5DUIA

Identification of a new foxo1 binding site that precludes creb binding at the glucose-6-phosphatase catalytic subunit gene promoter
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
WGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures reveal a new and novel FoxO1 binding site within the human glucose-6-phosphatase catalytic subunit 1 gene promoter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Forkhead box protein O1
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5duiA00
5CVJA 3HRTA 1LNWA 2HYFA 1KQ9A 2ZMEB 3R0AA 4G7OF 4TV7A 1H9GA 4LB6B 2AS5F 3ECOA 3ZMUA 3U9GA 1QZZA 3GZ5A 2RC4A 3K2ZA 2KJBA 4M9SA 3WTZA 3DKWA 3IWFA 5D8KB 2RN7A 1HSTA 4G8XA 4IJAA 4KNYA 2GAUA 1PDNC 5LGUA 1E17A 3W6KB 4ZYEA 3F8MA 3RPQA 5HLGA 1GVJA 2CW0F 4NHJA 4CO8A 3RTRA 1P4WA 4CDGA 2HOEA 4A6DA 2IJLA 4LD5A 1A04A 3VOEA 1G3YA 3R6SA 3CJNA 3E97A 3I53A 1LDJA 2BEOA 3I0TA 5D4SA 1FP1D 1Z1DA 3ML6A 3CO6C 4DQ2A 3OV8A 3WTSC 2NAZA 4PGGA 2PQ8A 2QQ9A 4YIIA 4B09A 2VBWA 3ZPLA 2CG4A 2Y0MA 3E6DA 5ERIA 2A61A 1G3WA 4NB5A 2RQPA 3ELKA 1REPC 2MLKA 3QPHA 3U2RA 4IF4A 5J6XA 4LFUA 2X4HA 3T1BA 5BPDA 3ABTA 1DDNA 2EK5A 4MTDA 3M1EA 4KN4X 4RB1A 3K1MA 4OMYA 2DW4A 1TW2A 5L3FA 1KYZA 3EQLF 4XSZF 5FB2A 2O3FA 2EFOA 4KYWA 2NYXA 4RGUA 5LHIA 5L3GA 1ZREA 1ZHFA 2EFNA 1F1ZA 1SFEA 4O5VA 2LKPA 3J7AO 4LB5A 1YW9A 4EM1A 3P7NA 3MAJA 4O6JA 1K79A 1P4AA 2J5OA 2HTSA 2W25A 4U88A 3CO7C 3O2PE 4AWXB 3ABUA 3K0LA 3R60A 3C18A 1XCVA 5K1YA 4HF2A 2JPBA 4PCQA 2TDXA 1SMYF 5AONA 1EV7A 2DFIA 4BHPA 4ENMA 2M45A 2A6EF 1FYLA 1JE8A 3WGHA 1MJBA 2FBHA 4XLNF 3TGNA 1J7KA 2F5FA 1F9NA 1Y0UA 2LSOA 3PFIA 3JSPA 1USSA 2ZBKA 1QPMA 1YS7A 1D3YA 5ICCA 4DNCA 3ZP5A 1R1TA 4CHUA 4G6DA 1O7FA 2D2WA 3KP4A 4NQWA 2W84A 1JGSA 2R7FA 2RV8A 4GGGA 2EFQA 4BXUA 3DQVC 3R61A 5L3EA 3U1DA 5ICGA 5HS7A 4KIFA 4KUMA 2PN6A 1S6LA 3HRSA 2A3SA 2HWVA 2PI0A 1IRFA 3KP6A 1QO0D 3ISPA 2FMLA 3WGGA 3GX4X 1LEBA 4CXFA 2FQ3A 4EM0B 4P9UA 1R7JA 1BN5A 3WG9A 4HQMA 3HHGA 3G3ZA 2FMYA 5L3DA 3M9AA 3ROUA 1FX7A 1UB9A 2OZ6A 2PBIA 4QLCU 2VBYA 2GXGA 4G7ZF 3C7JA 1ZG5A 2FSWA 1B1BA 1SD7A 3FXRA 4HDVA 3RJPA 4ZZDA 1R36A 1O3QA 2XAHA 2YR2A 1J0RA 2EV6A 1J5YA 2P7VB 1ZG1A 1KYWA 2XAQA 3KP7A 4CGZA 4KMFA 2JRTA 4MEYF 3E6MA 3WU1B 1KQ0A 4IRHA 1QGPA 4JK1X 2D1VA 4Q48A 1ZLKA 3SHFA 2DI3A 4RS8A 2C6YA 2GA1A 4G9YA 4M74A 4HLYA 4FX4A 4YIFA 3KZYA 1IN6A 3RDIA 1G3TA 1YYVA 2K7LA 2BGCA 3F6VA 1TQIA 3COAC 3LAPA 1O3TA 3DXJF 2IVMA 2ZXJA 5HOOA 4HYEA 3QU6A 1TBXA 3PQJA 3FWEA 2IA0A 2A68F 5E18F 4L5JA 5IT3A 5ILVA 3F72A 2FXAA 3DPLC 4Q5SF 4I98B 2AXLA 5E8IA 2XKPA 1B4AA 4MNUA 4MQVA 3RIRA 3IL2A 4HF0A 1XMAA 3EYYA 2H09A 2KIMA 1TNTA 3T5XA 4FHTA 2P4WA 1G3SA 1NHAA 4M9ZA 1D8JA 3GO5A 3SFZA 5TJJA 4A2UA 5F1RA 1BIBA 3ZMTA 3WTYC 1RUOA 1J75A 2A6HF 2V1XA 4GCVA 1QZYA 4Q4ZF 3E5XA 3MCZA 1W5SA 2Y48A 3TOAA 2DPUA 1ZRDA 4P5OA 4WXHA 5DCMB 3F3XA 4ESFA 5A2QK 1FNNA 1R5HA 2UXXA 4GXOA 3ECHA 4OIPF 1FY7A 1FOKA 4Q47A 1WSUA 2V79A 5LGNA 1XMKA 2Z3YA 3F8NA 2E7WA 1QQIA 1KU3A 5A2QZ 3SQNA 4UVAA 1Z6RA 4ENNA 1PP8F 1U6GA 4MTEA 2FF4A 5IT9K 1IRGA 2RGVA 4IRGA 2PEXA 2XAJA 1OYYA 3M8FA 3HOSA 1P2FA 2DQLA 4M71A 2ACJA 5L3CA 2NS0A 2XASA 1XD7A 1UFMA 2QUFA 3F23A 2P5VA 1YS6A 2G9WA 2IA1A 3RKXA 2O03A 2EA2A 1IXCA 2X0LA 5DYMA 4HLXA 2VN2A 3BPXA 3GWZA 3LQRA 5LRSA 2IPQX 2DO7A 3Q9VA 4ZZLA 2RNJA 4YFKF 3BJ6A 2VC1A 2OU2A 1J9IA 1ULYA 5ILSA 1MJ9A 1SMTA 5JI6A 1O3SA 2VC0A 2M30A 1ZAOA 5FLXZ 2F5EA 1IN5A 4HOBA 4A0YA 4KIBA 1W7PD 1BM9A 4HDUA 3TO6A 2ESHA 3GVAA 1O57A 2OBPA 3WTUC 1EH8A 3FXUA 1OPCA 4IHTA 2L01A 2P6TA 3HYIA 5EEHA 3I59A 3IKVA 3HRUA 2ISZA 1MKMA 2F5CA 1ZGAA 1ON1A 4BHCA 4KMUX 1BBYA 3I58A 2FEZA 2QZ8A 2BV6A 3F8CA 1IXSB 2QQAA 2P7CB 2XVCA 5DUKA 1FYKA 1FYMA 4EJVA 2VT3A 2JPCA 2MH2A 4HQEA 3TDUC 2RVCA 2VE9A 3L7WA 2HKXA 2D45A 2YPRA 2D1HA 6PAXA 3L09A 2O6GE 1ZLJA 5H20A 1BC7C 2ZFWA 3ZMDA 2PMHA 1UHWA 2DPDA 4D0PA 4ZYHA 5DV5A 2CGPA 2QENA 4IXAA 5H6QA 4I2OA 5K5OA 4LJZF 1GXQA 3MEXA 4RAZA 1LB2A 2RDPA 4ENKA 1FT9A 3JTHA 2FBIA 4ESBA 1T2KA 2DAOA 1EH6A 3SXYA 3K1PA 4RB3C 2FE3A 2H6BA 2LDUA 2MA3A 2P5KA 1K78A 1D8KA 3FMQA 2ZNYA 1SFUA 2Z9OA 3I5UA 2DBBA 1I6XA 1KGSA 2HR3A 4MEXF 3CTAA 3K1NA 2HYGD 3WU0A 3DV8A 2F5DA 3V7CA 1SFXA 1C0WA 4A5MA 2STTA 4A0XA 1XCBA 3GEZA 2H94A 4CYDA 3ZMSA 2XGXA 4BHBA 2HQRA 3N4MA 3FM5A 3V7RA 1WQ2A 4S05A 5HLIA 3FX3A 4XRFA 3WODF 1T98A 2DLLA 3N97A 3GW2A 1U5TA 1USTA 5CVUA 2DK5A 1VTNC 3KP3A 2BBYA 2KRFA 3NQOA 3ZQ7A 4KT5C 5HLHA 2F2EA 4EJOA 5LEJA 3JAMK 2IT0A 4P9FA 3ZMZA 1ZRFA 1IN4A 2EFPA 2L3DA 3IC7A 4S04A 1T6SA 2BE5F 4WF2A 5HS9A 3KZZA 1UHMA 2H6CA 4MGRA 4UV9A 1TW3A 1OR7A 1CF7B 3J80K 3H3UA 4E70A 4R1HA 2EA4A 1OMIA 2FA5A 4YFNF 3RPUA 1KU9A 1HXDA 4M72A 2HDCA 2FNPA 4K2EA 4L5IA 1J2XA 4L0YB 1HKQA 2JT1A 3WTWC 4UV8A 3EUHA 3BPVA 1RNLA 3LA3A 5FLXK 1JHHA 1LVAA 2PG4A 1WI9A 5EEGA 4I01A 1HQCA 3JSOA 2GXBA 2EV5A 5TRDA 3K69A 1PUEE 1GXPA 5K5RA 1U8RA 2VE8A 4RGRA 3KFWX 4EV0A 1TQPA 4HX8A 2QWWA 3R0JA 2W85A 2IRFG 1I1SA 1SAXA 4CZZA 2MC3A 5BS6A 4P96A 1SD5A 3C3WA 3CUQA 4G94A 2UWMA 2DU9A 1IF1A 2COMA 3QPTA 4BH9A 3M8EA 1FLIA 5LHGA 2V6CA 4UXNA 1IXRC 3J80Z 4OIOF 2ZO4A 4L9TA 4IHSA 4IRIA 1R00A 1R23A 2HQNA 2L54A 3V8JA 3E6BA 4IVNA 3WTVC 3CLOA 4H0EA 4GYGA 1HKTA 4BQAA 4EVIA 2IA2A 1R1UA 3KETA 3TDZC 3LAJA 1L0OC 4ZYDA 5J8CA 4HZFA 4AVPA 1W7PA 1KA8A 3V7SA 2ELHA 2ZCWA 1S3JA 2XAFA 5DD4A 2GWRA 1XGNA 2CSOA 4LLLA 3TOBA 4OINF 5AIQA 2QYOA 5ILUA 4P55A 1OYWA 4HX7A 1F4KA 4A6EA 5CVIA 4LK0F 3JW4A 1ZARA 5FFZA 2FNAA 2P6SA 2ESNA 3P9CA 2GZWA 3FMRA 5AIPA 3J81Z 2MD5A 5E1XA 3NRVA 2LF8A 2XAGA 2ETHA 2H27A 2W24A 4ASNA 1OYIA 1O7LA 1WWXA 2M87A 1XGOA 1P6RA 4L9VA 2MH9A 5BMZA 1S7OA 3BJOA 3KE2A 2QVOA 5HS8A 1U2WA 4HBLA 4G6QA 1KU7A 1MDMA 4R8HA 3HHHA 1BJAA 2WTEA 1LDKB 3RI4A 3WTXC 1R22A 1BC8C 3T8RA 5F64A 1I1GA 2DQRA 5E1ZB 3IKTA 3F6OA 5KVRA 4UUVA 4ON0A 5KK1A 3C1DA 4AIJA 3HOTA 2QBYA 2A5YB 3QU3A 2VXZA 2PLYA 1IW7F 1FBQA 1IZ1A 5LBQA 1MGTA 1FSEA 4HF1A 3LSTA 1ZGJA 2K4JA 5D6EA 4LG0B 2CWEA 3GLXA 4UVBA 3ZN0A 1TLHB 1HBXG 1K7AA 1S8NA 4EJTA 4BNCA 1FC3A 4GYIA 4BAYA 2Q8KA 3GFIA 1Q1HA 3CUOA 3O3KA 2CYYA 3HSRA 2GIVA 3P9KA 3OOPA 1ZG3A 3TQNA 4AIKA 1XSXA 4OU0A 1K6OA 2J5PA 4WXCA 2CFXA 5HVQC 2MBFA 4QWQA 2B0LA 2M5WA 2ZMEA 1B59A 4YFXF 4PGHA 1MD0A 4L9JA 3NEUA 1MJAA 5HDGA 4M73A 1TQMA 4UHTA 1H0MA 4LLGF 5D4RA 5K5QA 5D8LB 2EV0A 5LLQA 2PMUA 3TO7A 4M9XA 1YG2A 3E5UA 3HRMA 1PP7U 2HTJA 2ISYA 3BZ6A 4HW0A 5D5XB 3ZN1A 3HTUA 4EQQA 4JBAA 5FFXA 1YW7A 5JHUA 5E17F 2P8TA 3REOA 1KQ8A 4WCGA 5DCFA 3D0SA 1QBJA 3I54A 2ADUA 3VB2A 5DD8A 1Z91A 1HSJA 4M6YA 1RI7A 4ETSA 2DTRA 1HW1A 1Z9CA 3D5LA 1T0FA 5IT9Z 5E8GA 1IAWA 5E20A 2K4BA 2YX4A 5BOXA 2VT2A 3VEPA 3E5QA 3WE2A 3FF5A 3LWFA 1DUXC 1XN7A 3HSEA 4U7BA 3BY6A 4EGZA 2O61A 3QOPA 3GYHX 1GHCA 3TKYA 1JXSA 5FO5A 5CJ9A 3AAFA 4KN7X 1G4DA 1YFHA 4XLPF 1I5ZA 4N9HA 1H9TA 3T0YA 3JTGA 3GFMA 4N0BA 2DK8A 1TTYA 3MZHA 2NNNA 4F7ZA 1ODDA 1V3FA 3JAMZ 4LGWA 4B8XA 3DFGA 2L02A 3B73A 1WRJA 3WGIA 1BI3A 1XGSA 3G73A 3ERED 1K78B 5CYVA 3EETA 1XSDA 2Z5UA 2G7UA 2EFWA 2HFHA 1AOYA 3HTSB 3S2WA 4RAYA 4KDPA 2OZUA 4AD9A 3E6CC 1Z05A 1XGMA 4BYYA 2Y75A 2A07F 2NRAC 1FBUA 2W57A 1YW8A 3RYRA 2PJPA 3GUDA 5JFRA 4Y15A 2K86A 4LMYA 5H6RA 4MHGA 4I09A 1S29A 1ON2A 4HA8A 2OAZA 5LGTA 2XHKA 4HX4A 1YO5C 4Y13A 2XKOA 1DPRA 2OD5A 1BI2A 3DPTA 2IP2A 5LEKA 1L3LA 2E1CA 1R1VA 3L9FA 2L4AA 5LRRA 2GA2A 1ONVA 4L18B 1G6NA 3EYIA 4UNOA 2HEOA 2EJRA 2LF7A 2HGCA 4EM2A 3F22A 1YTYA 4OMZA 3BOQA 2E7XA 5FGMA 2HZTA 1YQAA 5HDNA 2V9VA 4Y17A 3T8TA 3BROA 2KJCA 2VBZA 3BP8A 2VOPA 5ICEA 4LG0A 1P92A 4PZJA 3QP6A 4EJWA 3W6JB 3V4GA 3MWMA 3FZVA 1BI1A 3VFZA 5JVTA 2YX7A 1TNSA 4AIHA 2XIGA 2G7HA 4I7HA 3LA7A 1HKSA 2ZJ2A 3H92A 3FMSA 2QBYB 1UCRA 3O6BB 4L0ZB 1U3EM 4A5NA 4GO1A 3V8LA 3MQ0A 2M8EA 4EMSA 3MFKA 3GFJA 3KEOA 1LEAA 1MDMB 3BWGA 3RKWA 4WWCA 4U0VA 4A12A 2WWYA 3E3VA 3LQQA 3TO9A 1ZRCA 3IWZA 2QQBA 3SZTA 1FBSA 1KU2A 2EB7A 2O0YA 1YIOA 2EWNA 5E1WA 3KLOA 2K02A 4L9NA 1B6AA 1I27A 1LJ9A 1V4RA 3GXOA 3SZPA 4HV5A 3LFKA 2Q0OA 1SD4A 5DEQA 1BOAA 4YG2F 2NNYA 3QAHA 2VBXA 1O3RA 2KKOA 5J8FA 2QLZA 5HDKA 3IRQA 2OA4A 1U5TC 4FX0A 4KIGA 1B9NA 2FOKA 1JHFA 5D6FA 4WK8F 2K27A 1W7PB 3KLNA 4FT8A 2A69F 1IN8A 5DCMA 2OQGA 2V1DA 1T38A 4ZH4F 2CO5A 3L2CA 2OQRA 4RB2C 3DF8A 4I0BA 3VODA 1F5TA 5LHHA 3R4KA 1ZN2A 1E2XA 4RB0A 1J59A 1R58A 4RGSA 2XUBA 5F6FA 2L4MA 2ZNZA 2IW5A 1BIAA 1RZ4A 2FBKA 3HUGA 2XRNA 2HKOA 2HS5A 3BDDA 3IRRA 5DUIA 3V8KA 1FP2A 3Q9SA 3CUQB 5FD5A 3QP5A 2CQKA 1WKMA 4Z2YA 4ZYGA 4A0ZA 2RKHA 3M7GA 1QNTA 1LDDA 2GQQA 4R79A 4EJUA 1XB4A 3DEUA 3DP7A 1BI0A 3F21A 3I71A 4EGYA 4G7HF 5BPIA 3FXQA 1R5GA 3F8BA 3RKYA 1HW5A 3HSFA 5D5VB 1YLFA 4HAMA 3RYPA 2Z33A 5JR3A 1T39A 3EDPA 3H3ZA 3F8FA 1FPQA 2UXNA 4OIQF 3BJAA 1CF7A 4U7DA 4MQ9F 2PFBA 2Z99A 4OOIA 3K9TA 5ED4A 2UZKA 5DDGA 1RIOH 1W5TA 4CICA 3CDHA 2O8XA 1XDUA 4XSXF 3KP2A 1DPUA 4ESJA 2FU4A 4N9IA 3ZMVA 1S7AA 3P9IA 3PQKA 1U5TB 1FWZA 3QRFF 4I0AA 4KA4A 5CVRA 1IUYA 4LK1F 2XV4S 3IHUA 1LQ1A 2LNBA 2R7DA 1CGPA 4XBFA 5ICFA 4U0WA 2V1UA 2JTVA 2E1NA 1U78A 2YSRA 3WTTC 5BQTA 4LLNA 2JSCA 4UVCA 2BYVE 3GFLA 3KP5A 1OKRA 2WC2A 1FZPB 1STZA 1DP7P 2WV0A 4U0YA 4ENJA 3L00A 2KIUA 4JQFA 1MZBA 1XSVA 2R3SA 1AWCA 2QM3A 2Q2EA 4M6XA 2MLGA 2VONA 1FSHA 1X3UA 4PDKA 5D5UB 4IPAA 4HV6A 1HW2A 3J81K 3WE3A 3B02A 2FRHA 3KEQA 5L3BA 3ULQB 1B9MA 3FHZA 3LA2A 2VOOA 4RGXA 4O3MA 3KCCA 1ZH5A 3HIFA 4KICA 3GZ6A 1IN7A 4KFCA 2ZKZA 2P5LC 3FM3A 5CLSA 1W4MA 2M1BA 3I64A 3MZYA 4WX9A 4I02A 1Z7UA 1D5VA 3Q5FA 5D5WB 3CUQC 2JZYA 2DT5A 1P4XA 1ZYRF 3I4PA 5CVVA 1XDSA 2XROA 1SD6A 3I59B 1EH7A 4WXDA 1RUNA 5FD6A 2YU3A 4OIRF 3GF2A 2KIFA 2VODA 2STWA 1Z6TA
chains in the Genus database with same CATH superfamily
2OPTA 5CVJA 3I4MJ 2BVMA 3HRTA 1LNWA 2HYFA 2ELKA 1KQ9A 2WADA 2ZMEB 1YITI 2F4OB 3R0AA 4ZDLA 1T08B 1ZTRA 4G7OF 4TV7A 5F04A 1QPIA 3SDGA 1H9GA 3FHNA 4LB6B 1LPQA 3ZCOA 2AS5F 3ECOA 3ZMUA 4V2FA 2E1MC 1QZZA 1LFBA 3IH2A 3U9GA 1X3WB 2R7UA 2E2JJ 3GZ5A 2RC4A 4AYBA 3K2ZA 4NC6A 2KJBA 2TRTA 4M9SA 3J7ZI 3FXKA 3WTZA 3DKWA 1VZ0A 3IWFA 3S1RJ 2LR8A 5D8KB 3JRIA 2RN7A 1HSTA 4G8XA 1I50J 4IJAA 4KNYA 2GAUA 5B66C 4PJJA 1PDNC 5LGUA 2BZTA 1WJBA 2DYSH 1E17A 3W6KB 4C2TA 4IL6C 4ZYEA 2DDAA 2KZVA 3F8MA 3F9KA 3RPQA 3RKQA 2L5QA 5HLGA 1GVJA 2CW0F 4NHJA 4CO8A 3RTRA 3W3CA 2VJ5A 1P4WA 1ENHA 3FKIJ 4CDGA 2HOEA 5F27A 4A6DA 4JX5A 2IJLA 4LD5A 4I99C 1A04A 1RETA 3VOEA 4UUSA 2WY8Q 1G3YA 1OCZH 3HOWJ 2ZMEC 3R6SA 1W5CC 3CJNA 3E97A 3I53A 1U9OA 1LDJA 2BEOA 3MKLA 2ME0A 1I39A 3I0TA 1VQKI 3S17J 4EATA 2LY2A 1FP1D 5D4SA 1Z1DA 2RNGA 1V5EA 3PSFA 3W6VA 4LITA 2HQAA 3S3NA 4HRIA 1T8IA 5HNFA 3ML6A 3CO6C 5FKMA 3GLLA 4RLQA 3K7AJ 4DQ2A 3OV8A 4MFEA 3HOXJ 4BY7J 3WTSC 2NAZA 1EA3A 4PGGA 2PQ8A 2QQ9A 4YIIA 4B09A 5EDNA 3SEQA 3J7YJ 1MMSA 2VBWA 4F55A 3GTOJ 2EQRA 2E36A 3ZPLA 2CG4A 2Y0MA 2JJ7A 4XOTA 3E6DA 2QA4I 1FIPA 5ERIA 2A61A 1G3WA 4NB5A 2DOFA 2RQPA 3ELKA 3JREA 1REPC 2MLKA 3ZRGA 4BGDA 4OAYA 3QPHA 3U2RA 4IF4A 3RZDJ 1VQ8I 4C3JJ 1BR2A 1NG6A 1OCCH 5J6XA 2BXZA 5F08A 4MIMA 2WBMA 3CJRB 4LFUA 2X4HA 3CCRI 3T1BA 5EG0A 5BPDA 1N77A 4DW6A 3ABTA 1DDNA 1HDDC 4AYBN 2EK5A 4MTDA 1PUFA 3M1EA 3K4KA 4KN4X 4RB1A 3K1MA 4OMYA 2BHYA 2DW4A 1TW2A 5B3SH 5L3FA 1MBJA 1KYZA 3EQLF 4XSZF 5FB2A 2XF7A 1R5ID 1YJNI 1ZQ3P 2O3FA 4PFOA 2EFOA 4KYWA 2W82A 2NYXA 2X1EA 4RGUA 5LHIA 5KAFC 2ICWG 5L3GA 1ZREA 1ZHFA 3NWTA 2EFNA 3H36A 1F1ZA 1BL0A 4PFPA 2HXOA 1SFEA 3BLYA 1P9QC 4O5VA 4CA0A 1MBHA 2LKPA 3OYGA 1X4PA 3J7AO 5IYCJ 1OCOH 1YW9A 4EM1A 5E3MA 4LB5A 3P7NA 4F92B 3MAJA 4O6JA 2J5OA 1P4AA 1TT5B 1YOVB 2HTSA 2W25A 3O2PE 4U88A 3CO7C 1K79A 4AWXB 3ABUA 1K61A 3K0LA 1LFPA 3Q0VA 2EIKH 3MKZA 3R60A 3C18A 3ABKH 3A03A 1XCVA 3CCQI 1FMVA 2TCTA 5K1YA 2KFDA 5JHFA 5LFAA 4HF2A 3L2WA 4PSXA 3CMYA 3H5AA 2JPBA 2X6YA 4PCQA 1TWHJ 2TDXA 3S1MJ 3G1OA 1SMYF 5AONA 1EV7A 5IP6A 2DFIA 4BHPA 3JRBA 3I3LA 3QYFA 4ENMA 2M45A 2A6EF 1FYLA 3CCSI 2DA7A 3ZQLA 1JE8A 1OCPA 3WGHA 1MJBA 2FBHA 4XLNF 3TGNA 2ECCA 5TGTA 1J7KA 2E1MB 2F5FA 1F9NA 1YX5A 1Y0UA 1Y6IA 4UUTA 2LSOA 3PFIA 3JSPA 1USSA 5JLXA 2ZBKA 3OYAA 1QPMA 1YS7A 1D3YA 5ICCA 4J01A 1FOYA 4IQ4A 1XMXA 4DNCA 2JA2A 3ZR8X 3ZP5A 1R1TA 4CHUA 2IGOA 1OCTC 2JRMA 1ETVA 3S8PA 1R6RA 2HOTA 4G6DA 1U8BA 1O7FA 1Q1VA 2LTPA 1U0JA 2IGNA 2VJJA 4HSRA 2D2WA 3KP4A 2NS8A 2IS1A 4NQWA 2W84A 1JGSA 2R7FA 1Y0NA 2RV8A 4A3IJ 4GGGA 1HCRA 2EFQA 4HEA2 4BXUA 2CW7A 3DQVC 3R61A 5L3EA 1IGNA 3U1DA 5ICGA 4MFDA 5HS7A 4KIFA 1WH5A 4KUMA 2PN6A 1S6LA 1ERDA 3HRSA 2A3SA 2HWVA 2PI0A 1IRFA 2QCOA 3KP6A 1QO0D 1QA6A 3E7LA 3ISPA 2FMLA 3WGGA 3GX4X 1LEBA 1JJ6C 4CXFA 2FQ3A 4EM0B 4P9UA 1R7JA 3JRCA 1BN5A 3WG9A 3WU2C 3OIPA 4HQMA 3HHGA 2Q1ZB 3ZGKA 3K70C 1T56A 2FMYA 3G3ZA 3P5JA 2VLAA 3RZOJ 4A93J 1ACIA 2M7AA 4UB8C 3BZCA 5L3DA 3M9AA 3J7AY 1EKEA 2R7QA 4E6KG 1X2NA 3ROUA 1FX7A 1UB9A 2OZ6A 2PBIA 4QLCU 2VBYA 2GXGA 3CDIA 4XL9A 4G7ZF 2FX0A 3C7JA 1ZG5A 5FKNA 1GT0C 1TP4A 1WJCA 2FSWA 1BOBA 3VSLA 2KPMA 1B1BA 1SD7A 3FXRA 4HDVA 4C30A 3RJPA 2W4SA 4DOZA 4ZZDA 1NH3A 2ZXHA 4BQNA 1B8IB 1IC8A 1R36A 1O3QA 2XAHA 2YR2A 3S1NJ 1PJRA 1J0RA 2EV6A 1J5YA 2P7VB 1E0EA 1ZG1A 1KYWA 4B44A 2XAQA 3KP7A 3U1KA 1DGRM 4CGZA 4KMFA 1FIAA 2JRTA 2KLOA 3QQAA 1QVUA 3NARA 3E6MA 4MEYF 3CCVI 3E1SA 1Y1WJ 3WU1B 1KQ0A 4IRHA 3GTMJ 4II2A 1QGPA 3OIOA 4JK1X 2D1VA 4Q48A 3HB9A 2Z16A 3JCUC 1ZLKA 3SHFA 2DI3A 3FBIB 3FXLA 4RS8A 3OYNA 3GTLJ 2C6YA 2GA1A 4G9YA 4B1RA 1X58A 4M74A 1JI8A 2NVTJ 2HQ5A 4HLYA 1QHHD 4FX4A 4YIFA 1YI2I 3KZYA 1IN6A 3RDIA 5KNLA 3JRHA 4IOCF 1G3TA 4BE2A 1YYVA 4X0GA 5K7FA 4LIUA 1XTAA 2BGCA 2K7LA 3ASNH 4YRVA 3F6VA 4A3FJ 2Z1DA 2X51A 1TQIA 4X1EA 3COAC 5M5YJ 2PJRA 4NQWB 3LAPA 2CH0A 1O3TA 3DXJF 2IVMA 2DJIA 3ABLH 3CMAI 2BY1A 2ZXJA 3D5RC 3LSJA 5HOOA 4HYEA 3QU6A 1TBXA 2LBFB 4AM3A 3PQJA 3FWEA 2IA0A 2JA6J 2A68F 3FK6A 5E18F 4L5JA 1WJ5A 5IT3A 4RM3A 2R5ZB 4IO9F 5ILVA 3F72A 3CCEI 2FXAA 3DPLC 5M5WJ 4Q5SF 4I98B 3K6GA 2AXLA 5E3OA 4LIVA 4D5CA 5E8IA 2XKPA 3RQIA 1B4AA 4RAGA 4HG2A 2L2OA 4MNUA 3MMYB 3CESA 4MQVA 3RIRA 3TW7A 1Y8QB 3A02A 3HKZN 2CQNA 3MZ8A 3IL2A 4HF0A 1XMAA 3EYYA 2H09A 3NWSA 2KIMA 4FQGA 1TNTA 1IDZA 3T5XA 4FHTA 1XS9A 2L7ZA 3DEWA 2LG4A 2ELJA 2F6CA 2P4WA 1G3SA 3RSNA 3M1CA 1ETQA 1NHAA 4M9ZA 1D8JA 3GO5A 3HUGB 3SFZA 2CW8A 5TJJA 3BG7A 3G1LA 3A01B 4A2UA 2DA5A 5F1RA 2VXDA 4DZPA 3IUOA 4HNTA 1BIBA 1BR1A 3ZMTA 2LY1A 2X85A 3FXMA 3WTYC 1UZCA 1RUOA 4YIRX 1J75A 2A6HF 2V1XA 4GCVA 5IOZA 1OR7C 1QZYA 2OCCH 5M3FJ 2R7VA 3OYEA 4Q4ZF 2L7KA 3TMOA 2IEKA 3E5XA 1GDTA 3MCZA 1W5SA 1LFUP 3S1QJ 2BY0A 4BQQA 5FLMJ 4CYCA 2KHMA 2Y48A 4BKXA 1YJ9I 3BR2A 3TOAA 5IYDJ 5FKKA 1CQTA 2JVHA 2DPUA 1ZRDA 1IV6A 4P5OA 3BG6A 4WXHA 5DCMB 3F3XA 4B47A 2R7OA 4ESFA 1ETWA 4J00A 2XRLA 2PMZN 5A2QK 1FNNA 1HOMA 1R5HA 2UXXA 2LFBA 3B6CA 1S9HA 3W2WA 4GXOA 3BQZA 2W7NA 3ECHA 5LD2C 1FY7A 1IRXA 1FOKA 4OIPF 3H9JA 4Q47A 4Z6YA 2JSPA 5EG0B 9ANTA 1WSUA 2HPMA 4KISA 3PNYA 1K83J 2V79A 4FETA 3F8NA 1XMKA 2Z3YA 5LGNA 1E3OC 1QQIA 2E7WA 1KU3A 2DMTA 5A2QZ 3KYLA 3SQNA 4UVAA 1Z6RA 4ENNA 1PP8F 1U6GA 4MTEA 2OTLI 5HLTA 2FF4A 5IT9K 1IRGA 2RGVA 3LSGA 4IRGA 2PEXA 3S32A 5GAEJ 2XAJA 5IY5H 4CCOA 1OYYA 2E5ZA 3L2RA 1F43A 3M8FA 3HOSA 2VIXA 2ZB9A 1MBGA 1P2FA 2DQLA 4M71A 5FJ8J 2V6EA 2ACJA 2HXIA 5L3CA 4NNJA 3A1YA 2H8RA 3JRFA 2NS0A 2XASA 3CCMI 1XD7A 2ID3A 3FXJA 4AC0A 1UFMA 3LSPA 2QUFA 3F23A 2P5VA 3F0CA 2CMPA 3HDDA 1YS6A 2G9WA 2IA1A 3RKXA 1SVOA 1IRZA 4HNVA 1E3HA 2O03A 3TL4X 4IHYA 4A3MJ 2MC4A 2CUFA 3TEDA 2EA2A 5H2FC 3PIOF 1MMGA 1IXCA 2X0LA 4Y52J 3I9V2 2Z2SB 3LMMA 3A2KA 5DYMA 5CQGA 2DXIA 4XIDA 3PNVA 3OS1A 2DT6A 4HLXA 2GXAA 2VN2A 3BPXA 1F36A 3GWZA 3H5NA 2VPLA 3LQRA 2B7EA 5LRSA 4QTRA 2IPQX 3K4JA 1H88C 2DO7A 3Q9VA 4ZZLA 2RNJA 1O4XA 4YFKF 3HEFA 2ZSIB 3BJ6A 4BQOA 4IX7A 2IAIA 3KEYA 2VC1A 3GBGA 1JT6A 2OU2A 1J9IA 1ULYA 2FOWA 5ILSA 4E7LA 1MJ9A 2Y0SA 2WB1A 4RA2A 1SMTA 4A3LJ 1ZKGA 5JI6A 1O3SA 3CC4I 3Q0UA 5GAGJ 2VC0A 2M30A 3OYIA 2JN6A 1ZAOA 4XK4A 2VKVA 5FLXZ 5E3LA 2F5EA 1IN5A 4HOBA 5IP9J 4A0YA 3UKGA 4KIBA 3IV5A 2UUZA 4XLHA 4II3A 4FE4A 3ZQQA 3VYSB 1W7PD 1BM9A 4HDUA 1VFCA 2DOEA 5F0CA 3TO6A 2ESHA 3FIWA 2E19A 3GVAA 4YELA 1O57A 2OBPA 3WTUC 1EH8A 2E60A 2JWTA 3FXUA 3MKWB 1Y1VJ 3B6AA 1JGGA 1OPCA 4IHTA 2XF6A 4XKWA 2L01A 2P6TA 3HYIA 5EEHA 4F3QA 3I59A 3IKVA 2HZDA 4BBRJ 3ZQCA 3HRUA 2ISZA 2IBDA 1MKMA 2F5CA 1ZGAA 3JR9A 1ON1A 3K2AA 1BA5A 4BHCA 4KMUX 1MNEA 3M8JA 1BBYA 3I58A 2ZSHB 2FEZA 2ID6A 2QZ8A 2BV6A 3F8CA 5EZHA 1IXSB 2W1OA 2LOOA 3HBLA 1GUUA 2QQAA 3KYDB 3L2UA 1QRYA 4IHWA 3ESWB 2P7CB 3S2HJ 2XVCA 5GPAA 5DUKA 1EF4A 2PX9A 3GTKJ 2L9SA 1FYKA 3A0BC 1JKRC 2EPFA 1FYMA 2HU9A 2CQXA 1I3AA 1M1EB 4EJVA 3BTCA 2Y9YA 3OYJA 2VT3A 2JPCA 4QPOA 1JUSA 4BL0B 1YJWI 3BR3A 1XC5A 2GOXB 2MH2A 4HQEA 3BQYA 3TDUC 2RVCA 2VE9A 4V19K 3L7WA 5FRMA 2HKXA 2D45A 3IP4B 1W0UA 1T0FC 2YPRA 2D1HA 6PAXA 2M7BA 2K3FA 3L09A 4BXFA 3EUAA 2HOSA 5H20A 1ZLJA 1BC7C 2O6GE 2ZFWA 3ZMDA 2ZFUA 2PMHA 2JK3A 1MH3A 2H1KA 1IJWC 2H1LA 1UHWA 2DPDA 4D0PA 3H0GJ 4ZYHA 5DV5A 2CGPA 2QENA 4IXAA 3SFIA 5H6QA 4I2OA 5K5OA 3GMEA 4LJZF 1GXQA 3MEXA 4RAZA 1LB2A 4ZDOA 2K9MA 2Q2EB 2CS3A 3HC7A 2RDPA 4ENKA 1FT9A 1A5JA 3JTHA 1YHQI 1S72I 3DLAA 2FBIA 4NUBA 4ESBA 1T2KA 2DAOA 4PJMA 2R4GA 3HPGA 1EH6A 3SXYA 3D5SC 3G1MA 3K1PA 4RB3C 2FE3A 2H6BA 2LDUA 2MA3A 2P5KA 1UJ8A 1K78A 1DGWY 1D8KA 2QGUA 3FMQA 3CCYA 4G6TB 2ZNYA 4F93B 2R7ZJ 5B1AH 1SFUA 2Z9OA 3SEZA 3I5UA 3X2QH 2DBBA 1I6XA 1KGSA 2E2HJ 1YX3A 2HR3A 4MEXF 1D0ZA 5GADJ 1V5GA 3CTAA 3K1NA 2HYGD 3WU0A 1VI0A 3Q0WA 5GTHC 2GOMA 3DV8A 2DA6A 4BE0A 2F5DA 2WV1A 3V7CA 2MSYA 4FE7A 3Q3SA 1SFXA 3DTEA 1C0WA 4A5MA 2LP0A 2STTA 2YS9A 4A0XA 3OYKA 1XCBA 3GEZA 2H94A 3IH3A 4CYDA 3ZMSA 1B72A 2XGXA 4BHBA 3IAM2 2HQRA 3N4MA 3FM5A 3LSKA 3V7RA 5M3MJ 1WQ2A 4S05A 1V54H 3KPHA 5HLIA 2DMUA 3FX3A 4RAFA 2BOLA 1R49A 1X1AA 4XRFA 3WODF 1OJLA 4A3KJ 1T98A 2DLLA 3N97A 3GW2A 1U5TA 3DBHB 1USTA 3VWBA 2E5NA 4CCJA 5CVUA 3ZQHA 2VJIA 2DK5A 4PUSA 2BW3A 1VTNC 3KP3A 1ETOA 2BBYA 2KRFA 2HVSA 3NQOA 3ZQ7A 1MBKA 3TW6A 4BDZA 4KT5C 5HLHA 2KIQA 2F2EA 2Y69H 4EJOA 2XPUA 5LEJA 2NXNB 3JAMK 3GZNB 3A4CA 2IT0A 2L9NA 4P9FA 2RQQA 1LE8A 2L9VA 3ZMZA 1ZRFA 1IN4A 4BDYA 2EFPA 3K4MA 2L3DA 3IC7A 2MFZA 3PM1A 3BG5A 1FTTA 1LUJB 4S04A 4IOAF 1T6SA 2BE5F 4WF2A 2CU7A 1XX5A 5HS9A 3GCMA 1MIJA 3L2VA 4PSWA 3KZZA 1UHMA 2H6CA 4MGRA 4UV9A 2WAQA 1ORKA 1TW3A 1OR7A 4NDLA 2QSHX 1CF7B 3J80K 3H3UA 4E70A 4R1HA 2EA4A 3K4NA 1OMIA 2FA5A 4YFNF 1SVMA 3L2QA 3RPUA 1KU9A 5C4XJ 1HXDA 4M72A 2HDCA 2FNPA 4C2UA 4K2EA 4L5IA 1Y39A 1J2XA 4L0YB 3H3VK 1WGXA 1IUFA 1HKQA 2VQHA 1BR4A 2JT1A 3WTWC 2AQEA 4UV8A 3WHCA 1D5YA 3EUHA 3BPVA 1RNLA 3LA3A 5FLXK 3IAS2 4XLCA 4XKVA 2QSGX 1JHHA 1LVAA 1J09A 2PG4A 2E35A 1WI9A 2Y30A 5EEGA 4I01A 1HQCA 4XICA 1KONA 3JSOA 2GXBA 2EV5A 3CZ6A 5TRDA 3K69A 1PUEE 2JMWA 5K5RA 1U8RA 1GXPA 2VE8A 3PUBA 4E7ZA 1MMAA 4RGRA 3KFWX 1V55H 3K4BA 2X1DA 3U21A 4EV0A 3CC7I 3BG3A 2CV1A 2AQFA 4A69C 3QWLA 1TQPA 4HX8A 2QWWA 4XMYA 3R0JA 2XGEA 2VQCA 2LYCA 2M4GA 4A3BJ 2W85A 4BXXJ 2IRFG 3DKYA 3H5RA 1I1SA 4KITB 1SAXA 3FKJA 1VQOI 4FTHA 4W1UA 4CZZA 2MC3A 5BS6A 4P96A 2X1CA 1SAUA 3N05A 1SD5A 3C3WA 1K6YA 1HA8A 3BR5A 2FUG2 2EZKA 3CUQA 4G94A 2UWMA 2OJED 3G6EI 2DU9A 1JUPA 1IF1A 3OWTA 2COMA 3ONQA 1DQUA 1APLC 3QPTA 4BH9A 4I76A 3M8EA 1FOWA 5F1JA 1FLIA 2E34A 2NOGA 2XAUA 5LHGA 1X3ZB 2WAQN 2M8GX 2V6CA 1E3PA 1TWGJ 4UXNA 2IXSA 2DMNA 4B3XA 2V4JC 2CRGA 1IXRC 3J80Z 4OIOF 2ZO4A 4IHXA 2GM4A 4L9TA 1RR8C 4IHSA 4IRIA 1R00A 1R23A 2HQNA 3SJMA 2L54A 3V8JA 3E6BA 4IVNA 3S15J 4U87A 3WTVC 3CLOA 1P7JA 4H0EA 4GYGA 4NC8A 2M0CA 1HKTA 2BY3A 1T95A 4BQAA 4EVIA 5EF6A 1SFOJ 2M3AA 1VQ7I 2IA2A 2MYSA 1R1UA 3KETA 3CCUI 1JTXA 3TDZC 3LAJA 2R7TA 1L0OC 4C9YA 4ZYDA 5J8CA 4D7NA 4CUGA 4HZFA 3PL8A 4AVPA 1W7PA 4DYQA 1KA8A 3OYBA 1S5LC 3V7SA 3HPHA 4M3GA 2ELHA 1XPXA 2ZCWA 1S3JA 2LC2A 2XAFA 3ABMH 5DD4A 2GWRA 4G12A 1XGNA 1X1CA 2CSOA 2P81A 4LLLA 4DGWB 3TOBA 4OINF 5AIQA 2QYOA 4FASD 2WY7Q 5ILUA 4P55A 1OYWA 2CJJA 2FQ4A 4HX7A 1TC3C 1F4KA 3M4OJ 2I8DA 5CVIA 2LLKA 4A6EA 4CH7A 4LK0F 5DTDA 3JW4A 1ZARA 3KIOA 5FFZA 2FNAA 2YUSA 2P6SA 2ESNA 3P9CA 3FDYA 3CJQB 2GZWA 2EZLA 3FMRA 5AIPA 3J81Z 2MD5A 5E1XA 3NRVA 3VYRB 2LF8A 3OY9A 2XAGA 2ETHA 1Z0XA 2H27A 2W24A 4ASNA 2V7FA 1OYIA 2CUEA 3QYBA 1O7LA 2K9SA 3BZKA 1H8AC 1X19A 1BW5A 1WWXA 4D5FA 1JKQC 2M87A 1XGOA 1UMQA 2LMDA 1SC7A 1P6RA 4L9VA 1PUFB 1K4TA 2OV7A 2MH9A 5BMZA 1S7OA 3BJOA 1ETYA 3HGYA 3KE2A 2QVOA 5HS8A 3BCBA 5DM6F 1U2WA 1WJAA 3HKZA 4HBLA 2DN0A 1I3QJ 4G6QA 3CMEI 2DMPA 1KU7A 1MDMA 4R8HA 3HHHA 1BJAA 2WTEA 1SVLA 2V9KA 4L5EA 1LDKB 4CYCB 3RI4A 2XSDC 1A31A 3VYTB 1R22A 3WTXC 3T8RA 5F64A 1BC8C 1OFCX 2HDWA 2K40A 1I1GA 2DQRA 5E1ZB 1VNDA 3IKTA 4ZJZA 1N78A 3F6OA 4D1QA 4ANJA 3TBIA 5KVRA 4Y3OA 2HVRA 2QQ8A 4UUVA 4ON0A 5KK1A 2VKDA 3C1DA 1N75A 1WCMJ 4AIJA 3HOTA 4XLFA 2QBYA 2A5YB 3MVPA 3QU3A 3D1NI 1X1BA 2VXZA 2X9DA 4M3BA 2PLYA 1IW7F 3BCAA 2DTZA 3OYMA 1FEXA 2KQRA 4C3HJ 4J19A 2EBIA 1QVTA 2EIJH 3DEEA 4E7KA 3H35A 2F4IA 5E79C 2O9LA 1FBQA 1IZ1A 3CQZJ 1MGTA 5LBQA 4OWRB 1FSEA 4PJ0C 4HF1A 3LSTA 1ZGJA 4M3DA 2K4JA 5D6EA 4LG0B 2CWEA 2NOJB 3LL7A 2XPVA 3GLXA 4BJTA 4UVBA 3ZN0A 1MSEC 1TLHB 1HBXG 4M3EA 1K7AA 2XGDA 3CCJI 1S8NA 1ZELA 4ZTFA 3DKXA 3DLLF 4EJTA 4BNCA 1FC3A 1TWAJ 4GYIA 4BAYA 2Q8KA 2R5ZA 2B63J 3HGGA 2VASA 3GFIA 2LD5A 2F4MB 1Q1HA 3HG9A 2JA5J 5GAHJ 3CUOA 3O3KA 2CYYA 3HSRA 2GIVA 3P9KA 2L0KA 5FLVA 3OOPA 2KZGA 2NVYJ 4CZCA 1ZG3A 1W36D 1BJZA 3TQNA 4AIKA 1XSXA 3OL4A 4OU0A 1K6OA 4DZJA 2J5PA 3KYCB 1U9NA 2BHZA 4WXCA 2CFXA 5HVQC 3VPRA 2MBFA 4QWQA 2M4KA 2H8WA 5BNGA 2VB6A 2B0LA 1Z21A 3ERMA 3FISA 2I10A 2M5WA 2ZMEA 4JYKA 2DODA 1B59A 4YFXF 2L7FP 1P7IA 4PGHA 2EH3A 1MD0A 3E0JB 3PNTA 4RBOA 3DBRB 4L9JA 3NEUA 1MJAA 5HDGA 4A3JJ 4M73A 1TQMA 1MW7A 4UHTA 1H0MA 4LLGF 5D4RA 5K5QA 2CUJA 4XRMA 5D8LB 1V5FA 2EV0A 5LLQA 1JJ8C 1HLVA 2PMUA 2MD0A 2X6WA 3TO7A 3GTQJ 4PK4A 4M9XA 1YG2A 3E5UA 3QPLA 3BR0A 1IO2A 1OLTA 1B8IA 1NK3P 3OYLA 3A0HC 3HRMA 1SANA 1PP7U 1TWFJ 3MD2A 2HTJA 2ISYA 3BZ6A 4HW0A 2OCEA 3AG3H 5D5XB 3ZN1A 3HTUA 4BUPA 4XKBA 4D7MA 4E7JA 1MH4A 3H1CA 1A36A 4EQQA 3HOUJ 4F91B 4GFBA 4JBAA 5JLWA 1N25A 1MNDA 5FFXA 1YW7A 4PJLA 3RPUD 3I56I 1RR7A 5JHUA 5E17F 3AL0B 2P8TA 4H4KC 3REOA 4B3AA 3VYUB 1KQ8A 3RCOA 1R9TJ 5FRNA 1Z77A 5DCFA 4WCGA 1HDPA 1R4NB 2LK2A 3D0SA 5DM7F 4KT6A 1QBJA 2NS7A 3I54A 1G59A 2ADUA 2W48A 3WHBA 3VB2A 5DD8A 1Z91A 1HSJA 4AVZA 4AIDA 2EILH 2OTJI 4M6YA 1RI7A 4ETSA 2DTRA 4HSTA 1HW1A 3PJRA 1Z9CA 4FISA 5EGOB 3D5LA 1T0FA 1XG1A 5IT9Z 5E8GA 1IAWA 2WB1N 2K5CA 3QPSA 5E20A 2R92J 2K4BA 2YX4A 4XORA 4W97A 2VT2A 5BOXA 3OSFA 2L9RA 3VEPA 3E5QA 3CLQA 3IH4A 2HI3A 3WE2A 3FF5A 1WH7A 3DTKA 3HJEA 3LWFA 4XKCA 4MLOA 2XDVA 1DUXC 1MMNA 1XN7A 3HSEA 5EZGA 4XQFA 3EUHC 4XRSA 4U7BA 1JKOC 3OSGA 2ECBA 3L1PA 1NG7A 1QZEA 3BY6A 1UG0A 3DU5A 5CQEA 4UY8I 4EGZA 2Y9ZA 3I55I 2O61A 4BU2A 3QOPA 3GYHX 1GHCA 3TKYA 3DWLE 3CMMA 2JUCA 2JVGA 4GRIA 1JXSA 5FO5A 5CJ9A 3AAFA 4KN7X 3G4SI 1POGA 2DA3A 5IOYA 4I6ZA 1G4DA 4ZDPA 1YFHA 1MNMC 4IQJA 4XLPF 1I5ZA 4N9HA 4E7IA 3M3YJ 1H9TA 3T0YA 4BACA 1WFXA 3JTGA 1QU3A 3JRGA 3GFMA 3SZGA 5EGOA 2HOAA 4LG3A 2M34A 1TT0A 4N0BA 1TTYA 2DK8A 2D5VA 4XNFA 3MZHA 2NNNA 1Z3XA 1R4MB 4F7ZA 1WJDA 1ODDA 1V3FA 3JAMZ 4LGWA 4B8XA 2LKSA 3DFGA 5J1RA 2LVSA 1WJFA 2M9HA 2L02A 3B73A 3OS0A 2DFHA 4RDUA 2DFFA 2XPWA 2HDDA 3MKYB 1WRJA 2ZC2A 3WGIA 1GV2A 1BI3A 1XGSA 2EINH 3G73A 3ERED 1K78B 5CKTA 2JA7J 5CYVA 3EETA 1G8XA 1XSDA 2Z5UA 2G7UA 1X2MA 3EPZA 2EFWA 5IPAA 1R71A 1RKWA 2HFHA 1AOYA 3HTSB 4IZZA 3S2WA 3K4CA 3VSKA 3PIPF 2K9LA 4RAYA 4KDPA 1GV5A 2OZUA 4AD9A 1NK2P 1ZR2A 4JOMA 1AU7A 1D0XA 2KRCA 3E6CC 3AL0C 1Z05A 1XGMA 2CV2A 4BYYA 2RREA 3PO3J 2Y75A 2A07F 2NRAC 1DU0A 1FBUA 3FK7A 2W57A 4OAZA 4ITVA 3S14J 3ASOH 1YW8A 3RYRA 2PJPA 3GUDA 4BY1J 5JFRA 1ETKA 4Y15A 2K86A 2IS4A 5J4YA 4DYCA 2L7MP 4E7SA 3LSIA 2XB5A 4XLEA 1IDYA 2LRDA 4LMYA 3CC2I 2ZJRF 1VQPI 3H0DA 3FBNB 5H6RA 4MHGA 4I09A 4QSHA 4B4CA 5J47A 1S29A 1ON2A 4HA8A 2OAZA 5LGTA 2XHKA 4HX4A 4UUSB 4Y33A 1YO5C 4Y13A 2XKOA 1UHSA 2ME6A 1DPRA 2OD5A 1BI2A 3DPTA 2O7OA 2IP2A 5LEKA 1L3LA 2E1CA 1R1VA 3L9FA 4N4NB 2L4AA 5LRRA 1WHUA 2GA2A 2X48A 1ONVA 4L18B 4RLFA 1G6NA 3EYIA 1JUMA 4UNOA 2HEOA 2EJRA 4DBQA 4F52A 2LF7A 2HGCA 2DFEA 4EM2A 5EYRA 2KL4A 3F22A 3LSRA 2BVLA 1YTYA 4OMZA 3BOQA 1D1AA 4D9JA 1D1CA 2E7XA 1ITYA 2XF5A 2HZTA 5FGMA 1YQAA 2VJ4A 3O8HA 5HDNA 2V9VA 4Y17A 3T8TA 3BROA 1AKHB 2M2EA 5C4JJ 2KJCA 2VBZA 1YRNA 3CF5F 5F0FA 3BP8A 3PUFA 4XN0A 2V26A 2VOPA 1JTYA 2OC6A 5ICEA 4DYRA 4LG0A 3AG1H 1P92A 3DPUA 3ZOBA 5TISC 4PZJA 1KZHA 1GVDA 3QP6A 4EJWA 3W6JB 3V4GA 3MWMA 3FZVA 1BI1A 2CFOA 2R0QC 1SEUA 2V9PA 3BR6A 3VFZA 5JVTA 2YX7A 1TNSA 2QEXI 4CCNA 4AIHA 2XIGA 2I5UA 2G7HA 5HNHA 4I7HA 2KDOA 3LA7A 3AKZA 1HKSA 2ZJ2A 3H92A 3LFUA 2UV1A 2XGCA 3FMSA 3LOCA 2QBYB 1UCRA 2ZXWH 3O6BB 4L0ZB 4HPQA 2DT7B 2QSFX 3G71I 1U3EM 5IYBJ 1VQ4I 2A5WA 4A5NA 4V2GA 2E1OA 2JQ7A 4GO1A 3H9QA 2IGKA 3BTLA 3OYFA 3V8LA 2ZJQF 3GTPJ 4BE1A 1VQNI 3MQ0A 3OYDA 4HNUA 1OQYA 2M8EA 4EMSA 1X4OA 2K9NA 1UG2A 5DS9A 3MFKA 1JT0A 2HNHA 3DU6A 3DCFA 3GFJA 2R7WA 3S3MA 1VQ9I 1H89C 4NC7A 4M3FA 2CV0A 3KEOA 1LEAA 1MDMB 3BWGA 3RKWA 4WWCA 4BEHA 5FKOA 4CCMA 4U0VA 4A12A 4IEJA 2WWYA 3E3VA 3LQQA 3TO9A 4P1WA 3OR2C 1ZRCA 1OISA 3AG4H 3UR3C 3OYHA 5KAIC 3CP2A 2IS6A 1D1BA 3IWZA 2QQBA 3C2BA 3SZTA 1FBSA 1KU2A 1I6HJ 2EB7A 2O0YA 1YIOA 2LKXA 3O8GA 2DJNA 2EWNA 5E1WA 3KLOA 2K02A 3OYCA 3BTJA 5E3NA 3CD6I 3S3OA 4L9NA 1B6AA 1I27A 3KZIC 2GLOA 1LJ9A 1V4RA 3GXOA 3SZPA 4HV5A 3LFKA 2Q0OA 1SD4A 5DEQA 3MN2A 1BOAA 4BS9A 4YG2F 1RPWA 2NNYA 1PVEA 4FCYA 3QAHA 3RQ4A 3W2AA 2VBXA 3LNQA 1O3RA 4XRSG 1VF9A 2KKOA 2LH9A 1NTCA 4E7HA 5KCMA 5J8FA 2QLZA 5HDKA 3IRQA 3CP8A 2OA4A 2HPIA 1U5TC 3K4LA 1QHGA 2EZHA 2KDZA 2DA2A 2Y0SN 3CJTB 3CF2A 3ZQFA 2QKLB 3CDLA 4FX0A 2MABA 4KIGA 1RESA 4Y4RA 1B9NA 2NVUB 3ZXSA 3SYTA 2K3PA 2FOKA 1JHFA 5CPRB 4RM2A 3LSMA 5D6FA 2YU9J 3BR1A 4WK8F 1ZR4A 2K27A 3HOZJ 1W7PB 1X1PA 3KLNA 4FT8A 1LKXA 3EUKL 1IG7A 2A69F 1IN8A 5DCMA 2OQGA 2V1DA 1FOXA 2QKMB 2VL8A 1T38A 4ZH4F 2CO5A 2DCEA 2VUMJ 2KISA 3K70D 4XR6A 1Z3YA 5B1BH 2CQ7A 2COBA 2KT0A 1WI3A 2Y31A 3L2CA 2OQRA 3SDBA 4RB2C 3DF8A 4I0BA 3VODA 4XM3A 5GP9A 1F5TA 3OL3A 5LHHA 3R4KA 2OUMA 4XOPA 1ZN2A 1E2XA 4RB0A 5F0HA 3S93A 1J59A 3JRDA 1R58A 4RGSA 2XUBA 5F6FA 2L4MA 2VPRA 2ZNZA 2IW5A 3ZQIA 3PO2J 3A01A 1BIAA 1RZ4A 2FBKA 3HUGA 2XRNA 4ZC3A 2HKOA 2EZIA 2HS5A 3BDDA 4KJZA 3IRRA 2MG4A 2BXYA 1Z7LA 1AA7A 5JVGF 1FMWA 5DUIA 3CCLI 3PSIA 3BC8A 3V8KA 1EJ9A 1FP2A 1Y56A 2RAEA 3DTIA 4MO7A 4EEFG 3Q9SA 3CUQB 3G2BA 5IP7J 5FD5A 3QP5A 2K85A 4CCKA 2F5VA 1TWCJ 2R5YA 2K9QA 3OS2A 2CQKA 2OF7A 5C3EJ 1YRNB 1WKMA 4RMNA 4Z2YA 4ZYGA 1AKHA 2ZXIA 5J1UA 4JX4A 4A0ZA 2R93J 3S2DJ 5FROA 4AUXA 1FTZA 2AXTC 2RKHA 3M7GA 2LBFA 1QNTA 2M0MA 5C44J 1LDDA 2A6TA 2GQQA 4R79A 1RKTA 4DJAA 3HL2A 2PJRB 4EJUA 5GTIC 1XB4A 3HZJA 4NBQA 1BW6A 1WPKA 3DEUA 3DP7A 1BI0A 4DIQA 3F21A 2B9SA 3I71A 3NAUA 2PMZA 1WJEA 4X6AJ 2FD5A 4QIWN 4EGYA 4G7HF 5BPIA 3FXQA 4N4OB 2W00A 5EEAA 3BTIA 5K7ZA 2WA0A 1AHDP 1R5GA 3F8BA 3RKYA 2P0WA 1HW5A 1PYVA 3HSFA 2VKHA 3TP3A 5D5VB 1YLFA 2MGQA 1Z67A 3BT9A 4HAMA 4UB6C 3RYPA 3QYEA 2DDBA 2Z33A 2VI6A 3GTGJ 5JR3A 3H9GA 1IV8A 4A3EJ 1T39A 1W36C 3S16J 3EDPA 4A3DJ 4S0HB 3H3ZA 3F8FA 4IHVA 3VDXA 1FPQA 2UXNA 4OIQF 3BJAA 3OR1C 1CF7A 4U7DA 4BJ5C 4MQ9F 2PFBA 2Z99A 4OOIA 3K9TA 5B5EC 3C2HA 1D0YA 5ED4A 2UZKA 1VQLI 1HF0A 5FKLA 2VQLA 5DDGA 1RIOH 1MBFA 3WG7H 1VQ6I 3HOVJ 1G2HA 1LE8B 1W5TA 2IS2A 1A6QA 4CICA 3CDHA 2R5YB 5J1YA 1LVKA 2KP6A 2O8XA 2DA4A 1XDUA 2X6OA 4XSXF 3KP2A 1DPUA 3V42A 4ESJA 3AG2H 2FU4A 3OMYA 1OCRH 2BW3B 3M07A 4N9IA 3ZMVA 1S7AA 3I4NJ 4JX6A 3P9IA 4ZYAA 1YE9A 3PQKA 1U5TB 1FWZA 4I0AA 4C3IJ 4KA4A 3QRFF 1WVRA 5CVRA 2JUGA 1IUYA 1DU6A 1A6IA 4LK1F 2XV4S 2O8KA 3IHUA 1LQ1A 3QODA 2N8GA 2LNBA 1ETXA 2R7DA 4LOCA 1CGPA 4XBFA 2VQGA 3FXOA 2V1NA 4U0WA 5ICFA 5K7HA 1B72B 1HC8A 3UNGC 1Y8RB 2O5RA 5J3LA 4Y7NJ 2V1UA 4XN3A 2ZJPF 2JTVA 2NVXJ 5HODA 2E1NA 4ABZA 2IGMA 2DMQA 1U78A 2YSRA 4CSWA 1ZGWA 3WTTC 5BQTA 4C2MJ 5J4VA 3PFYA 4M6VA 1X1DA 4LLNA 2HVQA 2JSCA 4UVCA 2BYVE 1SFKA 3GFLA 3KP5A 1UAAA 1OKRA 2WC2A 4ZTJA 1MBEA 1FZPB 1STZA 1DP7P 2XSJC 2WV0A 1DP3A 2A05A 4U0YA 2FJ1A 4BJ6C 4ENJA 3L00A 2LREA 1JKPC 4A3GJ 2AO9A 2KIUA 4JQFA 2R7SA 1MZBA 1YIJI 1S7EA 2E2IJ 1K4SA 1XSVA 4BBSJ 5EJCA 1A35A 2R3SA 3C2GA 1AWCA 2QM3A 2Q2EA 4AU7A 2EIMH 4M6XA 2MLGA 1UELB 1VQMI 2KRHA 2VONA 1FSHA 1X3UA 4PDKA 4PJNA 2DA1A 2XC7A 3LSHA 5D5UB 4IPAA 2CQQA 4HV6A 2WAEA 1HW2A 2R7XA 3J81K 3KX2A 1MSFC 4XLAA 3WE3A 4QPQA 3B02A 2HYJA 2FRHA 3KEQA 1RC9A 5L3BA 1TL8A 3GTJJ 3ULQB 1B9MA 2AHQA 2E71A 4XONA 3FHZA 3OIQA 3LA2A 2VOOA 4RGXA 3HOYJ 4O3MA 3KCCA 1W0TA 1ZH5A 3HIFA 3OOUA 4KICA 4A3CJ 1GLNA 1IN7A 3GZ6A 4KFCA 2XB0X 3BG9A 2MW8A 1RRJA 2ZKZA 2DOAA 2F48A 2P5LC 3FM3A 5CLSA 1W4MA 2WAFA 2M1BA 2CUZA 3HM5A 5GPCA 3JRAA 2Y2ZA 5J40A 3I64A 4BEHB 4E4HA 1MMDA 2G0EA 3MZYA 3AFHA 1ZK8A 4WX9A 4I02A 2VKEA 2NVQJ 3TP0A 1T33A 2GBYA 4DBRA 5KHDA 1W1WE 1Z7UA 2BY2A 1D5VA 3Q5FA 5D5WB 3CUQC 2JZYA 2KMUA 1VQ5I 2DT5A 1P4XA 3K10A 4YEJA 1ZYRF 3I4PA 5CVVA 2GIZA 4B48A 1XDSA 1FJLA 2XROA 1SD6A 2X6XA 3I59B 1EH7A 4B43A 2QF7A 2R7RA 3ZQGA 4IKFA 4WXDA 3HXLA 1RUNA 5M5XJ 3QOEA 5FD6A 4JP0A 2JA8J 1WZ2A 4GDFA 2YU3A 4OIRF 3GF2A 2KIFA 2VODA 4CCLA 3DBLB 2STWA 2DYRH 2LY9A 1Z6TA 1TZLA 3W2VA
chains in the Genus database with same CATH topology
5CVJA 3HRTA 1LNWA 2HYFA 1KQ9A 2ZMEB 3R0AA 4G7OF 4TV7A 1H9GA 4LB6B 2AS5F 3ECOA 3ZMUA 3U9GA 1QZZA 3GZ5A 2RC4A 3K2ZA 2KJBA 4M9SA 3WTZA 3DKWA 3IWFA 5D8KB 2RN7A 1HSTA 4G8XA 4IJAA 4KNYA 2GAUA 1PDNC 5LGUA 1E17A 3W6KB 4ZYEA 3F8MA 3RPQA 5HLGA 1GVJA 2CW0F 4NHJA 4CO8A 3RTRA 1P4WA 4CDGA 2HOEA 4A6DA 2IJLA 4LD5A 1A04A 3VOEA 1G3YA 3R6SA 3CJNA 3E97A 3I53A 1LDJA 2BEOA 3I0TA 5D4SA 1FP1D 1Z1DA 3ML6A 3CO6C 4DQ2A 3OV8A 3WTSC 2NAZA 4PGGA 2PQ8A 2QQ9A 4YIIA 4B09A 2VBWA 3ZPLA 2CG4A 2Y0MA 3E6DA 5ERIA 2A61A 1G3WA 4NB5A 2RQPA 3ELKA 1REPC 2MLKA 3QPHA 3U2RA 4IF4A 5J6XA 4LFUA 2X4HA 3T1BA 5BPDA 3ABTA 1DDNA 2EK5A 4MTDA 3M1EA 4KN4X 4RB1A 3K1MA 4OMYA 2DW4A 1TW2A 5L3FA 1KYZA 3EQLF 4XSZF 5FB2A 2O3FA 2EFOA 4KYWA 2NYXA 4RGUA 5LHIA 5L3GA 1ZREA 1ZHFA 2EFNA 1F1ZA 1SFEA 4O5VA 2LKPA 3J7AO 4LB5A 1YW9A 4EM1A 3P7NA 3MAJA 4O6JA 1K79A 1P4AA 2J5OA 2HTSA 2W25A 4U88A 3CO7C 3O2PE 4AWXB 3ABUA 3K0LA 3R60A 3C18A 1XCVA 5K1YA 4HF2A 2JPBA 4PCQA 2TDXA 1SMYF 5AONA 1EV7A 2DFIA 4BHPA 4ENMA 2M45A 2A6EF 1FYLA 1JE8A 3WGHA 1MJBA 2FBHA 4XLNF 3TGNA 1J7KA 2F5FA 1F9NA 1Y0UA 2LSOA 3PFIA 3JSPA 1USSA 2ZBKA 1QPMA 1YS7A 1D3YA 5ICCA 4DNCA 3ZP5A 1R1TA 4CHUA 4G6DA 1O7FA 2D2WA 3KP4A 4NQWA 2W84A 1JGSA 2R7FA 2RV8A 4GGGA 2EFQA 4BXUA 3DQVC 3R61A 5L3EA 3U1DA 5ICGA 5HS7A 4KIFA 4KUMA 2PN6A 1S6LA 3HRSA 2A3SA 2HWVA 2PI0A 1IRFA 3KP6A 1QO0D 3ISPA 2FMLA 3WGGA 3GX4X 1LEBA 4CXFA 2FQ3A 4EM0B 4P9UA 1R7JA 1BN5A 3WG9A 4HQMA 3HHGA 3G3ZA 2FMYA 5L3DA 3M9AA 3ROUA 1FX7A 1UB9A 2OZ6A 2PBIA 4QLCU 2VBYA 2GXGA 4G7ZF 3C7JA 1ZG5A 2FSWA 1B1BA 1SD7A 3FXRA 4HDVA 3RJPA 4ZZDA 1R36A 1O3QA 2XAHA 2YR2A 1J0RA 2EV6A 1J5YA 2P7VB 1ZG1A 1KYWA 2XAQA 3KP7A 4CGZA 4KMFA 2JRTA 4MEYF 3E6MA 3WU1B 1KQ0A 4IRHA 1QGPA 4JK1X 2D1VA 4Q48A 1ZLKA 3SHFA 2DI3A 4RS8A 2C6YA 2GA1A 4G9YA 4M74A 4HLYA 4FX4A 4YIFA 3KZYA 1IN6A 3RDIA 1G3TA 1YYVA 2K7LA 2BGCA 3F6VA 1TQIA 3COAC 3LAPA 1O3TA 3DXJF 2IVMA 2ZXJA 5HOOA 4HYEA 3QU6A 1TBXA 3PQJA 3FWEA 2IA0A 2A68F 5E18F 4L5JA 5IT3A 5ILVA 3F72A 2FXAA 3DPLC 4Q5SF 4I98B 2AXLA 5E8IA 2XKPA 1B4AA 4MNUA 4MQVA 3RIRA 3IL2A 4HF0A 1XMAA 3EYYA 2H09A 2KIMA 1TNTA 3T5XA 4FHTA 2P4WA 1G3SA 1NHAA 4M9ZA 1D8JA 3GO5A 3SFZA 5TJJA 4A2UA 5F1RA 1BIBA 3ZMTA 3WTYC 1RUOA 1J75A 2A6HF 2V1XA 4GCVA 1QZYA 4Q4ZF 3E5XA 3MCZA 1W5SA 2Y48A 3TOAA 2DPUA 1ZRDA 4P5OA 4WXHA 5DCMB 3F3XA 4ESFA 5A2QK 1FNNA 1R5HA 2UXXA 4GXOA 3ECHA 4OIPF 1FY7A 1FOKA 4Q47A 1WSUA 2V79A 5LGNA 1XMKA 2Z3YA 3F8NA 2E7WA 1QQIA 1KU3A 5A2QZ 3SQNA 4UVAA 1Z6RA 4ENNA 1PP8F 1U6GA 4MTEA 2FF4A 5IT9K 1IRGA 2RGVA 4IRGA 2PEXA 2XAJA 1OYYA 3M8FA 3HOSA 1P2FA 2DQLA 4M71A 2ACJA 5L3CA 2NS0A 2XASA 1XD7A 1UFMA 2QUFA 3F23A 2P5VA 1YS6A 2G9WA 2IA1A 3RKXA 2O03A 2EA2A 1IXCA 2X0LA 5DYMA 4HLXA 2VN2A 3BPXA 3GWZA 3LQRA 5LRSA 2IPQX 2DO7A 3Q9VA 4ZZLA 2RNJA 4YFKF 3BJ6A 2VC1A 2OU2A 1J9IA 1ULYA 5ILSA 1MJ9A 1SMTA 5JI6A 1O3SA 2VC0A 2M30A 1ZAOA 5FLXZ 2F5EA 1IN5A 4HOBA 4A0YA 4KIBA 1W7PD 1BM9A 4HDUA 3TO6A 2ESHA 3GVAA 1O57A 2OBPA 3WTUC 1EH8A 3FXUA 1OPCA 4IHTA 2L01A 2P6TA 3HYIA 5EEHA 3I59A 3IKVA 3HRUA 2ISZA 1MKMA 2F5CA 1ZGAA 1ON1A 4BHCA 4KMUX 1BBYA 3I58A 2FEZA 2QZ8A 2BV6A 3F8CA 1IXSB 2QQAA 2P7CB 2XVCA 5DUKA 1FYKA 1FYMA 4EJVA 2VT3A 2JPCA 2MH2A 4HQEA 3TDUC 2RVCA 2VE9A 3L7WA 2HKXA 2D45A 2YPRA 2D1HA 6PAXA 3L09A 2O6GE 1ZLJA 5H20A 1BC7C 2ZFWA 3ZMDA 2PMHA 1UHWA 2DPDA 4D0PA 4ZYHA 5DV5A 2CGPA 2QENA 4IXAA 5H6QA 4I2OA 5K5OA 4LJZF 1GXQA 3MEXA 4RAZA 1LB2A 2RDPA 4ENKA 1FT9A 3JTHA 2FBIA 4ESBA 1T2KA 2DAOA 1EH6A 3SXYA 3K1PA 4RB3C 2FE3A 2H6BA 2LDUA 2MA3A 2P5KA 1K78A 1D8KA 3FMQA 2ZNYA 1SFUA 2Z9OA 3I5UA 2DBBA 1I6XA 1KGSA 2HR3A 4MEXF 3CTAA 3K1NA 2HYGD 3WU0A 3DV8A 2F5DA 3V7CA 1SFXA 1C0WA 4A5MA 2STTA 4A0XA 1XCBA 3GEZA 2H94A 4CYDA 3ZMSA 2XGXA 4BHBA 2HQRA 3N4MA 3FM5A 3V7RA 1WQ2A 4S05A 5HLIA 3FX3A 4XRFA 3WODF 1T98A 2DLLA 3N97A 3GW2A 1U5TA 1USTA 5CVUA 2DK5A 1VTNC 3KP3A 2BBYA 2KRFA 3NQOA 3ZQ7A 4KT5C 5HLHA 2F2EA 4EJOA 5LEJA 3JAMK 2IT0A 4P9FA 3ZMZA 1ZRFA 1IN4A 2EFPA 2L3DA 3IC7A 4S04A 1T6SA 2BE5F 4WF2A 5HS9A 3KZZA 1UHMA 2H6CA 4MGRA 4UV9A 1TW3A 1OR7A 1CF7B 3J80K 3H3UA 4E70A 4R1HA 2EA4A 1OMIA 2FA5A 4YFNF 3RPUA 1KU9A 1HXDA 4M72A 2HDCA 2FNPA 4K2EA 4L5IA 1J2XA 4L0YB 1HKQA 2JT1A 3WTWC 4UV8A 3EUHA 3BPVA 1RNLA 3LA3A 5FLXK 1JHHA 1LVAA 2PG4A 1WI9A 5EEGA 4I01A 1HQCA 3JSOA 2GXBA 2EV5A 5TRDA 3K69A 1PUEE 1GXPA 5K5RA 1U8RA 2VE8A 4RGRA 3KFWX 4EV0A 1TQPA 4HX8A 2QWWA 3R0JA 2W85A 2IRFG 1I1SA 1SAXA 4CZZA 2MC3A 5BS6A 4P96A 1SD5A 3C3WA 3CUQA 4G94A 2UWMA 2DU9A 1IF1A 2COMA 3QPTA 4BH9A 3M8EA 1FLIA 5LHGA 2V6CA 4UXNA 1IXRC 3J80Z 4OIOF 2ZO4A 4L9TA 4IHSA 4IRIA 1R00A 1R23A 2HQNA 2L54A 3V8JA 3E6BA 4IVNA 3WTVC 3CLOA 4H0EA 4GYGA 1HKTA 4BQAA 4EVIA 2IA2A 1R1UA 3KETA 3TDZC 3LAJA 1L0OC 4ZYDA 5J8CA 4HZFA 4AVPA 1W7PA 1KA8A 3V7SA 2ELHA 2ZCWA 1S3JA 2XAFA 5DD4A 2GWRA 1XGNA 2CSOA 4LLLA 3TOBA 4OINF 5AIQA 2QYOA 5ILUA 4P55A 1OYWA 4HX7A 1F4KA 4A6EA 5CVIA 4LK0F 3JW4A 1ZARA 5FFZA 2FNAA 2P6SA 2ESNA 3P9CA 2GZWA 3FMRA 5AIPA 3J81Z 2MD5A 5E1XA 3NRVA 2LF8A 2XAGA 2ETHA 2H27A 2W24A 4ASNA 1OYIA 1O7LA 1WWXA 2M87A 1XGOA 1P6RA 4L9VA 2MH9A 5BMZA 1S7OA 3BJOA 3KE2A 2QVOA 5HS8A 1U2WA 4HBLA 4G6QA 1KU7A 1MDMA 4R8HA 3HHHA 1BJAA 2WTEA 1LDKB 3RI4A 3WTXC 1R22A 1BC8C 3T8RA 5F64A 1I1GA 2DQRA 5E1ZB 3IKTA 3F6OA 5KVRA 4UUVA 4ON0A 5KK1A 3C1DA 4AIJA 3HOTA 2QBYA 2A5YB 3QU3A 2VXZA 2PLYA 1IW7F 1FBQA 1IZ1A 5LBQA 1MGTA 1FSEA 4HF1A 3LSTA 1ZGJA 2K4JA 5D6EA 4LG0B 2CWEA 3GLXA 4UVBA 3ZN0A 1TLHB 1HBXG 1K7AA 1S8NA 4EJTA 4BNCA 1FC3A 4GYIA 4BAYA 2Q8KA 3GFIA 1Q1HA 3CUOA 3O3KA 2CYYA 3HSRA 2GIVA 3P9KA 3OOPA 1ZG3A 3TQNA 4AIKA 1XSXA 4OU0A 1K6OA 2J5PA 4WXCA 2CFXA 5HVQC 2MBFA 4QWQA 2B0LA 2M5WA 2ZMEA 1B59A 4YFXF 4PGHA 1MD0A 4L9JA 3NEUA 1MJAA 5HDGA 4M73A 1TQMA 4UHTA 1H0MA 4LLGF 5D4RA 5K5QA 5D8LB 2EV0A 5LLQA 2PMUA 3TO7A 4M9XA 1YG2A 3E5UA 3HRMA 1PP7U 2HTJA 2ISYA 3BZ6A 4HW0A 5D5XB 3ZN1A 3HTUA 4EQQA 4JBAA 5FFXA 1YW7A 5JHUA 5E17F 2P8TA 3REOA 1KQ8A 4WCGA 5DCFA 3D0SA 1QBJA 3I54A 2ADUA 3VB2A 5DD8A 1Z91A 1HSJA 4M6YA 1RI7A 4ETSA 2DTRA 1HW1A 1Z9CA 3D5LA 1T0FA 5IT9Z 5E8GA 1IAWA 5E20A 2K4BA 2YX4A 5BOXA 2VT2A 3VEPA 3E5QA 3WE2A 3FF5A 3LWFA 1DUXC 1XN7A 3HSEA 4U7BA 3BY6A 4EGZA 2O61A 3QOPA 3GYHX 1GHCA 3TKYA 1JXSA 5FO5A 5CJ9A 3AAFA 4KN7X 1G4DA 1YFHA 4XLPF 1I5ZA 4N9HA 1H9TA 3T0YA 3JTGA 3GFMA 4N0BA 2DK8A 1TTYA 3MZHA 2NNNA 4F7ZA 1ODDA 1V3FA 3JAMZ 4LGWA 4B8XA 3DFGA 2L02A 3B73A 1WRJA 3WGIA 1BI3A 1XGSA 3G73A 3ERED 1K78B 5CYVA 3EETA 1XSDA 2Z5UA 2G7UA 2EFWA 2HFHA 1AOYA 3HTSB 3S2WA 4RAYA 4KDPA 2OZUA 4AD9A 3E6CC 1Z05A 1XGMA 4BYYA 2Y75A 2A07F 2NRAC 1FBUA 2W57A 1YW8A 3RYRA 2PJPA 3GUDA 5JFRA 4Y15A 2K86A 4LMYA 5H6RA 4MHGA 4I09A 1S29A 1ON2A 4HA8A 2OAZA 5LGTA 2XHKA 4HX4A 1YO5C 4Y13A 2XKOA 1DPRA 2OD5A 1BI2A 3DPTA 2IP2A 5LEKA 1L3LA 2E1CA 1R1VA 3L9FA 2L4AA 5LRRA 2GA2A 1ONVA 4L18B 1G6NA 3EYIA 4UNOA 2HEOA 2EJRA 2LF7A 2HGCA 4EM2A 3F22A 1YTYA 4OMZA 3BOQA 2E7XA 5FGMA 2HZTA 1YQAA 5HDNA 2V9VA 4Y17A 3T8TA 3BROA 2KJCA 2VBZA 3BP8A 2VOPA 5ICEA 4LG0A 1P92A 4PZJA 3QP6A 4EJWA 3W6JB 3V4GA 3MWMA 3FZVA 1BI1A 3VFZA 5JVTA 2YX7A 1TNSA 4AIHA 2XIGA 2G7HA 4I7HA 3LA7A 1HKSA 2ZJ2A 3H92A 3FMSA 2QBYB 1UCRA 3O6BB 4L0ZB 1U3EM 4A5NA 4GO1A 3V8LA 3MQ0A 2M8EA 4EMSA 3MFKA 3GFJA 3KEOA 1LEAA 1MDMB 3BWGA 3RKWA 4WWCA 4U0VA 4A12A 2WWYA 3E3VA 3LQQA 3TO9A 1ZRCA 3IWZA 2QQBA 3SZTA 1FBSA 1KU2A 2EB7A 2O0YA 1YIOA 2EWNA 5E1WA 3KLOA 2K02A 4L9NA 1B6AA 1I27A 1LJ9A 1V4RA 3GXOA 3SZPA 4HV5A 3LFKA 2Q0OA 1SD4A 5DEQA 1BOAA 4YG2F 2NNYA 3QAHA 2VBXA 1O3RA 2KKOA 5J8FA 2QLZA 5HDKA 3IRQA 2OA4A 1U5TC 4FX0A 4KIGA 1B9NA 2FOKA 1JHFA 5D6FA 4WK8F 2K27A 1W7PB 3KLNA 4FT8A 2A69F 1IN8A 5DCMA 2OQGA 2V1DA 1T38A 4ZH4F 2CO5A 3L2CA 2OQRA 4RB2C 3DF8A 4I0BA 3VODA 1F5TA 5LHHA 3R4KA 1ZN2A 1E2XA 4RB0A 1J59A 1R58A 4RGSA 2XUBA 5F6FA 2L4MA 2ZNZA 2IW5A 1BIAA 1RZ4A 2FBKA 3HUGA 2XRNA 2HKOA 2HS5A 3BDDA 3IRRA 5DUIA 3V8KA 1FP2A 3Q9SA 3CUQB 5FD5A 3QP5A 2CQKA 1WKMA 4Z2YA 4ZYGA 4A0ZA 2RKHA 3M7GA 1QNTA 1LDDA 2GQQA 4R79A 4EJUA 1XB4A 3DEUA 3DP7A 1BI0A 3F21A 3I71A 4EGYA 4G7HF 5BPIA 3FXQA 1R5GA 3F8BA 3RKYA 1HW5A 3HSFA 5D5VB 1YLFA 4HAMA 3RYPA 2Z33A 5JR3A 1T39A 3EDPA 3H3ZA 3F8FA 1FPQA 2UXNA 4OIQF 3BJAA 1CF7A 4U7DA 4MQ9F 2PFBA 2Z99A 4OOIA 3K9TA 5ED4A 2UZKA 5DDGA 1RIOH 1W5TA 4CICA 3CDHA 2O8XA 1XDUA 4XSXF 3KP2A 1DPUA 4ESJA 2FU4A 4N9IA 3ZMVA 1S7AA 3P9IA 3PQKA 1U5TB 1FWZA 3QRFF 4I0AA 4KA4A 5CVRA 1IUYA 4LK1F 2XV4S 3IHUA 1LQ1A 2LNBA 2R7DA 1CGPA 4XBFA 5ICFA 4U0WA 2V1UA 2JTVA 2E1NA 1U78A 2YSRA 3WTTC 5BQTA 4LLNA 2JSCA 4UVCA 2BYVE 3GFLA 3KP5A 1OKRA 2WC2A 1FZPB 1STZA 1DP7P 2WV0A 4U0YA 4ENJA 3L00A 2KIUA 4JQFA 1MZBA 1XSVA 2R3SA 1AWCA 2QM3A 2Q2EA 4M6XA 2MLGA 2VONA 1FSHA 1X3UA 4PDKA 5D5UB 4IPAA 4HV6A 1HW2A 3J81K 3WE3A 3B02A 2FRHA 3KEQA 5L3BA 3ULQB 1B9MA 3FHZA 3LA2A 2VOOA 4RGXA 4O3MA 3KCCA 1ZH5A 3HIFA 4KICA 3GZ6A 1IN7A 4KFCA 2ZKZA 2P5LC 3FM3A 5CLSA 1W4MA 2M1BA 3I64A 3MZYA 4WX9A 4I02A 1Z7UA 1D5VA 3Q5FA 5D5WB 3CUQC 2JZYA 2DT5A 1P4XA 1ZYRF 3I4PA 5CVVA 1XDSA 2XROA 1SD6A 3I59B 1EH7A 4WXDA 1RUNA 5FD6A 2YU3A 4OIRF 3GF2A 2KIFA 2VODA 2STWA 1Z6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVJ A;  3HRT A;  1LNW A;  2HYF A;  1KQ9 A;  2ZME B;  3R0A A;  4G7O F;  4TV7 A;  1H9G A;  4LB6 B;  2AS5 F;  3ECO A;  3ZMU A;  3U9G A;  1QZZ A;  3GZ5 A;  2RC4 A;  3K2Z A;  2KJB A;  4M9S A;  3WTZ A;  3DKW A;  3IWF A;  5D8K B;  2RN7 A;  1HST A;  4G8X A;  4IJA A;  4KNY A;  2GAU A;  1PDN C;  5LGU A;  1E17 A;  3W6K B;  4ZYE A;  3F8M A;  3RPQ A;  5HLG A;  1GVJ A;  2CW0 F;  4NHJ A;  4CO8 A;  3RTR A;  1P4W A;  4CDG A;  2HOE A;  4A6D A;  2IJL A;  4LD5 A;  1A04 A;  3VOE A;  1G3Y A;  3R6S A;  3CJN A;  3E97 A;  3I53 A;  1LDJ A;  2BEO A;  3I0T A;  5D4S A;  1FP1 D;  1Z1D A;  3ML6 A;  3CO6 C;  4DQ2 A;  3OV8 A;  3WTS C;  2NAZ A;  4PGG A;  2PQ8 A;  2QQ9 A;  4YII A;  4B09 A;  2VBW A;  3ZPL A;  2CG4 A;  2Y0M A;  3E6D A;  5ERI A;  2A61 A;  1G3W A;  4NB5 A;  2RQP A;  3ELK A;  1REP C;  2MLK A;  3QPH A;  3U2R A;  4IF4 A;  5J6X A;  4LFU A;  2X4H A;  3T1B A;  5BPD A;  3ABT A;  1DDN A;  2EK5 A;  4MTD A;  3M1E A;  4KN4 X;  4RB1 A;  3K1M A;  4OMY A;  2DW4 A;  1TW2 A;  5L3F A;  1KYZ A;  3EQL F;  4XSZ F;  5FB2 A;  2O3F A;  2EFO A;  4KYW A;  2NYX A;  4RGU A;  5LHI A;  5L3G A;  1ZRE A;  1ZHF A;  2EFN A;  1F1Z A;  1SFE A;  4O5V A;  2LKP A;  3J7A O;  4LB5 A;  1YW9 A;  4EM1 A;  3P7N A;  3MAJ A;  4O6J A;  1K79 A;  1P4A A;  2J5O A;  2HTS A;  2W25 A;  4U88 A;  3CO7 C;  3O2P E;  4AWX B;  3ABU A;  3K0L A;  3R60 A;  3C18 A;  1XCV A;  5K1Y A;  4HF2 A;  2JPB A;  4PCQ A;  2TDX A;  1SMY F;  5AON A;  1EV7 A;  2DFI A;  4BHP A;  4ENM A;  2M45 A;  2A6E F;  1FYL A;  1JE8 A;  3WGH A;  1MJB A;  2FBH A;  4XLN F;  3TGN A;  1J7K A;  2F5F A;  1F9N A;  1Y0U A;  2LSO A;  3PFI A;  3JSP A;  1USS A;  2ZBK A;  1QPM A;  1YS7 A;  1D3Y A;  5ICC A;  4DNC A;  3ZP5 A;  1R1T A;  4CHU A;  4G6D A;  1O7F A;  2D2W A;  3KP4 A;  4NQW A;  2W84 A;  1JGS A;  2R7F A;  2RV8 A;  4GGG A;  2EFQ A;  4BXU A;  3DQV C;  3R61 A;  5L3E A;  3U1D A;  5ICG A;  5HS7 A;  4KIF A;  4KUM A;  2PN6 A;  1S6L A;  3HRS A;  2A3S A;  2HWV A;  2PI0 A;  1IRF A;  3KP6 A;  1QO0 D;  3ISP A;  2FML A;  3WGG A;  3GX4 X;  1LEB A;  4CXF A;  2FQ3 A;  4EM0 B;  4P9U A;  1R7J A;  1BN5 A;  3WG9 A;  4HQM A;  3HHG A;  3G3Z A;  2FMY A;  5L3D A;  3M9A A;  3ROU A;  1FX7 A;  1UB9 A;  2OZ6 A;  2PBI A;  4QLC U;  2VBY A;  2GXG A;  4G7Z F;  3C7J A;  1ZG5 A;  2FSW A;  1B1B A;  1SD7 A;  3FXR A;  4HDV A;  3RJP A;  4ZZD A;  1R36 A;  1O3Q A;  2XAH A;  2YR2 A;  1J0R A;  2EV6 A;  1J5Y A;  2P7V B;  1ZG1 A;  1KYW A;  2XAQ A;  3KP7 A;  4CGZ A;  4KMF A;  2JRT A;  4MEY F;  3E6M A;  3WU1 B;  1KQ0 A;  4IRH A;  1QGP A;  4JK1 X;  2D1V A;  4Q48 A;  1ZLK A;  3SHF A;  2DI3 A;  4RS8 A;  2C6Y A;  2GA1 A;  4G9Y A;  4M74 A;  4HLY A;  4FX4 A;  4YIF A;  3KZY A;  1IN6 A;  3RDI A;  1G3T A;  1YYV A;  2K7L A;  2BGC A;  3F6V A;  1TQI A;  3COA C;  3LAP A;  1O3T A;  3DXJ F;  2IVM A;  2ZXJ A;  5HOO A;  4HYE A;  3QU6 A;  1TBX A;  3PQJ A;  3FWE A;  2IA0 A;  2A68 F;  5E18 F;  4L5J A;  5IT3 A;  5ILV A;  3F72 A;  2FXA A;  3DPL C;  4Q5S F;  4I98 B;  2AXL A;  5E8I A;  2XKP A;  1B4A A;  4MNU A;  4MQV A;  3RIR A;  3IL2 A;  4HF0 A;  1XMA A;  3EYY A;  2H09 A;  2KIM A;  1TNT A;  3T5X A;  4FHT A;  2P4W A;  1G3S A;  1NHA A;  4M9Z A;  1D8J A;  3GO5 A;  3SFZ A;  5TJJ A;  4A2U A;  5F1R A;  1BIB A;  3ZMT A;  3WTY C;  1RUO A;  1J75 A;  2A6H F;  2V1X A;  4GCV A;  1QZY A;  4Q4Z F;  3E5X A;  3MCZ A;  1W5S A;  2Y48 A;  3TOA A;  2DPU A;  1ZRD A;  4P5O A;  4WXH A;  5DCM B;  3F3X A;  4ESF A;  5A2Q K;  1FNN A;  1R5H A;  2UXX A;  4GXO A;  3ECH A;  4OIP F;  1FY7 A;  1FOK A;  4Q47 A;  1WSU A;  2V79 A;  5LGN A;  1XMK A;  2Z3Y A;  3F8N A;  2E7W A;  1QQI A;  1KU3 A;  5A2Q Z;  3SQN A;  4UVA A;  1Z6R A;  4ENN A;  1PP8 F;  1U6G A;  4MTE A;  2FF4 A;  5IT9 K;  1IRG A;  2RGV A;  4IRG A;  2PEX A;  2XAJ A;  1OYY A;  3M8F A;  3HOS A;  1P2F A;  2DQL A;  4M71 A;  2ACJ A;  5L3C A;  2NS0 A;  2XAS A;  1XD7 A;  1UFM A;  2QUF A;  3F23 A;  2P5V A;  1YS6 A;  2G9W A;  2IA1 A;  3RKX A;  2O03 A;  2EA2 A;  1IXC A;  2X0L A;  5DYM A;  4HLX A;  2VN2 A;  3BPX A;  3GWZ A;  3LQR A;  5LRS A;  2IPQ X;  2DO7 A;  3Q9V A;  4ZZL A;  2RNJ A;  4YFK F;  3BJ6 A;  2VC1 A;  2OU2 A;  1J9I A;  1ULY A;  5ILS A;  1MJ9 A;  1SMT A;  5JI6 A;  1O3S A;  2VC0 A;  2M30 A;  1ZAO A;  5FLX Z;  2F5E A;  1IN5 A;  4HOB A;  4A0Y A;  4KIB A;  1W7P D;  1BM9 A;  4HDU A;  3TO6 A;  2ESH A;  3GVA A;  1O57 A;  2OBP A;  3WTU C;  1EH8 A;  3FXU A;  1OPC A;  4IHT A;  2L01 A;  2P6T A;  3HYI A;  5EEH A;  3I59 A;  3IKV A;  3HRU A;  2ISZ A;  1MKM A;  2F5C A;  1ZGA A;  1ON1 A;  4BHC A;  4KMU X;  1BBY A;  3I58 A;  2FEZ A;  2QZ8 A;  2BV6 A;  3F8C A;  1IXS B;  2QQA A;  2P7C B;  2XVC A;  5DUK A;  1FYK A;  1FYM A;  4EJV A;  2VT3 A;  2JPC A;  2MH2 A;  4HQE A;  3TDU C;  2RVC A;  2VE9 A;  3L7W A;  2HKX A;  2D45 A;  2YPR A;  2D1H A;  6PAX A;  3L09 A;  2O6G E;  1ZLJ A;  5H20 A;  1BC7 C;  2ZFW A;  3ZMD A;  2PMH A;  1UHW A;  2DPD A;  4D0P A;  4ZYH A;  5DV5 A;  2CGP A;  2QEN A;  4IXA A;  5H6Q A;  4I2O A;  5K5O A;  4LJZ F;  1GXQ A;  3MEX A;  4RAZ A;  1LB2 A;  2RDP A;  4ENK A;  1FT9 A;  3JTH A;  2FBI A;  4ESB A;  1T2K A;  2DAO A;  1EH6 A;  3SXY A;  3K1P A;  4RB3 C;  2FE3 A;  2H6B A;  2LDU A;  2MA3 A;  2P5K A;  1K78 A;  1D8K A;  3FMQ A;  2ZNY A;  1SFU A;  2Z9O A;  3I5U A;  2DBB A;  1I6X A;  1KGS A;  2HR3 A;  4MEX F;  3CTA A;  3K1N A;  2HYG D;  3WU0 A;  3DV8 A;  2F5D A;  3V7C A;  1SFX A;  1C0W A;  4A5M A;  2STT A;  4A0X A;  1XCB A;  3GEZ A;  2H94 A;  4CYD A;  3ZMS A;  2XGX A;  4BHB A;  2HQR A;  3N4M A;  3FM5 A;  3V7R A;  1WQ2 A;  4S05 A;  5HLI A;  3FX3 A;  4XRF A;  3WOD F;  1T98 A;  2DLL A;  3N97 A;  3GW2 A;  1U5T A;  1UST A;  5CVU A;  2DK5 A;  1VTN C;  3KP3 A;  2BBY A;  2KRF A;  3NQO A;  3ZQ7 A;  4KT5 C;  5HLH A;  2F2E A;  4EJO A;  5LEJ A;  3JAM K;  2IT0 A;  4P9F A;  3ZMZ A;  1ZRF A;  1IN4 A;  2EFP A;  2L3D A;  3IC7 A;  4S04 A;  1T6S A;  2BE5 F;  4WF2 A;  5HS9 A;  3KZZ A;  1UHM A;  2H6C A;  4MGR A;  4UV9 A;  1TW3 A;  1OR7 A;  1CF7 B;  3J80 K;  3H3U A;  4E70 A;  4R1H A;  2EA4 A;  1OMI A;  2FA5 A;  4YFN F;  3RPU A;  1KU9 A;  1HXD A;  4M72 A;  2HDC A;  2FNP A;  4K2E A;  4L5I A;  1J2X A;  4L0Y B;  1HKQ A;  2JT1 A;  3WTW C;  4UV8 A;  3EUH A;  3BPV A;  1RNL A;  3LA3 A;  5FLX K;  1JHH A;  1LVA A;  2PG4 A;  1WI9 A;  5EEG A;  4I01 A;  1HQC A;  3JSO A;  2GXB A;  2EV5 A;  5TRD A;  3K69 A;  1PUE E;  1GXP A;  5K5R A;  1U8R A;  2VE8 A;  4RGR A;  3KFW X;  4EV0 A;  1TQP A;  4HX8 A;  2QWW A;  3R0J A;  2W85 A;  2IRF G;  1I1S A;  1SAX A;  4CZZ A;  2MC3 A;  5BS6 A;  4P96 A;  1SD5 A;  3C3W A;  3CUQ A;  4G94 A;  2UWM A;  2DU9 A;  1IF1 A;  2COM A;  3QPT A;  4BH9 A;  3M8E A;  1FLI A;  5LHG A;  2V6C A;  4UXN A;  1IXR C;  3J80 Z;  4OIO F;  2ZO4 A;  4L9T A;  4IHS A;  4IRI A;  1R00 A;  1R23 A;  2HQN A;  2L54 A;  3V8J A;  3E6B A;  4IVN A;  3WTV C;  3CLO A;  4H0E A;  4GYG A;  1HKT A;  4BQA A;  4EVI A;  2IA2 A;  1R1U A;  3KET A;  3TDZ C;  3LAJ A;  1L0O C;  4ZYD A;  5J8C A;  4HZF A;  4AVP A;  1W7P A;  1KA8 A;  3V7S A;  2ELH A;  2ZCW A;  1S3J A;  2XAF A;  5DD4 A;  2GWR A;  1XGN A;  2CSO A;  4LLL A;  3TOB A;  4OIN F;  5AIQ A;  2QYO A;  5ILU A;  4P55 A;  1OYW A;  4HX7 A;  1F4K A;  4A6E A;  5CVI A;  4LK0 F;  3JW4 A;  1ZAR A;  5FFZ A;  2FNA A;  2P6S A;  2ESN A;  3P9C A;  2GZW A;  3FMR A;  5AIP A;  3J81 Z;  2MD5 A;  5E1X A;  3NRV A;  2LF8 A;  2XAG A;  2ETH A;  2H27 A;  2W24 A;  4ASN A;  1OYI A;  1O7L A;  1WWX A;  2M87 A;  1XGO A;  1P6R A;  4L9V A;  2MH9 A;  5BMZ A;  1S7O A;  3BJO A;  3KE2 A;  2QVO A;  5HS8 A;  1U2W A;  4HBL A;  4G6Q A;  1KU7 A;  1MDM A;  4R8H A;  3HHH A;  1BJA A;  2WTE A;  1LDK B;  3RI4 A;  3WTX C;  1R22 A;  1BC8 C;  3T8R A;  5F64 A;  1I1G A;  2DQR A;  5E1Z B;  3IKT A;  3F6O A;  5KVR A;  4UUV A;  4ON0 A;  5KK1 A;  3C1D A;  4AIJ A;  3HOT A;  2QBY A;  2A5Y B;  3QU3 A;  2VXZ A;  2PLY A;  1IW7 F;  1FBQ A;  1IZ1 A;  5LBQ A;  1MGT A;  1FSE A;  4HF1 A;  3LST A;  1ZGJ A;  2K4J A;  5D6E A;  4LG0 B;  2CWE A;  3GLX A;  4UVB A;  3ZN0 A;  1TLH B;  1HBX G;  1K7A A;  1S8N A;  4EJT A;  4BNC A;  1FC3 A;  4GYI A;  4BAY A;  2Q8K A;  3GFI A;  1Q1H A;  3CUO A;  3O3K A;  2CYY A;  3HSR A;  2GIV A;  3P9K A;  3OOP A;  1ZG3 A;  3TQN A;  4AIK A;  1XSX A;  4OU0 A;  1K6O A;  2J5P A;  4WXC A;  2CFX A;  5HVQ C;  2MBF A;  4QWQ A;  2B0L A;  2M5W A;  2ZME A;  1B59 A;  4YFX F;  4PGH A;  1MD0 A;  4L9J A;  3NEU A;  1MJA A;  5HDG A;  4M73 A;  1TQM A;  4UHT A;  1H0M A;  4LLG F;  5D4R A;  5K5Q A;  5D8L B;  2EV0 A;  5LLQ A;  2PMU A;  3TO7 A;  4M9X A;  1YG2 A;  3E5U A;  3HRM A;  1PP7 U;  2HTJ A;  2ISY A;  3BZ6 A;  4HW0 A;  5D5X B;  3ZN1 A;  3HTU A;  4EQQ A;  4JBA A;  5FFX A;  1YW7 A;  5JHU A;  5E17 F;  2P8T A;  3REO A;  1KQ8 A;  4WCG A;  5DCF A;  3D0S A;  1QBJ A;  3I54 A;  2ADU A;  3VB2 A;  5DD8 A;  1Z91 A;  1HSJ A;  4M6Y A;  1RI7 A;  4ETS A;  2DTR A;  1HW1 A;  1Z9C A;  3D5L A;  1T0F A;  5IT9 Z;  5E8G A;  1IAW A;  5E20 A;  2K4B A;  2YX4 A;  5BOX A;  2VT2 A;  3VEP A;  3E5Q A;  3WE2 A;  3FF5 A;  3LWF A;  1DUX C;  1XN7 A;  3HSE A;  4U7B A;  3BY6 A;  4EGZ A;  2O61 A;  3QOP A;  3GYH X;  1GHC A;  3TKY A;  1JXS A;  5FO5 A;  5CJ9 A;  3AAF A;  4KN7 X;  1G4D A;  1YFH A;  4XLP F;  1I5Z A;  4N9H A;  1H9T A;  3T0Y A;  3JTG A;  3GFM A;  4N0B A;  2DK8 A;  1TTY A;  3MZH A;  2NNN A;  4F7Z A;  1ODD A;  1V3F A;  3JAM Z;  4LGW A;  4B8X A;  3DFG A;  2L02 A;  3B73 A;  1WRJ A;  3WGI A;  1BI3 A;  1XGS A;  3G73 A;  3ERE D;  1K78 B;  5CYV A;  3EET A;  1XSD A;  2Z5U A;  2G7U A;  2EFW A;  2HFH A;  1AOY A;  3HTS B;  3S2W A;  4RAY A;  4KDP A;  2OZU A;  4AD9 A;  3E6C C;  1Z05 A;  1XGM A;  4BYY A;  2Y75 A;  2A07 F;  2NRA C;  1FBU A;  2W57 A;  1YW8 A;  3RYR A;  2PJP A;  3GUD A;  5JFR A;  4Y15 A;  2K86 A;  4LMY A;  5H6R A;  4MHG A;  4I09 A;  1S29 A;  1ON2 A;  4HA8 A;  2OAZ A;  5LGT A;  2XHK A;  4HX4 A;  1YO5 C;  4Y13 A;  2XKO A;  1DPR A;  2OD5 A;  1BI2 A;  3DPT A;  2IP2 A;  5LEK A;  1L3L A;  2E1C A;  1R1V A;  3L9F A;  2L4A A;  5LRR A;  2GA2 A;  1ONV A;  4L18 B;  1G6N A;  3EYI A;  4UNO A;  2HEO A;  2EJR A;  2LF7 A;  2HGC A;  4EM2 A;  3F22 A;  1YTY A;  4OMZ A;  3BOQ A;  2E7X A;  5FGM A;  2HZT A;  1YQA A;  5HDN A;  2V9V A;  4Y17 A;  3T8T A;  3BRO A;  2KJC A;  2VBZ A;  3BP8 A;  2VOP A;  5ICE A;  4LG0 A;  1P92 A;  4PZJ A;  3QP6 A;  4EJW A;  3W6J B;  3V4G A;  3MWM A;  3FZV A;  1BI1 A;  3VFZ A;  5JVT A;  2YX7 A;  1TNS A;  4AIH A;  2XIG A;  2G7H A;  4I7H A;  3LA7 A;  1HKS A;  2ZJ2 A;  3H92 A;  3FMS A;  2QBY B;  1UCR A;  3O6B B;  4L0Z B;  1U3E M;  4A5N A;  4GO1 A;  3V8L A;  3MQ0 A;  2M8E A;  4EMS A;  3MFK A;  3GFJ A;  3KEO A;  1LEA A;  1MDM B;  3BWG A;  3RKW A;  4WWC A;  4U0V A;  4A12 A;  2WWY A;  3E3V A;  3LQQ A;  3TO9 A;  1ZRC A;  3IWZ A;  2QQB A;  3SZT A;  1FBS A;  1KU2 A;  2EB7 A;  2O0Y A;  1YIO A;  2EWN A;  5E1W A;  3KLO A;  2K02 A;  4L9N A;  1B6A A;  1I27 A;  1LJ9 A;  1V4R A;  3GXO A;  3SZP A;  4HV5 A;  3LFK A;  2Q0O A;  1SD4 A;  5DEQ A;  1BOA A;  4YG2 F;  2NNY A;  3QAH A;  2VBX A;  1O3R A;  2KKO A;  5J8F A;  2QLZ A;  5HDK A;  3IRQ A;  2OA4 A;  1U5T C;  4FX0 A;  4KIG A;  1B9N A;  2FOK A;  1JHF A;  5D6F A;  4WK8 F;  2K27 A;  1W7P B;  3KLN A;  4FT8 A;  2A69 F;  1IN8 A;  5DCM A;  2OQG A;  2V1D A;  1T38 A;  4ZH4 F;  2CO5 A;  3L2C A;  2OQR A;  4RB2 C;  3DF8 A;  4I0B A;  3VOD A;  1F5T A;  5LHH A;  3R4K A;  1ZN2 A;  1E2X A;  4RB0 A;  1J59 A;  1R58 A;  4RGS A;  2XUB A;  5F6F A;  2L4M A;  2ZNZ A;  2IW5 A;  1BIA A;  1RZ4 A;  2FBK A;  3HUG A;  2XRN A;  2HKO A;  2HS5 A;  3BDD A;  3IRR A;  5DUI A;  3V8K A;  1FP2 A;  3Q9S A;  3CUQ B;  5FD5 A;  3QP5 A;  2CQK A;  1WKM A;  4Z2Y A;  4ZYG A;  4A0Z A;  2RKH A;  3M7G A;  1QNT A;  1LDD A;  2GQQ A;  4R79 A;  4EJU A;  1XB4 A;  3DEU A;  3DP7 A;  1BI0 A;  3F21 A;  3I71 A;  4EGY A;  4G7H F;  5BPI A;  3FXQ A;  1R5G A;  3F8B A;  3RKY A;  1HW5 A;  3HSF A;  5D5V B;  1YLF A;  4HAM A;  3RYP A;  2Z33 A;  5JR3 A;  1T39 A;  3EDP A;  3H3Z A;  3F8F A;  1FPQ A;  2UXN A;  4OIQ F;  3BJA A;  1CF7 A;  4U7D A;  4MQ9 F;  2PFB A;  2Z99 A;  4OOI A;  3K9T A;  5ED4 A;  2UZK A;  5DDG A;  1RIO H;  1W5T A;  4CIC A;  3CDH A;  2O8X A;  1XDU A;  4XSX F;  3KP2 A;  1DPU A;  4ESJ A;  2FU4 A;  4N9I A;  3ZMV A;  1S7A A;  3P9I A;  3PQK A;  1U5T B;  1FWZ A;  3QRF F;  4I0A A;  4KA4 A;  5CVR A;  1IUY A;  4LK1 F;  2XV4 S;  3IHU A;  1LQ1 A;  2LNB A;  2R7D A;  1CGP A;  4XBF A;  5ICF A;  4U0W A;  2V1U A;  2JTV A;  2E1N A;  1U78 A;  2YSR A;  3WTT C;  5BQT A;  4LLN A;  2JSC A;  4UVC A;  2BYV E;  3GFL A;  3KP5 A;  1OKR A;  2WC2 A;  1FZP B;  1STZ A;  1DP7 P;  2WV0 A;  4U0Y A;  4ENJ A;  3L00 A;  2KIU A;  4JQF A;  1MZB A;  1XSV A;  2R3S A;  1AWC A;  2QM3 A;  2Q2E A;  4M6X A;  2MLG A;  2VON A;  1FSH A;  1X3U A;  4PDK A;  5D5U B;  4IPA A;  4HV6 A;  1HW2 A;  3J81 K;  3WE3 A;  3B02 A;  2FRH A;  3KEQ A;  5L3B A;  3ULQ B;  1B9M A;  3FHZ A;  3LA2 A;  2VOO A;  4RGX A;  4O3M A;  3KCC A;  1ZH5 A;  3HIF A;  4KIC A;  3GZ6 A;  1IN7 A;  4KFC A;  2ZKZ A;  2P5L C;  3FM3 A;  5CLS A;  1W4M A;  2M1B A;  3I64 A;  3MZY A;  4WX9 A;  4I02 A;  1Z7U A;  1D5V A;  3Q5F A;  5D5W B;  3CUQ C;  2JZY A;  2DT5 A;  1P4X A;  1ZYR F;  3I4P A;  5CVV A;  1XDS A;  2XRO A;  1SD6 A;  3I59 B;  1EH7 A;  4WXD A;  1RUN A;  5FD6 A;  2YU3 A;  4OIR F;  3GF2 A;  2KIF A;  2VOD A;  2STW A;  1Z6T A; 
#chains in the Genus database with same CATH topology
 2OPT A;  5CVJ A;  3I4M J;  2BVM A;  3HRT A;  1LNW A;  2HYF A;  2ELK A;  1KQ9 A;  2WAD A;  2ZME B;  1YIT I;  2F4O B;  3R0A A;  4ZDL A;  1T08 B;  1ZTR A;  4G7O F;  4TV7 A;  5F04 A;  1QPI A;  3SDG A;  1H9G A;  3FHN A;  4LB6 B;  1LPQ A;  3ZCO A;  2AS5 F;  3ECO A;  3ZMU A;  4V2F A;  2E1M C;  1QZZ A;  1LFB A;  3IH2 A;  3U9G A;  1X3W B;  2R7U A;  2E2J J;  3GZ5 A;  2RC4 A;  4AYB A;  3K2Z A;  4NC6 A;  2KJB A;  2TRT A;  4M9S A;  3J7Z I;  3FXK A;  3WTZ A;  3DKW A;  1VZ0 A;  3IWF A;  3S1R J;  2LR8 A;  5D8K B;  3JRI A;  2RN7 A;  1HST A;  4G8X A;  1I50 J;  4IJA A;  4KNY A;  2GAU A;  5B66 C;  4PJJ A;  1PDN C;  5LGU A;  2BZT A;  1WJB A;  2DYS H;  1E17 A;  3W6K B;  4C2T A;  4IL6 C;  4ZYE A;  2DDA A;  2KZV A;  3F8M A;  3F9K A;  3RPQ A;  3RKQ A;  2L5Q A;  5HLG A;  1GVJ A;  2CW0 F;  4NHJ A;  4CO8 A;  3RTR A;  3W3C A;  2VJ5 A;  1P4W A;  1ENH A;  3FKI J;  4CDG A;  2HOE A;  5F27 A;  4A6D A;  4JX5 A;  2IJL A;  4LD5 A;  4I99 C;  1A04 A;  1RET A;  3VOE A;  4UUS A;  2WY8 Q;  1G3Y A;  1OCZ H;  3HOW J;  2ZME C;  3R6S A;  1W5C C;  3CJN A;  3E97 A;  3I53 A;  1U9O A;  1LDJ A;  2BEO A;  3MKL A;  2ME0 A;  1I39 A;  3I0T A;  1VQK I;  3S17 J;  4EAT A;  2LY2 A;  1FP1 D;  5D4S A;  1Z1D A;  2RNG A;  1V5E A;  3PSF A;  3W6V A;  4LIT A;  2HQA A;  3S3N A;  4HRI A;  1T8I A;  5HNF A;  3ML6 A;  3CO6 C;  5FKM A;  3GLL A;  4RLQ A;  3K7A J;  4DQ2 A;  3OV8 A;  4MFE A;  3HOX J;  4BY7 J;  3WTS C;  2NAZ A;  1EA3 A;  4PGG A;  2PQ8 A;  2QQ9 A;  4YII A;  4B09 A;  5EDN A;  3SEQ A;  3J7Y J;  1MMS A;  2VBW A;  4F55 A;  3GTO J;  2EQR A;  2E36 A;  3ZPL A;  2CG4 A;  2Y0M A;  2JJ7 A;  4XOT A;  3E6D A;  2QA4 I;  1FIP A;  5ERI A;  2A61 A;  1G3W A;  4NB5 A;  2DOF A;  2RQP A;  3ELK A;  3JRE A;  1REP C;  2MLK A;  3ZRG A;  4BGD A;  4OAY A;  3QPH A;  3U2R A;  4IF4 A;  3RZD J;  1VQ8 I;  4C3J J;  1BR2 A;  1NG6 A;  1OCC H;  5J6X A;  2BXZ A;  5F08 A;  4MIM A;  2WBM A;  3CJR B;  4LFU A;  2X4H A;  3CCR I;  3T1B A;  5EG0 A;  5BPD A;  1N77 A;  4DW6 A;  3ABT A;  1DDN A;  1HDD C;  4AYB N;  2EK5 A;  4MTD A;  1PUF A;  3M1E A;  3K4K A;  4KN4 X;  4RB1 A;  3K1M A;  4OMY A;  2BHY A;  2DW4 A;  1TW2 A;  5B3S H;  5L3F A;  1MBJ A;  1KYZ A;  3EQL F;  4XSZ F;  5FB2 A;  2XF7 A;  1R5I D;  1YJN I;  1ZQ3 P;  2O3F A;  4PFO A;  2EFO A;  4KYW A;  2W82 A;  2NYX A;  2X1E A;  4RGU A;  5LHI A;  5KAF C;  2ICW G;  5L3G A;  1ZRE A;  1ZHF A;  3NWT A;  2EFN A;  3H36 A;  1F1Z A;  1BL0 A;  4PFP A;  2HXO A;  1SFE A;  3BLY A;  1P9Q C;  4O5V A;  4CA0 A;  1MBH A;  2LKP A;  3OYG A;  1X4P A;  3J7A O;  5IYC J;  1OCO H;  1YW9 A;  4EM1 A;  5E3M A;  4LB5 A;  3P7N A;  4F92 B;  3MAJ A;  4O6J A;  2J5O A;  1P4A A;  1TT5 B;  1YOV B;  2HTS A;  2W25 A;  3O2P E;  4U88 A;  3CO7 C;  1K79 A;  4AWX B;  3ABU A;  1K61 A;  3K0L A;  1LFP A;  3Q0V A;  2EIK H;  3MKZ A;  3R60 A;  3C18 A;  3ABK H;  3A03 A;  1XCV A;  3CCQ I;  1FMV A;  2TCT A;  5K1Y A;  2KFD A;  5JHF A;  5LFA A;  4HF2 A;  3L2W A;  4PSX A;  3CMY A;  3H5A A;  2JPB A;  2X6Y A;  4PCQ A;  1TWH J;  2TDX A;  3S1M J;  3G1O A;  1SMY F;  5AON A;  1EV7 A;  5IP6 A;  2DFI A;  4BHP A;  3JRB A;  3I3L A;  3QYF A;  4ENM A;  2M45 A;  2A6E F;  1FYL A;  3CCS I;  2DA7 A;  3ZQL A;  1JE8 A;  1OCP A;  3WGH A;  1MJB A;  2FBH A;  4XLN F;  3TGN A;  2ECC A;  5TGT A;  1J7K A;  2E1M B;  2F5F A;  1F9N A;  1YX5 A;  1Y0U A;  1Y6I A;  4UUT A;  2LSO A;  3PFI A;  3JSP A;  1USS A;  5JLX A;  2ZBK A;  3OYA A;  1QPM A;  1YS7 A;  1D3Y A;  5ICC A;  4J01 A;  1FOY A;  4IQ4 A;  1XMX A;  4DNC A;  2JA2 A;  3ZR8 X;  3ZP5 A;  1R1T A;  4CHU A;  2IGO A;  1OCT C;  2JRM A;  1ETV A;  3S8P A;  1R6R A;  2HOT A;  4G6D A;  1U8B A;  1O7F A;  1Q1V A;  2LTP A;  1U0J A;  2IGN A;  2VJJ A;  4HSR A;  2D2W A;  3KP4 A;  2NS8 A;  2IS1 A;  4NQW A;  2W84 A;  1JGS A;  2R7F A;  1Y0N A;  2RV8 A;  4A3I J;  4GGG A;  1HCR A;  2EFQ A;  4HEA 2;  4BXU A;  2CW7 A;  3DQV C;  3R61 A;  5L3E A;  1IGN A;  3U1D A;  5ICG A;  4MFD A;  5HS7 A;  4KIF A;  1WH5 A;  4KUM A;  2PN6 A;  1S6L A;  1ERD A;  3HRS A;  2A3S A;  2HWV A;  2PI0 A;  1IRF A;  2QCO A;  3KP6 A;  1QO0 D;  1QA6 A;  3E7L A;  3ISP A;  2FML A;  3WGG A;  3GX4 X;  1LEB A;  1JJ6 C;  4CXF A;  2FQ3 A;  4EM0 B;  4P9U A;  1R7J A;  3JRC A;  1BN5 A;  3WG9 A;  3WU2 C;  3OIP A;  4HQM A;  3HHG A;  2Q1Z B;  3ZGK A;  3K70 C;  1T56 A;  2FMY A;  3G3Z A;  3P5J A;  2VLA A;  3RZO J;  4A93 J;  1ACI A;  2M7A A;  4UB8 C;  3BZC A;  5L3D A;  3M9A A;  3J7A Y;  1EKE A;  2R7Q A;  4E6K G;  1X2N A;  3ROU A;  1FX7 A;  1UB9 A;  2OZ6 A;  2PBI A;  4QLC U;  2VBY A;  2GXG A;  3CDI A;  4XL9 A;  4G7Z F;  2FX0 A;  3C7J A;  1ZG5 A;  5FKN A;  1GT0 C;  1TP4 A;  1WJC A;  2FSW A;  1BOB A;  3VSL A;  2KPM A;  1B1B A;  1SD7 A;  3FXR A;  4HDV A;  4C30 A;  3RJP A;  2W4S A;  4DOZ A;  4ZZD A;  1NH3 A;  2ZXH A;  4BQN A;  1B8I B;  1IC8 A;  1R36 A;  1O3Q A;  2XAH A;  2YR2 A;  3S1N J;  1PJR A;  1J0R A;  2EV6 A;  1J5Y A;  2P7V B;  1E0E A;  1ZG1 A;  1KYW A;  4B44 A;  2XAQ A;  3KP7 A;  3U1K A;  1DGR M;  4CGZ A;  4KMF A;  1FIA A;  2JRT A;  2KLO A;  3QQA A;  1QVU A;  3NAR A;  3E6M A;  4MEY F;  3CCV I;  3E1S A;  1Y1W J;  3WU1 B;  1KQ0 A;  4IRH A;  3GTM J;  4II2 A;  1QGP A;  3OIO A;  4JK1 X;  2D1V A;  4Q48 A;  3HB9 A;  2Z16 A;  3JCU C;  1ZLK A;  3SHF A;  2DI3 A;  3FBI B;  3FXL A;  4RS8 A;  3OYN A;  3GTL J;  2C6Y A;  2GA1 A;  4G9Y A;  4B1R A;  1X58 A;  4M74 A;  1JI8 A;  2NVT J;  2HQ5 A;  4HLY A;  1QHH D;  4FX4 A;  4YIF A;  1YI2 I;  3KZY A;  1IN6 A;  3RDI A;  5KNL A;  3JRH A;  4IOC F;  1G3T A;  4BE2 A;  1YYV A;  4X0G A;  5K7F A;  4LIU A;  1XTA A;  2BGC A;  2K7L A;  3ASN H;  4YRV A;  3F6V A;  4A3F J;  2Z1D A;  2X51 A;  1TQI A;  4X1E A;  3COA C;  5M5Y J;  2PJR A;  4NQW B;  3LAP A;  2CH0 A;  1O3T A;  3DXJ F;  2IVM A;  2DJI A;  3ABL H;  3CMA I;  2BY1 A;  2ZXJ A;  3D5R C;  3LSJ A;  5HOO A;  4HYE A;  3QU6 A;  1TBX A;  2LBF B;  4AM3 A;  3PQJ A;  3FWE A;  2IA0 A;  2JA6 J;  2A68 F;  3FK6 A;  5E18 F;  4L5J A;  1WJ5 A;  5IT3 A;  4RM3 A;  2R5Z B;  4IO9 F;  5ILV A;  3F72 A;  3CCE I;  2FXA A;  3DPL C;  5M5W J;  4Q5S F;  4I98 B;  3K6G A;  2AXL A;  5E3O A;  4LIV A;  4D5C A;  5E8I A;  2XKP A;  3RQI A;  1B4A A;  4RAG A;  4HG2 A;  2L2O A;  4MNU A;  3MMY B;  3CES A;  4MQV A;  3RIR A;  3TW7 A;  1Y8Q B;  3A02 A;  3HKZ N;  2CQN A;  3MZ8 A;  3IL2 A;  4HF0 A;  1XMA A;  3EYY A;  2H09 A;  3NWS A;  2KIM A;  4FQG A;  1TNT A;  1IDZ A;  3T5X A;  4FHT A;  1XS9 A;  2L7Z A;  3DEW A;  2LG4 A;  2ELJ A;  2F6C A;  2P4W A;  1G3S A;  3RSN A;  3M1C A;  1ETQ A;  1NHA A;  4M9Z A;  1D8J A;  3GO5 A;  3HUG B;  3SFZ A;  2CW8 A;  5TJJ A;  3BG7 A;  3G1L A;  3A01 B;  4A2U A;  2DA5 A;  5F1R A;  2VXD A;  4DZP A;  3IUO A;  4HNT A;  1BIB A;  1BR1 A;  3ZMT A;  2LY1 A;  2X85 A;  3FXM A;  3WTY C;  1UZC A;  1RUO A;  4YIR X;  1J75 A;  2A6H F;  2V1X A;  4GCV A;  5IOZ A;  1OR7 C;  1QZY A;  2OCC H;  5M3F J;  2R7V A;  3OYE A;  4Q4Z F;  2L7K A;  3TMO A;  2IEK A;  3E5X A;  1GDT A;  3MCZ A;  1W5S A;  1LFU P;  3S1Q J;  2BY0 A;  4BQQ A;  5FLM J;  4CYC A;  2KHM A;  2Y48 A;  4BKX A;  1YJ9 I;  3BR2 A;  3TOA A;  5IYD J;  5FKK A;  1CQT A;  2JVH A;  2DPU A;  1ZRD A;  1IV6 A;  4P5O A;  3BG6 A;  4WXH A;  5DCM B;  3F3X A;  4B47 A;  2R7O A;  4ESF A;  1ETW A;  4J00 A;  2XRL A;  2PMZ N;  5A2Q K;  1FNN A;  1HOM A;  1R5H A;  2UXX A;  2LFB A;  3B6C A;  1S9H A;  3W2W A;  4GXO A;  3BQZ A;  2W7N A;  3ECH A;  5LD2 C;  1FY7 A;  1IRX A;  1FOK A;  4OIP F;  3H9J A;  4Q47 A;  4Z6Y A;  2JSP A;  5EG0 B;  9ANT A;  1WSU A;  2HPM A;  4KIS A;  3PNY A;  1K83 J;  2V79 A;  4FET A;  3F8N A;  1XMK A;  2Z3Y A;  5LGN A;  1E3O C;  1QQI A;  2E7W A;  1KU3 A;  2DMT A;  5A2Q Z;  3KYL A;  3SQN A;  4UVA A;  1Z6R A;  4ENN A;  1PP8 F;  1U6G A;  4MTE A;  2OTL I;  5HLT A;  2FF4 A;  5IT9 K;  1IRG A;  2RGV A;  3LSG A;  4IRG A;  2PEX A;  3S32 A;  5GAE J;  2XAJ A;  5IY5 H;  4CCO A;  1OYY A;  2E5Z A;  3L2R A;  1F43 A;  3M8F A;  3HOS A;  2VIX A;  2ZB9 A;  1MBG A;  1P2F A;  2DQL A;  4M71 A;  5FJ8 J;  2V6E A;  2ACJ A;  2HXI A;  5L3C A;  4NNJ A;  3A1Y A;  2H8R A;  3JRF A;  2NS0 A;  2XAS A;  3CCM I;  1XD7 A;  2ID3 A;  3FXJ A;  4AC0 A;  1UFM A;  3LSP A;  2QUF A;  3F23 A;  2P5V A;  3F0C A;  2CMP A;  3HDD A;  1YS6 A;  2G9W A;  2IA1 A;  3RKX A;  1SVO A;  1IRZ A;  4HNV A;  1E3H A;  2O03 A;  3TL4 X;  4IHY A;  4A3M J;  2MC4 A;  2CUF A;  3TED A;  2EA2 A;  5H2F C;  3PIO F;  1MMG A;  1IXC A;  2X0L A;  4Y52 J;  3I9V 2;  2Z2S B;  3LMM A;  3A2K A;  5DYM A;  5CQG A;  2DXI A;  4XID A;  3PNV A;  3OS1 A;  2DT6 A;  4HLX A;  2GXA A;  2VN2 A;  3BPX A;  1F36 A;  3GWZ A;  3H5N A;  2VPL A;  3LQR A;  2B7E A;  5LRS A;  4QTR A;  2IPQ X;  3K4J A;  1H88 C;  2DO7 A;  3Q9V A;  4ZZL A;  2RNJ A;  1O4X A;  4YFK F;  3HEF A;  2ZSI B;  3BJ6 A;  4BQO A;  4IX7 A;  2IAI A;  3KEY A;  2VC1 A;  3GBG A;  1JT6 A;  2OU2 A;  1J9I A;  1ULY A;  2FOW A;  5ILS A;  4E7L A;  1MJ9 A;  2Y0S A;  2WB1 A;  4RA2 A;  1SMT A;  4A3L J;  1ZKG A;  5JI6 A;  1O3S A;  3CC4 I;  3Q0U A;  5GAG J;  2VC0 A;  2M30 A;  3OYI A;  2JN6 A;  1ZAO A;  4XK4 A;  2VKV A;  5FLX Z;  5E3L A;  2F5E A;  1IN5 A;  4HOB A;  5IP9 J;  4A0Y A;  3UKG A;  4KIB A;  3IV5 A;  2UUZ A;  4XLH A;  4II3 A;  4FE4 A;  3ZQQ A;  3VYS B;  1W7P D;  1BM9 A;  4HDU A;  1VFC A;  2DOE A;  5F0C A;  3TO6 A;  2ESH A;  3FIW A;  2E19 A;  3GVA A;  4YEL A;  1O57 A;  2OBP A;  3WTU C;  1EH8 A;  2E60 A;  2JWT A;  3FXU A;  3MKW B;  1Y1V J;  3B6A A;  1JGG A;  1OPC A;  4IHT A;  2XF6 A;  4XKW A;  2L01 A;  2P6T A;  3HYI A;  5EEH A;  4F3Q A;  3I59 A;  3IKV A;  2HZD A;  4BBR J;  3ZQC A;  3HRU A;  2ISZ A;  2IBD A;  1MKM A;  2F5C A;  1ZGA A;  3JR9 A;  1ON1 A;  3K2A A;  1BA5 A;  4BHC A;  4KMU X;  1MNE A;  3M8J A;  1BBY A;  3I58 A;  2ZSH B;  2FEZ A;  2ID6 A;  2QZ8 A;  2BV6 A;  3F8C A;  5EZH A;  1IXS B;  2W1O A;  2LOO A;  3HBL A;  1GUU A;  2QQA A;  3KYD B;  3L2U A;  1QRY A;  4IHW A;  3ESW B;  2P7C B;  3S2H J;  2XVC A;  5GPA A;  5DUK A;  1EF4 A;  2PX9 A;  3GTK J;  2L9S A;  1FYK A;  3A0B C;  1JKR C;  2EPF A;  1FYM A;  2HU9 A;  2CQX A;  1I3A A;  1M1E B;  4EJV A;  3BTC A;  2Y9Y A;  3OYJ A;  2VT3 A;  2JPC A;  4QPO A;  1JUS A;  4BL0 B;  1YJW I;  3BR3 A;  1XC5 A;  2GOX B;  2MH2 A;  4HQE A;  3BQY A;  3TDU C;  2RVC A;  2VE9 A;  4V19 K;  3L7W A;  5FRM A;  2HKX A;  2D45 A;  3IP4 B;  1W0U A;  1T0F C;  2YPR A;  2D1H A;  6PAX A;  2M7B A;  2K3F A;  3L09 A;  4BXF A;  3EUA A;  2HOS A;  5H20 A;  1ZLJ A;  1BC7 C;  2O6G E;  2ZFW A;  3ZMD A;  2ZFU A;  2PMH A;  2JK3 A;  1MH3 A;  2H1K A;  1IJW C;  2H1L A;  1UHW A;  2DPD A;  4D0P A;  3H0G J;  4ZYH A;  5DV5 A;  2CGP A;  2QEN A;  4IXA A;  3SFI A;  5H6Q A;  4I2O A;  5K5O A;  3GME A;  4LJZ F;  1GXQ A;  3MEX A;  4RAZ A;  1LB2 A;  4ZDO A;  2K9M A;  2Q2E B;  2CS3 A;  3HC7 A;  2RDP A;  4ENK A;  1FT9 A;  1A5J A;  3JTH A;  1YHQ I;  1S72 I;  3DLA A;  2FBI A;  4NUB A;  4ESB A;  1T2K A;  2DAO A;  4PJM A;  2R4G A;  3HPG A;  1EH6 A;  3SXY A;  3D5S C;  3G1M A;  3K1P A;  4RB3 C;  2FE3 A;  2H6B A;  2LDU A;  2MA3 A;  2P5K A;  1UJ8 A;  1K78 A;  1DGW Y;  1D8K A;  2QGU A;  3FMQ A;  3CCY A;  4G6T B;  2ZNY A;  4F93 B;  2R7Z J;  5B1A H;  1SFU A;  2Z9O A;  3SEZ A;  3I5U A;  3X2Q H;  2DBB A;  1I6X A;  1KGS A;  2E2H J;  1YX3 A;  2HR3 A;  4MEX F;  1D0Z A;  5GAD J;  1V5G A;  3CTA A;  3K1N A;  2HYG D;  3WU0 A;  1VI0 A;  3Q0W A;  5GTH C;  2GOM A;  3DV8 A;  2DA6 A;  4BE0 A;  2F5D A;  2WV1 A;  3V7C A;  2MSY A;  4FE7 A;  3Q3S A;  1SFX A;  3DTE A;  1C0W A;  4A5M A;  2LP0 A;  2STT A;  2YS9 A;  4A0X A;  3OYK A;  1XCB A;  3GEZ A;  2H94 A;  3IH3 A;  4CYD A;  3ZMS A;  1B72 A;  2XGX A;  4BHB A;  3IAM 2;  2HQR A;  3N4M A;  3FM5 A;  3LSK A;  3V7R A;  5M3M J;  1WQ2 A;  4S05 A;  1V54 H;  3KPH A;  5HLI A;  2DMU A;  3FX3 A;  4RAF A;  2BOL A;  1R49 A;  1X1A A;  4XRF A;  3WOD F;  1OJL A;  4A3K J;  1T98 A;  2DLL A;  3N97 A;  3GW2 A;  1U5T A;  3DBH B;  1UST A;  3VWB A;  2E5N A;  4CCJ A;  5CVU A;  3ZQH A;  2VJI A;  2DK5 A;  4PUS A;  2BW3 A;  1VTN C;  3KP3 A;  1ETO A;  2BBY A;  2KRF A;  2HVS A;  3NQO A;  3ZQ7 A;  1MBK A;  3TW6 A;  4BDZ A;  4KT5 C;  5HLH A;  2KIQ A;  2F2E A;  2Y69 H;  4EJO A;  2XPU A;  5LEJ A;  2NXN B;  3JAM K;  3GZN B;  3A4C A;  2IT0 A;  2L9N A;  4P9F A;  2RQQ A;  1LE8 A;  2L9V A;  3ZMZ A;  1ZRF A;  1IN4 A;  4BDY A;  2EFP A;  3K4M A;  2L3D A;  3IC7 A;  2MFZ A;  3PM1 A;  3BG5 A;  1FTT A;  1LUJ B;  4S04 A;  4IOA F;  1T6S A;  2BE5 F;  4WF2 A;  2CU7 A;  1XX5 A;  5HS9 A;  3GCM A;  1MIJ A;  3L2V A;  4PSW A;  3KZZ A;  1UHM A;  2H6C A;  4MGR A;  4UV9 A;  2WAQ A;  1ORK A;  1TW3 A;  1OR7 A;  4NDL A;  2QSH X;  1CF7 B;  3J80 K;  3H3U A;  4E70 A;  4R1H A;  2EA4 A;  3K4N A;  1OMI A;  2FA5 A;  4YFN F;  1SVM A;  3L2Q A;  3RPU A;  1KU9 A;  5C4X J;  1HXD A;  4M72 A;  2HDC A;  2FNP A;  4C2U A;  4K2E A;  4L5I A;  1Y39 A;  1J2X A;  4L0Y B;  3H3V K;  1WGX A;  1IUF A;  1HKQ A;  2VQH A;  1BR4 A;  2JT1 A;  3WTW C;  2AQE A;  4UV8 A;  3WHC A;  1D5Y A;  3EUH A;  3BPV A;  1RNL A;  3LA3 A;  5FLX K;  3IAS 2;  4XLC A;  4XKV A;  2QSG X;  1JHH A;  1LVA A;  1J09 A;  2PG4 A;  2E35 A;  1WI9 A;  2Y30 A;  5EEG A;  4I01 A;  1HQC A;  4XIC A;  1KON A;  3JSO A;  2GXB A;  2EV5 A;  3CZ6 A;  5TRD A;  3K69 A;  1PUE E;  2JMW A;  5K5R A;  1U8R A;  1GXP A;  2VE8 A;  3PUB A;  4E7Z A;  1MMA A;  4RGR A;  3KFW X;  1V55 H;  3K4B A;  2X1D A;  3U21 A;  4EV0 A;  3CC7 I;  3BG3 A;  2CV1 A;  2AQF A;  4A69 C;  3QWL A;  1TQP A;  4HX8 A;  2QWW A;  4XMY A;  3R0J A;  2XGE A;  2VQC A;  2LYC A;  2M4G A;  4A3B J;  2W85 A;  4BXX J;  2IRF G;  3DKY A;  3H5R A;  1I1S A;  4KIT B;  1SAX A;  3FKJ A;  1VQO I;  4FTH A;  4W1U A;  4CZZ A;  2MC3 A;  5BS6 A;  4P96 A;  2X1C A;  1SAU A;  3N05 A;  1SD5 A;  3C3W A;  1K6Y A;  1HA8 A;  3BR5 A;  2FUG 2;  2EZK A;  3CUQ A;  4G94 A;  2UWM A;  2OJE D;  3G6E I;  2DU9 A;  1JUP A;  1IF1 A;  3OWT A;  2COM A;  3ONQ A;  1DQU A;  1APL C;  3QPT A;  4BH9 A;  4I76 A;  3M8E A;  1FOW A;  5F1J A;  1FLI A;  2E34 A;  2NOG A;  2XAU A;  5LHG A;  1X3Z B;  2WAQ N;  2M8G X;  2V6C A;  1E3P A;  1TWG J;  4UXN A;  2IXS A;  2DMN A;  4B3X A;  2V4J C;  2CRG A;  1IXR C;  3J80 Z;  4OIO F;  2ZO4 A;  4IHX A;  2GM4 A;  4L9T A;  1RR8 C;  4IHS A;  4IRI A;  1R00 A;  1R23 A;  2HQN A;  3SJM A;  2L54 A;  3V8J A;  3E6B A;  4IVN A;  3S15 J;  4U87 A;  3WTV C;  3CLO A;  1P7J A;  4H0E A;  4GYG A;  4NC8 A;  2M0C A;  1HKT A;  2BY3 A;  1T95 A;  4BQA A;  4EVI A;  5EF6 A;  1SFO J;  2M3A A;  1VQ7 I;  2IA2 A;  2MYS A;  1R1U A;  3KET A;  3CCU I;  1JTX A;  3TDZ C;  3LAJ A;  2R7T A;  1L0O C;  4C9Y A;  4ZYD A;  5J8C A;  4D7N A;  4CUG A;  4HZF A;  3PL8 A;  4AVP A;  1W7P A;  4DYQ A;  1KA8 A;  3OYB A;  1S5L C;  3V7S A;  3HPH A;  4M3G A;  2ELH A;  1XPX A;  2ZCW A;  1S3J A;  2LC2 A;  2XAF A;  3ABM H;  5DD4 A;  2GWR A;  4G12 A;  1XGN A;  1X1C A;  2CSO A;  2P81 A;  4LLL A;  4DGW B;  3TOB A;  4OIN F;  5AIQ A;  2QYO A;  4FAS D;  2WY7 Q;  5ILU A;  4P55 A;  1OYW A;  2CJJ A;  2FQ4 A;  4HX7 A;  1TC3 C;  1F4K A;  3M4O J;  2I8D A;  5CVI A;  2LLK A;  4A6E A;  4CH7 A;  4LK0 F;  5DTD A;  3JW4 A;  1ZAR A;  3KIO A;  5FFZ A;  2FNA A;  2YUS A;  2P6S A;  2ESN A;  3P9C A;  3FDY A;  3CJQ B;  2GZW A;  2EZL A;  3FMR A;  5AIP A;  3J81 Z;  2MD5 A;  5E1X A;  3NRV A;  3VYR B;  2LF8 A;  3OY9 A;  2XAG A;  2ETH A;  1Z0X A;  2H27 A;  2W24 A;  4ASN A;  2V7F A;  1OYI A;  2CUE A;  3QYB A;  1O7L A;  2K9S A;  3BZK A;  1H8A C;  1X19 A;  1BW5 A;  1WWX A;  4D5F A;  1JKQ C;  2M87 A;  1XGO A;  1UMQ A;  2LMD A;  1SC7 A;  1P6R A;  4L9V A;  1PUF B;  1K4T A;  2OV7 A;  2MH9 A;  5BMZ A;  1S7O A;  3BJO A;  1ETY A;  3HGY A;  3KE2 A;  2QVO A;  5HS8 A;  3BCB A;  5DM6 F;  1U2W A;  1WJA A;  3HKZ A;  4HBL A;  2DN0 A;  1I3Q J;  4G6Q A;  3CME I;  2DMP A;  1KU7 A;  1MDM A;  4R8H A;  3HHH A;  1BJA A;  2WTE A;  1SVL A;  2V9K A;  4L5E A;  1LDK B;  4CYC B;  3RI4 A;  2XSD C;  1A31 A;  3VYT B;  1R22 A;  3WTX C;  3T8R A;  5F64 A;  1BC8 C;  1OFC X;  2HDW A;  2K40 A;  1I1G A;  2DQR A;  5E1Z B;  1VND A;  3IKT A;  4ZJZ A;  1N78 A;  3F6O A;  4D1Q A;  4ANJ A;  3TBI A;  5KVR A;  4Y3O A;  2HVR A;  2QQ8 A;  4UUV A;  4ON0 A;  5KK1 A;  2VKD A;  3C1D A;  1N75 A;  1WCM J;  4AIJ A;  3HOT A;  4XLF A;  2QBY A;  2A5Y B;  3MVP A;  3QU3 A;  3D1N I;  1X1B A;  2VXZ A;  2X9D A;  4M3B A;  2PLY A;  1IW7 F;  3BCA A;  2DTZ A;  3OYM A;  1FEX A;  2KQR A;  4C3H J;  4J19 A;  2EBI A;  1QVT A;  2EIJ H;  3DEE A;  4E7K A;  3H35 A;  2F4I A;  5E79 C;  2O9L A;  1FBQ A;  1IZ1 A;  3CQZ J;  1MGT A;  5LBQ A;  4OWR B;  1FSE A;  4PJ0 C;  4HF1 A;  3LST A;  1ZGJ A;  4M3D A;  2K4J A;  5D6E A;  4LG0 B;  2CWE A;  2NOJ B;  3LL7 A;  2XPV A;  3GLX A;  4BJT A;  4UVB A;  3ZN0 A;  1MSE C;  1TLH B;  1HBX G;  4M3E A;  1K7A A;  2XGD A;  3CCJ I;  1S8N A;  1ZEL A;  4ZTF A;  3DKX A;  3DLL F;  4EJT A;  4BNC A;  1FC3 A;  1TWA J;  4GYI A;  4BAY A;  2Q8K A;  2R5Z A;  2B63 J;  3HGG A;  2VAS A;  3GFI A;  2LD5 A;  2F4M B;  1Q1H A;  3HG9 A;  2JA5 J;  5GAH J;  3CUO A;  3O3K A;  2CYY A;  3HSR A;  2GIV A;  3P9K A;  2L0K A;  5FLV A;  3OOP A;  2KZG A;  2NVY J;  4CZC A;  1ZG3 A;  1W36 D;  1BJZ A;  3TQN A;  4AIK A;  1XSX A;  3OL4 A;  4OU0 A;  1K6O A;  4DZJ A;  2J5P A;  3KYC B;  1U9N A;  2BHZ A;  4WXC A;  2CFX A;  5HVQ C;  3VPR A;  2MBF A;  4QWQ A;  2M4K A;  2H8W A;  5BNG A;  2VB6 A;  2B0L A;  1Z21 A;  3ERM A;  3FIS A;  2I10 A;  2M5W A;  2ZME A;  4JYK A;  2DOD A;  1B59 A;  4YFX F;  2L7F P;  1P7I A;  4PGH A;  2EH3 A;  1MD0 A;  3E0J B;  3PNT A;  4RBO A;  3DBR B;  4L9J A;  3NEU A;  1MJA A;  5HDG A;  4A3J J;  4M73 A;  1TQM A;  1MW7 A;  4UHT A;  1H0M A;  4LLG F;  5D4R A;  5K5Q A;  2CUJ A;  4XRM A;  5D8L B;  1V5F A;  2EV0 A;  5LLQ A;  1JJ8 C;  1HLV A;  2PMU A;  2MD0 A;  2X6W A;  3TO7 A;  3GTQ J;  4PK4 A;  4M9X A;  1YG2 A;  3E5U A;  3QPL A;  3BR0 A;  1IO2 A;  1OLT A;  1B8I A;  1NK3 P;  3OYL A;  3A0H C;  3HRM A;  1SAN A;  1PP7 U;  1TWF J;  3MD2 A;  2HTJ A;  2ISY A;  3BZ6 A;  4HW0 A;  2OCE A;  3AG3 H;  5D5X B;  3ZN1 A;  3HTU A;  4BUP A;  4XKB A;  4D7M A;  4E7J A;  1MH4 A;  3H1C A;  1A36 A;  4EQQ A;  3HOU J;  4F91 B;  4GFB A;  4JBA A;  5JLW A;  1N25 A;  1MND A;  5FFX A;  1YW7 A;  4PJL A;  3RPU D;  3I56 I;  1RR7 A;  5JHU A;  5E17 F;  3AL0 B;  2P8T A;  4H4K C;  3REO A;  4B3A A;  3VYU B;  1KQ8 A;  3RCO A;  1R9T J;  5FRN A;  1Z77 A;  5DCF A;  4WCG A;  1HDP A;  1R4N B;  2LK2 A;  3D0S A;  5DM7 F;  4KT6 A;  1QBJ A;  2NS7 A;  3I54 A;  1G59 A;  2ADU A;  2W48 A;  3WHB A;  3VB2 A;  5DD8 A;  1Z91 A;  1HSJ A;  4AVZ A;  4AID A;  2EIL H;  2OTJ I;  4M6Y A;  1RI7 A;  4ETS A;  2DTR A;  4HST A;  1HW1 A;  3PJR A;  1Z9C A;  4FIS A;  5EGO B;  3D5L A;  1T0F A;  1XG1 A;  5IT9 Z;  5E8G A;  1IAW A;  2WB1 N;  2K5C A;  3QPS A;  5E20 A;  2R92 J;  2K4B A;  2YX4 A;  4XOR A;  4W97 A;  2VT2 A;  5BOX A;  3OSF A;  2L9R A;  3VEP A;  3E5Q A;  3CLQ A;  3IH4 A;  2HI3 A;  3WE2 A;  3FF5 A;  1WH7 A;  3DTK A;  3HJE A;  3LWF A;  4XKC A;  4MLO A;  2XDV A;  1DUX C;  1MMN A;  1XN7 A;  3HSE A;  5EZG A;  4XQF A;  3EUH C;  4XRS A;  4U7B A;  1JKO C;  3OSG A;  2ECB A;  3L1P A;  1NG7 A;  1QZE A;  3BY6 A;  1UG0 A;  3DU5 A;  5CQE A;  4UY8 I;  4EGZ A;  2Y9Z A;  3I55 I;  2O61 A;  4BU2 A;  3QOP A;  3GYH X;  1GHC A;  3TKY A;  3DWL E;  3CMM A;  2JUC A;  2JVG A;  4GRI A;  1JXS A;  5FO5 A;  5CJ9 A;  3AAF A;  4KN7 X;  3G4S I;  1POG A;  2DA3 A;  5IOY A;  4I6Z A;  1G4D A;  4ZDP A;  1YFH A;  1MNM C;  4IQJ A;  4XLP F;  1I5Z A;  4N9H A;  4E7I A;  3M3Y J;  1H9T A;  3T0Y A;  4BAC A;  1WFX A;  3JTG A;  1QU3 A;  3JRG A;  3GFM A;  3SZG A;  5EGO A;  2HOA A;  4LG3 A;  2M34 A;  1TT0 A;  4N0B A;  1TTY A;  2DK8 A;  2D5V A;  4XNF A;  3MZH A;  2NNN A;  1Z3X A;  1R4M B;  4F7Z A;  1WJD A;  1ODD A;  1V3F A;  3JAM Z;  4LGW A;  4B8X A;  2LKS A;  3DFG A;  5J1R A;  2LVS A;  1WJF A;  2M9H A;  2L02 A;  3B73 A;  3OS0 A;  2DFH A;  4RDU A;  2DFF A;  2XPW A;  2HDD A;  3MKY B;  1WRJ A;  2ZC2 A;  3WGI A;  1GV2 A;  1BI3 A;  1XGS A;  2EIN H;  3G73 A;  3ERE D;  1K78 B;  5CKT A;  2JA7 J;  5CYV A;  3EET A;  1G8X A;  1XSD A;  2Z5U A;  2G7U A;  1X2M A;  3EPZ A;  2EFW A;  5IPA A;  1R71 A;  1RKW A;  2HFH A;  1AOY A;  3HTS B;  4IZZ A;  3S2W A;  3K4C A;  3VSK A;  3PIP F;  2K9L A;  4RAY A;  4KDP A;  1GV5 A;  2OZU A;  4AD9 A;  1NK2 P;  1ZR2 A;  4JOM A;  1AU7 A;  1D0X A;  2KRC A;  3E6C C;  3AL0 C;  1Z05 A;  1XGM A;  2CV2 A;  4BYY A;  2RRE A;  3PO3 J;  2Y75 A;  2A07 F;  2NRA C;  1DU0 A;  1FBU A;  3FK7 A;  2W57 A;  4OAZ A;  4ITV A;  3S14 J;  3ASO H;  1YW8 A;  3RYR A;  2PJP A;  3GUD A;  4BY1 J;  5JFR A;  1ETK A;  4Y15 A;  2K86 A;  2IS4 A;  5J4Y A;  4DYC A;  2L7M P;  4E7S A;  3LSI A;  2XB5 A;  4XLE A;  1IDY A;  2LRD A;  4LMY A;  3CC2 I;  2ZJR F;  1VQP I;  3H0D A;  3FBN B;  5H6R A;  4MHG A;  4I09 A;  4QSH A;  4B4C A;  5J47 A;  1S29 A;  1ON2 A;  4HA8 A;  2OAZ A;  5LGT A;  2XHK A;  4HX4 A;  4UUS B;  4Y33 A;  1YO5 C;  4Y13 A;  2XKO A;  1UHS A;  2ME6 A;  1DPR A;  2OD5 A;  1BI2 A;  3DPT A;  2O7O A;  2IP2 A;  5LEK A;  1L3L A;  2E1C A;  1R1V A;  3L9F A;  4N4N B;  2L4A A;  5LRR A;  1WHU A;  2GA2 A;  2X48 A;  1ONV A;  4L18 B;  4RLF A;  1G6N A;  3EYI A;  1JUM A;  4UNO A;  2HEO A;  2EJR A;  4DBQ A;  4F52 A;  2LF7 A;  2HGC A;  2DFE A;  4EM2 A;  5EYR A;  2KL4 A;  3F22 A;  3LSR A;  2BVL A;  1YTY A;  4OMZ A;  3BOQ A;  1D1A A;  4D9J A;  1D1C A;  2E7X A;  1ITY A;  2XF5 A;  2HZT A;  5FGM A;  1YQA A;  2VJ4 A;  3O8H A;  5HDN A;  2V9V A;  4Y17 A;  3T8T A;  3BRO A;  1AKH B;  2M2E A;  5C4J J;  2KJC A;  2VBZ A;  1YRN A;  3CF5 F;  5F0F A;  3BP8 A;  3PUF A;  4XN0 A;  2V26 A;  2VOP A;  1JTY A;  2OC6 A;  5ICE A;  4DYR A;  4LG0 A;  3AG1 H;  1P92 A;  3DPU A;  3ZOB A;  5TIS C;  4PZJ A;  1KZH A;  1GVD A;  3QP6 A;  4EJW A;  3W6J B;  3V4G A;  3MWM A;  3FZV A;  1BI1 A;  2CFO A;  2R0Q C;  1SEU A;  2V9P A;  3BR6 A;  3VFZ A;  5JVT A;  2YX7 A;  1TNS A;  2QEX I;  4CCN A;  4AIH A;  2XIG A;  2I5U A;  2G7H A;  5HNH A;  4I7H A;  2KDO A;  3LA7 A;  3AKZ A;  1HKS A;  2ZJ2 A;  3H92 A;  3LFU A;  2UV1 A;  2XGC A;  3FMS A;  3LOC A;  2QBY B;  1UCR A;  2ZXW H;  3O6B B;  4L0Z B;  4HPQ A;  2DT7 B;  2QSF X;  3G71 I;  1U3E M;  5IYB J;  1VQ4 I;  2A5W A;  4A5N A;  4V2G A;  2E1O A;  2JQ7 A;  4GO1 A;  3H9Q A;  2IGK A;  3BTL A;  3OYF A;  3V8L A;  2ZJQ F;  3GTP J;  4BE1 A;  1VQN I;  3MQ0 A;  3OYD A;  4HNU A;  1OQY A;  2M8E A;  4EMS A;  1X4O A;  2K9N A;  1UG2 A;  5DS9 A;  3MFK A;  1JT0 A;  2HNH A;  3DU6 A;  3DCF A;  3GFJ A;  2R7W A;  3S3M A;  1VQ9 I;  1H89 C;  4NC7 A;  4M3F A;  2CV0 A;  3KEO A;  1LEA A;  1MDM B;  3BWG A;  3RKW A;  4WWC A;  4BEH A;  5FKO A;  4CCM A;  4U0V A;  4A12 A;  4IEJ A;  2WWY A;  3E3V A;  3LQQ A;  3TO9 A;  4P1W A;  3OR2 C;  1ZRC A;  1OIS A;  3AG4 H;  3UR3 C;  3OYH A;  5KAI C;  3CP2 A;  2IS6 A;  1D1B A;  3IWZ A;  2QQB A;  3C2B A;  3SZT A;  1FBS A;  1KU2 A;  1I6H J;  2EB7 A;  2O0Y A;  1YIO A;  2LKX A;  3O8G A;  2DJN A;  2EWN A;  5E1W A;  3KLO A;  2K02 A;  3OYC A;  3BTJ A;  5E3N A;  3CD6 I;  3S3O A;  4L9N A;  1B6A A;  1I27 A;  3KZI C;  2GLO A;  1LJ9 A;  1V4R A;  3GXO A;  3SZP A;  4HV5 A;  3LFK A;  2Q0O A;  1SD4 A;  5DEQ A;  3MN2 A;  1BOA A;  4BS9 A;  4YG2 F;  1RPW A;  2NNY A;  1PVE A;  4FCY A;  3QAH A;  3RQ4 A;  3W2A A;  2VBX A;  3LNQ A;  1O3R A;  4XRS G;  1VF9 A;  2KKO A;  2LH9 A;  1NTC A;  4E7H A;  5KCM A;  5J8F A;  2QLZ A;  5HDK A;  3IRQ A;  3CP8 A;  2OA4 A;  2HPI A;  1U5T C;  3K4L A;  1QHG A;  2EZH A;  2KDZ A;  2DA2 A;  2Y0S N;  3CJT B;  3CF2 A;  3ZQF A;  2QKL B;  3CDL A;  4FX0 A;  2MAB A;  4KIG A;  1RES A;  4Y4R A;  1B9N A;  2NVU B;  3ZXS A;  3SYT A;  2K3P A;  2FOK A;  1JHF A;  5CPR B;  4RM2 A;  3LSM A;  5D6F A;  2YU9 J;  3BR1 A;  4WK8 F;  1ZR4 A;  2K27 A;  3HOZ J;  1W7P B;  1X1P A;  3KLN A;  4FT8 A;  1LKX A;  3EUK L;  1IG7 A;  2A69 F;  1IN8 A;  5DCM A;  2OQG A;  2V1D A;  1FOX A;  2QKM B;  2VL8 A;  1T38 A;  4ZH4 F;  2CO5 A;  2DCE A;  2VUM J;  2KIS A;  3K70 D;  4XR6 A;  1Z3Y A;  5B1B H;  2CQ7 A;  2COB A;  2KT0 A;  1WI3 A;  2Y31 A;  3L2C A;  2OQR A;  3SDB A;  4RB2 C;  3DF8 A;  4I0B A;  3VOD A;  4XM3 A;  5GP9 A;  1F5T A;  3OL3 A;  5LHH A;  3R4K A;  2OUM A;  4XOP A;  1ZN2 A;  1E2X A;  4RB0 A;  5F0H A;  3S93 A;  1J59 A;  3JRD A;  1R58 A;  4RGS A;  2XUB A;  5F6F A;  2L4M A;  2VPR A;  2ZNZ A;  2IW5 A;  3ZQI A;  3PO2 J;  3A01 A;  1BIA A;  1RZ4 A;  2FBK A;  3HUG A;  2XRN A;  4ZC3 A;  2HKO A;  2EZI A;  2HS5 A;  3BDD A;  4KJZ A;  3IRR A;  2MG4 A;  2BXY A;  1Z7L A;  1AA7 A;  5JVG F;  1FMW A;  5DUI A;  3CCL I;  3PSI A;  3BC8 A;  3V8K A;  1EJ9 A;  1FP2 A;  1Y56 A;  2RAE A;  3DTI A;  4MO7 A;  4EEF G;  3Q9S A;  3CUQ B;  3G2B A;  5IP7 J;  5FD5 A;  3QP5 A;  2K85 A;  4CCK A;  2F5V A;  1TWC J;  2R5Y A;  2K9Q A;  3OS2 A;  2CQK A;  2OF7 A;  5C3E J;  1YRN B;  1WKM A;  4RMN A;  4Z2Y A;  4ZYG A;  1AKH A;  2ZXI A;  5J1U A;  4JX4 A;  4A0Z A;  2R93 J;  3S2D J;  5FRO A;  4AUX A;  1FTZ A;  2AXT C;  2RKH A;  3M7G A;  2LBF A;  1QNT A;  2M0M A;  5C44 J;  1LDD A;  2A6T A;  2GQQ A;  4R79 A;  1RKT A;  4DJA A;  3HL2 A;  2PJR B;  4EJU A;  5GTI C;  1XB4 A;  3HZJ A;  4NBQ A;  1BW6 A;  1WPK A;  3DEU A;  3DP7 A;  1BI0 A;  4DIQ A;  3F21 A;  2B9S A;  3I71 A;  3NAU A;  2PMZ A;  1WJE A;  4X6A J;  2FD5 A;  4QIW N;  4EGY A;  4G7H F;  5BPI A;  3FXQ A;  4N4O B;  2W00 A;  5EEA A;  3BTI A;  5K7Z A;  2WA0 A;  1AHD P;  1R5G A;  3F8B A;  3RKY A;  2P0W A;  1HW5 A;  1PYV A;  3HSF A;  2VKH A;  3TP3 A;  5D5V B;  1YLF A;  2MGQ A;  1Z67 A;  3BT9 A;  4HAM A;  4UB6 C;  3RYP A;  3QYE A;  2DDB A;  2Z33 A;  2VI6 A;  3GTG J;  5JR3 A;  3H9G A;  1IV8 A;  4A3E J;  1T39 A;  1W36 C;  3S16 J;  3EDP A;  4A3D J;  4S0H B;  3H3Z A;  3F8F A;  4IHV A;  3VDX A;  1FPQ A;  2UXN A;  4OIQ F;  3BJA A;  3OR1 C;  1CF7 A;  4U7D A;  4BJ5 C;  4MQ9 F;  2PFB A;  2Z99 A;  4OOI A;  3K9T A;  5B5E C;  3C2H A;  1D0Y A;  5ED4 A;  2UZK A;  1VQL I;  1HF0 A;  5FKL A;  2VQL A;  5DDG A;  1RIO H;  1MBF A;  3WG7 H;  1VQ6 I;  3HOV J;  1G2H A;  1LE8 B;  1W5T A;  2IS2 A;  1A6Q A;  4CIC A;  3CDH A;  2R5Y B;  5J1Y A;  1LVK A;  2KP6 A;  2O8X A;  2DA4 A;  1XDU A;  2X6O A;  4XSX F;  3KP2 A;  1DPU A;  3V42 A;  4ESJ A;  3AG2 H;  2FU4 A;  3OMY A;  1OCR H;  2BW3 B;  3M07 A;  4N9I A;  3ZMV A;  1S7A A;  3I4N J;  4JX6 A;  3P9I A;  4ZYA A;  1YE9 A;  3PQK A;  1U5T B;  1FWZ A;  4I0A A;  4C3I J;  4KA4 A;  3QRF F;  1WVR A;  5CVR A;  2JUG A;  1IUY A;  1DU6 A;  1A6I A;  4LK1 F;  2XV4 S;  2O8K A;  3IHU A;  1LQ1 A;  3QOD A;  2N8G A;  2LNB A;  1ETX A;  2R7D A;  4LOC A;  1CGP A;  4XBF A;  2VQG A;  3FXO A;  2V1N A;  4U0W A;  5ICF A;  5K7H A;  1B72 B;  1HC8 A;  3UNG C;  1Y8R B;  2O5R A;  5J3L A;  4Y7N J;  2V1U A;  4XN3 A;  2ZJP F;  2JTV A;  2NVX J;  5HOD A;  2E1N A;  4ABZ A;  2IGM A;  2DMQ A;  1U78 A;  2YSR A;  4CSW A;  1ZGW A;  3WTT C;  5BQT A;  4C2M J;  5J4V A;  3PFY A;  4M6V A;  1X1D A;  4LLN A;  2HVQ A;  2JSC A;  4UVC A;  2BYV E;  1SFK A;  3GFL A;  3KP5 A;  1UAA A;  1OKR A;  2WC2 A;  4ZTJ A;  1MBE A;  1FZP B;  1STZ A;  1DP7 P;  2XSJ C;  2WV0 A;  1DP3 A;  2A05 A;  4U0Y A;  2FJ1 A;  4BJ6 C;  4ENJ A;  3L00 A;  2LRE A;  1JKP C;  4A3G J;  2AO9 A;  2KIU A;  4JQF A;  2R7S A;  1MZB A;  1YIJ I;  1S7E A;  2E2I J;  1K4S A;  1XSV A;  4BBS J;  5EJC A;  1A35 A;  2R3S A;  3C2G A;  1AWC A;  2QM3 A;  2Q2E A;  4AU7 A;  2EIM H;  4M6X A;  2MLG A;  1UEL B;  1VQM I;  2KRH A;  2VON A;  1FSH A;  1X3U A;  4PDK A;  4PJN A;  2DA1 A;  2XC7 A;  3LSH A;  5D5U B;  4IPA A;  2CQQ A;  4HV6 A;  2WAE A;  1HW2 A;  2R7X A;  3J81 K;  3KX2 A;  1MSF C;  4XLA A;  3WE3 A;  4QPQ A;  3B02 A;  2HYJ A;  2FRH A;  3KEQ A;  1RC9 A;  5L3B A;  1TL8 A;  3GTJ J;  3ULQ B;  1B9M A;  2AHQ A;  2E71 A;  4XON A;  3FHZ A;  3OIQ A;  3LA2 A;  2VOO A;  4RGX A;  3HOY J;  4O3M A;  3KCC A;  1W0T A;  1ZH5 A;  3HIF A;  3OOU A;  4KIC A;  4A3C J;  1GLN A;  1IN7 A;  3GZ6 A;  4KFC A;  2XB0 X;  3BG9 A;  2MW8 A;  1RRJ A;  2ZKZ A;  2DOA A;  2F48 A;  2P5L C;  3FM3 A;  5CLS A;  1W4M A;  2WAF A;  2M1B A;  2CUZ A;  3HM5 A;  5GPC A;  3JRA A;  2Y2Z A;  5J40 A;  3I64 A;  4BEH B;  4E4H A;  1MMD A;  2G0E A;  3MZY A;  3AFH A;  1ZK8 A;  4WX9 A;  4I02 A;  2VKE A;  2NVQ J;  3TP0 A;  1T33 A;  2GBY A;  4DBR A;  5KHD A;  1W1W E;  1Z7U A;  2BY2 A;  1D5V A;  3Q5F A;  5D5W B;  3CUQ C;  2JZY A;  2KMU A;  1VQ5 I;  2DT5 A;  1P4X A;  3K10 A;  4YEJ A;  1ZYR F;  3I4P A;  5CVV A;  2GIZ A;  4B48 A;  1XDS A;  1FJL A;  2XRO A;  1SD6 A;  2X6X A;  3I59 B;  1EH7 A;  4B43 A;  2QF7 A;  2R7R A;  3ZQG A;  4IKF A;  4WXD A;  3HXL A;  1RUN A;  5M5X J;  3QOE A;  5FD6 A;  4JP0 A;  2JA8 J;  1WZ2 A;  4GDF A;  2YU3 A;  4OIR F;  3GF2 A;  2KIF A;  2VOD A;  4CCL A;  3DBL B;  2STW A;  2DYR H;  2LY9 A;  1Z6T A;  1TZL A;  3W2V A; 
#chains in the Genus database with same CATH homology
 5CVJ A;  3HRT A;  1LNW A;  2HYF A;  1KQ9 A;  2ZME B;  3R0A A;  4G7O F;  4TV7 A;  1H9G A;  4LB6 B;  2AS5 F;  3ECO A;  3ZMU A;  3U9G A;  1QZZ A;  3GZ5 A;  2RC4 A;  3K2Z A;  2KJB A;  4M9S A;  3WTZ A;  3DKW A;  3IWF A;  5D8K B;  2RN7 A;  1HST A;  4G8X A;  4IJA A;  4KNY A;  2GAU A;  1PDN C;  5LGU A;  1E17 A;  3W6K B;  4ZYE A;  3F8M A;  3RPQ A;  5HLG A;  1GVJ A;  2CW0 F;  4NHJ A;  4CO8 A;  3RTR A;  1P4W A;  4CDG A;  2HOE A;  4A6D A;  2IJL A;  4LD5 A;  1A04 A;  3VOE A;  1G3Y A;  3R6S A;  3CJN A;  3E97 A;  3I53 A;  1LDJ A;  2BEO A;  3I0T A;  5D4S A;  1FP1 D;  1Z1D A;  3ML6 A;  3CO6 C;  4DQ2 A;  3OV8 A;  3WTS C;  2NAZ A;  4PGG A;  2PQ8 A;  2QQ9 A;  4YII A;  4B09 A;  2VBW A;  3ZPL A;  2CG4 A;  2Y0M A;  3E6D A;  5ERI A;  2A61 A;  1G3W A;  4NB5 A;  2RQP A;  3ELK A;  1REP C;  2MLK A;  3QPH A;  3U2R A;  4IF4 A;  5J6X A;  4LFU A;  2X4H A;  3T1B A;  5BPD A;  3ABT A;  1DDN A;  2EK5 A;  4MTD A;  3M1E A;  4KN4 X;  4RB1 A;  3K1M A;  4OMY A;  2DW4 A;  1TW2 A;  5L3F A;  1KYZ A;  3EQL F;  4XSZ F;  5FB2 A;  2O3F A;  2EFO A;  4KYW A;  2NYX A;  4RGU A;  5LHI A;  5L3G A;  1ZRE A;  1ZHF A;  2EFN A;  1F1Z A;  1SFE A;  4O5V A;  2LKP A;  3J7A O;  4LB5 A;  1YW9 A;  4EM1 A;  3P7N A;  3MAJ A;  4O6J A;  1K79 A;  1P4A A;  2J5O A;  2HTS A;  2W25 A;  4U88 A;  3CO7 C;  3O2P E;  4AWX B;  3ABU A;  3K0L A;  3R60 A;  3C18 A;  1XCV A;  5K1Y A;  4HF2 A;  2JPB A;  4PCQ A;  2TDX A;  1SMY F;  5AON A;  1EV7 A;  2DFI A;  4BHP A;  4ENM A;  2M45 A;  2A6E F;  1FYL A;  1JE8 A;  3WGH A;  1MJB A;  2FBH A;  4XLN F;  3TGN A;  1J7K A;  2F5F A;  1F9N A;  1Y0U A;  2LSO A;  3PFI A;  3JSP A;  1USS A;  2ZBK A;  1QPM A;  1YS7 A;  1D3Y A;  5ICC A;  4DNC A;  3ZP5 A;  1R1T A;  4CHU A;  4G6D A;  1O7F A;  2D2W A;  3KP4 A;  4NQW A;  2W84 A;  1JGS A;  2R7F A;  2RV8 A;  4GGG A;  2EFQ A;  4BXU A;  3DQV C;  3R61 A;  5L3E A;  3U1D A;  5ICG A;  5HS7 A;  4KIF A;  4KUM A;  2PN6 A;  1S6L A;  3HRS A;  2A3S A;  2HWV A;  2PI0 A;  1IRF A;  3KP6 A;  1QO0 D;  3ISP A;  2FML A;  3WGG A;  3GX4 X;  1LEB A;  4CXF A;  2FQ3 A;  4EM0 B;  4P9U A;  1R7J A;  1BN5 A;  3WG9 A;  4HQM A;  3HHG A;  3G3Z A;  2FMY A;  5L3D A;  3M9A A;  3ROU A;  1FX7 A;  1UB9 A;  2OZ6 A;  2PBI A;  4QLC U;  2VBY A;  2GXG A;  4G7Z F;  3C7J A;  1ZG5 A;  2FSW A;  1B1B A;  1SD7 A;  3FXR A;  4HDV A;  3RJP A;  4ZZD A;  1R36 A;  1O3Q A;  2XAH A;  2YR2 A;  1J0R A;  2EV6 A;  1J5Y A;  2P7V B;  1ZG1 A;  1KYW A;  2XAQ A;  3KP7 A;  4CGZ A;  4KMF A;  2JRT A;  4MEY F;  3E6M A;  3WU1 B;  1KQ0 A;  4IRH A;  1QGP A;  4JK1 X;  2D1V A;  4Q48 A;  1ZLK A;  3SHF A;  2DI3 A;  4RS8 A;  2C6Y A;  2GA1 A;  4G9Y A;  4M74 A;  4HLY A;  4FX4 A;  4YIF A;  3KZY A;  1IN6 A;  3RDI A;  1G3T A;  1YYV A;  2K7L A;  2BGC A;  3F6V A;  1TQI A;  3COA C;  3LAP A;  1O3T A;  3DXJ F;  2IVM A;  2ZXJ A;  5HOO A;  4HYE A;  3QU6 A;  1TBX A;  3PQJ A;  3FWE A;  2IA0 A;  2A68 F;  5E18 F;  4L5J A;  5IT3 A;  5ILV A;  3F72 A;  2FXA A;  3DPL C;  4Q5S F;  4I98 B;  2AXL A;  5E8I A;  2XKP A;  1B4A A;  4MNU A;  4MQV A;  3RIR A;  3IL2 A;  4HF0 A;  1XMA A;  3EYY A;  2H09 A;  2KIM A;  1TNT A;  3T5X A;  4FHT A;  2P4W A;  1G3S A;  1NHA A;  4M9Z A;  1D8J A;  3GO5 A;  3SFZ A;  5TJJ A;  4A2U A;  5F1R A;  1BIB A;  3ZMT A;  3WTY C;  1RUO A;  1J75 A;  2A6H F;  2V1X A;  4GCV A;  1QZY A;  4Q4Z F;  3E5X A;  3MCZ A;  1W5S A;  2Y48 A;  3TOA A;  2DPU A;  1ZRD A;  4P5O A;  4WXH A;  5DCM B;  3F3X A;  4ESF A;  5A2Q K;  1FNN A;  1R5H A;  2UXX A;  4GXO A;  3ECH A;  4OIP F;  1FY7 A;  1FOK A;  4Q47 A;  1WSU A;  2V79 A;  5LGN A;  1XMK A;  2Z3Y A;  3F8N A;  2E7W A;  1QQI A;  1KU3 A;  5A2Q Z;  3SQN A;  4UVA A;  1Z6R A;  4ENN A;  1PP8 F;  1U6G A;  4MTE A;  2FF4 A;  5IT9 K;  1IRG A;  2RGV A;  4IRG A;  2PEX A;  2XAJ A;  1OYY A;  3M8F A;  3HOS A;  1P2F A;  2DQL A;  4M71 A;  2ACJ A;  5L3C A;  2NS0 A;  2XAS A;  1XD7 A;  1UFM A;  2QUF A;  3F23 A;  2P5V A;  1YS6 A;  2G9W A;  2IA1 A;  3RKX A;  2O03 A;  2EA2 A;  1IXC A;  2X0L A;  5DYM A;  4HLX A;  2VN2 A;  3BPX A;  3GWZ A;  3LQR A;  5LRS A;  2IPQ X;  2DO7 A;  3Q9V A;  4ZZL A;  2RNJ A;  4YFK F;  3BJ6 A;  2VC1 A;  2OU2 A;  1J9I A;  1ULY A;  5ILS A;  1MJ9 A;  1SMT A;  5JI6 A;  1O3S A;  2VC0 A;  2M30 A;  1ZAO A;  5FLX Z;  2F5E A;  1IN5 A;  4HOB A;  4A0Y A;  4KIB A;  1W7P D;  1BM9 A;  4HDU A;  3TO6 A;  2ESH A;  3GVA A;  1O57 A;  2OBP A;  3WTU C;  1EH8 A;  3FXU A;  1OPC A;  4IHT A;  2L01 A;  2P6T A;  3HYI A;  5EEH A;  3I59 A;  3IKV A;  3HRU A;  2ISZ A;  1MKM A;  2F5C A;  1ZGA A;  1ON1 A;  4BHC A;  4KMU X;  1BBY A;  3I58 A;  2FEZ A;  2QZ8 A;  2BV6 A;  3F8C A;  1IXS B;  2QQA A;  2P7C B;  2XVC A;  5DUK A;  1FYK A;  1FYM A;  4EJV A;  2VT3 A;  2JPC A;  2MH2 A;  4HQE A;  3TDU C;  2RVC A;  2VE9 A;  3L7W A;  2HKX A;  2D45 A;  2YPR A;  2D1H A;  6PAX A;  3L09 A;  2O6G E;  1ZLJ A;  5H20 A;  1BC7 C;  2ZFW A;  3ZMD A;  2PMH A;  1UHW A;  2DPD A;  4D0P A;  4ZYH A;  5DV5 A;  2CGP A;  2QEN A;  4IXA A;  5H6Q A;  4I2O A;  5K5O A;  4LJZ F;  1GXQ A;  3MEX A;  4RAZ A;  1LB2 A;  2RDP A;  4ENK A;  1FT9 A;  3JTH A;  2FBI A;  4ESB A;  1T2K A;  2DAO A;  1EH6 A;  3SXY A;  3K1P A;  4RB3 C;  2FE3 A;  2H6B A;  2LDU A;  2MA3 A;  2P5K A;  1K78 A;  1D8K A;  3FMQ A;  2ZNY A;  1SFU A;  2Z9O A;  3I5U A;  2DBB A;  1I6X A;  1KGS A;  2HR3 A;  4MEX F;  3CTA A;  3K1N A;  2HYG D;  3WU0 A;  3DV8 A;  2F5D A;  3V7C A;  1SFX A;  1C0W A;  4A5M A;  2STT A;  4A0X A;  1XCB A;  3GEZ A;  2H94 A;  4CYD A;  3ZMS A;  2XGX A;  4BHB A;  2HQR A;  3N4M A;  3FM5 A;  3V7R A;  1WQ2 A;  4S05 A;  5HLI A;  3FX3 A;  4XRF A;  3WOD F;  1T98 A;  2DLL A;  3N97 A;  3GW2 A;  1U5T A;  1UST A;  5CVU A;  2DK5 A;  1VTN C;  3KP3 A;  2BBY A;  2KRF A;  3NQO A;  3ZQ7 A;  4KT5 C;  5HLH A;  2F2E A;  4EJO A;  5LEJ A;  3JAM K;  2IT0 A;  4P9F A;  3ZMZ A;  1ZRF A;  1IN4 A;  2EFP A;  2L3D A;  3IC7 A;  4S04 A;  1T6S A;  2BE5 F;  4WF2 A;  5HS9 A;  3KZZ A;  1UHM A;  2H6C A;  4MGR A;  4UV9 A;  1TW3 A;  1OR7 A;  1CF7 B;  3J80 K;  3H3U A;  4E70 A;  4R1H A;  2EA4 A;  1OMI A;  2FA5 A;  4YFN F;  3RPU A;  1KU9 A;  1HXD A;  4M72 A;  2HDC A;  2FNP A;  4K2E A;  4L5I A;  1J2X A;  4L0Y B;  1HKQ A;  2JT1 A;  3WTW C;  4UV8 A;  3EUH A;  3BPV A;  1RNL A;  3LA3 A;  5FLX K;  1JHH A;  1LVA A;  2PG4 A;  1WI9 A;  5EEG A;  4I01 A;  1HQC A;  3JSO A;  2GXB A;  2EV5 A;  5TRD A;  3K69 A;  1PUE E;  1GXP A;  5K5R A;  1U8R A;  2VE8 A;  4RGR A;  3KFW X;  4EV0 A;  1TQP A;  4HX8 A;  2QWW A;  3R0J A;  2W85 A;  2IRF G;  1I1S A;  1SAX A;  4CZZ A;  2MC3 A;  5BS6 A;  4P96 A;  1SD5 A;  3C3W A;  3CUQ A;  4G94 A;  2UWM A;  2DU9 A;  1IF1 A;  2COM A;  3QPT A;  4BH9 A;  3M8E A;  1FLI A;  5LHG A;  2V6C A;  4UXN A;  1IXR C;  3J80 Z;  4OIO F;  2ZO4 A;  4L9T A;  4IHS A;  4IRI A;  1R00 A;  1R23 A;  2HQN A;  2L54 A;  3V8J A;  3E6B A;  4IVN A;  3WTV C;  3CLO A;  4H0E A;  4GYG A;  1HKT A;  4BQA A;  4EVI A;  2IA2 A;  1R1U A;  3KET A;  3TDZ C;  3LAJ A;  1L0O C;  4ZYD A;  5J8C A;  4HZF A;  4AVP A;  1W7P A;  1KA8 A;  3V7S A;  2ELH A;  2ZCW A;  1S3J A;  2XAF A;  5DD4 A;  2GWR A;  1XGN A;  2CSO A;  4LLL A;  3TOB A;  4OIN F;  5AIQ A;  2QYO A;  5ILU A;  4P55 A;  1OYW A;  4HX7 A;  1F4K A;  4A6E A;  5CVI A;  4LK0 F;  3JW4 A;  1ZAR A;  5FFZ A;  2FNA A;  2P6S A;  2ESN A;  3P9C A;  2GZW A;  3FMR A;  5AIP A;  3J81 Z;  2MD5 A;  5E1X A;  3NRV A;  2LF8 A;  2XAG A;  2ETH A;  2H27 A;  2W24 A;  4ASN A;  1OYI A;  1O7L A;  1WWX A;  2M87 A;  1XGO A;  1P6R A;  4L9V A;  2MH9 A;  5BMZ A;  1S7O A;  3BJO A;  3KE2 A;  2QVO A;  5HS8 A;  1U2W A;  4HBL A;  4G6Q A;  1KU7 A;  1MDM A;  4R8H A;  3HHH A;  1BJA A;  2WTE A;  1LDK B;  3RI4 A;  3WTX C;  1R22 A;  1BC8 C;  3T8R A;  5F64 A;  1I1G A;  2DQR A;  5E1Z B;  3IKT A;  3F6O A;  5KVR A;  4UUV A;  4ON0 A;  5KK1 A;  3C1D A;  4AIJ A;  3HOT A;  2QBY A;  2A5Y B;  3QU3 A;  2VXZ A;  2PLY A;  1IW7 F;  1FBQ A;  1IZ1 A;  5LBQ A;  1MGT A;  1FSE A;  4HF1 A;  3LST A;  1ZGJ A;  2K4J A;  5D6E A;  4LG0 B;  2CWE A;  3GLX A;  4UVB A;  3ZN0 A;  1TLH B;  1HBX G;  1K7A A;  1S8N A;  4EJT A;  4BNC A;  1FC3 A;  4GYI A;  4BAY A;  2Q8K A;  3GFI A;  1Q1H A;  3CUO A;  3O3K A;  2CYY A;  3HSR A;  2GIV A;  3P9K A;  3OOP A;  1ZG3 A;  3TQN A;  4AIK A;  1XSX A;  4OU0 A;  1K6O A;  2J5P A;  4WXC A;  2CFX A;  5HVQ C;  2MBF A;  4QWQ A;  2B0L A;  2M5W A;  2ZME A;  1B59 A;  4YFX F;  4PGH A;  1MD0 A;  4L9J A;  3NEU A;  1MJA A;  5HDG A;  4M73 A;  1TQM A;  4UHT A;  1H0M A;  4LLG F;  5D4R A;  5K5Q A;  5D8L B;  2EV0 A;  5LLQ A;  2PMU A;  3TO7 A;  4M9X A;  1YG2 A;  3E5U A;  3HRM A;  1PP7 U;  2HTJ A;  2ISY A;  3BZ6 A;  4HW0 A;  5D5X B;  3ZN1 A;  3HTU A;  4EQQ A;  4JBA A;  5FFX A;  1YW7 A;  5JHU A;  5E17 F;  2P8T A;  3REO A;  1KQ8 A;  4WCG A;  5DCF A;  3D0S A;  1QBJ A;  3I54 A;  2ADU A;  3VB2 A;  5DD8 A;  1Z91 A;  1HSJ A;  4M6Y A;  1RI7 A;  4ETS A;  2DTR A;  1HW1 A;  1Z9C A;  3D5L A;  1T0F A;  5IT9 Z;  5E8G A;  1IAW A;  5E20 A;  2K4B A;  2YX4 A;  5BOX A;  2VT2 A;  3VEP A;  3E5Q A;  3WE2 A;  3FF5 A;  3LWF A;  1DUX C;  1XN7 A;  3HSE A;  4U7B A;  3BY6 A;  4EGZ A;  2O61 A;  3QOP A;  3GYH X;  1GHC A;  3TKY A;  1JXS A;  5FO5 A;  5CJ9 A;  3AAF A;  4KN7 X;  1G4D A;  1YFH A;  4XLP F;  1I5Z A;  4N9H A;  1H9T A;  3T0Y A;  3JTG A;  3GFM A;  4N0B A;  2DK8 A;  1TTY A;  3MZH A;  2NNN A;  4F7Z A;  1ODD A;  1V3F A;  3JAM Z;  4LGW A;  4B8X A;  3DFG A;  2L02 A;  3B73 A;  1WRJ A;  3WGI A;  1BI3 A;  1XGS A;  3G73 A;  3ERE D;  1K78 B;  5CYV A;  3EET A;  1XSD A;  2Z5U A;  2G7U A;  2EFW A;  2HFH A;  1AOY A;  3HTS B;  3S2W A;  4RAY A;  4KDP A;  2OZU A;  4AD9 A;  3E6C C;  1Z05 A;  1XGM A;  4BYY A;  2Y75 A;  2A07 F;  2NRA C;  1FBU A;  2W57 A;  1YW8 A;  3RYR A;  2PJP A;  3GUD A;  5JFR A;  4Y15 A;  2K86 A;  4LMY A;  5H6R A;  4MHG A;  4I09 A;  1S29 A;  1ON2 A;  4HA8 A;  2OAZ A;  5LGT A;  2XHK A;  4HX4 A;  1YO5 C;  4Y13 A;  2XKO A;  1DPR A;  2OD5 A;  1BI2 A;  3DPT A;  2IP2 A;  5LEK A;  1L3L A;  2E1C A;  1R1V A;  3L9F A;  2L4A A;  5LRR A;  2GA2 A;  1ONV A;  4L18 B;  1G6N A;  3EYI A;  4UNO A;  2HEO A;  2EJR A;  2LF7 A;  2HGC A;  4EM2 A;  3F22 A;  1YTY A;  4OMZ A;  3BOQ A;  2E7X A;  5FGM A;  2HZT A;  1YQA A;  5HDN A;  2V9V A;  4Y17 A;  3T8T A;  3BRO A;  2KJC A;  2VBZ A;  3BP8 A;  2VOP A;  5ICE A;  4LG0 A;  1P92 A;  4PZJ A;  3QP6 A;  4EJW A;  3W6J B;  3V4G A;  3MWM A;  3FZV A;  1BI1 A;  3VFZ A;  5JVT A;  2YX7 A;  1TNS A;  4AIH A;  2XIG A;  2G7H A;  4I7H A;  3LA7 A;  1HKS A;  2ZJ2 A;  3H92 A;  3FMS A;  2QBY B;  1UCR A;  3O6B B;  4L0Z B;  1U3E M;  4A5N A;  4GO1 A;  3V8L A;  3MQ0 A;  2M8E A;  4EMS A;  3MFK A;  3GFJ A;  3KEO A;  1LEA A;  1MDM B;  3BWG A;  3RKW A;  4WWC A;  4U0V A;  4A12 A;  2WWY A;  3E3V A;  3LQQ A;  3TO9 A;  1ZRC A;  3IWZ A;  2QQB A;  3SZT A;  1FBS A;  1KU2 A;  2EB7 A;  2O0Y A;  1YIO A;  2EWN A;  5E1W A;  3KLO A;  2K02 A;  4L9N A;  1B6A A;  1I27 A;  1LJ9 A;  1V4R A;  3GXO A;  3SZP A;  4HV5 A;  3LFK A;  2Q0O A;  1SD4 A;  5DEQ A;  1BOA A;  4YG2 F;  2NNY A;  3QAH A;  2VBX A;  1O3R A;  2KKO A;  5J8F A;  2QLZ A;  5HDK A;  3IRQ A;  2OA4 A;  1U5T C;  4FX0 A;  4KIG A;  1B9N A;  2FOK A;  1JHF A;  5D6F A;  4WK8 F;  2K27 A;  1W7P B;  3KLN A;  4FT8 A;  2A69 F;  1IN8 A;  5DCM A;  2OQG A;  2V1D A;  1T38 A;  4ZH4 F;  2CO5 A;  3L2C A;  2OQR A;  4RB2 C;  3DF8 A;  4I0B A;  3VOD A;  1F5T A;  5LHH A;  3R4K A;  1ZN2 A;  1E2X A;  4RB0 A;  1J59 A;  1R58 A;  4RGS A;  2XUB A;  5F6F A;  2L4M A;  2ZNZ A;  2IW5 A;  1BIA A;  1RZ4 A;  2FBK A;  3HUG A;  2XRN A;  2HKO A;  2HS5 A;  3BDD A;  3IRR A;  5DUI A;  3V8K A;  1FP2 A;  3Q9S A;  3CUQ B;  5FD5 A;  3QP5 A;  2CQK A;  1WKM A;  4Z2Y A;  4ZYG A;  4A0Z A;  2RKH A;  3M7G A;  1QNT A;  1LDD A;  2GQQ A;  4R79 A;  4EJU A;  1XB4 A;  3DEU A;  3DP7 A;  1BI0 A;  3F21 A;  3I71 A;  4EGY A;  4G7H F;  5BPI A;  3FXQ A;  1R5G A;  3F8B A;  3RKY A;  1HW5 A;  3HSF A;  5D5V B;  1YLF A;  4HAM A;  3RYP A;  2Z33 A;  5JR3 A;  1T39 A;  3EDP A;  3H3Z A;  3F8F A;  1FPQ A;  2UXN A;  4OIQ F;  3BJA A;  1CF7 A;  4U7D A;  4MQ9 F;  2PFB A;  2Z99 A;  4OOI A;  3K9T A;  5ED4 A;  2UZK A;  5DDG A;  1RIO H;  1W5T A;  4CIC A;  3CDH A;  2O8X A;  1XDU A;  4XSX F;  3KP2 A;  1DPU A;  4ESJ A;  2FU4 A;  4N9I A;  3ZMV A;  1S7A A;  3P9I A;  3PQK A;  1U5T B;  1FWZ A;  3QRF F;  4I0A A;  4KA4 A;  5CVR A;  1IUY A;  4LK1 F;  2XV4 S;  3IHU A;  1LQ1 A;  2LNB A;  2R7D A;  1CGP A;  4XBF A;  5ICF A;  4U0W A;  2V1U A;  2JTV A;  2E1N A;  1U78 A;  2YSR A;  3WTT C;  5BQT A;  4LLN A;  2JSC A;  4UVC A;  2BYV E;  3GFL A;  3KP5 A;  1OKR A;  2WC2 A;  1FZP B;  1STZ A;  1DP7 P;  2WV0 A;  4U0Y A;  4ENJ A;  3L00 A;  2KIU A;  4JQF A;  1MZB A;  1XSV A;  2R3S A;  1AWC A;  2QM3 A;  2Q2E A;  4M6X A;  2MLG A;  2VON A;  1FSH A;  1X3U A;  4PDK A;  5D5U B;  4IPA A;  4HV6 A;  1HW2 A;  3J81 K;  3WE3 A;  3B02 A;  2FRH A;  3KEQ A;  5L3B A;  3ULQ B;  1B9M A;  3FHZ A;  3LA2 A;  2VOO A;  4RGX A;  4O3M A;  3KCC A;  1ZH5 A;  3HIF A;  4KIC A;  3GZ6 A;  1IN7 A;  4KFC A;  2ZKZ A;  2P5L C;  3FM3 A;  5CLS A;  1W4M A;  2M1B A;  3I64 A;  3MZY A;  4WX9 A;  4I02 A;  1Z7U A;  1D5V A;  3Q5F A;  5D5W B;  3CUQ C;  2JZY A;  2DT5 A;  1P4X A;  1ZYR F;  3I4P A;  5CVV A;  1XDS A;  2XRO A;  1SD6 A;  3I59 B;  1EH7 A;  4WXD A;  1RUN A;  5FD6 A;  2YU3 A;  4OIR F;  3GF2 A;  2KIF A;  2VOD A;  2STW A;  1Z6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...