0DA 1O77A 5AJWA 4OBXA 4DV7B 3WLOA 3TSAA 3VR1A 5I7OA 2BFEA 2Y1OA 3Q15C 2YZNA 1KKUA 2FMXA 2ZLBA 8AT1A 3Q3IA 1UBJS 2NO5A 1CVIA 3DLCA 3OPYI 5FBRB 3WYFA 4MV6A 3JD0A 1B43A 3VX3A 3M6XA 4LDQA 1BX3A 3AF3A 5CYFA 2EHDA 2J45A 3HVHA 1JQDA 3EBLA 1KIFA 3KWLA 5FI3A 1LF0A 1T8YA 1CSEE 1WMBA 4YRDA 2V6MA 3LXXA 4GXTA 1U9CA 4PICA 5DI9A 3WL5A 2ZZNA 3DDWA 2DRIA 2NW6A 4FE4A 3UM9A 3KWJA 1VSUA 1SC6A 2WWIA 1GLVA 1M2EA 3AEUB 3U4QA 1N5IA 2P5UA 4ZT5A 3RS7A 3LVFO 2WA1A 3JWPA 1XN4A 3MTBA 4N0DA 5A4FS 4MKZA 2PZKA 1E2KA 5EXEA 5CXUA 5K8LA 1PFVA 3CO5A 1TRKA 4IVZA 1B6RA 1OVGA 4FR2A 4HO1X 3J80A 8OHMA 4D9BA 2H0QA 4ROSA 3M1IA 4MINA 3N8IA 5BR1A 1C4OA 2FZCA 2JKVA 4N47A 5AXCA 5A05A 1R8SA 4WJLA 1TVCA 3F3KA 3MGCA 4TWBA 3S7TA 2ECQA 1K2VN 4A9AA 4DR6B 3FSGA 3GFSA 2MDTA 2PA0A 1II8B 4IINA 3SOZA 3UOAB 3GFBA 3R7BA 3GG2A 1SB8A 3IJEB 3WNCA 1Z0AA 2CJXA 5LZ7A 1J97A 1Z63A 3GCZA 2PTGA 1QE5A 2QX8A 1VBNA 3W9SA 1M74A 4BCBA 3U80A 1O95C 1V8FA 4I6TA 4B3IA 4FJ2A 3CBGA 4LSWA 4MV0A 3F7OA 2QUHA 4QQKA 1ZXLA 2WV9A 2IWRA 4IGAA 5TLSA 2P79A 4Y2UA 3PEYA 4F3TA 2NO7A 3AI7A 3RSGA 3BFKA 4XM0A 3VU3A 2CEKA 3ZUPA 3THXB 2ZVDA 3HDHA 1KYVA 2QIPA 1QF9A 2DKFA 2VP2A 1MCZA 1WXFA 3GVIA 5DASA 1Z47A 2ORYA 1LRKA 4R5MA 2FW6A 3IHKA 4RM2A 4DL9A 5BNZA 3J81A 3PHGA 2R1TA 1JPJA 3QI7A 3IODA 1Y9QA 3RSSA 4HZUA 2P4UA 4HCJA 4QDUA 1CRLA 2C4KA 1JECA 1DTSA 1E6KA 4OBMA 1IXRC 1O8BA 3LY5A 3MM4A 3N6RA 4AK9A 1Y6QA 5REQA 5BWCA 4LE1A 3P32A 1OXKB 3NYIA 4ZPXA 2JB9A 3AFIA 3TQQA 4AUMA 3BIOA 4A8JC 4F4IA 2YOFA 1J1UA 2Q7OE 4DM7A 4ZI2A 1RIOA 4PSAA 1ONOA 1NR5A 2O06A 2VOEA 3C3CA 3MZ0A 1E3SA 5HDQA 4R68A 3ZDFA 5DE3A 5E6SA 4QGGA 4BQPA 3O83A 3R0JA 1Y33E 2DULA 4LHWA 1EX1A 4PC2A 4RV9A 3SVTA 1US8A 4RA6B 5A71A 4EFKA 3ILHA 5DNYB 3A1DA 4MIKA 4ZHQA 2JGDA 5EKTA 4KRGA 4W1PA 5D8DA 1I7SB 2LLVA 2YVLA 3RVJA 3LO8A 1DAKA 4EH1A 2RHHA 2DPYA 4PC6A 3H75A 4NTZA 1DJPA 2GK6A 3QLVA 5K0SA 2XH8A 4J1TA 3BFVA 2PGXA 1TQHA 4G86A 2P75A 2GRJA 4HEA6 4HQNA 1RPNA 1ZGAA 4PQRA 4HL6A 2XYGA 1SWVA 1RWWA 1T6XA 5DHFA 5LD2B 1QE3A 3C6QA 4JSYA 5HKOA 4MX8A 4N6OA 5CA1A 4UVIA 1PTJA 3GO4A 2XJ9A 2CEAA 3FFWA 4KLNA 1D2NA 1DMRA 1Z8NA 2DE0X 4UBNA 1VL0A 1WPQA 4GLLA 1ILWA 2WU8A 4NVRA 3D6MA 3S4YA 3VOTA 3WVNA 4DCOA 1A82A 3UB4A 5BR8B 1XTBA 2O8BA 3MMPA 1Z7EA 1KR5A 3CRZA 3A0UA 4AG6A 5LMUB 1J5EB 3IX7A 4GWKA 1BCSA 4ASUA 1QQBA 2ZM5A 1RPJA 4DNOA 2H5LA 3QX8A 3VSCA 1VYVA 2PD4A 1N2CA 1PYDA 4ISBA 1GSIA 1DJMA 4UE3S 4KE6A 1UJNA 2HHJA 3R3VA 3VJRA 4XGQA 1NGSA 4L6IA 1RZVA 5IJXA 3OETA 4A16A 3AZQA 5IWAB 2HNAA 3RKSA 4Y2RA 3H7AA 5JFOA 4P4UA 3V4RA 3E84A 3ORFA 4O08A 2CHFA 1AD2A 2O4AA 8ABPA 5IXJA 3AVQA 5KVCA 2W42A 2AFHB 5KPDA 5T3UA 4W7IA 1A50B 3MK31 3EZYA 3IUBA 4K9MA 4YMLA 4MS3B 2CV2A 4YA6A 3JQQA 3E2MA 5JNWA 3D7NA 4R1MA 1Z0ZA 4KWCA 4DCCA 2IVGA 4NCKA 2XE7A 1KRWA 2HA5A 1LBTA 3N2GA 1I51A 2J46A 4W5WA 3KSRA 4DCGA 1JVSA 5HTOA 3B3AA 1CR0A 1Y3BE 1B8NA 1XZFA 3H17A 3TXYA 3P9CA 1VG8A 3ZKWA 2WAXA 3VI3B 3K5WA 3RC9A 2W2QA 1DCFA 3C8MA 5FV7A 4JP2A 1SA0B 4CUKA 1HNZB 3C1OA 3T3DA 1XP5A 4ZP1A 3W7BA 4QJ5A 5HM8A 4HYQA 1VI2A 1X3LA 1V45E 1W93A 2XDWA 2IU3A 1VHQA 4FFNA 2ZS8A 4LJ9A 5JY6A 8ADHA 3G0CA 4YRTA 2ZB7A 2WHEA 1MB4A 2VPQA 4D57A 4RTMA 4OD0A 4JHXA 1JB9A 4P4SB 1E1QA 3PNKA 2LE0A 4JQCA 2B37A 1TIPA 5FR2A 4JYBA 3JYLA 3WG9A 3THYB 1H66A 2FLVA 3BUSA 3KCNA 2ZWAA 3KLBA 4A73A 5LNK1 3M6VA 5HMMA 2IU0A 4AF7A 1DBIA 2ET6A 3DBRA 3MF4A 3NCHA 4EHAA 5U4QA 1I4OA 1UBTS 4TQGA 4EFMA 3UFXA 1WMAA 4FD3A 1RWKA 2R8EA 1QONA 5CFNA 1A9TA 2C2OA 3NH6A 3R6WA 5KX5A 1FU7A 1H22A 1STOA 4YV2A 1ZIXA 4B79A 5IS2A 3G0IA 5K98B 2G40A 2KBEA 2X7HA 2NYUA 3FPKA 1D2GA 4LDJA 3VUEA 1QVRA 2Z6UA 4KJZA 4FDVA 3AEQB 2ZROA 1WLYA 4HSGA 2YRWA 4E0BA 2YVQA 1YKSA 4KIFA 3QOXA 1XL1A 4NEQA 1N1MA 1QFZA 3H1FA 2Q0XA 4EITA 2GRAA 4IHAA 4KK4A 1S2LA 1YBVA 1NAIA 4QUJA 2JCBA 1T3SA 1Z8FA 2P2SA 3ORSA 3WYAA 1JHAA 2FSPA 1NVKA 2AW6A 4MW0A 4GECA 5HS6A 3TH5A 1XVLA 3BA1A 1I5EA 1JJFA 4RGYA 4JCOA 2I87A 4FMCB 4K7JA 4D9KA 5B36A 5BYKA 3TFOA 3F71A 1IY2A 3GJRA 4OI4A 1XI2A 1G20E 4FS3A 3JASB 1TMKA 4H4DA 3KJIA 5ESRA 4U9HS 3LECA 2FPWA 2OCGA 4JVLA 3FUCA 2PH3A 2YVAA 3WLEA 3M4XA 1AIPA 3O1JC 4PX3A 4ETNA 4EG6A 3KQWA 3QPAA 4OMFG 3IAAA 5B7NA 1P18A 1EUZA 4C2TA 1LVGA 4F3NA 1T4CB 4LUCA 2YMQA 2OUIA 5IKEA 5I47A 2CVPA 5BYJA 3PXGA 3NTRA 4B48A 4RBNA 4QNNA 4Q9IA 3PC4A 1OLXA 1DC6A 1EU1A 2JIMA 4L16A 2QTLA 2OAEA 3ZE2B 3I09A 2B4AA 3PGLA 1E7MA 1SUSA 4RVHA 2OCIA 1TAHA 1JKIA 1YAHA 2FR8A 3LQKA 1JSLA 1N75A 4AJ2A 4AZSA 5A06A 5C4IA 1XZGA 4GZ6A 2WG0A 2FRVA 1JHXA 4YB8A 5IN5A 3SE0A 1XKXA 4I8IA 3UBMA 1EXDA 1DE0A 2D7CA 3MWEB 3R7SA 1XRJA 2JLSA 4C3ZA 3SYNA 3DBLB 3OPNA 4B84A 3K5PA 4RVCA 1GD1O 5CHYA 1L5HA 1IH8A 5IASA 1C7IA 2BLNA 1VGRA 5F77A 5HFNA 3VH3A 3IR5A 4EECA 5JS6A 5I4CA 1K63A 4QXQA 3RSLA 3NTVA 1EH5A 3H5LA 1SUEA 1S02A 4KMOA 5C46F 1PV4A 3A3PA 2PV7A 1IOWA 1GQ2A 4YXFA 2J3DA 2G28A 3JYPA 4UQOA 3CZQA 3T9BA 1V1JA 4DT1A 1R7RA 3U6BA 1ZJJA 1LNSA 1MB9A 1WV0A 2DPHA 2ZRAA 1BFDA 2ZPTX 3H65A 2XCTB 2J0SA 3EIFA 1CJSA 2O5EA 4WACA 3HCAA 4BX8A 1Q50A 3I52A 3O4GA 4GI2A 5CVCA 1ACLA 2VP6A 1PFYA 4YXWD 5BW4A 5EJFA 4BLPA 3CN9A 3KR0A 3N5CA 4XRRA 1Z0DA 2EC5A 1KO4A 2ZRIA 5NLLA 4CM8B 1SXJC 3AUAA 3DYVA 1UJ2A 2RHLA 1KK2A 3CZ4A 3AEKA 2ZJBA 1B74A 4PINA 2X9NA 2X5XA 2XUFA 3KUXA 2NXWA 1NJSA 1RXUA 3GBPA 1GV1A 5E4FA 3AY7A 4IF4A 1NN1A 1SPXA 3OTGA 2WIFA 3TTWA 2RGRA 4HPJB 3ZLJA 3X1XA 1YHYA 4EHFA 3QV2A 4MRRA 5AJUA 1E1CB 4RQAA 2IYPA 2ZWMA 4CEHB 1O6BA 2ZCVA 2I4NA 1DAIA 3K09A 2GRLA 2R7KA 3QEOA 3LAWA 3OPYA 1Q0QA 1Z0FA 3VOAA 3JTMA 4BIIA 2FEXA 2IY9A 4DRZA 1E6UA 1RYEA 1YONA 1NPDA 3OKPA 3FYUB 3T4PA 1ILEA 3ZY2A 2WV7A 3HRHA 2ODPA 4RV5A 1MH9A 4AJ4A 4RQBA 3RAFC 3HPRA 3QHAA 1GEEA 4PG8A 1QU2A 2WFLA 4YBAA 3T41A 4HTFA 2NAPA 1WUHS 2DFPA 5EY5B 3PQFA 4W6ZA 1IJBA 2P7HA 3M6FA 4N03A 4P4GA 4PIPA 3PZBA 4WCFA 1PRVA 5SZHB 2WJAA 2EF8A 3JR3A 3CNQS 3ZJYA 5GQSA 2GEVA 1KJZA 2X9GA 3L8DA 1L1QA 1NQUA