5DUIA

Identification of a new foxo1 binding site that precludes creb binding at the glucose-6-phosphatase catalytic subunit gene promoter
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
WGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures reveal a new and novel FoxO1 binding site within the human glucose-6-phosphatase catalytic subunit 1 gene promoter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Forkhead box protein O1
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5duiA00
4G94A 2A68F 5D4SA 4R79A 1PP8F 4HF2A 1Z7UA 1OR7A 1Z6RA 3ZN1A 4HDVA 3DQVC 3L2CA 3CUOA 3T8TA 4JQFA 3SFZA 2DI3A 5JVTA 3EYIA 3NQOA 4PGHA 3RPUA 5FD6A 4ZYEA 2FEZA 5DUIA 4GYGA 1YYVA 5TJJA 1I1SA 3HHHA 4A0YA 5E17F 3LAPA 1OYWA 4I01A 4NB5A 4ENJA 4IRHA 3QP5A 2XAHA 4I09A 5LEKA 3ZMZA 1KQ9A 2LF8A 3V7CA 1XN7A 3JSPA 2V1XA 2G7UA 1RZ4A 4I02A 2P7CB 3WTUC 3F6VA 1ZG1A 3SXYA 3LA3A 4HDUA 3P9IA 1OYYA 1I27A 4S04A 1ZRDA 2GXGA 1UB9A 5CVRA 5EEHA 5AIPA 3RPQA 5KK1A 1KYWA 2EWNA 2F2EA 4MNUA 3F8MA 1XD7A 3CUQB 2MC3A 3FM3A 4Q47A 4ZYDA 1HXDA 1FWZA 3W6JB 4Z2YA 1T6SA 2XASA 1TNSA 4L5JA 3BP8A 3R60A 1TQPA 2ZMEB 5ERIA 1R1UA 3CTAA 5CVIA 2HR3A 1ON2A 2M8EA 3IRRA 1QGPA 4YFXF 3HRUA 5FD5A 1U8RA 2QWWA 5HS7A 3GVAA 2OA4A 4KUMA 4GYIA 2V79A 3F3XA 4RB3C 2HGCA 1IN4A 5A2QZ 1L3LA 3MWMA 4MQ9F 3FF5A 1Z6TA 2EFQA 3M7GA 1XDUA 1VTNC 2OQGA 4KN4X 3J81K 3LAJA 1HQCA 3DXJF 3S2WA 3HUGA 3ULQB 1OMIA 3E5XA 4ZYGA 4M9ZA 4B09A 1IXSB 2JRTA 2JSCA 4A5MA 2XVCA 4UVAA 3MAJA 1R5GA 2K4JA 2ACJA 1W7PB 4KT5C 5KVRA 1WRJA 4IHSA 3KP6A 4ESJA 3WE3A 3BOQA 1USTA 3RYRA 4KIBA 4HQEA 1C0WA 2CFXA 3O3KA 3T0YA 3F22A 4U0WA 1G4DA 1ODDA 1FZPB 2W25A 1HKTA 2IT0A 2JPBA 2Y75A 4EJVA 2PFBA 1BI3A 1QZZA 4LJZF 4EGZA 1JGSA 5ICCA 1G6NA 4U7DA 3RYPA 1IUYA 1TQIA 3ZMSA 5DD8A 5D4RA 4NQWA 3I4PA 1R22A 3GW2A 1S7AA 4L5IA 5JHUA 1FPQA 4IRIA 3M8EA 5L3CA 3Q9SA 4RGUA 2H09A 3F23A 5HLGA 2DK8A 4F7ZA 2RKHA 2FF4A 4HF0A 3NRVA 2W85A 3EYYA 1ZG5A 3EQLF 1G3WA 2WV0A 2KRFA 2YSRA 1P6RA 3F72A 1TNTA 2RN7A 1K6OA 3JTHA 4MGRA 3E6DA 3PQKA 2GAUA 3EDPA 4PDKA 3RKXA 2XAFA 1JHHA 3GX4X 4KYWA 1O7FA 1TTYA 4ASNA 4IXAA 2HZTA 3JSOA 4P96A 3IWFA 1BIAA 1W7PA 4I0BA 3I59A 5ICFA 4H0EA 1W4MA 2O8XA 3FWEA 3P9KA 4CO8A 3FXQA 1RI7A 5ILSA 4Y15A 1U6GA 2O6GE 3H92A 1FOKA 2PQ8A 1TW2A 1LJ9A 3AAFA 5LHIA 4MHGA 1USSA 3RKWA 4P5OA 5CVJA 2PJPA 4BH9A 4L9NA 3VOEA 1BM9A 4HZFA 2WC2A 1XCBA 5K5RA 2H27A 3R61A 3K1NA 2Z3YA 1X3UA 4NHJA 1SD5A 2DTRA 4O6JA 5HLHA 1SFEA 2ESHA 3LQRA 4I7HA 5ICGA 2VODA 3CLOA 4L9VA 1LNWA 5K5QA 1R5HA 2EJRA 5L3DA 2K86A 4R1HA 1MDMB 1UHMA 4CHUA 1QBJA 5DEQA 2QYOA 5LGUA 3R6SA 2GWRA 5J6XA 1XGNA 4YFKF 3J81Z 1WSUA 2DT5A 4Q48A 1CGPA 2EV5A 1P2FA 4D0PA 1FBSA 5HDGA 4CXFA 5BS6A 2FQ3A 1MJ9A 1WWXA 3CO6C 2A07F 4HAMA 4YG2F 2IJLA 1UFMA 2ZKZA 4KDPA 3R4KA 1IW7F 1JHFA 5DCFA 3K2ZA 1YLFA 3E6BA 2XAJA 2Z5UA 1LB2A 2FMLA 4S05A 3LWFA 4XLPF 3SQNA 4M74A 2E7XA 1QNTA 3TOBA 1DDNA 1I5ZA 3Q5FA 2H94A 1ZG3A 1JE8A 2FBIA 2RVCA 4HA8A 5J8CA 3F8NA 4LG0B 4LB5A 3PFIA 1R58A 5L3BA 2A61A 3GFIA 4HW0A 1MZBA 5DCMB 1YS6A 4MEXF 4EMSA 4G8XA 1HSJA 2BYVE 2FNAA 5CJ9A 1FLIA 1J0RA 5D5VB 4CGZA 2PG4A 3KZYA 4UVCA 2DFIA 4KMUX 2A6HF 4IPAA 1LVAA 5HOOA 3BPVA 5H20A 1IRGA 3F6OA 2ELHA 1OYIA 3SZPA 3KEQA 1BC7C 2E1CA 2ZJ2A 3I71A 2CWEA 2EFOA 3IKTA 2DQRA 2IP2A 2P6TA 3GZ6A 2COMA 2J5OA 2ZNZA 2PEXA 1XDSA 1S7OA 5D5XB 4A6DA 1MJBA 1BOAA 4EJTA 1H9GA 2BEOA 3FXUA 3KEOA 1U78A 3E97A 2VE9A 2HTJA 4IRGA 1FYMA 3V8KA 5LHHA 4IF4A 2XAGA 3J7AO 1WI9A 3IHUA 1LDKB 4HYEA 3DF8A 1NHAA 2HTSA 1KQ8A 4EM1A 2HQNA 1P4AA 1XSVA 2M30A 2ZBKA 4LK1F 3HRMA 1YQAA 1STZA 4GGGA 4EJWA 2FNPA 2IW5A 2LSOA 2ISYA 5D8LB 1Z05A 4LMYA 1BI0A 5HDKA 3T8RA 1KA8A 2E1NA 5E18F 2STTA 3VB2A 1ZLJA 2M87A 1W7PD 1V4RA 4A0XA 1S6LA 1LEAA 1ZAOA 4MEYF 4RB0A 5H6QA 2L4AA 3ABUA 2STWA 3GYHX 4RAYA 4FX4A 2K4BA 4U7BA 1ZYRF 2GA2A 5E8IA 4HF1A 3J80K 1T98A 5HS9A 1R7JA 2R3SA 1KYZA 2MLGA 2YPRA 4M9SA 2F5EA 4AIJA 3U2RA 1J7KA 2DK5A 2HQRA 1IN6A 2DW4A 4G7HF 3F21A 3U1DA 3NEUA 2QENA 1EH7A 1J9IA 3TDUC 3FMQA 4XRFA 1XSDA 3EETA 2FBHA 3HOTA 3BJ6A 2O61A 3GZ5A 3HSEA 3M9AA 4KA4A 4LLLA 5BOXA 3GFMA 1YW7A 1H0MA 4FT8A 3K0LA 1P92A 3WGIA 1IF1A 3WU0A 4IVNA 1F1ZA 4ZH4F 3T5XA 3BWGA 3IWZA 3ZP5A 3RDIA 3I64A 2VOOA 2CQKA 1O3SA 2C6YA 3TDZC 3TQNA 3RIRA 1BI2A 2VE8A 2PMHA 1U5TA 1R00A 4P9FA 2Q8KA 4A2UA 2NS0A 2YU3A 3DP7A 2FRHA 4U0YA 1YW8A 1JXSA 2V9VA 4I2OA 1Z91A 4PCQA 1DP7P 2VXZA 2FMYA 3ROUA 1BJAA 3QU6A 2KIMA 2HS5A 3I58A 2DPUA 4L0ZB 1S8NA 3CDHA 4EM0B 4XLNF 4ENKA 4LB6B 2NAZA 1G3TA 1MGTA 3RTRA 3WTXC 1EH6A 3CUQC 2EB7A 1HKQA 1MJAA 3GFJA 5ILVA 4BQAA 4M72A 1D8JA 5D5WB 3ZMVA 4L9JA 2D1VA 1OKRA 4OOIA 3BY6A 3T1BA 2F5FA 2YX7A 3U9GA 3F8CA 3IL2A 5BPDA 1FP2A 4WXDA 2BV6A 3I59B 3ZN0A 4I0AA 2O0YA 3ISPA 3ZMTA 1GVJA 2VT3A 5D6FA 3OV8A 3TOAA 2NNYA 5BMZA 4FX0A 2YR2A 1FNNA 2A5YB 4CZZA 3WGHA 3FM5A 3GWZA 5AONA 1O3QA 4ON0A 1U3EM 2VBYA 4G6QA 2LF7A 2DU9A 4L18B 4HX4A 1R23A 2ADUA 2QVOA 1D3YA 1D5VA 5D6EA 4LG0A 5JFRA 2MH9A 4BAYA 3D0SA 3JAMZ 2FU4A 3GFLA 3TO7A 4K2EA 4HV6A 1XGSA 4HLXA 4XBFA 1UHWA 2OAZA 2TDXA 1LDJA 4ESBA 2HKXA 2IRFG 1FSEA 2HDCA 2AS5F 4A12A 2PI0A 1EH8A 1GXQA 2A69F 2GQQA 3WTVC 2EA4A 3N4MA 1FYLA 3WE2A 1ZRCA 3HRSA 3MFKA 3GXOA 3MZHA 1XGOA 5FFXA 3C18A 2CW0F 2EFNA 4E70A 5D5UB 1G3YA 2R7DA 3WU1B 4TV7A 5CVUA 1FX7A 1SD4A 3IC7A 2PMUA 3QRFF 4G6DA 3HTSB 2KIUA 2ZO4A 4BHBA 2DAOA 2P7VB 2HOEA 2X4HA 2H6CA 1HW2A 4N9IA 2A3SA 4UNOA 1WQ2A 2OBPA 4A6EA 4RGSA 2HEOA 2EK5A 4P55A 5DCMA 5LEJA 2VT2A 3TO6A 4CICA 3I5UA 5HS8A 1BIBA 2D45A 1EV7A 2FSWA 3WTYC 3O2PE 2M1BA 3I54A 2IA1A 3QU3A 2EV6A 1A04A 3FXRA 3V8LA 1B4AA 1OPCA 1FYKA 2XKOA 2R7FA 4HOBA 5HVQC 4EQQA 2UXNA 1K78B 2LNBA 1E17A 4M71A 2AXLA 3ECOA 4I98B 1DPRA 5FO5A 4KICA 3ZMDA 2FBKA 3ERED 3TO9A 2PN6A 1SD7A 3M8FA 1T39A 2L01A 4LK0F 1YIOA 2O03A 1IXRC 4LFUA 4QLCU 2GXBA 4WXCA 4P9UA 4HX7A 3GLXA 1IN7A 3P7NA 4RB2C 5LHGA 3MZYA 4EJOA 2D1HA 2HFHA 3QPHA 2F5CA 1KU3A 6PAXA 1IN8A 4OIPF 4WX9A 2Z99A 4RB1A 3V7RA 1R1TA 1LEBA 3HHGA 3CO7C 5JI6A 1LDDA 4ENNA 2E7WA 4Y17A 2KKOA 3KLOA 2RV8A 4M73A 4LLNA 1SMYF 2QQAA 5CLSA 2ESNA 4UHTA 4CYDA 1TQMA 5FFZA 1XCVA 1FT9A 1KU9A 3L00A 4DNCA 4EJUA 3L7WA 1KGSA 3M1EA 3GUDA 4AIKA 3BDDA 1PUEE 3HSFA 2BBYA 5F1RA 1K79A 3BJOA 2XAQA 1HW5A 5JR3A 2JT1A 3GEZA 4BNCA 3C7JA 4KFCA 1CF7B 1T0FA 3GF2A 5BPIA 3B02A 2RGVA 2W57A 4LGWA 4AVPA 4IJAA 1BBYA 1ZRFA 1U2WA 4G7ZF 3WGGA 3O6BB 2EFWA 1J75A 2BGCA 1K7AA 3C1DA 2VBWA 2XKPA 3G3ZA 4O5VA 1YFHA 2D2WA 4U0VA 2W84A 2ZCWA 1Q1HA 3VODA 1QZYA 1XMKA 1GXPA 1ZREA 5D8KB 2RNJA 3CJNA 2P5KA 2L3DA 3PQJA 2FE3A 2W24A 1J59A 3I0TA 2WTEA 2QUFA 5EEGA 1IXCA 3KE2A 4BHCA 4A5NA 3F8FA 2HYFA 1MD0A 2OQRA 2OZUA 4M6XA 1RUNA 2EFPA 4WWCA 2Y0MA 1FP1D 3J80Z 2A6EF 1YG2A 5FLXZ 1T2KA 3FMRA 2OU2A 3DV8A 4OIQF 4WK8F 2FXAA 1ZARA 2HKOA 2ZMEA 4KN7X 2P6SA 3ABTA 2VC1A 4JK1X 3KETA 3FZVA 4RS8A 1S3JA 2NYXA 4UUVA 4GXOA 3COAC 4DQ2A 3DFGA 3BZ6A 4WXHA 2LKPA 1BC8C 2RC4A 4ZZDA 4G9YA 5E1XA 3DEUA 4XSZF 1UCRA 5FGMA 4WCGA 5ED4A 1ZHFA 2QLZA 3LA2A 4L9TA 3QPTA 1U5TB 4OIOF 4RAZA 2XROA 3ECHA 5HDNA 4KMFA 1YW9A 3HIFA 1F9NA 2QBYB 2DO7A 3WG9A 3L9FA 4JBAA 3P9CA 1MKMA 4ESFA 5E1ZB 3IKVA 2K27A 4HBLA 1ZLKA 2DQLA 1ZGAA 1SMTA 3N97A 2QM3A 1FC3A 3V8JA 4UV9A 4Q4ZF 3LSTA 5FLXK 4OINF 2K7LA 3KLNA 1L0OC 1BN5A 2GIVA 2XGXA 1RUOA 1G3SA 3K69A 1QQIA 2V6CA 3KFWX 4GO1A 1PP7U 2O3FA 1O3TA 4R8HA 5HLIA 2HYGD 3K1PA 1XB4A 4RGXA 4IHTA 3LA7A 3RI4A 4MTDA 3Q9VA 3FHZA 4MQVA 3CUQA 2OD5A 2P5LC 2JPCA 1WKMA 5K5OA 1K78A 1ZH5A 3KP7A 4AWXB 2K02A 1Y0UA 2G9WA 2FOKA 4OMYA 5ILUA 1FSHA 1IAWA 1B9MA 1O57A 2VONA 2V1UA 3JW4A 3HYIA 5F64A 3L09A 5IT3A 4ENMA 2VBZA 2RQPA 1T38A 5LRRA 1U5TC 5AIQA 1F5TA 2VN2A 1F4KA 3H3ZA 1W5TA 5DUKA 2L4MA 3V4GA 4WF2A 4CDGA 1XSXA 3G73A 2CG4A 3E6CC 3D5LA 2UXXA 4B8XA 4KIGA 2XHKA 3FMSA 5L3FA 4OIRF 4FHTA 5LGTA 4M6YA 2H6BA 2QQBA 3ML6A 1YO5C 2XV4S 1FBQA 4BYYA 4OMZA 2VC0A 1LQ1A 1QO0D 1ZN2A 2ZFWA 2BE5F 2DPDA 1IRFA 3BJAA 1P4WA 2LDUA 2XIGA 3HSRA 2EV0A 1YS7A 1PDNC 1REPC 1R1VA 4RGRA 1MDMA 3EUHA 1I1GA 2DBBA 5LLQA 3R0AA 4LD5A 4BHPA 1O7LA 4PGGA 4UXNA 4UV8A 1J5YA 3RKYA 3JTGA 1QPMA 2Z9OA 3MCZA 1B6AA 2MD5A 2JTVA 1HW1A 3GO5A 2RDPA 3KCCA 1B1BA 2ZNYA 1RNLA 3HRTA 3RJPA 2M45A 4EGYA 4EVIA 2Z33A 2EA2A 2UWMA 2DLLA 4PZJA 3K1MA 2OZ6A 4LLGF 1HBXG 2QQ9A 5DV5A 3VFZA 3BPXA 2IA0A 2KJBA 1SD6A 4Y13A 3KP5A 4UVBA 1DUXC 4ETSA 3ZQ7A 1TW3A 4KIFA 1S29A 1E2XA 2KJCA 4AIHA 5LRSA 4HLYA 2Q2EA 2QBYA 1TBXA 1ON1A 2CGPA 4OU0A 1BI1A 3HTUA 3E5UA 3I53A 2L54A 2P8TA 4EV0A 2MBFA 3F8BA 5F6FA 2IA2A 3E5QA 1ONVA 1YTYA 2J5PA 1D8KA 3MQ0A 2JZYA 5DDGA 2L02A 4MTEA 5DD4A 3BROA 1TLHB 5A2QK 3TGNA 5FB2A 2YX4A 2ZXJA 5L3EA 5LGNA 3KP2A 3LQQA 1W5SA 2G7HA 4XSXF 1IN5A 3REOA 3B73A 2M5WA 5IT9K 3VEPA 5BQTA 3E3VA 2F5DA 2X0LA 2KIFA 3WTZA 3R0JA 4G7OF 5IT9Z 3JAMK 1O3RA 1GHCA 4HV5A 4YIFA 2VOPA 1P4XA 3DPTA 5CVVA 1FBUA 3SHFA 3FX3A 3KP4A 3KP3A 1KQ0A 3QAHA 5TRDA 5E1WA 3C3WA 5K1YA 4YFNF 2P5VA 2PLYA 3MEXA 4U88A 2QZ8A 2CYYA 4HX8A 5ICEA 4AD9A 3E6MA 1HSTA 3DPLC 2MH2A 3QP6A 3SZTA 1H9TA 5LBQA 5CYVA 5L3GA 2CSOA 1SAXA 2P4WA 2MLKA 2XRNA 4O3MA 3V7SA 4N9HA 3IRQA 2ISZA 5E20A 4YIIA 3KZZA 2MA3A 1XGMA 2GZWA 3LFKA 5DYMA 4KNYA 4A0ZA 1B9NA 3WTTC 4M9XA 2HWVA 3TKYA 1SFUA 1CF7A 2UZKA 4HQMA 1SFXA 4N0BA 1R36A 2Y48A 1AWCA 1J2XA 2FA5A 5H6RA 2B0LA 2VBXA 2PBIA 2Q0OA 5J8FA 2WWYA 3DKWA 2NRAC 1Z9CA 1KU7A 3ELKA 1AOYA 1FY7A 4L0YB 3ZPLA 3H3UA 3ZMUA 1RIOH 3HOSA 3WODF 4EM2A 1IZ1A 1B59A 1ULYA 2GA1A 2IPQX 3OOPA 3WTWC 4GCVA 1I6XA 3QOPA 4BXUA 1KU2A 2IVMA 4Q5SF 1Z1DA 4ZYHA 1XMAA 3K9TA 3W6KB 1DPUA 2XUBA 4ZZLA 2ETHA 4QWQA 3WTSC 1ZGJA 5E8GA 2CO5A 1HKSA 1V3FA 2V1DA 2NNNA
chains in the Genus database with same CATH superfamily
1MNEA 4G94A 2MW8A 3VYTB 2A68F 5D4SA 4R79A 1PP8F 4HF2A 1Z7UA 1OR7A 3JRIA 1Z6RA 3ZN1A 4HDVA 3DQVC 3L2CA 3CUOA 1BW5A 1LVKA 4JQFA 3C2BA 3T8TA 3SFZA 4AYBN 1JT0A 2DI3A 5JVTA 1MH3A 4B3XA 3EYIA 3NQOA 4AYBA 4PGHA 1JKOC 2XB0X 3RPUA 4YIRX 2L9NA 5FD6A 3L1PA 1QPIA 1MMGA 1HCRA 2OPTA 2HQAA 2VLAA 4ZYEA 1SVMA 2FEZA 5DUIA 1LFBA 4GYGA 1YYVA 5TJJA 1I1SA 1ZR2A 2VQGA 2XSJC 3CJQB 3HHHA 4A0YA 5E17F 3LAPA 1OYWA 4I01A 4NB5A 4D5CA 4ENJA 4IRHA 2CV0A 3PIOF 3QP5A 2XAHA 4I09A 5LEKA 3ZMZA 1XS9A 1KQ9A 2LF8A 4A69C 3JREA 1LPQA 3TP0A 3V7CA 3HOZJ 1TWGJ 1XN7A 3JSPA 3KX2A 2VKHA 4C3JJ 2V1XA 2G7UA 3S14J 4P1WA 1RZ4A 4I02A 3LSRA 2P7CB 1WJFA 4RAFA 5J4VA 3WTUC 1YRNA 3F6VA 1VQ4I 1ZG1A 1JUMA 4XKCA 1G59A 1U0JA 2TRTA 3GTGJ 3SXYA 3LA3A 4HDUA 3P9IA 2BW3A 2HYJA 1OYYA 2OJED 1I27A 2L5QA 4S04A 2GXGA 1UB9A 1ZRDA 1YRNB 2D5VA 2QKLB 2E1MB 1JUSA 5CVRA 3CCYA 5EEHA 3ZRGA 5AIPA 3OS0A 3RPQA 3BTCA 5KK1A 1KYWA 2EWNA 2F2EA 5J1YA 2DYSH 4XL9A 1LKXA 2EZLA 4MNUA 3F8MA 1XD7A 3CUQB 2MC3A 3FM3A 4Q47A 3HGGA 3HB9A 4ZYDA 1MSEC 1HXDA 1FWZA 4Z2YA 3W6JB 1T6SA 2XASA 3ZOBA 4J01A 1VQOI 1TNSA 4L5JA 3BP8A 3R60A 1OISA 1TQPA 2CQ7A 3LSGA 2ZMEB 2VKDA 2BY3A 4MIMA 1MBGA 3VYUB 1W36D 3CDLA 5ERIA 3OYFA 3BZKA 1R1UA 3BR0A 3CTAA 5CVIA 1IDYA 2K9LA 1Z67A 2HR3A 1ON2A 5LD2C 2M8EA 3ZCOA 1GLNA 2CUJA 1SFKA 3QPSA 3IRRA 1FTZA 3MKWB 1QGPA 1IC8A 4YFXF 3HRUA 5FD5A 1U8RA 2QWWA 3BCAA 1RKWA 4IKFA 1V55H 5HS7A 2HXIA 1VQ9I 1YJWI 3GVAA 4UUSB 2EH3A 4RDUA 1I6HJ 4C2UA 1QA6A 2OA4A 4KUMA 4GYIA 2V79A 3F3XA 2LR8A 2X6YA 4RB3C 2HGCA 5DS9A 1IN4A 5A2QZ 1YI2I 1L3LA 3MWMA 2R7XA 3CF5F 3UKGA 5F04A 4MQ9F 5M5XJ 2V7FA 3FF5A 1Z6TA 2EFQA 3ERMA 3M7GA 1XDUA 4XMYA 5B1BH 2OQGA 1VTNC 4KN4X 3J81K 3OY9A 2LBFA 3LAJA 1HQCA 3DXJF 5HNFA 3S2WA 3HUGA 3ULQB 4C9YA 3JRAA 1UMQA 5C4XJ 4PSWA 1JTYA 1OMIA 1JJ6C 3E5XA 4ZYGA 3BC8A 4M9ZA 4B09A 1IXSB 2JRTA 1RR8C 2JSCA 4A5MA 2YU9J 2XVCA 4ZC3A 4UVAA 2HVQA 2FOWA 3MAJA 2CS3A 1R5GA 2EZIA 2K4JA 3WHBA 3WHCA 2ACJA 1W7PB 4KT5C 4PJMA 2ID6A 2AXTC 2HDDA 3E0JB 1IJWC 3AL0B 5KVRA 1WRJA 4IHSA 3BR3A 2XB5A 3KP6A 4ESJA 3WE3A 2L7FP 3BOQA 1LE8A 4BS9A 1U8BA 1USTA 3RYRA 4KIBA 1YX3A 4RM2A 4HQEA 4N4NB 3B6AA 3I3LA 2X6XA 5KAFC 2BY1A 1C0WA 3K4CA 2CFXA 4XKVA 3O3KA 1E3OC 5KCMA 1N75A 3NAUA 1X58A 3T0YA 3F22A 3BR2A 4U0WA 1G4DA 1XC5A 1XMXA 1ODDA 1TWHJ 2K9NA 1FZPB 2W25A 2CQNA 1HKTA 2IT0A 2K9QA 5CPRB 2ZJRF 1ETQA 4XLAA 5GTIC 3CCMI 2JPBA 2Y75A 3GTPJ 2H1LA 4EJVA 1B72B 2KISA 2PFBA 2KRCA 4A3MJ 1VQKI 1BI3A 1QZZA 4LJZF 4EGZA 2PJRB 1JGSA 5ICCA 1G6NA 4U7DA 2O9LA 3RYPA 3G71I 1VQPI 1IUYA 1GVDA 1TQIA 3ZMSA 1MMSA 1OLTA 3TEDA 2MFZA 4ZDOA 4BBSJ 2FX0A 5DD8A 5D4RA 1YHQI 4NQWA 3I4PA 5E79C 1X19A 5JHFA 1W1WE 1R22A 2L9VA 4DZJA 1RRJA 3GW2A 1APLC 1S7AA 4L5IA 5JHUA 2OCEA 1HDDC 3A01A 1FPQA 4IRIA 4OAYA 3M8EA 5L3CA 3Q9SA 4RGUA 2ME0A 3RQIA 1G2HA 2H09A 3F23A 3KIOA 5HLGA 2HPMA 1MMDA 2DK8A 4F7ZA 2RKHA 2FF4A 4HF0A 3NRVA 2W85A 3EYYA 1ZG5A 2MG4A 3EQLF 4IQJA 2QGUA 2EIMH 3TW7A 1G3WA 2WV0A 2KRFA 2YSRA 1P6RA 3F72A 1TNTA 2RN7A 3A02A 1K6OA 1EA3A 3JTHA 4MGRA 4GFBA 5EGOA 3E6DA 3RPUD 3PQKA 3ESWB 2DYRH 2I10A 2QF7A 2Y30A 2GAUA 3EDPA 3OIOA 4PDKA 3RKXA 3D1NI 3CC2I 2XAFA 1JHHA 3GX4X 4KYWA 1O7FA 1TTYA 3CESA 5HODA 1D5YA 4ASNA 4IXAA 3GTMJ 2HZTA 4BUPA 1VQ7I 3C2GA 2JA8J 2NVQJ 1K4TA 4RM3A 3OYBA 3JSOA 4P96A 3IWFA 1BIAA 1W7PA 2LP0A 1WI3A 5K7HA 3P5JA 2GM4A 3H36A 4I0BA 3I59A 5ICFA 4H0EA 2DA4A 1W4MA 3IV5A 4XN3A 1VFCA 1OR7C 2O8XA 2DFEA 3FWEA 3P9KA 3QYBA 2QEXI 4CO8A 2V6EA 3EPZA 3FXQA 4A3BJ 1RI7A 5ILSA 4Y15A 1DQUA 1WGXA 2K9SA 1U6GA 1Z21A 4B43A 2QSGX 2A5WA 2O6GE 3H92A 1FOKA 2PQ8A 2UUZA 1TW2A 3GTKJ 1LJ9A 2HI3A 2IBDA 2ZC2A 3AAFA 5LHIA 2X6WA 2Y9ZA 4MHGA 1USSA 3RKWA 1YIJI 3ABLH 2M4KA 2CMPA 2P81A 4P5OA 5J1RA 2Y9YA 5CVJA 2PJPA 3K70D 4BH9A 4L9NA 3ZQLA 4CYCA 4PJ0C 1ENHA 3VOEA 1BM9A 2WB1A 2WC2A 1XCBA 4HZFA 5K5RA 1ITYA 3MMYB 2H27A 5FKMA 4DYRA 3R61A 2M8GX 3K1NA 2Z3YA 4II3A 2LK2A 2Z1DA 3GMEA 4B44A 2BXYA 4IQ4A 1R5ID 1X3UA 4NHJA 1SD5A 3FK6A 1S5LC 2DTRA 4O6JA 5HLHA 1SFEA 2ESHA 4X6AJ 4I76A 3LQRA 2H8WA 1HLVA 4NC8A 1ETXA 5BNGA 4I7HA 5ICGA 2VODA 3CLOA 1IV8A 3I9V2 2DODA 1LNWA 4L9VA 4D9JA 5K5QA 4M3BA 1WJDA 3SEQA 1R5HA 3PSIA 2EJRA 5L3DA 4V19K 3I55I 2DMPA 2K86A 2LY1A 4F92B 2R5ZA 4R1HA 3O8HA 1MDMB 1UHMA 4CHUA 1QBJA 5DEQA 2QYOA 5LGUA 1B8IA 3R6SA 2GWRA 3DLLF 3W2AA 1IG7A 5FLVA 5J6XA 1DGRM 4G12A 1XGNA 3DU6A 4YFKF 2LTPA 3K10A 3J81Z 1WSUA 2DT5A 4Q48A 3OYGA 2AO9A 1CGPA 4PJJA 1OQYA 1JJ8C 3GZNB 3M07A 5EG0B 4XR6A 2EV5A 1P2FA 5IPAA 2JA6J 4AM3A 4D0PA 1FBSA 2HPIA 5HDGA 2R7TA 4CXFA 5BS6A 5IYDJ 3H35A 2KIQA 2FQ3A 1MJ9A 2Z2SB 1QVUA 3CCVI 4ANJA 1WWXA 3JRBA 1WPKA 3CO6C 2XF6A 4HAMA 4YG2F 2A07F 3UNGC 2IJLA 2OC6A 4UUSA 2CQXA 3I4MJ 2KFDA 1UFMA 2KHMA 2ZKZA 3HJEA 3DCFA 3ZGKA 2WV1A 4KDPA 4F91B 3R4KA 1IW7F 1IGNA 4BU2A 1X1CA 4XNFA 2DA3A 2IGNA 2LMDA 3FK7A 1Z0XA 1JHFA 5DCFA 3K2ZA 1YLFA 3E6BA 1XTAA 3BZCA 2WY8Q 2XAJA 2Z5UA 3A03A 1LB2A 2FMLA 2LY9A 4S05A 3LWFA 4XLPF 1SFOJ 2QA4I 3SQNA 2KZGA 4M74A 2E7XA 1QNTA 3TOBA 2NVUB 1DDNA 1NTCA 1I5ZA 1W0UA 4IL6C 3Q5FA 2H94A 1ZG3A 4HSRA 1JE8A 2FBIA 4XICA 3PO2J 2RVCA 4HA8A 5J8CA 2JVHA 3K4MA 3OS1A 1PJRA 3F8NA 4LG0B 4LB5A 3J7AY 1WH5A 3PO3J 5FKOA 3PFIA 3VPRA 1R58A 2M9HA 3FDYA 2BHZA 5HLTA 4QTRA 5L3BA 2A61A 3GFIA 4KT6A 3DBRB 2CUZA 3EUHC 2XF7A 4HW0A 3CC7I 2AQFA 3K6GA 1MZBA 2MD0A 5DCMB 3M3YJ 4V2FA 1YS6A 4MEXF 2XRLA 4EMSA 3IH4A 4G8XA 1HSJA 2BYVE 2FNAA 5CJ9A 1FLIA 2DFFA 3CMYA 4DBRA 1J0RA 5IOYA 1BR4A 5D5VB 4CGZA 1GUUA 1NH3A 2PG4A 3KZYA 4UVCA 2DFIA 4KMUX 2A6HF 4IPAA 2NOGA 5JVGF 3S1MJ 2GIZA 1X1DA 4BXXJ 1LVAA 5HOOA 3S2HJ 3BPVA 4BQQA 5H20A 3OL3A 3TL4X 5J47A 1IRGA 3F6OA 2CU7A 4RA2A 2ELHA 3HEFA 2BW3B 2PX9A 1IV6A 1OYIA 2ZXIA 3HOYJ 3SZPA 3HM5A 3KEQA 1BC7C 3CLQA 1R49A 2E1CA 3ABKH 2RQQA 2ZJ2A 5GAEJ 3I71A 2KZVA 3DKYA 2CWEA 2EFOA 1D1AA 1FIAA 3IKTA 2DQRA 2IP2A 2P6TA 3GZ6A 1Y6IA 2COMA 2J5OA 4D1QA 3D5SC 3GTOJ 2MYSA 2ZNZA 2PEXA 1XDSA 3ZQGA 3ZXSA 1S7OA 3UR3C 2IGOA 5D5XB 4A6DA 1OCZH 1MJBA 1BOAA 3PUFA 4EJTA 3I4NJ 1PYVA 1H9GA 5IP6A 2BEOA 3FXUA 3KEOA 1U78A 3E97A 4RBOA 2VE9A 2HTJA 4IRGA 3H9JA 3BLYA 1FYMA 1Z3XA 3V8KA 1UELB 5LHHA 1U9NA 2EBIA 4IF4A 2XAGA 3S17J 3J7AO 3NARA 1WI9A 3IHUA 1LDKB 1FMVA 3Q3SA 4HYEA 3DF8A 3HKZA 1R9TJ 1NHAA 2HTSA 2Z16A 3PJRA 1BA5A 1KQ8A 2M7AA 4IHWA 4EM1A 3CMEI 2ELJA 2E1OA 5B1AH 2HQNA 3DBLB 4B47A 1P4AA 1XSVA 2M30A 4CH7A 2ZBKA 3OIPA 1T95A 4LK1F 3HRMA 2KT0A 4BKXA 1X2MA 2E2JJ 1YQAA 1STZA 4GGGA 4EJWA 2FNPA 2IW5A 2LSOA 2ISYA 1VQNI 5B5EC 2VUMJ 3ASNH 2I5UA 2W82A 2QSFX 2QSHX 3D5RC 5D8LB 1Z05A 4LMYA 4E7ZA 1UG0A 3VSKA 1BI0A 5HDKA 1YOVB 3T8RA 1KA8A 2E1NA 5E18F 4IHXA 2MC4A 2STTA 3VB2A 1ZLJA 3JRDA 1TZLA 2M87A 1W7PD 2XPUA 4CA0A 1XPXA 5EEAA 3GLLA 4KISA 3H9GA 2CW8A 5K7FA 1V4RA 4IHVA 4A0XA 1S6LA 1TP4A 3J7YJ 1LEAA 1ZAOA 4MEYF 4RB0A 1MIJA 2AHQA 5H6QA 2L4AA 3ABUA 3FXLA 4FASD 3G6EI 2STWA 3GYHX 3OYAA 4RAYA 4FX4A 2K4BA 1MMNA 1LFPA 3OYKA 3K70C 1H8AC 4U7BA 1ZYRF 3S1RJ 1JKPC 2GA2A 2IGMA 1BJZA 5E8IA 1ZQ3P 3J80K 4HF1A 3BCBA 1T98A 3LSMA 5FKNA 5HS9A 3A4CA 4II2A 1R7JA 1PUFB 2R3SA 5E3NA 3GTLJ 1ETWA 1KYZA 2MLGA 2YPRA 4M9SA 2F5EA 4AIJA 3U2RA 1J7KA 1NG6A 4AIDA 2DK5A 2DCEA 2HQRA 1IN6A 2DW4A 4G7HF 5EZGA 4A3LJ 4XRSA 3F21A 3U1DA 4BY7J 1WJBA 3S3MA 3NEUA 4QPQA 4D5FA 2QENA 1EH7A 1J9IA 3TDUC 2Y31A 3FMQA 2R0QC 4XRFA 3W2WA 3K4BA 1XSDA 2DT6A 3EETA 2P0WA 4BDZA 1ETVA 2FBHA 3HOTA 3BJ6A 2O61A 4F93B 5E3OA 3GZ5A 3HSEA 3M9AA 4KA4A 4A3KJ 2EZHA 2BHYA 2LLKA 1S9HA 1ETYA 2GLOA 3A0BC 4LLLA 5BOXA 3GFMA 2BY2A 2PMZA 1YW7A 3AL0C 1WHUA 1H0MA 2M34A 2V4JC 2DA6A 4FT8A 4OAZA 1MBJA 2DTZA 1VQLI 3K0LA 5LFAA 4GRIA 4A3EJ 4E6KG 1P92A 3WGIA 1IF1A 1OCRH 3WU0A 4BL0B 2KDOA 4IVNA 1F1ZA 2V9KA 4ZH4F 3T5XA 3IH2A 2IAIA 1ZGWA 3BWGA 3PSFA 3IWZA 1A36A 3HOUJ 5M3MJ 3ZP5A 3RDIA 3BQYA 3I64A 2VOOA 9ANTA 4EEFG 2M4GA 1HDPA 1H88C 2CQKA 1O3SA 2HVRA 2C6YA 2JA5J 3TDZC 3PNVA 1AU7A 2R7QA 3TQNA 3RIRA 4J19A 1AA7A 1BI2A 5EGOB 1N77A 1GT0C 2VE8A 1TT5B 2PMHA 5CQGA 1U5TA 1R00A 4P9FA 3CP2A 2BZTA 3OL4A 2Q8KA 2CFOA 4A2UA 2NS0A 2YU3A 4DIQA 5DM7F 2JA7J 3DP7A 2VXDA 4BQNA 2FRHA 2UV1A 4U0YA 1YW8A 1JXSA 2V9VA 4I2OA 1Z91A 4PCQA 1OJLA 3A1YA 4IX7A 1DP7P 2VXZA 3L2QA 2FMYA 4IZZA 5IY5H 3ROUA 4FCYA 1QVTA 2V1NA 4XONA 4A3GJ 1BJAA 3QU6A 4HNVA 2K3PA 2E2HJ 2KIMA 2HS5A 3I58A 2EQRA 2DPUA 4L0ZB 3LSPA 2NS8A 2XDVA 1S8NA 3CDHA 4EM0B 2CUFA 4HNTA 4XLNF 1SVLA 4ENKA 1RESA 4LB6B 3TP3A 2ECBA 2R5YB 2E36A 2NAZA 5FKLA 4A3JJ 1G3TA 2B63J 1MGTA 1NG7A 1Z3YA 3RTRA 4F3QA 4BXFA 3WTXC 1EH6A 3CUQC 4ZTFA 2EB7A 1HKQA 1S72I 1V5FA 4B48A 3QYEA 1ERDA 2VPLA 1MJAA 2F5VA 2X48A 1J09A 3GFJA 5ILVA 4Y33A 1BL0A 4M72A 4BQAA 1D8JA 5D5WB 3ZMVA 4L9JA 3HOWJ 2D1VA 1OKRA 4OOIA 1RR7A 3BY6A 3T1BA 1QZEA 4E7HA 4MLOA 2F5FA 2YX7A 3U9GA 1WFXA 4D7NA 4BY1J 3F8CA 1JTXA 3TW6A 5IYCJ 1FP2A 3IL2A 4WXDA 5BPDA 2BV6A 3V42A 3I59B 2E2IJ 3ZN0A 2W48A 2O0YA 4I0AA 1WJ5A 3ISPA 3ZMTA 1IRZA 3IUOA 1UAAA 1GVJA 2VT3A 5D6FA 4DOZA 2R7WA 3HL2A 3H3VK 3OV8A 3TOAA 3J7ZI 2NNYA 4Y7NJ 2PJRA 5B3SH 5BMZA 2NVTJ 4FX0A 2K3FA 3FIWA 2CV1A 3FKJA 3BG5A 1POGA 2LD5A 2VL8A 4XIDA 4PFOA 2YR2A 1Y39A 3GTQJ 1FNNA 2A5YB 2XC7A 4CZZA 3WGHA 3FM5A 2NS7A 4HRIA 3GWZA 5AONA 2EILH 2MGQA 2OCCH 4ZDPA 1O3QA 4ON0A 1U3EM 2VBYA 2MABA 4W1UA 1JT6A 4G6QA 5C44J 2EIKH 2LF7A 1F43A 2GOMA 4BEHA 2DU9A 2ZJPF 2IXSA 4IOCF 4L18B 4HX4A 4ABZA 1R23A 1GV5A 1X4PA 4A3DJ 2ADUA 2QVOA 1D3YA 1D5VA 4N4OB 5D6EA 4LG0A 5JFRA 2E1MC 2MH9A 4BAYA 3D0SA 3S3OA 2JK3A 3JAMZ 5C4JJ 2FU4A 3GFLA 4RLQA 1QU3A 3FXJA 3TO7A 4K2EA 4HV6A 1BR1A 3ZQQA 1CQTA 2W00A 1XGSA 5C3EJ 2IS6A 4HLXA 4XBFA 1UHWA 2OAZA 2JVGA 2TDXA 1LDJA 4YELA 4ESBA 2HKXA 3M8JA 1MNMC 5J40A 1E3HA 4BJ6C 2IRFG 1FSEA 4ZDLA 4RMNA 1R4MB 4XK4A 1OCTC 3K7AJ 2HDCA 3B6CA 1JKRC 2AS5F 2IS4A 3BG7A 4A12A 3Q0WA 5GTHC 2PI0A 1EH8A 5M3FJ 2ZXHA 1QRYA 4IEJA 2ME6A 1GXQA 2A69F 2GQQA 3CDIA 2HDWA 1X1BA 3WTVC 4BJ5C 2EA4A 3N4MA 3CC4I 4FISA 2XSDC 3WE2A 1T56A 3CMAI 1FYLA 1ZRCA 3HRSA 3MFKA 5DTDA 2M7BA 3GXOA 5GADJ 3MZHA 1XGOA 5FFXA 3C18A 2R7ZJ 1W0TA 4DYCA 2CW0F 2WB1N 5KHDA 2EFNA 3OYIA 4E70A 5D5UB 1GDTA 1F36A 1G3YA 2R7DA 3SDGA 3WU1B 3H5NA 1D1BA 4TV7A 3BR5A 1FX7A 1SD4A 3PL8A 3IC7A 5CVUA 5JLWA 3JR9A 3I56I 3EUKL 1UG2A 2PMUA 5KAIC 4UUTA 5J3LA 1T08B 5IOZA 3QRFF 3A2KA 1DU0A 2HXOA 4G6DA 3CCJI 3HTSB 2KIUA 2ZO4A 4BHBA 1HOMA 4L5EA 4BDYA 2DAOA 2P7VB 2R5ZB 1KONA 4M3DA 2HOEA 2ZXWH 5CKTA 2X4HA 2H6CA 3OIQA 1HW2A 4N9IA 2DA1A 2DJNA 3F0CA 2A3SA 2DOFA 3M1CA 4UNOA 2IS2A 1WQ2A 3QPLA 3L2VA 2OBPA 3CP8A 4A6EA 4RGSA 2HEOA 2EK5A 2IS1A 5HNHA 2OF7A 4M6VA 4P55A 5DCMA 2GXAA 5LEJA 3LSIA 3KEYA 3SDBA 4CCKA 1TL8A 2VT2A 3TO6A 4CICA 4XQFA 3I5UA 5HS8A 1BIBA 2HOSA 3OYJA 2D45A 4HG2A 1I3AA 3DTKA 5B66C 1EV7A 2KDZA 2FSWA 3WTYC 1HF0A 3O2PE 2F6CA 1W5CC 2M1BA 3I54A 2IA1A 3LMMA 5EZHA 3QU3A 2EV6A 1A04A 1EKEA 3BTJA 3FKIJ 1IRXA 3FXRA 3V8LA 2L7KA 1B4AA 1OPCA 2LKXA 1FYKA 5EYRA 3S3NA 2XKOA 2R7FA 4HOBA 1WCMJ 1V5GA 5HVQC 3BR6A 5F1JA 4EQQA 3MVPA 1G8XA 2UXNA 1R6RA 1K78B 2LNBA 1E17A 2K9MA 4M71A 2KP6A 2BVLA 2AXLA 3ECOA 3QWLA 1U9OA 1T8IA 2DOAA 4I98B 1DPRA 1X1PA 5FO5A 2OTLI 4NBQA 4KICA 3ZMDA 4YEJA 3HG9A 1X2NA 2FBKA 2DN0A 1FOYA 3ERED 3TO9A 1VNDA 4BJTA 2PN6A 4A3CJ 1T33A 1SD7A 3M8FA 1OCPA 2L01A 4QPOA 4D7MA 5DM6F 1T39A 4LK0F 1YIOA 2O03A 1IXRC 2LY2A 4LFUA 4QLCU 2NXNB 2L7ZA 3RZOJ 3W6VA 2GXBA 4WXCA 3FXOA 4P9UA 2H1KA 4HX7A 3GLXA 2YS9A 1IN7A 3P7NA 1IUFA 2KPMA 4U87A 4E7IA 4RB2C 4QSHA 4IO9F 3K4NA 5LHGA 3MZYA 4EJOA 4BEHB 3H1CA 2D1HA 2HFHA 3QPHA 2F5CA 1KU3A 6PAXA 3LL7A 1IN8A 2LKSA 1N78A 4OIPF 4WX9A 3HOXJ 2BOLA 1A6IA 2WY7Q 3A0HC 1YITI 2Z99A 1WJAA 4RB1A 3V7RA 3AKZA 4A93J 3H0DA 3G2BA 1QHGA 1TWFJ 1R1TA 4A3FJ 3PNTA 2EIJH 1LEBA 2E19A 3HHGA 2MSYA 3CO7C 4HEA2 2OUMA 3G1MA 5JI6A 1LDDA 2B9SA 4ENNA 1S7EA 2E7WA 3IH3A 3FXKA 1DGWY 2XPWA 4Y17A 2ZSHB 2KKOA 3KLOA 2RV8A 4M73A 4LLNA 3PFYA 1SMYF 2QQAA 5CLSA 1AKHB 4B4CA 2ESNA 4NC7A 3OR1C 4UHTA 4CYDA 2VJJA 4XLHA 1I50J 3VSLA 3JRHA 3HPGA 3RQ4A 1TQMA 4DZPA 5FFZA 1XCVA 2PMZN 3OYMA 1FT9A 4G6TB 1KU9A 3CCQI 3L00A 4AUXA 4DNCA 4EJUA 3L7WA 2R92J 2O5RA 1KGSA 3M1EA 1TWAJ 3GUDA 4AIKA 3BDDA 5F0CA 1PUEE 3HSFA 2B7EA 2BBYA 1JGGA 5F1RA 1OCCH 3RCOA 1K79A 2K40A 3BJOA 2XAQA 1HW5A 5JR3A 2JT1A 3DBHB 2ID3A 3GEZA 4BNCA 1VQ6I 3C7JA 4KFCA 1CF7B 3ZQHA 3OR2C 1P7JA 1T0FA 2VJ4A 3GF2A 2ZJQF 5BPIA 3B02A 1AKHA 3HXLA 4BE0A 1ZELA 2HOTA 2RGVA 2E5ZA 1KZHA 2W57A 3RSNA 4KITB 3BQZA 4LGWA 4AVPA 4IJAA 5GPAA 3SYTA 3VWBA 1BBYA 1ZRFA 1U2WA 3AG4H 3OSFA 4J00A 4Y4RA 4G7ZF 3WGGA 1V5EA 1X3ZB 1MBEA 3O6BB 2K5CA 2EFWA 4CUGA 1J75A 2BGCA 1K7AA 2DMTA 5K7ZA 3C1DA 4XOPA 2FQ4A 1B8IB 3HKZN 2VBWA 2XKPA 2H8RA 2JUGA 3QQAA 2R5YA 3G3ZA 4O5VA 4XM3A 1YFHA 1BW6A 2D2WA 3VDXA 2Y0SA 2JQ7A 4U0VA 2W84A 2ZCWA 1M1EB 1Q1HA 3VODA 3LSKA 2BXZA 2M2EA 1QZYA 1XMKA 1GXPA 3PM1A 4V2GA 3OYEA 1ZREA 5D8KB 2RNJA 3CJNA 3TBIA 5GAHJ 2P5KA 5GP9A 2L3DA 3PQJA 2FE3A 2W24A 1O4XA 1J59A 3I0TA 3TMOA 5FLMJ 2WTEA 2QUFA 3EUAA 2DJIA 5EEGA 4X1EA 4S0HB 4C2TA 1IXCA 1FJLA 2VIXA 3KE2A 2KLOA 2OV7A 3FHNA 4BHCA 4DW6A 4A5NA 3F8FA 1UZCA 2HYFA 4JX6A 2NOJB 1I3QJ 1MD0A 2E71A 3S16J 2OQRA 2OZUA 4M6XA 2X1DA 2EFPA 4WWCA 1RUNA 1LE8B 2Y0MA 1FP1D 4ITVA 2A6EF 3J80Z 1DU6A 3CZ6A 3CCUI 1SC7A 1W36C 1YG2A 2Q1ZB 1EF4A 2KQRA 4IHYA 5FLXZ 1T2KA 1GV2A 3FMRA 2OU2A 3BTLA 3DV8A 3H9QA 4OIQF 4WK8F 3L2RA 4HSTA 1YX5A 2FXAA 1ZARA 2HKOA 2ZMEA 4KN7X 2X51A 2P6SA 3ABTA 2VC1A 4JK1X 3KETA 1A5JA 3FZVA 4RS8A 3OOUA 5FROA 1S3JA 5F0HA 2NYXA 2XAUA 4UUVA 4FETA 4NNJA 1JUPA 4GXOA 4NDLA 2YUSA 1MW7A 3COAC 4DQ2A 1OFCX 2F4OB 2LBFB 3DFGA 5GPCA 1Z7LA 4CCNA 2GOXB 3BZ6A 4WXHA 1H89C 2WAQN 2JMWA 2O7OA 2LKPA 5FRNA 4F52A 1BC8C 2RC4A 4C3HJ 3K4KA 3SFIA 4ZZDA 3DWLE 4G9YA 5E1XA 2WBMA 3DEUA 4RLFA 4XSZF 1UCRA 1Y1VJ 2RNGA 2LC2A 5EF6A 5FGMA 4WCGA 4ZTJA 2X9DA 4MO7A 1VI0A 2BVMA 5E3MA 5ED4A 1ZHFA 4EATA 2QLZA 3DPUA 3LA2A 2M0CA 3S32A 4L9TA 2R93J 3QPTA 2JUCA 1U5TB 3Q0UA 4OIOF 4RAZA 2XROA 2XGEA 3W2VA 3ECHA 5HDNA 1R4NB 1MBHA 4KMFA 1K6YA 4XORA 2LYCA 1YW9A 3HIFA 1F9NA 2QBYB 1SAUA 2DXIA 4ZYAA 2DO7A 3WG9A 3L9FA 3BG3A 3W3CA 2VJ5A 2LH9A 3MN2A 4JBAA 3SEZA 3A01B 3P9CA 3CQZJ 1MKMA 4PJLA 4ESFA 2CW7A 5E1ZB 4CCLA 4XOTA 3IKVA 2K27A 4HBLA 4M3GA 1ZLKA 2DQLA 4FTHA 1IDZA 2X85A 1ZGAA 1SMTA 3C2HA 2DDAA 3N97A 2QM3A 1FC3A 3V8JA 1ZKGA 4BE2A 1JKQC 4OWRB 4UV9A 3E1SA 4Q4ZF 3LSTA 5FLXK 2RREA 5FRMA 4OINF 3CJRB 1JI8A 2K7LA 3OYHA 4IOAF 3KLNA 5E3LA 4XKWA 1L0OC 1BN5A 2GIVA 2XGXA 3AG3H 1RUOA 3AG1H 4GDFA 2F4IA 1SANA 1G3SA 3K69A 3OYDA 1QQIA 1P9QC 4XRSG 2ICWG 1A31A 1RETA 1DP3A 4LOCA 2JA2A 2V6CA 3F9KA 4KJZA 4JOMA 4XKBA 2E34A 2VQLA 3BTIA 3KFWX 4JX4A 4GO1A 4BACA 2O3FA 1PP7U 1O3TA 2L0KA 4R8HA 3JCUC 2KMUA 5HLIA 2HYGD 1OCOH 3K1PA 1XB4A 4RGXA 4XLCA 4IHTA 3ASOH 3LA7A 3RI4A 4MTDA 3Q9VA 4AC0A 4C2MJ 3N05A 3FHZA 4MQVA 3CUQA 2LREA 2E60A 1HC8A 2OD5A 1R71A 2BY0A 3FBNB 2P5LC 3L2UA 2Y69H 3IAS2 3HBLA 2JPCA 1WKMA 4LIVA 3BT9A 2JJ7A 5K5OA 3S8PA 1K78A 2LRDA 1QHHD 4NC6A 1WVRA 1ZH5A 3KP7A 4AWXB 2K02A 1Y0UA 2ELKA 2G9WA 2FOKA 5FJ8J 3OYCA 4OMYA 2AQEA 3S1NJ 4E7JA 2L2OA 3DTIA 3AG2H 3AFHA 2VJIA 3MZ8A 1E0EA 5ILUA 2QCOA 3RKQA 1FSHA 1IAWA 2CV2A 1B9MA 1O57A 2VONA 2WAEA 2V1UA 3JW4A 3HYIA 2XPVA 5F64A 3L09A 5IYBJ 4MFDA 2ZFUA 4XLFA 5IT3A 1ETOA 3HC7A 4ENMA 4CCMA 2VI6A 2HNHA 3H5RA 2VBZA 2RQPA 4E7KA 1A35A 1T38A 4M3FA 4LITA 5LRRA 1U5TC 1K4SA 5AIQA 2CUEA 1F5TA 2VN2A 2O8KA 2HQ5A 2FUG2 1F4KA 3H3ZA 1HA8A 1X1AA 1W5TA 5DUKA 2IGKA 2L4MA 1ZR4A 2X1CA 3V4GA 1PVEA 4WF2A 1RC9A 4FE7A 4CDGA 1XSXA 3G73A 2R7SA 2CG4A 3CCLI 1VF9A 2DDBA 3E6CC 5IP7J 4M3EA 3D5LA 5EG0A 2UXXA 4B8XA 1K61A 4XLEA 2VPRA 1ACIA 4KIGA 2XHKA 4HNUA 3FMSA 4RAGA 5L3FA 4JYKA 4OIRF 2TCTA 4FHTA 5LGTA 1XX5A 2H6BA 2QQBA 4M6YA 3ML6A 4E7LA 4W97A 1YO5C 2A6TA 5J1UA 2OTJI 3BG9A 2XV4S 5EJCA 1FBQA 1UHSA 4BBRJ 4BYYA 1P7IA 4OMZA 1EJ9A 1D0ZA 2VC0A 1D1CA 3WG7H 2WADA 1LQ1A 2R7RA 1QO0D 3G1LA 1X4OA 3WU2C 1WH7A 1ZN2A 2ZFWA 1ETKA 2BE5F 1MNDA 2WA0A 4JX5A 2DPDA 4B1RA 3KYDB 3JRGA 1IRFA 3BJAA 1P4WA 5M5WJ 2LDUA 2XIGA 3HSRA 2EV0A 3U1KA 1YS7A 1PDNC 1REPC 1D0XA 1R1VA 2W4SA 4RGRA 1MDMA 3GBGA 1N25A 3EUHA 3FISA 1I1GA 2DBBA 3ZQIA 4PSXA 3S93A 5LLQA 2F4MB 3LSJA 3R0AA 4LD5A 1O7LA 4BHPA 3MKZA 1FMWA 4PGGA 4PJNA 3IP4B 1J5YA 4UV8A 4UXNA 3RKYA 4Y3OA 1QPMA 3JTGA 2W7NA 4AVZA 2Z9OA 3MCZA 2A05A 5J4YA 1B6AA 2CRGA 2MD5A 2JN6A 1LFUP 3DKXA 4CZCA 4UB6C 2JTVA 4XN0A 1HW1A 1TT0A 3GO5A 2RDPA 3KCCA 4CSWA 2DMNA 5FKKA 1B1BA 2ZNYA 3SJMA 1YJ9I 3PUBA 1RNLA 3QODA 5IP9J 3HRTA 3RJPA 3S1QJ 1BOBA 2CH0A 2M45A 4EGYA 1VQMI 4EVIA 1NK3P 3ZR8X 3KYCB 3MKYB 2Z33A 2W1OA 3OWTA 3JRFA 2EA2A 2JWTA 1MBFA 3DU5A 1ZK8A 5EDNA 2UWMA 1Y56A 2DMUA 2DLLA 4PZJA 3H0GJ 3K1MA 4X0GA 3FXMA 2OZ6A 4LLGF 1HBXG 3CD6I 3CMMA 5CQEA 2QQ9A 5DV5A 3VFZA 3BPXA 2ZSIB 2IA0A 2KJBA 1SD6A 4Y13A 2E5NA 3KP5A 2VASA 2X1EA 4UVBA 3IAM2 1DUXC 3CCRI 4ETSA 5H2FC 3OS2A 5TGTA 2DA7A 2NVXJ 3ZQFA 1SVOA 3ZQ7A 1TW3A 3K2AA 4KIFA 3K4JA 1S29A 3G1OA 3U21A 2DOEA 1IO2A 2VB6A 2DT7B 1E2XA 2KJCA 4AIHA 5LRSA 1ORKA 2Q2EA 5F08A 4HLYA 1FIPA 3QYFA 1WZ2A 2QBYA 4NUBA 1TBXA 1ON1A 1K83J 2CGPA 4OU0A 1BI1A 3HTUA 3E5UA 4PK4A 3QOEA 1I39A 3I53A 3ONQA 1TWCJ 2HU9A 2G0EA 1FOXA 2L54A 2P8TA 2VKEA 2WAFA 4EV0A 2FD5A 2L9SA 2MBFA 4C3IJ 3F8BA 5F6FA 3CCSI 2IA2A 4I99C 1Q1VA 3E5QA 2RAEA 1ONVA 4HPQA 2M3AA 3E7LA 1Y1WJ 1YTYA 1MSFC 3ZQCA 3H5AA 3DEWA 1VQ5I 2J5PA 5F0FA 1D8KA 3G4SI 1FOWA 1A6QA 3MQ0A 1YJNI 2JZYA 5DDGA 2L02A 3HUGB 3HPHA 4MTEA 4DGWB 5DD4A 2JRMA 3BROA 1TLHB 5FB2A 3TGNA 5A2QK 3HGYA 1UJ8A 2R4GA 2VQCA 2YX4A 2ZXJA 5L3EA 5LGNA 3KP2A 3LFUA 3LQQA 1W5SA 2G7HA 1MH4A 1NK2P 2R7VA 3PNYA 4XSXF 1D0YA 1IN5A 4AU7A 3REOA 3JRCA 3OYLA 3PIPF 3B73A 2M5WA 3CF2A 5IT9K 4CYCB 4LIUA 1VQ8I 3BR1A 3VEPA 5BQTA 1YE9A 3E3VA 4BE1A 1MMAA 3DTEA 1PUFA 2F5DA 4UB8C 2X0LA 4UY8I 1LUJB 1FEXA 2KIFA 3NWSA 2F48A 3NWTA 3WTZA 3R0JA 4G7OF 1E3PA 4CCOA 5IT9Z 3JAMK 4JP0A 1O3RA 1GHCA 2VKVA 5TISC 4HV5A 3X2QH 4YIFA 2VOPA 1P4XA 1WJEA 3DPTA 1VZ0A 5CVVA 2DA2A 1FBUA 3SHFA 3FX3A 3KZIC 4FE4A 3KP4A 1SEUA 2X6OA 3KP3A 1T0FC 1KQ0A 4CCJA 2GBYA 1RKTA 2Q2EB 3QAHA 5TRDA 5E1WA 4E7SA 3C3WA 2FJ1A 4I6ZA 2I8DA 5K1YA 2R7OA 4YFNF 1Z77A 2P5VA 3VYRB 2PLYA 2DA5A 3MEXA 4U88A 2QZ8A 3DEEA 3CJTB 3FBIB 4DJAA 4QIWN 2CYYA 2EINH 2QKMB 2M0MA 4HX8A 3KPHA 5ICEA 3MKLA 4AD9A 3E6MA 1ZTRA 2N8GA 1HSTA 3DPLC 2HZDA 2MH2A 3QP6A 3SZTA 1H9TA 2NVYJ 5LBQA 3LNQA 4A3IJ 1AHDP 5CYVA 3S2DJ 4ZJZA 5L3GA 4Y52J 2CSOA 4MFEA 3RZDJ 1SAXA 2HOAA 2MLKA 2P4WA 1BR2A 2COBA 3CCEI 3OMYA 1X3WB 2XRNA 5KNLA 4O3MA 3DLAA 3V7SA 4N9HA 4PFPA 3OSGA 3IRQA 2ISZA 4NQWB 2XF5A 3LSHA 2IEKA 5E20A 3SZGA 4LG3A 2K85A 3KZZA 2MA3A 1XGMA 2V9PA 4YIIA 4Z6YA 2GZWA 3LFKA 5DYMA 2XGDA 4KNYA 1Y8RB 4A0ZA 3MD2A 1B9NA 2XGCA 3WTTC 1XG1A 4M9XA 2QQ8A 2HWVA 1B72A 3M4OJ 3S15J 2WAQA 4B3AA 2ZMEC 3TKYA 1SFUA 1CF7A 3GCMA 2UZKA 2LVSA 2Y2ZA 4HQMA 5M5YJ 1SFXA 2Y0SN 2CJJA 3Q0VA 4N0BA 1R36A 3HOVJ 2EPFA 2Y48A 4XRMA 2LOOA 2V26A 4BGDA 1AWCA 1MBKA 1J2XA 2FA5A 2KL4A 5H6RA 2B0LA 1Y0NA 2L7MP 4H4KC 2VBXA 3BG6A 2PBIA 2KRHA 1RPWA 2Q0OA 5J8FA 2WWYA 3DKWA 3L2WA 1TC3C 2NRAC 1Z9CA 3HDDA 1KU7A 2DFHA 3ELKA 1AOYA 1FY7A 4YRVA 4L0YB 3ZPLA 2HVSA 2LG4A 3H3UA 3ZMUA 2DMQA 1RIOH 2R7UA 2E35A 1FTTA 3HOSA 3WODF 4EM2A 1IZ1A 1B59A 5F27A 4F55A 1ULYA 2GA1A 2IPQX 4DYQA 3OOPA 3WTWC 4GCVA 5GAGJ 4DBQA 1I6XA 1V54H 1Y8QB 3QOPA 2ZB9A 3KYLA 4BXUA 1KU2A 5JLXA 2IVMA 2JSPA 4Q5SF 1Z1DA 2CQQA 2L9RA 4ZYHA 3ABMH 1XMAA 2VQHA 3OYNA 2ECCA 3K9TA 4E4HA 4C30A 3W6KB 1DPUA 3O8GA 2XUBA 3K4LA 4ZZLA 3VYSB 2ETHA 4QWQA 3WTSC 1ZGJA 2EZKA 2LFBA 4FQGA 3LOCA 3GTJJ 3HZJA 2CO5A 5E8GA 1HKSA 1V3FA 1WJCA 2V1DA 2NNNA 4PUSA 4BQOA
chains in the Genus database with same CATH topology
4G94A 2A68F 5D4SA 4R79A 1PP8F 4HF2A 1Z7UA 1OR7A 1Z6RA 3ZN1A 4HDVA 3DQVC 3L2CA 3CUOA 3T8TA 4JQFA 3SFZA 2DI3A 5JVTA 3EYIA 3NQOA 4PGHA 3RPUA 5FD6A 4ZYEA 2FEZA 5DUIA 4GYGA 1YYVA 5TJJA 1I1SA 3HHHA 4A0YA 5E17F 3LAPA 1OYWA 4I01A 4NB5A 4ENJA 4IRHA 3QP5A 2XAHA 4I09A 5LEKA 3ZMZA 1KQ9A 2LF8A 3V7CA 1XN7A 3JSPA 2V1XA 2G7UA 1RZ4A 4I02A 2P7CB 3WTUC 3F6VA 1ZG1A 3SXYA 3LA3A 4HDUA 3P9IA 1OYYA 1I27A 4S04A 1ZRDA 2GXGA 1UB9A 5CVRA 5EEHA 5AIPA 3RPQA 5KK1A 1KYWA 2EWNA 2F2EA 4MNUA 3F8MA 1XD7A 3CUQB 2MC3A 3FM3A 4Q47A 4ZYDA 1HXDA 1FWZA 3W6JB 4Z2YA 1T6SA 2XASA 1TNSA 4L5JA 3BP8A 3R60A 1TQPA 2ZMEB 5ERIA 1R1UA 3CTAA 5CVIA 2HR3A 1ON2A 2M8EA 3IRRA 1QGPA 4YFXF 3HRUA 5FD5A 1U8RA 2QWWA 5HS7A 3GVAA 2OA4A 4KUMA 4GYIA 2V79A 3F3XA 4RB3C 2HGCA 1IN4A 5A2QZ 1L3LA 3MWMA 4MQ9F 3FF5A 1Z6TA 2EFQA 3M7GA 1XDUA 1VTNC 2OQGA 4KN4X 3J81K 3LAJA 1HQCA 3DXJF 3S2WA 3HUGA 3ULQB 1OMIA 3E5XA 4ZYGA 4M9ZA 4B09A 1IXSB 2JRTA 2JSCA 4A5MA 2XVCA 4UVAA 3MAJA 1R5GA 2K4JA 2ACJA 1W7PB 4KT5C 5KVRA 1WRJA 4IHSA 3KP6A 4ESJA 3WE3A 3BOQA 1USTA 3RYRA 4KIBA 4HQEA 1C0WA 2CFXA 3O3KA 3T0YA 3F22A 4U0WA 1G4DA 1ODDA 1FZPB 2W25A 1HKTA 2IT0A 2JPBA 2Y75A 4EJVA 2PFBA 1BI3A 1QZZA 4LJZF 4EGZA 1JGSA 5ICCA 1G6NA 4U7DA 3RYPA 1IUYA 1TQIA 3ZMSA 5DD8A 5D4RA 4NQWA 3I4PA 1R22A 3GW2A 1S7AA 4L5IA 5JHUA 1FPQA 4IRIA 3M8EA 5L3CA 3Q9SA 4RGUA 2H09A 3F23A 5HLGA 2DK8A 4F7ZA 2RKHA 2FF4A 4HF0A 3NRVA 2W85A 3EYYA 1ZG5A 3EQLF 1G3WA 2WV0A 2KRFA 2YSRA 1P6RA 3F72A 1TNTA 2RN7A 1K6OA 3JTHA 4MGRA 3E6DA 3PQKA 2GAUA 3EDPA 4PDKA 3RKXA 2XAFA 1JHHA 3GX4X 4KYWA 1O7FA 1TTYA 4ASNA 4IXAA 2HZTA 3JSOA 4P96A 3IWFA 1BIAA 1W7PA 4I0BA 3I59A 5ICFA 4H0EA 1W4MA 2O8XA 3FWEA 3P9KA 4CO8A 3FXQA 1RI7A 5ILSA 4Y15A 1U6GA 2O6GE 3H92A 1FOKA 2PQ8A 1TW2A 1LJ9A 3AAFA 5LHIA 4MHGA 1USSA 3RKWA 4P5OA 5CVJA 2PJPA 4BH9A 4L9NA 3VOEA 1BM9A 4HZFA 2WC2A 1XCBA 5K5RA 2H27A 3R61A 3K1NA 2Z3YA 1X3UA 4NHJA 1SD5A 2DTRA 4O6JA 5HLHA 1SFEA 2ESHA 3LQRA 4I7HA 5ICGA 2VODA 3CLOA 4L9VA 1LNWA 5K5QA 1R5HA 2EJRA 5L3DA 2K86A 4R1HA 1MDMB 1UHMA 4CHUA 1QBJA 5DEQA 2QYOA 5LGUA 3R6SA 2GWRA 5J6XA 1XGNA 4YFKF 3J81Z 1WSUA 2DT5A 4Q48A 1CGPA 2EV5A 1P2FA 4D0PA 1FBSA 5HDGA 4CXFA 5BS6A 2FQ3A 1MJ9A 1WWXA 3CO6C 2A07F 4HAMA 4YG2F 2IJLA 1UFMA 2ZKZA 4KDPA 3R4KA 1IW7F 1JHFA 5DCFA 3K2ZA 1YLFA 3E6BA 2XAJA 2Z5UA 1LB2A 2FMLA 4S05A 3LWFA 4XLPF 3SQNA 4M74A 2E7XA 1QNTA 3TOBA 1DDNA 1I5ZA 3Q5FA 2H94A 1ZG3A 1JE8A 2FBIA 2RVCA 4HA8A 5J8CA 3F8NA 4LG0B 4LB5A 3PFIA 1R58A 5L3BA 2A61A 3GFIA 4HW0A 1MZBA 5DCMB 1YS6A 4MEXF 4EMSA 4G8XA 1HSJA 2BYVE 2FNAA 5CJ9A 1FLIA 1J0RA 5D5VB 4CGZA 2PG4A 3KZYA 4UVCA 2DFIA 4KMUX 2A6HF 4IPAA 1LVAA 5HOOA 3BPVA 5H20A 1IRGA 3F6OA 2ELHA 1OYIA 3SZPA 3KEQA 1BC7C 2E1CA 2ZJ2A 3I71A 2CWEA 2EFOA 3IKTA 2DQRA 2IP2A 2P6TA 3GZ6A 2COMA 2J5OA 2ZNZA 2PEXA 1XDSA 1S7OA 5D5XB 4A6DA 1MJBA 1BOAA 4EJTA 1H9GA 2BEOA 3FXUA 3KEOA 1U78A 3E97A 2VE9A 2HTJA 4IRGA 1FYMA 3V8KA 5LHHA 4IF4A 2XAGA 3J7AO 1WI9A 3IHUA 1LDKB 4HYEA 3DF8A 1NHAA 2HTSA 1KQ8A 4EM1A 2HQNA 1P4AA 1XSVA 2M30A 2ZBKA 4LK1F 3HRMA 1YQAA 1STZA 4GGGA 4EJWA 2FNPA 2IW5A 2LSOA 2ISYA 5D8LB 1Z05A 4LMYA 1BI0A 5HDKA 3T8RA 1KA8A 2E1NA 5E18F 2STTA 3VB2A 1ZLJA 2M87A 1W7PD 1V4RA 4A0XA 1S6LA 1LEAA 1ZAOA 4MEYF 4RB0A 5H6QA 2L4AA 3ABUA 2STWA 3GYHX 4RAYA 4FX4A 2K4BA 4U7BA 1ZYRF 2GA2A 5E8IA 4HF1A 3J80K 1T98A 5HS9A 1R7JA 2R3SA 1KYZA 2MLGA 2YPRA 4M9SA 2F5EA 4AIJA 3U2RA 1J7KA 2DK5A 2HQRA 1IN6A 2DW4A 4G7HF 3F21A 3U1DA 3NEUA 2QENA 1EH7A 1J9IA 3TDUC 3FMQA 4XRFA 1XSDA 3EETA 2FBHA 3HOTA 3BJ6A 2O61A 3GZ5A 3HSEA 3M9AA 4KA4A 4LLLA 5BOXA 3GFMA 1YW7A 1H0MA 4FT8A 3K0LA 1P92A 3WGIA 1IF1A 3WU0A 4IVNA 1F1ZA 4ZH4F 3T5XA 3BWGA 3IWZA 3ZP5A 3RDIA 3I64A 2VOOA 2CQKA 1O3SA 2C6YA 3TDZC 3TQNA 3RIRA 1BI2A 2VE8A 2PMHA 1U5TA 1R00A 4P9FA 2Q8KA 4A2UA 2NS0A 2YU3A 3DP7A 2FRHA 4U0YA 1YW8A 1JXSA 2V9VA 4I2OA 1Z91A 4PCQA 1DP7P 2VXZA 2FMYA 3ROUA 1BJAA 3QU6A 2KIMA 2HS5A 3I58A 2DPUA 4L0ZB 1S8NA 3CDHA 4EM0B 4XLNF 4ENKA 4LB6B 2NAZA 1G3TA 1MGTA 3RTRA 3WTXC 1EH6A 3CUQC 2EB7A 1HKQA 1MJAA 3GFJA 5ILVA 4BQAA 4M72A 1D8JA 5D5WB 3ZMVA 4L9JA 2D1VA 1OKRA 4OOIA 3BY6A 3T1BA 2F5FA 2YX7A 3U9GA 3F8CA 3IL2A 5BPDA 1FP2A 4WXDA 2BV6A 3I59B 3ZN0A 4I0AA 2O0YA 3ISPA 3ZMTA 1GVJA 2VT3A 5D6FA 3OV8A 3TOAA 2NNYA 5BMZA 4FX0A 2YR2A 1FNNA 2A5YB 4CZZA 3WGHA 3FM5A 3GWZA 5AONA 1O3QA 4ON0A 1U3EM 2VBYA 4G6QA 2LF7A 2DU9A 4L18B 4HX4A 1R23A 2ADUA 2QVOA 1D3YA 1D5VA 5D6EA 4LG0A 5JFRA 2MH9A 4BAYA 3D0SA 3JAMZ 2FU4A 3GFLA 3TO7A 4K2EA 4HV6A 1XGSA 4HLXA 4XBFA 1UHWA 2OAZA 2TDXA 1LDJA 4ESBA 2HKXA 2IRFG 1FSEA 2HDCA 2AS5F 4A12A 2PI0A 1EH8A 1GXQA 2A69F 2GQQA 3WTVC 2EA4A 3N4MA 1FYLA 3WE2A 1ZRCA 3HRSA 3MFKA 3GXOA 3MZHA 1XGOA 5FFXA 3C18A 2CW0F 2EFNA 4E70A 5D5UB 1G3YA 2R7DA 3WU1B 4TV7A 5CVUA 1FX7A 1SD4A 3IC7A 2PMUA 3QRFF 4G6DA 3HTSB 2KIUA 2ZO4A 4BHBA 2DAOA 2P7VB 2HOEA 2X4HA 2H6CA 1HW2A 4N9IA 2A3SA 4UNOA 1WQ2A 2OBPA 4A6EA 4RGSA 2HEOA 2EK5A 4P55A 5DCMA 5LEJA 2VT2A 3TO6A 4CICA 3I5UA 5HS8A 1BIBA 2D45A 1EV7A 2FSWA 3WTYC 3O2PE 2M1BA 3I54A 2IA1A 3QU3A 2EV6A 1A04A 3FXRA 3V8LA 1B4AA 1OPCA 1FYKA 2XKOA 2R7FA 4HOBA 5HVQC 4EQQA 2UXNA 1K78B 2LNBA 1E17A 4M71A 2AXLA 3ECOA 4I98B 1DPRA 5FO5A 4KICA 3ZMDA 2FBKA 3ERED 3TO9A 2PN6A 1SD7A 3M8FA 1T39A 2L01A 4LK0F 1YIOA 2O03A 1IXRC 4LFUA 4QLCU 2GXBA 4WXCA 4P9UA 4HX7A 3GLXA 1IN7A 3P7NA 4RB2C 5LHGA 3MZYA 4EJOA 2D1HA 2HFHA 3QPHA 2F5CA 1KU3A 6PAXA 1IN8A 4OIPF 4WX9A 2Z99A 4RB1A 3V7RA 1R1TA 1LEBA 3HHGA 3CO7C 5JI6A 1LDDA 4ENNA 2E7WA 4Y17A 2KKOA 3KLOA 2RV8A 4M73A 4LLNA 1SMYF 2QQAA 5CLSA 2ESNA 4UHTA 4CYDA 1TQMA 5FFZA 1XCVA 1FT9A 1KU9A 3L00A 4DNCA 4EJUA 3L7WA 1KGSA 3M1EA 3GUDA 4AIKA 3BDDA 1PUEE 3HSFA 2BBYA 5F1RA 1K79A 3BJOA 2XAQA 1HW5A 5JR3A 2JT1A 3GEZA 4BNCA 3C7JA 4KFCA 1CF7B 1T0FA 3GF2A 5BPIA 3B02A 2RGVA 2W57A 4LGWA 4AVPA 4IJAA 1BBYA 1ZRFA 1U2WA 4G7ZF 3WGGA 3O6BB 2EFWA 1J75A 2BGCA 1K7AA 3C1DA 2VBWA 2XKPA 3G3ZA 4O5VA 1YFHA 2D2WA 4U0VA 2W84A 2ZCWA 1Q1HA 3VODA 1QZYA 1XMKA 1GXPA 1ZREA 5D8KB 2RNJA 3CJNA 2P5KA 2L3DA 3PQJA 2FE3A 2W24A 1J59A 3I0TA 2WTEA 2QUFA 5EEGA 1IXCA 3KE2A 4BHCA 4A5NA 3F8FA 2HYFA 1MD0A 2OQRA 2OZUA 4M6XA 1RUNA 2EFPA 4WWCA 2Y0MA 1FP1D 3J80Z 2A6EF 1YG2A 5FLXZ 1T2KA 3FMRA 2OU2A 3DV8A 4OIQF 4WK8F 2FXAA 1ZARA 2HKOA 2ZMEA 4KN7X 2P6SA 3ABTA 2VC1A 4JK1X 3KETA 3FZVA 4RS8A 1S3JA 2NYXA 4UUVA 4GXOA 3COAC 4DQ2A 3DFGA 3BZ6A 4WXHA 2LKPA 1BC8C 2RC4A 4ZZDA 4G9YA 5E1XA 3DEUA 4XSZF 1UCRA 5FGMA 4WCGA 5ED4A 1ZHFA 2QLZA 3LA2A 4L9TA 3QPTA 1U5TB 4OIOF 4RAZA 2XROA 3ECHA 5HDNA 4KMFA 1YW9A 3HIFA 1F9NA 2QBYB 2DO7A 3WG9A 3L9FA 4JBAA 3P9CA 1MKMA 4ESFA 5E1ZB 3IKVA 2K27A 4HBLA 1ZLKA 2DQLA 1ZGAA 1SMTA 3N97A 2QM3A 1FC3A 3V8JA 4UV9A 4Q4ZF 3LSTA 5FLXK 4OINF 2K7LA 3KLNA 1L0OC 1BN5A 2GIVA 2XGXA 1RUOA 1G3SA 3K69A 1QQIA 2V6CA 3KFWX 4GO1A 1PP7U 2O3FA 1O3TA 4R8HA 5HLIA 2HYGD 3K1PA 1XB4A 4RGXA 4IHTA 3LA7A 3RI4A 4MTDA 3Q9VA 3FHZA 4MQVA 3CUQA 2OD5A 2P5LC 2JPCA 1WKMA 5K5OA 1K78A 1ZH5A 3KP7A 4AWXB 2K02A 1Y0UA 2G9WA 2FOKA 4OMYA 5ILUA 1FSHA 1IAWA 1B9MA 1O57A 2VONA 2V1UA 3JW4A 3HYIA 5F64A 3L09A 5IT3A 4ENMA 2VBZA 2RQPA 1T38A 5LRRA 1U5TC 5AIQA 1F5TA 2VN2A 1F4KA 3H3ZA 1W5TA 5DUKA 2L4MA 3V4GA 4WF2A 4CDGA 1XSXA 3G73A 2CG4A 3E6CC 3D5LA 2UXXA 4B8XA 4KIGA 2XHKA 3FMSA 5L3FA 4OIRF 4FHTA 5LGTA 4M6YA 2H6BA 2QQBA 3ML6A 1YO5C 2XV4S 1FBQA 4BYYA 4OMZA 2VC0A 1LQ1A 1QO0D 1ZN2A 2ZFWA 2BE5F 2DPDA 1IRFA 3BJAA 1P4WA 2LDUA 2XIGA 3HSRA 2EV0A 1YS7A 1PDNC 1REPC 1R1VA 4RGRA 1MDMA 3EUHA 1I1GA 2DBBA 5LLQA 3R0AA 4LD5A 4BHPA 1O7LA 4PGGA 4UXNA 4UV8A 1J5YA 3RKYA 3JTGA 1QPMA 2Z9OA 3MCZA 1B6AA 2MD5A 2JTVA 1HW1A 3GO5A 2RDPA 3KCCA 1B1BA 2ZNYA 1RNLA 3HRTA 3RJPA 2M45A 4EGYA 4EVIA 2Z33A 2EA2A 2UWMA 2DLLA 4PZJA 3K1MA 2OZ6A 4LLGF 1HBXG 2QQ9A 5DV5A 3VFZA 3BPXA 2IA0A 2KJBA 1SD6A 4Y13A 3KP5A 4UVBA 1DUXC 4ETSA 3ZQ7A 1TW3A 4KIFA 1S29A 1E2XA 2KJCA 4AIHA 5LRSA 4HLYA 2Q2EA 2QBYA 1TBXA 1ON1A 2CGPA 4OU0A 1BI1A 3HTUA 3E5UA 3I53A 2L54A 2P8TA 4EV0A 2MBFA 3F8BA 5F6FA 2IA2A 3E5QA 1ONVA 1YTYA 2J5PA 1D8KA 3MQ0A 2JZYA 5DDGA 2L02A 4MTEA 5DD4A 3BROA 1TLHB 5A2QK 3TGNA 5FB2A 2YX4A 2ZXJA 5L3EA 5LGNA 3KP2A 3LQQA 1W5SA 2G7HA 4XSXF 1IN5A 3REOA 3B73A 2M5WA 5IT9K 3VEPA 5BQTA 3E3VA 2F5DA 2X0LA 2KIFA 3WTZA 3R0JA 4G7OF 5IT9Z 3JAMK 1O3RA 1GHCA 4HV5A 4YIFA 2VOPA 1P4XA 3DPTA 5CVVA 1FBUA 3SHFA 3FX3A 3KP4A 3KP3A 1KQ0A 3QAHA 5TRDA 5E1WA 3C3WA 5K1YA 4YFNF 2P5VA 2PLYA 3MEXA 4U88A 2QZ8A 2CYYA 4HX8A 5ICEA 4AD9A 3E6MA 1HSTA 3DPLC 2MH2A 3QP6A 3SZTA 1H9TA 5LBQA 5CYVA 5L3GA 2CSOA 1SAXA 2P4WA 2MLKA 2XRNA 4O3MA 3V7SA 4N9HA 3IRQA 2ISZA 5E20A 4YIIA 3KZZA 2MA3A 1XGMA 2GZWA 3LFKA 5DYMA 4KNYA 4A0ZA 1B9NA 3WTTC 4M9XA 2HWVA 3TKYA 1SFUA 1CF7A 2UZKA 4HQMA 1SFXA 4N0BA 1R36A 2Y48A 1AWCA 1J2XA 2FA5A 5H6RA 2B0LA 2VBXA 2PBIA 2Q0OA 5J8FA 2WWYA 3DKWA 2NRAC 1Z9CA 1KU7A 3ELKA 1AOYA 1FY7A 4L0YB 3ZPLA 3H3UA 3ZMUA 1RIOH 3HOSA 3WODF 4EM2A 1IZ1A 1B59A 1ULYA 2GA1A 2IPQX 3OOPA 3WTWC 4GCVA 1I6XA 3QOPA 4BXUA 1KU2A 2IVMA 4Q5SF 1Z1DA 4ZYHA 1XMAA 3K9TA 3W6KB 1DPUA 2XUBA 4ZZLA 2ETHA 4QWQA 3WTSC 1ZGJA 5E8GA 2CO5A 1HKSA 1V3FA 2V1DA 2NNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G94 A;  2A68 F;  5D4S A;  4R79 A;  1PP8 F;  4HF2 A;  1Z7U A;  1OR7 A;  1Z6R A;  3ZN1 A;  4HDV A;  3DQV C;  3L2C A;  3CUO A;  3T8T A;  4JQF A;  3SFZ A;  2DI3 A;  5JVT A;  3EYI A;  3NQO A;  4PGH A;  3RPU A;  5FD6 A;  4ZYE A;  2FEZ A;  5DUI A;  4GYG A;  1YYV A;  5TJJ A;  1I1S A;  3HHH A;  4A0Y A;  5E17 F;  3LAP A;  1OYW A;  4I01 A;  4NB5 A;  4ENJ A;  4IRH A;  3QP5 A;  2XAH A;  4I09 A;  5LEK A;  3ZMZ A;  1KQ9 A;  2LF8 A;  3V7C A;  1XN7 A;  3JSP A;  2V1X A;  2G7U A;  1RZ4 A;  4I02 A;  2P7C B;  3WTU C;  3F6V A;  1ZG1 A;  3SXY A;  3LA3 A;  4HDU A;  3P9I A;  1OYY A;  1I27 A;  4S04 A;  1ZRD A;  2GXG A;  1UB9 A;  5CVR A;  5EEH A;  5AIP A;  3RPQ A;  5KK1 A;  1KYW A;  2EWN A;  2F2E A;  4MNU A;  3F8M A;  1XD7 A;  3CUQ B;  2MC3 A;  3FM3 A;  4Q47 A;  4ZYD A;  1HXD A;  1FWZ A;  3W6J B;  4Z2Y A;  1T6S A;  2XAS A;  1TNS A;  4L5J A;  3BP8 A;  3R60 A;  1TQP A;  2ZME B;  5ERI A;  1R1U A;  3CTA A;  5CVI A;  2HR3 A;  1ON2 A;  2M8E A;  3IRR A;  1QGP A;  4YFX F;  3HRU A;  5FD5 A;  1U8R A;  2QWW A;  5HS7 A;  3GVA A;  2OA4 A;  4KUM A;  4GYI A;  2V79 A;  3F3X A;  4RB3 C;  2HGC A;  1IN4 A;  5A2Q Z;  1L3L A;  3MWM A;  4MQ9 F;  3FF5 A;  1Z6T A;  2EFQ A;  3M7G A;  1XDU A;  1VTN C;  2OQG A;  4KN4 X;  3J81 K;  3LAJ A;  1HQC A;  3DXJ F;  3S2W A;  3HUG A;  3ULQ B;  1OMI A;  3E5X A;  4ZYG A;  4M9Z A;  4B09 A;  1IXS B;  2JRT A;  2JSC A;  4A5M A;  2XVC A;  4UVA A;  3MAJ A;  1R5G A;  2K4J A;  2ACJ A;  1W7P B;  4KT5 C;  5KVR A;  1WRJ A;  4IHS A;  3KP6 A;  4ESJ A;  3WE3 A;  3BOQ A;  1UST A;  3RYR A;  4KIB A;  4HQE A;  1C0W A;  2CFX A;  3O3K A;  3T0Y A;  3F22 A;  4U0W A;  1G4D A;  1ODD A;  1FZP B;  2W25 A;  1HKT A;  2IT0 A;  2JPB A;  2Y75 A;  4EJV A;  2PFB A;  1BI3 A;  1QZZ A;  4LJZ F;  4EGZ A;  1JGS A;  5ICC A;  1G6N A;  4U7D A;  3RYP A;  1IUY A;  1TQI A;  3ZMS A;  5DD8 A;  5D4R A;  4NQW A;  3I4P A;  1R22 A;  3GW2 A;  1S7A A;  4L5I A;  5JHU A;  1FPQ A;  4IRI A;  3M8E A;  5L3C A;  3Q9S A;  4RGU A;  2H09 A;  3F23 A;  5HLG A;  2DK8 A;  4F7Z A;  2RKH A;  2FF4 A;  4HF0 A;  3NRV A;  2W85 A;  3EYY A;  1ZG5 A;  3EQL F;  1G3W A;  2WV0 A;  2KRF A;  2YSR A;  1P6R A;  3F72 A;  1TNT A;  2RN7 A;  1K6O A;  3JTH A;  4MGR A;  3E6D A;  3PQK A;  2GAU A;  3EDP A;  4PDK A;  3RKX A;  2XAF A;  1JHH A;  3GX4 X;  4KYW A;  1O7F A;  1TTY A;  4ASN A;  4IXA A;  2HZT A;  3JSO A;  4P96 A;  3IWF A;  1BIA A;  1W7P A;  4I0B A;  3I59 A;  5ICF A;  4H0E A;  1W4M A;  2O8X A;  3FWE A;  3P9K A;  4CO8 A;  3FXQ A;  1RI7 A;  5ILS A;  4Y15 A;  1U6G A;  2O6G E;  3H92 A;  1FOK A;  2PQ8 A;  1TW2 A;  1LJ9 A;  3AAF A;  5LHI A;  4MHG A;  1USS A;  3RKW A;  4P5O A;  5CVJ A;  2PJP A;  4BH9 A;  4L9N A;  3VOE A;  1BM9 A;  4HZF A;  2WC2 A;  1XCB A;  5K5R A;  2H27 A;  3R61 A;  3K1N A;  2Z3Y A;  1X3U A;  4NHJ A;  1SD5 A;  2DTR A;  4O6J A;  5HLH A;  1SFE A;  2ESH A;  3LQR A;  4I7H A;  5ICG A;  2VOD A;  3CLO A;  4L9V A;  1LNW A;  5K5Q A;  1R5H A;  2EJR A;  5L3D A;  2K86 A;  4R1H A;  1MDM B;  1UHM A;  4CHU A;  1QBJ A;  5DEQ A;  2QYO A;  5LGU A;  3R6S A;  2GWR A;  5J6X A;  1XGN A;  4YFK F;  3J81 Z;  1WSU A;  2DT5 A;  4Q48 A;  1CGP A;  2EV5 A;  1P2F A;  4D0P A;  1FBS A;  5HDG A;  4CXF A;  5BS6 A;  2FQ3 A;  1MJ9 A;  1WWX A;  3CO6 C;  2A07 F;  4HAM A;  4YG2 F;  2IJL A;  1UFM A;  2ZKZ A;  4KDP A;  3R4K A;  1IW7 F;  1JHF A;  5DCF A;  3K2Z A;  1YLF A;  3E6B A;  2XAJ A;  2Z5U A;  1LB2 A;  2FML A;  4S05 A;  3LWF A;  4XLP F;  3SQN A;  4M74 A;  2E7X A;  1QNT A;  3TOB A;  1DDN A;  1I5Z A;  3Q5F A;  2H94 A;  1ZG3 A;  1JE8 A;  2FBI A;  2RVC A;  4HA8 A;  5J8C A;  3F8N A;  4LG0 B;  4LB5 A;  3PFI A;  1R58 A;  5L3B A;  2A61 A;  3GFI A;  4HW0 A;  1MZB A;  5DCM B;  1YS6 A;  4MEX F;  4EMS A;  4G8X A;  1HSJ A;  2BYV E;  2FNA A;  5CJ9 A;  1FLI A;  1J0R A;  5D5V B;  4CGZ A;  2PG4 A;  3KZY A;  4UVC A;  2DFI A;  4KMU X;  2A6H F;  4IPA A;  1LVA A;  5HOO A;  3BPV A;  5H20 A;  1IRG A;  3F6O A;  2ELH A;  1OYI A;  3SZP A;  3KEQ A;  1BC7 C;  2E1C A;  2ZJ2 A;  3I71 A;  2CWE A;  2EFO A;  3IKT A;  2DQR A;  2IP2 A;  2P6T A;  3GZ6 A;  2COM A;  2J5O A;  2ZNZ A;  2PEX A;  1XDS A;  1S7O A;  5D5X B;  4A6D A;  1MJB A;  1BOA A;  4EJT A;  1H9G A;  2BEO A;  3FXU A;  3KEO A;  1U78 A;  3E97 A;  2VE9 A;  2HTJ A;  4IRG A;  1FYM A;  3V8K A;  5LHH A;  4IF4 A;  2XAG A;  3J7A O;  1WI9 A;  3IHU A;  1LDK B;  4HYE A;  3DF8 A;  1NHA A;  2HTS A;  1KQ8 A;  4EM1 A;  2HQN A;  1P4A A;  1XSV A;  2M30 A;  2ZBK A;  4LK1 F;  3HRM A;  1YQA A;  1STZ A;  4GGG A;  4EJW A;  2FNP A;  2IW5 A;  2LSO A;  2ISY A;  5D8L B;  1Z05 A;  4LMY A;  1BI0 A;  5HDK A;  3T8R A;  1KA8 A;  2E1N A;  5E18 F;  2STT A;  3VB2 A;  1ZLJ A;  2M87 A;  1W7P D;  1V4R A;  4A0X A;  1S6L A;  1LEA A;  1ZAO A;  4MEY F;  4RB0 A;  5H6Q A;  2L4A A;  3ABU A;  2STW A;  3GYH X;  4RAY A;  4FX4 A;  2K4B A;  4U7B A;  1ZYR F;  2GA2 A;  5E8I A;  4HF1 A;  3J80 K;  1T98 A;  5HS9 A;  1R7J A;  2R3S A;  1KYZ A;  2MLG A;  2YPR A;  4M9S A;  2F5E A;  4AIJ A;  3U2R A;  1J7K A;  2DK5 A;  2HQR A;  1IN6 A;  2DW4 A;  4G7H F;  3F21 A;  3U1D A;  3NEU A;  2QEN A;  1EH7 A;  1J9I A;  3TDU C;  3FMQ A;  4XRF A;  1XSD A;  3EET A;  2FBH A;  3HOT A;  3BJ6 A;  2O61 A;  3GZ5 A;  3HSE A;  3M9A A;  4KA4 A;  4LLL A;  5BOX A;  3GFM A;  1YW7 A;  1H0M A;  4FT8 A;  3K0L A;  1P92 A;  3WGI A;  1IF1 A;  3WU0 A;  4IVN A;  1F1Z A;  4ZH4 F;  3T5X A;  3BWG A;  3IWZ A;  3ZP5 A;  3RDI A;  3I64 A;  2VOO A;  2CQK A;  1O3S A;  2C6Y A;  3TDZ C;  3TQN A;  3RIR A;  1BI2 A;  2VE8 A;  2PMH A;  1U5T A;  1R00 A;  4P9F A;  2Q8K A;  4A2U A;  2NS0 A;  2YU3 A;  3DP7 A;  2FRH A;  4U0Y A;  1YW8 A;  1JXS A;  2V9V A;  4I2O A;  1Z91 A;  4PCQ A;  1DP7 P;  2VXZ A;  2FMY A;  3ROU A;  1BJA A;  3QU6 A;  2KIM A;  2HS5 A;  3I58 A;  2DPU A;  4L0Z B;  1S8N A;  3CDH A;  4EM0 B;  4XLN F;  4ENK A;  4LB6 B;  2NAZ A;  1G3T A;  1MGT A;  3RTR A;  3WTX C;  1EH6 A;  3CUQ C;  2EB7 A;  1HKQ A;  1MJA A;  3GFJ A;  5ILV A;  4BQA A;  4M72 A;  1D8J A;  5D5W B;  3ZMV A;  4L9J A;  2D1V A;  1OKR A;  4OOI A;  3BY6 A;  3T1B A;  2F5F A;  2YX7 A;  3U9G A;  3F8C A;  3IL2 A;  5BPD A;  1FP2 A;  4WXD A;  2BV6 A;  3I59 B;  3ZN0 A;  4I0A A;  2O0Y A;  3ISP A;  3ZMT A;  1GVJ A;  2VT3 A;  5D6F A;  3OV8 A;  3TOA A;  2NNY A;  5BMZ A;  4FX0 A;  2YR2 A;  1FNN A;  2A5Y B;  4CZZ A;  3WGH A;  3FM5 A;  3GWZ A;  5AON A;  1O3Q A;  4ON0 A;  1U3E M;  2VBY A;  4G6Q A;  2LF7 A;  2DU9 A;  4L18 B;  4HX4 A;  1R23 A;  2ADU A;  2QVO A;  1D3Y A;  1D5V A;  5D6E A;  4LG0 A;  5JFR A;  2MH9 A;  4BAY A;  3D0S A;  3JAM Z;  2FU4 A;  3GFL A;  3TO7 A;  4K2E A;  4HV6 A;  1XGS A;  4HLX A;  4XBF A;  1UHW A;  2OAZ A;  2TDX A;  1LDJ A;  4ESB A;  2HKX A;  2IRF G;  1FSE A;  2HDC A;  2AS5 F;  4A12 A;  2PI0 A;  1EH8 A;  1GXQ A;  2A69 F;  2GQQ A;  3WTV C;  2EA4 A;  3N4M A;  1FYL A;  3WE2 A;  1ZRC A;  3HRS A;  3MFK A;  3GXO A;  3MZH A;  1XGO A;  5FFX A;  3C18 A;  2CW0 F;  2EFN A;  4E70 A;  5D5U B;  1G3Y A;  2R7D A;  3WU1 B;  4TV7 A;  5CVU A;  1FX7 A;  1SD4 A;  3IC7 A;  2PMU A;  3QRF F;  4G6D A;  3HTS B;  2KIU A;  2ZO4 A;  4BHB A;  2DAO A;  2P7V B;  2HOE A;  2X4H A;  2H6C A;  1HW2 A;  4N9I A;  2A3S A;  4UNO A;  1WQ2 A;  2OBP A;  4A6E A;  4RGS A;  2HEO A;  2EK5 A;  4P55 A;  5DCM A;  5LEJ A;  2VT2 A;  3TO6 A;  4CIC A;  3I5U A;  5HS8 A;  1BIB A;  2D45 A;  1EV7 A;  2FSW A;  3WTY C;  3O2P E;  2M1B A;  3I54 A;  2IA1 A;  3QU3 A;  2EV6 A;  1A04 A;  3FXR A;  3V8L A;  1B4A A;  1OPC A;  1FYK A;  2XKO A;  2R7F A;  4HOB A;  5HVQ C;  4EQQ A;  2UXN A;  1K78 B;  2LNB A;  1E17 A;  4M71 A;  2AXL A;  3ECO A;  4I98 B;  1DPR A;  5FO5 A;  4KIC A;  3ZMD A;  2FBK A;  3ERE D;  3TO9 A;  2PN6 A;  1SD7 A;  3M8F A;  1T39 A;  2L01 A;  4LK0 F;  1YIO A;  2O03 A;  1IXR C;  4LFU A;  4QLC U;  2GXB A;  4WXC A;  4P9U A;  4HX7 A;  3GLX A;  1IN7 A;  3P7N A;  4RB2 C;  5LHG A;  3MZY A;  4EJO A;  2D1H A;  2HFH A;  3QPH A;  2F5C A;  1KU3 A;  6PAX A;  1IN8 A;  4OIP F;  4WX9 A;  2Z99 A;  4RB1 A;  3V7R A;  1R1T A;  1LEB A;  3HHG A;  3CO7 C;  5JI6 A;  1LDD A;  4ENN A;  2E7W A;  4Y17 A;  2KKO A;  3KLO A;  2RV8 A;  4M73 A;  4LLN A;  1SMY F;  2QQA A;  5CLS A;  2ESN A;  4UHT A;  4CYD A;  1TQM A;  5FFZ A;  1XCV A;  1FT9 A;  1KU9 A;  3L00 A;  4DNC A;  4EJU A;  3L7W A;  1KGS A;  3M1E A;  3GUD A;  4AIK A;  3BDD A;  1PUE E;  3HSF A;  2BBY A;  5F1R A;  1K79 A;  3BJO A;  2XAQ A;  1HW5 A;  5JR3 A;  2JT1 A;  3GEZ A;  4BNC A;  3C7J A;  4KFC A;  1CF7 B;  1T0F A;  3GF2 A;  5BPI A;  3B02 A;  2RGV A;  2W57 A;  4LGW A;  4AVP A;  4IJA A;  1BBY A;  1ZRF A;  1U2W A;  4G7Z F;  3WGG A;  3O6B B;  2EFW A;  1J75 A;  2BGC A;  1K7A A;  3C1D A;  2VBW A;  2XKP A;  3G3Z A;  4O5V A;  1YFH A;  2D2W A;  4U0V A;  2W84 A;  2ZCW A;  1Q1H A;  3VOD A;  1QZY A;  1XMK A;  1GXP A;  1ZRE A;  5D8K B;  2RNJ A;  3CJN A;  2P5K A;  2L3D A;  3PQJ A;  2FE3 A;  2W24 A;  1J59 A;  3I0T A;  2WTE A;  2QUF A;  5EEG A;  1IXC A;  3KE2 A;  4BHC A;  4A5N A;  3F8F A;  2HYF A;  1MD0 A;  2OQR A;  2OZU A;  4M6X A;  1RUN A;  2EFP A;  4WWC A;  2Y0M A;  1FP1 D;  3J80 Z;  2A6E F;  1YG2 A;  5FLX Z;  1T2K A;  3FMR A;  2OU2 A;  3DV8 A;  4OIQ F;  4WK8 F;  2FXA A;  1ZAR A;  2HKO A;  2ZME A;  4KN7 X;  2P6S A;  3ABT A;  2VC1 A;  4JK1 X;  3KET A;  3FZV A;  4RS8 A;  1S3J A;  2NYX A;  4UUV A;  4GXO A;  3COA C;  4DQ2 A;  3DFG A;  3BZ6 A;  4WXH A;  2LKP A;  1BC8 C;  2RC4 A;  4ZZD A;  4G9Y A;  5E1X A;  3DEU A;  4XSZ F;  1UCR A;  5FGM A;  4WCG A;  5ED4 A;  1ZHF A;  2QLZ A;  3LA2 A;  4L9T A;  3QPT A;  1U5T B;  4OIO F;  4RAZ A;  2XRO A;  3ECH A;  5HDN A;  4KMF A;  1YW9 A;  3HIF A;  1F9N A;  2QBY B;  2DO7 A;  3WG9 A;  3L9F A;  4JBA A;  3P9C A;  1MKM A;  4ESF A;  5E1Z B;  3IKV A;  2K27 A;  4HBL A;  1ZLK A;  2DQL A;  1ZGA A;  1SMT A;  3N97 A;  2QM3 A;  1FC3 A;  3V8J A;  4UV9 A;  4Q4Z F;  3LST A;  5FLX K;  4OIN F;  2K7L A;  3KLN A;  1L0O C;  1BN5 A;  2GIV A;  2XGX A;  1RUO A;  1G3S A;  3K69 A;  1QQI A;  2V6C A;  3KFW X;  4GO1 A;  1PP7 U;  2O3F A;  1O3T A;  4R8H A;  5HLI A;  2HYG D;  3K1P A;  1XB4 A;  4RGX A;  4IHT A;  3LA7 A;  3RI4 A;  4MTD A;  3Q9V A;  3FHZ A;  4MQV A;  3CUQ A;  2OD5 A;  2P5L C;  2JPC A;  1WKM A;  5K5O A;  1K78 A;  1ZH5 A;  3KP7 A;  4AWX B;  2K02 A;  1Y0U A;  2G9W A;  2FOK A;  4OMY A;  5ILU A;  1FSH A;  1IAW A;  1B9M A;  1O57 A;  2VON A;  2V1U A;  3JW4 A;  3HYI A;  5F64 A;  3L09 A;  5IT3 A;  4ENM A;  2VBZ A;  2RQP A;  1T38 A;  5LRR A;  1U5T C;  5AIQ A;  1F5T A;  2VN2 A;  1F4K A;  3H3Z A;  1W5T A;  5DUK A;  2L4M A;  3V4G A;  4WF2 A;  4CDG A;  1XSX A;  3G73 A;  2CG4 A;  3E6C C;  3D5L A;  2UXX A;  4B8X A;  4KIG A;  2XHK A;  3FMS A;  5L3F A;  4OIR F;  4FHT A;  5LGT A;  4M6Y A;  2H6B A;  2QQB A;  3ML6 A;  1YO5 C;  2XV4 S;  1FBQ A;  4BYY A;  4OMZ A;  2VC0 A;  1LQ1 A;  1QO0 D;  1ZN2 A;  2ZFW A;  2BE5 F;  2DPD A;  1IRF A;  3BJA A;  1P4W A;  2LDU A;  2XIG A;  3HSR A;  2EV0 A;  1YS7 A;  1PDN C;  1REP C;  1R1V A;  4RGR A;  1MDM A;  3EUH A;  1I1G A;  2DBB A;  5LLQ A;  3R0A A;  4LD5 A;  4BHP A;  1O7L A;  4PGG A;  4UXN A;  4UV8 A;  1J5Y A;  3RKY A;  3JTG A;  1QPM A;  2Z9O A;  3MCZ A;  1B6A A;  2MD5 A;  2JTV A;  1HW1 A;  3GO5 A;  2RDP A;  3KCC A;  1B1B A;  2ZNY A;  1RNL A;  3HRT A;  3RJP A;  2M45 A;  4EGY A;  4EVI A;  2Z33 A;  2EA2 A;  2UWM A;  2DLL A;  4PZJ A;  3K1M A;  2OZ6 A;  4LLG F;  1HBX G;  2QQ9 A;  5DV5 A;  3VFZ A;  3BPX A;  2IA0 A;  2KJB A;  1SD6 A;  4Y13 A;  3KP5 A;  4UVB A;  1DUX C;  4ETS A;  3ZQ7 A;  1TW3 A;  4KIF A;  1S29 A;  1E2X A;  2KJC A;  4AIH A;  5LRS A;  4HLY A;  2Q2E A;  2QBY A;  1TBX A;  1ON1 A;  2CGP A;  4OU0 A;  1BI1 A;  3HTU A;  3E5U A;  3I53 A;  2L54 A;  2P8T A;  4EV0 A;  2MBF A;  3F8B A;  5F6F A;  2IA2 A;  3E5Q A;  1ONV A;  1YTY A;  2J5P A;  1D8K A;  3MQ0 A;  2JZY A;  5DDG A;  2L02 A;  4MTE A;  5DD4 A;  3BRO A;  1TLH B;  5A2Q K;  3TGN A;  5FB2 A;  2YX4 A;  2ZXJ A;  5L3E A;  5LGN A;  3KP2 A;  3LQQ A;  1W5S A;  2G7H A;  4XSX F;  1IN5 A;  3REO A;  3B73 A;  2M5W A;  5IT9 K;  3VEP A;  5BQT A;  3E3V A;  2F5D A;  2X0L A;  2KIF A;  3WTZ A;  3R0J A;  4G7O F;  5IT9 Z;  3JAM K;  1O3R A;  1GHC A;  4HV5 A;  4YIF A;  2VOP A;  1P4X A;  3DPT A;  5CVV A;  1FBU A;  3SHF A;  3FX3 A;  3KP4 A;  3KP3 A;  1KQ0 A;  3QAH A;  5TRD A;  5E1W A;  3C3W A;  5K1Y A;  4YFN F;  2P5V A;  2PLY A;  3MEX A;  4U88 A;  2QZ8 A;  2CYY A;  4HX8 A;  5ICE A;  4AD9 A;  3E6M A;  1HST A;  3DPL C;  2MH2 A;  3QP6 A;  3SZT A;  1H9T A;  5LBQ A;  5CYV A;  5L3G A;  2CSO A;  1SAX A;  2P4W A;  2MLK A;  2XRN A;  4O3M A;  3V7S A;  4N9H A;  3IRQ A;  2ISZ A;  5E20 A;  4YII A;  3KZZ A;  2MA3 A;  1XGM A;  2GZW A;  3LFK A;  5DYM A;  4KNY A;  4A0Z A;  1B9N A;  3WTT C;  4M9X A;  2HWV A;  3TKY A;  1SFU A;  1CF7 A;  2UZK A;  4HQM A;  1SFX A;  4N0B A;  1R36 A;  2Y48 A;  1AWC A;  1J2X A;  2FA5 A;  5H6R A;  2B0L A;  2VBX A;  2PBI A;  2Q0O A;  5J8F A;  2WWY A;  3DKW A;  2NRA C;  1Z9C A;  1KU7 A;  3ELK A;  1AOY A;  1FY7 A;  4L0Y B;  3ZPL A;  3H3U A;  3ZMU A;  1RIO H;  3HOS A;  3WOD F;  4EM2 A;  1IZ1 A;  1B59 A;  1ULY A;  2GA1 A;  2IPQ X;  3OOP A;  3WTW C;  4GCV A;  1I6X A;  3QOP A;  4BXU A;  1KU2 A;  2IVM A;  4Q5S F;  1Z1D A;  4ZYH A;  1XMA A;  3K9T A;  3W6K B;  1DPU A;  2XUB A;  4ZZL A;  2ETH A;  4QWQ A;  3WTS C;  1ZGJ A;  5E8G A;  2CO5 A;  1HKS A;  1V3F A;  2V1D A;  2NNN A; 
#chains in the Genus database with same CATH topology
 1MNE A;  4G94 A;  2MW8 A;  3VYT B;  2A68 F;  5D4S A;  4R79 A;  1PP8 F;  4HF2 A;  1Z7U A;  1OR7 A;  3JRI A;  1Z6R A;  3ZN1 A;  4HDV A;  3DQV C;  3L2C A;  3CUO A;  1BW5 A;  1LVK A;  4JQF A;  3C2B A;  3T8T A;  3SFZ A;  4AYB N;  1JT0 A;  2DI3 A;  5JVT A;  1MH3 A;  4B3X A;  3EYI A;  3NQO A;  4AYB A;  4PGH A;  1JKO C;  2XB0 X;  3RPU A;  4YIR X;  2L9N A;  5FD6 A;  3L1P A;  1QPI A;  1MMG A;  1HCR A;  2OPT A;  2HQA A;  2VLA A;  4ZYE A;  1SVM A;  2FEZ A;  5DUI A;  1LFB A;  4GYG A;  1YYV A;  5TJJ A;  1I1S A;  1ZR2 A;  2VQG A;  2XSJ C;  3CJQ B;  3HHH A;  4A0Y A;  5E17 F;  3LAP A;  1OYW A;  4I01 A;  4NB5 A;  4D5C A;  4ENJ A;  4IRH A;  2CV0 A;  3PIO F;  3QP5 A;  2XAH A;  4I09 A;  5LEK A;  3ZMZ A;  1XS9 A;  1KQ9 A;  2LF8 A;  4A69 C;  3JRE A;  1LPQ A;  3TP0 A;  3V7C A;  3HOZ J;  1TWG J;  1XN7 A;  3JSP A;  3KX2 A;  2VKH A;  4C3J J;  2V1X A;  2G7U A;  3S14 J;  4P1W A;  1RZ4 A;  4I02 A;  3LSR A;  2P7C B;  1WJF A;  4RAF A;  5J4V A;  3WTU C;  1YRN A;  3F6V A;  1VQ4 I;  1ZG1 A;  1JUM A;  4XKC A;  1G59 A;  1U0J A;  2TRT A;  3GTG J;  3SXY A;  3LA3 A;  4HDU A;  3P9I A;  2BW3 A;  2HYJ A;  1OYY A;  2OJE D;  1I27 A;  2L5Q A;  4S04 A;  2GXG A;  1UB9 A;  1ZRD A;  1YRN B;  2D5V A;  2QKL B;  2E1M B;  1JUS A;  5CVR A;  3CCY A;  5EEH A;  3ZRG A;  5AIP A;  3OS0 A;  3RPQ A;  3BTC A;  5KK1 A;  1KYW A;  2EWN A;  2F2E A;  5J1Y A;  2DYS H;  4XL9 A;  1LKX A;  2EZL A;  4MNU A;  3F8M A;  1XD7 A;  3CUQ B;  2MC3 A;  3FM3 A;  4Q47 A;  3HGG A;  3HB9 A;  4ZYD A;  1MSE C;  1HXD A;  1FWZ A;  4Z2Y A;  3W6J B;  1T6S A;  2XAS A;  3ZOB A;  4J01 A;  1VQO I;  1TNS A;  4L5J A;  3BP8 A;  3R60 A;  1OIS A;  1TQP A;  2CQ7 A;  3LSG A;  2ZME B;  2VKD A;  2BY3 A;  4MIM A;  1MBG A;  3VYU B;  1W36 D;  3CDL A;  5ERI A;  3OYF A;  3BZK A;  1R1U A;  3BR0 A;  3CTA A;  5CVI A;  1IDY A;  2K9L A;  1Z67 A;  2HR3 A;  1ON2 A;  5LD2 C;  2M8E A;  3ZCO A;  1GLN A;  2CUJ A;  1SFK A;  3QPS A;  3IRR A;  1FTZ A;  3MKW B;  1QGP A;  1IC8 A;  4YFX F;  3HRU A;  5FD5 A;  1U8R A;  2QWW A;  3BCA A;  1RKW A;  4IKF A;  1V55 H;  5HS7 A;  2HXI A;  1VQ9 I;  1YJW I;  3GVA A;  4UUS B;  2EH3 A;  4RDU A;  1I6H J;  4C2U A;  1QA6 A;  2OA4 A;  4KUM A;  4GYI A;  2V79 A;  3F3X A;  2LR8 A;  2X6Y A;  4RB3 C;  2HGC A;  5DS9 A;  1IN4 A;  5A2Q Z;  1YI2 I;  1L3L A;  3MWM A;  2R7X A;  3CF5 F;  3UKG A;  5F04 A;  4MQ9 F;  5M5X J;  2V7F A;  3FF5 A;  1Z6T A;  2EFQ A;  3ERM A;  3M7G A;  1XDU A;  4XMY A;  5B1B H;  2OQG A;  1VTN C;  4KN4 X;  3J81 K;  3OY9 A;  2LBF A;  3LAJ A;  1HQC A;  3DXJ F;  5HNF A;  3S2W A;  3HUG A;  3ULQ B;  4C9Y A;  3JRA A;  1UMQ A;  5C4X J;  4PSW A;  1JTY A;  1OMI A;  1JJ6 C;  3E5X A;  4ZYG A;  3BC8 A;  4M9Z A;  4B09 A;  1IXS B;  2JRT A;  1RR8 C;  2JSC A;  4A5M A;  2YU9 J;  2XVC A;  4ZC3 A;  4UVA A;  2HVQ A;  2FOW A;  3MAJ A;  2CS3 A;  1R5G A;  2EZI A;  2K4J A;  3WHB A;  3WHC A;  2ACJ A;  1W7P B;  4KT5 C;  4PJM A;  2ID6 A;  2AXT C;  2HDD A;  3E0J B;  1IJW C;  3AL0 B;  5KVR A;  1WRJ A;  4IHS A;  3BR3 A;  2XB5 A;  3KP6 A;  4ESJ A;  3WE3 A;  2L7F P;  3BOQ A;  1LE8 A;  4BS9 A;  1U8B A;  1UST A;  3RYR A;  4KIB A;  1YX3 A;  4RM2 A;  4HQE A;  4N4N B;  3B6A A;  3I3L A;  2X6X A;  5KAF C;  2BY1 A;  1C0W A;  3K4C A;  2CFX A;  4XKV A;  3O3K A;  1E3O C;  5KCM A;  1N75 A;  3NAU A;  1X58 A;  3T0Y A;  3F22 A;  3BR2 A;  4U0W A;  1G4D A;  1XC5 A;  1XMX A;  1ODD A;  1TWH J;  2K9N A;  1FZP B;  2W25 A;  2CQN A;  1HKT A;  2IT0 A;  2K9Q A;  5CPR B;  2ZJR F;  1ETQ A;  4XLA A;  5GTI C;  3CCM I;  2JPB A;  2Y75 A;  3GTP J;  2H1L A;  4EJV A;  1B72 B;  2KIS A;  2PFB A;  2KRC A;  4A3M J;  1VQK I;  1BI3 A;  1QZZ A;  4LJZ F;  4EGZ A;  2PJR B;  1JGS A;  5ICC A;  1G6N A;  4U7D A;  2O9L A;  3RYP A;  3G71 I;  1VQP I;  1IUY A;  1GVD A;  1TQI A;  3ZMS A;  1MMS A;  1OLT A;  3TED A;  2MFZ A;  4ZDO A;  4BBS J;  2FX0 A;  5DD8 A;  5D4R A;  1YHQ I;  4NQW A;  3I4P A;  5E79 C;  1X19 A;  5JHF A;  1W1W E;  1R22 A;  2L9V A;  4DZJ A;  1RRJ A;  3GW2 A;  1APL C;  1S7A A;  4L5I A;  5JHU A;  2OCE A;  1HDD C;  3A01 A;  1FPQ A;  4IRI A;  4OAY A;  3M8E A;  5L3C A;  3Q9S A;  4RGU A;  2ME0 A;  3RQI A;  1G2H A;  2H09 A;  3F23 A;  3KIO A;  5HLG A;  2HPM A;  1MMD A;  2DK8 A;  4F7Z A;  2RKH A;  2FF4 A;  4HF0 A;  3NRV A;  2W85 A;  3EYY A;  1ZG5 A;  2MG4 A;  3EQL F;  4IQJ A;  2QGU A;  2EIM H;  3TW7 A;  1G3W A;  2WV0 A;  2KRF A;  2YSR A;  1P6R A;  3F72 A;  1TNT A;  2RN7 A;  3A02 A;  1K6O A;  1EA3 A;  3JTH A;  4MGR A;  4GFB A;  5EGO A;  3E6D A;  3RPU D;  3PQK A;  3ESW B;  2DYR H;  2I10 A;  2QF7 A;  2Y30 A;  2GAU A;  3EDP A;  3OIO A;  4PDK A;  3RKX A;  3D1N I;  3CC2 I;  2XAF A;  1JHH A;  3GX4 X;  4KYW A;  1O7F A;  1TTY A;  3CES A;  5HOD A;  1D5Y A;  4ASN A;  4IXA A;  3GTM J;  2HZT A;  4BUP A;  1VQ7 I;  3C2G A;  2JA8 J;  2NVQ J;  1K4T A;  4RM3 A;  3OYB A;  3JSO A;  4P96 A;  3IWF A;  1BIA A;  1W7P A;  2LP0 A;  1WI3 A;  5K7H A;  3P5J A;  2GM4 A;  3H36 A;  4I0B A;  3I59 A;  5ICF A;  4H0E A;  2DA4 A;  1W4M A;  3IV5 A;  4XN3 A;  1VFC A;  1OR7 C;  2O8X A;  2DFE A;  3FWE A;  3P9K A;  3QYB A;  2QEX I;  4CO8 A;  2V6E A;  3EPZ A;  3FXQ A;  4A3B J;  1RI7 A;  5ILS A;  4Y15 A;  1DQU A;  1WGX A;  2K9S A;  1U6G A;  1Z21 A;  4B43 A;  2QSG X;  2A5W A;  2O6G E;  3H92 A;  1FOK A;  2PQ8 A;  2UUZ A;  1TW2 A;  3GTK J;  1LJ9 A;  2HI3 A;  2IBD A;  2ZC2 A;  3AAF A;  5LHI A;  2X6W A;  2Y9Z A;  4MHG A;  1USS A;  3RKW A;  1YIJ I;  3ABL H;  2M4K A;  2CMP A;  2P81 A;  4P5O A;  5J1R A;  2Y9Y A;  5CVJ A;  2PJP A;  3K70 D;  4BH9 A;  4L9N A;  3ZQL A;  4CYC A;  4PJ0 C;  1ENH A;  3VOE A;  1BM9 A;  2WB1 A;  2WC2 A;  1XCB A;  4HZF A;  5K5R A;  1ITY A;  3MMY B;  2H27 A;  5FKM A;  4DYR A;  3R61 A;  2M8G X;  3K1N A;  2Z3Y A;  4II3 A;  2LK2 A;  2Z1D A;  3GME A;  4B44 A;  2BXY A;  4IQ4 A;  1R5I D;  1X3U A;  4NHJ A;  1SD5 A;  3FK6 A;  1S5L C;  2DTR A;  4O6J A;  5HLH A;  1SFE A;  2ESH A;  4X6A J;  4I76 A;  3LQR A;  2H8W A;  1HLV A;  4NC8 A;  1ETX A;  5BNG A;  4I7H A;  5ICG A;  2VOD A;  3CLO A;  1IV8 A;  3I9V 2;  2DOD A;  1LNW A;  4L9V A;  4D9J A;  5K5Q A;  4M3B A;  1WJD A;  3SEQ A;  1R5H A;  3PSI A;  2EJR A;  5L3D A;  4V19 K;  3I55 I;  2DMP A;  2K86 A;  2LY1 A;  4F92 B;  2R5Z A;  4R1H A;  3O8H A;  1MDM B;  1UHM A;  4CHU A;  1QBJ A;  5DEQ A;  2QYO A;  5LGU A;  1B8I A;  3R6S A;  2GWR A;  3DLL F;  3W2A A;  1IG7 A;  5FLV A;  5J6X A;  1DGR M;  4G12 A;  1XGN A;  3DU6 A;  4YFK F;  2LTP A;  3K10 A;  3J81 Z;  1WSU A;  2DT5 A;  4Q48 A;  3OYG A;  2AO9 A;  1CGP A;  4PJJ A;  1OQY A;  1JJ8 C;  3GZN B;  3M07 A;  5EG0 B;  4XR6 A;  2EV5 A;  1P2F A;  5IPA A;  2JA6 J;  4AM3 A;  4D0P A;  1FBS A;  2HPI A;  5HDG A;  2R7T A;  4CXF A;  5BS6 A;  5IYD J;  3H35 A;  2KIQ A;  2FQ3 A;  1MJ9 A;  2Z2S B;  1QVU A;  3CCV I;  4ANJ A;  1WWX A;  3JRB A;  1WPK A;  3CO6 C;  2XF6 A;  4HAM A;  4YG2 F;  2A07 F;  3UNG C;  2IJL A;  2OC6 A;  4UUS A;  2CQX A;  3I4M J;  2KFD A;  1UFM A;  2KHM A;  2ZKZ A;  3HJE A;  3DCF A;  3ZGK A;  2WV1 A;  4KDP A;  4F91 B;  3R4K A;  1IW7 F;  1IGN A;  4BU2 A;  1X1C A;  4XNF A;  2DA3 A;  2IGN A;  2LMD A;  3FK7 A;  1Z0X A;  1JHF A;  5DCF A;  3K2Z A;  1YLF A;  3E6B A;  1XTA A;  3BZC A;  2WY8 Q;  2XAJ A;  2Z5U A;  3A03 A;  1LB2 A;  2FML A;  2LY9 A;  4S05 A;  3LWF A;  4XLP F;  1SFO J;  2QA4 I;  3SQN A;  2KZG A;  4M74 A;  2E7X A;  1QNT A;  3TOB A;  2NVU B;  1DDN A;  1NTC A;  1I5Z A;  1W0U A;  4IL6 C;  3Q5F A;  2H94 A;  1ZG3 A;  4HSR A;  1JE8 A;  2FBI A;  4XIC A;  3PO2 J;  2RVC A;  4HA8 A;  5J8C A;  2JVH A;  3K4M A;  3OS1 A;  1PJR A;  3F8N A;  4LG0 B;  4LB5 A;  3J7A Y;  1WH5 A;  3PO3 J;  5FKO A;  3PFI A;  3VPR A;  1R58 A;  2M9H A;  3FDY A;  2BHZ A;  5HLT A;  4QTR A;  5L3B A;  2A61 A;  3GFI A;  4KT6 A;  3DBR B;  2CUZ A;  3EUH C;  2XF7 A;  4HW0 A;  3CC7 I;  2AQF A;  3K6G A;  1MZB A;  2MD0 A;  5DCM B;  3M3Y J;  4V2F A;  1YS6 A;  4MEX F;  2XRL A;  4EMS A;  3IH4 A;  4G8X A;  1HSJ A;  2BYV E;  2FNA A;  5CJ9 A;  1FLI A;  2DFF A;  3CMY A;  4DBR A;  1J0R A;  5IOY A;  1BR4 A;  5D5V B;  4CGZ A;  1GUU A;  1NH3 A;  2PG4 A;  3KZY A;  4UVC A;  2DFI A;  4KMU X;  2A6H F;  4IPA A;  2NOG A;  5JVG F;  3S1M J;  2GIZ A;  1X1D A;  4BXX J;  1LVA A;  5HOO A;  3S2H J;  3BPV A;  4BQQ A;  5H20 A;  3OL3 A;  3TL4 X;  5J47 A;  1IRG A;  3F6O A;  2CU7 A;  4RA2 A;  2ELH A;  3HEF A;  2BW3 B;  2PX9 A;  1IV6 A;  1OYI A;  2ZXI A;  3HOY J;  3SZP A;  3HM5 A;  3KEQ A;  1BC7 C;  3CLQ A;  1R49 A;  2E1C A;  3ABK H;  2RQQ A;  2ZJ2 A;  5GAE J;  3I71 A;  2KZV A;  3DKY A;  2CWE A;  2EFO A;  1D1A A;  1FIA A;  3IKT A;  2DQR A;  2IP2 A;  2P6T A;  3GZ6 A;  1Y6I A;  2COM A;  2J5O A;  4D1Q A;  3D5S C;  3GTO J;  2MYS A;  2ZNZ A;  2PEX A;  1XDS A;  3ZQG A;  3ZXS A;  1S7O A;  3UR3 C;  2IGO A;  5D5X B;  4A6D A;  1OCZ H;  1MJB A;  1BOA A;  3PUF A;  4EJT A;  3I4N J;  1PYV A;  1H9G A;  5IP6 A;  2BEO A;  3FXU A;  3KEO A;  1U78 A;  3E97 A;  4RBO A;  2VE9 A;  2HTJ A;  4IRG A;  3H9J A;  3BLY A;  1FYM A;  1Z3X A;  3V8K A;  1UEL B;  5LHH A;  1U9N A;  2EBI A;  4IF4 A;  2XAG A;  3S17 J;  3J7A O;  3NAR A;  1WI9 A;  3IHU A;  1LDK B;  1FMV A;  3Q3S A;  4HYE A;  3DF8 A;  3HKZ A;  1R9T J;  1NHA A;  2HTS A;  2Z16 A;  3PJR A;  1BA5 A;  1KQ8 A;  2M7A A;  4IHW A;  4EM1 A;  3CME I;  2ELJ A;  2E1O A;  5B1A H;  2HQN A;  3DBL B;  4B47 A;  1P4A A;  1XSV A;  2M30 A;  4CH7 A;  2ZBK A;  3OIP A;  1T95 A;  4LK1 F;  3HRM A;  2KT0 A;  4BKX A;  1X2M A;  2E2J J;  1YQA A;  1STZ A;  4GGG A;  4EJW A;  2FNP A;  2IW5 A;  2LSO A;  2ISY A;  1VQN I;  5B5E C;  2VUM J;  3ASN H;  2I5U A;  2W82 A;  2QSF X;  2QSH X;  3D5R C;  5D8L B;  1Z05 A;  4LMY A;  4E7Z A;  1UG0 A;  3VSK A;  1BI0 A;  5HDK A;  1YOV B;  3T8R A;  1KA8 A;  2E1N A;  5E18 F;  4IHX A;  2MC4 A;  2STT A;  3VB2 A;  1ZLJ A;  3JRD A;  1TZL A;  2M87 A;  1W7P D;  2XPU A;  4CA0 A;  1XPX A;  5EEA A;  3GLL A;  4KIS A;  3H9G A;  2CW8 A;  5K7F A;  1V4R A;  4IHV A;  4A0X A;  1S6L A;  1TP4 A;  3J7Y J;  1LEA A;  1ZAO A;  4MEY F;  4RB0 A;  1MIJ A;  2AHQ A;  5H6Q A;  2L4A A;  3ABU A;  3FXL A;  4FAS D;  3G6E I;  2STW A;  3GYH X;  3OYA A;  4RAY A;  4FX4 A;  2K4B A;  1MMN A;  1LFP A;  3OYK A;  3K70 C;  1H8A C;  4U7B A;  1ZYR F;  3S1R J;  1JKP C;  2GA2 A;  2IGM A;  1BJZ A;  5E8I A;  1ZQ3 P;  3J80 K;  4HF1 A;  3BCB A;  1T98 A;  3LSM A;  5FKN A;  5HS9 A;  3A4C A;  4II2 A;  1R7J A;  1PUF B;  2R3S A;  5E3N A;  3GTL J;  1ETW A;  1KYZ A;  2MLG A;  2YPR A;  4M9S A;  2F5E A;  4AIJ A;  3U2R A;  1J7K A;  1NG6 A;  4AID A;  2DK5 A;  2DCE A;  2HQR A;  1IN6 A;  2DW4 A;  4G7H F;  5EZG A;  4A3L J;  4XRS A;  3F21 A;  3U1D A;  4BY7 J;  1WJB A;  3S3M A;  3NEU A;  4QPQ A;  4D5F A;  2QEN A;  1EH7 A;  1J9I A;  3TDU C;  2Y31 A;  3FMQ A;  2R0Q C;  4XRF A;  3W2W A;  3K4B A;  1XSD A;  2DT6 A;  3EET A;  2P0W A;  4BDZ A;  1ETV A;  2FBH A;  3HOT A;  3BJ6 A;  2O61 A;  4F93 B;  5E3O A;  3GZ5 A;  3HSE A;  3M9A A;  4KA4 A;  4A3K J;  2EZH A;  2BHY A;  2LLK A;  1S9H A;  1ETY A;  2GLO A;  3A0B C;  4LLL A;  5BOX A;  3GFM A;  2BY2 A;  2PMZ A;  1YW7 A;  3AL0 C;  1WHU A;  1H0M A;  2M34 A;  2V4J C;  2DA6 A;  4FT8 A;  4OAZ A;  1MBJ A;  2DTZ A;  1VQL I;  3K0L A;  5LFA A;  4GRI A;  4A3E J;  4E6K G;  1P92 A;  3WGI A;  1IF1 A;  1OCR H;  3WU0 A;  4BL0 B;  2KDO A;  4IVN A;  1F1Z A;  2V9K A;  4ZH4 F;  3T5X A;  3IH2 A;  2IAI A;  1ZGW A;  3BWG A;  3PSF A;  3IWZ A;  1A36 A;  3HOU J;  5M3M J;  3ZP5 A;  3RDI A;  3BQY A;  3I64 A;  2VOO A;  9ANT A;  4EEF G;  2M4G A;  1HDP A;  1H88 C;  2CQK A;  1O3S A;  2HVR A;  2C6Y A;  2JA5 J;  3TDZ C;  3PNV A;  1AU7 A;  2R7Q A;  3TQN A;  3RIR A;  4J19 A;  1AA7 A;  1BI2 A;  5EGO B;  1N77 A;  1GT0 C;  2VE8 A;  1TT5 B;  2PMH A;  5CQG A;  1U5T A;  1R00 A;  4P9F A;  3CP2 A;  2BZT A;  3OL4 A;  2Q8K A;  2CFO A;  4A2U A;  2NS0 A;  2YU3 A;  4DIQ A;  5DM7 F;  2JA7 J;  3DP7 A;  2VXD A;  4BQN A;  2FRH A;  2UV1 A;  4U0Y A;  1YW8 A;  1JXS A;  2V9V A;  4I2O A;  1Z91 A;  4PCQ A;  1OJL A;  3A1Y A;  4IX7 A;  1DP7 P;  2VXZ A;  3L2Q A;  2FMY A;  4IZZ A;  5IY5 H;  3ROU A;  4FCY A;  1QVT A;  2V1N A;  4XON A;  4A3G J;  1BJA A;  3QU6 A;  4HNV A;  2K3P A;  2E2H J;  2KIM A;  2HS5 A;  3I58 A;  2EQR A;  2DPU A;  4L0Z B;  3LSP A;  2NS8 A;  2XDV A;  1S8N A;  3CDH A;  4EM0 B;  2CUF A;  4HNT A;  4XLN F;  1SVL A;  4ENK A;  1RES A;  4LB6 B;  3TP3 A;  2ECB A;  2R5Y B;  2E36 A;  2NAZ A;  5FKL A;  4A3J J;  1G3T A;  2B63 J;  1MGT A;  1NG7 A;  1Z3Y A;  3RTR A;  4F3Q A;  4BXF A;  3WTX C;  1EH6 A;  3CUQ C;  4ZTF A;  2EB7 A;  1HKQ A;  1S72 I;  1V5F A;  4B48 A;  3QYE A;  1ERD A;  2VPL A;  1MJA A;  2F5V A;  2X48 A;  1J09 A;  3GFJ A;  5ILV A;  4Y33 A;  1BL0 A;  4M72 A;  4BQA A;  1D8J A;  5D5W B;  3ZMV A;  4L9J A;  3HOW J;  2D1V A;  1OKR A;  4OOI A;  1RR7 A;  3BY6 A;  3T1B A;  1QZE A;  4E7H A;  4MLO A;  2F5F A;  2YX7 A;  3U9G A;  1WFX A;  4D7N A;  4BY1 J;  3F8C A;  1JTX A;  3TW6 A;  5IYC J;  1FP2 A;  3IL2 A;  4WXD A;  5BPD A;  2BV6 A;  3V42 A;  3I59 B;  2E2I J;  3ZN0 A;  2W48 A;  2O0Y A;  4I0A A;  1WJ5 A;  3ISP A;  3ZMT A;  1IRZ A;  3IUO A;  1UAA A;  1GVJ A;  2VT3 A;  5D6F A;  4DOZ A;  2R7W A;  3HL2 A;  3H3V K;  3OV8 A;  3TOA A;  3J7Z I;  2NNY A;  4Y7N J;  2PJR A;  5B3S H;  5BMZ A;  2NVT J;  4FX0 A;  2K3F A;  3FIW A;  2CV1 A;  3FKJ A;  3BG5 A;  1POG A;  2LD5 A;  2VL8 A;  4XID A;  4PFO A;  2YR2 A;  1Y39 A;  3GTQ J;  1FNN A;  2A5Y B;  2XC7 A;  4CZZ A;  3WGH A;  3FM5 A;  2NS7 A;  4HRI A;  3GWZ A;  5AON A;  2EIL H;  2MGQ A;  2OCC H;  4ZDP A;  1O3Q A;  4ON0 A;  1U3E M;  2VBY A;  2MAB A;  4W1U A;  1JT6 A;  4G6Q A;  5C44 J;  2EIK H;  2LF7 A;  1F43 A;  2GOM A;  4BEH A;  2DU9 A;  2ZJP F;  2IXS A;  4IOC F;  4L18 B;  4HX4 A;  4ABZ A;  1R23 A;  1GV5 A;  1X4P A;  4A3D J;  2ADU A;  2QVO A;  1D3Y A;  1D5V A;  4N4O B;  5D6E A;  4LG0 A;  5JFR A;  2E1M C;  2MH9 A;  4BAY A;  3D0S A;  3S3O A;  2JK3 A;  3JAM Z;  5C4J J;  2FU4 A;  3GFL A;  4RLQ A;  1QU3 A;  3FXJ A;  3TO7 A;  4K2E A;  4HV6 A;  1BR1 A;  3ZQQ A;  1CQT A;  2W00 A;  1XGS A;  5C3E J;  2IS6 A;  4HLX A;  4XBF A;  1UHW A;  2OAZ A;  2JVG A;  2TDX A;  1LDJ A;  4YEL A;  4ESB A;  2HKX A;  3M8J A;  1MNM C;  5J40 A;  1E3H A;  4BJ6 C;  2IRF G;  1FSE A;  4ZDL A;  4RMN A;  1R4M B;  4XK4 A;  1OCT C;  3K7A J;  2HDC A;  3B6C A;  1JKR C;  2AS5 F;  2IS4 A;  3BG7 A;  4A12 A;  3Q0W A;  5GTH C;  2PI0 A;  1EH8 A;  5M3F J;  2ZXH A;  1QRY A;  4IEJ A;  2ME6 A;  1GXQ A;  2A69 F;  2GQQ A;  3CDI A;  2HDW A;  1X1B A;  3WTV C;  4BJ5 C;  2EA4 A;  3N4M A;  3CC4 I;  4FIS A;  2XSD C;  3WE2 A;  1T56 A;  3CMA I;  1FYL A;  1ZRC A;  3HRS A;  3MFK A;  5DTD A;  2M7B A;  3GXO A;  5GAD J;  3MZH A;  1XGO A;  5FFX A;  3C18 A;  2R7Z J;  1W0T A;  4DYC A;  2CW0 F;  2WB1 N;  5KHD A;  2EFN A;  3OYI A;  4E70 A;  5D5U B;  1GDT A;  1F36 A;  1G3Y A;  2R7D A;  3SDG A;  3WU1 B;  3H5N A;  1D1B A;  4TV7 A;  3BR5 A;  1FX7 A;  1SD4 A;  3PL8 A;  3IC7 A;  5CVU A;  5JLW A;  3JR9 A;  3I56 I;  3EUK L;  1UG2 A;  2PMU A;  5KAI C;  4UUT A;  5J3L A;  1T08 B;  5IOZ A;  3QRF F;  3A2K A;  1DU0 A;  2HXO A;  4G6D A;  3CCJ I;  3HTS B;  2KIU A;  2ZO4 A;  4BHB A;  1HOM A;  4L5E A;  4BDY A;  2DAO A;  2P7V B;  2R5Z B;  1KON A;  4M3D A;  2HOE A;  2ZXW H;  5CKT A;  2X4H A;  2H6C A;  3OIQ A;  1HW2 A;  4N9I A;  2DA1 A;  2DJN A;  3F0C A;  2A3S A;  2DOF A;  3M1C A;  4UNO A;  2IS2 A;  1WQ2 A;  3QPL A;  3L2V A;  2OBP A;  3CP8 A;  4A6E A;  4RGS A;  2HEO A;  2EK5 A;  2IS1 A;  5HNH A;  2OF7 A;  4M6V A;  4P55 A;  5DCM A;  2GXA A;  5LEJ A;  3LSI A;  3KEY A;  3SDB A;  4CCK A;  1TL8 A;  2VT2 A;  3TO6 A;  4CIC A;  4XQF A;  3I5U A;  5HS8 A;  1BIB A;  2HOS A;  3OYJ A;  2D45 A;  4HG2 A;  1I3A A;  3DTK A;  5B66 C;  1EV7 A;  2KDZ A;  2FSW A;  3WTY C;  1HF0 A;  3O2P E;  2F6C A;  1W5C C;  2M1B A;  3I54 A;  2IA1 A;  3LMM A;  5EZH A;  3QU3 A;  2EV6 A;  1A04 A;  1EKE A;  3BTJ A;  3FKI J;  1IRX A;  3FXR A;  3V8L A;  2L7K A;  1B4A A;  1OPC A;  2LKX A;  1FYK A;  5EYR A;  3S3N A;  2XKO A;  2R7F A;  4HOB A;  1WCM J;  1V5G A;  5HVQ C;  3BR6 A;  5F1J A;  4EQQ A;  3MVP A;  1G8X A;  2UXN A;  1R6R A;  1K78 B;  2LNB A;  1E17 A;  2K9M A;  4M71 A;  2KP6 A;  2BVL A;  2AXL A;  3ECO A;  3QWL A;  1U9O A;  1T8I A;  2DOA A;  4I98 B;  1DPR A;  1X1P A;  5FO5 A;  2OTL I;  4NBQ A;  4KIC A;  3ZMD A;  4YEJ A;  3HG9 A;  1X2N A;  2FBK A;  2DN0 A;  1FOY A;  3ERE D;  3TO9 A;  1VND A;  4BJT A;  2PN6 A;  4A3C J;  1T33 A;  1SD7 A;  3M8F A;  1OCP A;  2L01 A;  4QPO A;  4D7M A;  5DM6 F;  1T39 A;  4LK0 F;  1YIO A;  2O03 A;  1IXR C;  2LY2 A;  4LFU A;  4QLC U;  2NXN B;  2L7Z A;  3RZO J;  3W6V A;  2GXB A;  4WXC A;  3FXO A;  4P9U A;  2H1K A;  4HX7 A;  3GLX A;  2YS9 A;  1IN7 A;  3P7N A;  1IUF A;  2KPM A;  4U87 A;  4E7I A;  4RB2 C;  4QSH A;  4IO9 F;  3K4N A;  5LHG A;  3MZY A;  4EJO A;  4BEH B;  3H1C A;  2D1H A;  2HFH A;  3QPH A;  2F5C A;  1KU3 A;  6PAX A;  3LL7 A;  1IN8 A;  2LKS A;  1N78 A;  4OIP F;  4WX9 A;  3HOX J;  2BOL A;  1A6I A;  2WY7 Q;  3A0H C;  1YIT I;  2Z99 A;  1WJA A;  4RB1 A;  3V7R A;  3AKZ A;  4A93 J;  3H0D A;  3G2B A;  1QHG A;  1TWF J;  1R1T A;  4A3F J;  3PNT A;  2EIJ H;  1LEB A;  2E19 A;  3HHG A;  2MSY A;  3CO7 C;  4HEA 2;  2OUM A;  3G1M A;  5JI6 A;  1LDD A;  2B9S A;  4ENN A;  1S7E A;  2E7W A;  3IH3 A;  3FXK A;  1DGW Y;  2XPW A;  4Y17 A;  2ZSH B;  2KKO A;  3KLO A;  2RV8 A;  4M73 A;  4LLN A;  3PFY A;  1SMY F;  2QQA A;  5CLS A;  1AKH B;  4B4C A;  2ESN A;  4NC7 A;  3OR1 C;  4UHT A;  4CYD A;  2VJJ A;  4XLH A;  1I50 J;  3VSL A;  3JRH A;  3HPG A;  3RQ4 A;  1TQM A;  4DZP A;  5FFZ A;  1XCV A;  2PMZ N;  3OYM A;  1FT9 A;  4G6T B;  1KU9 A;  3CCQ I;  3L00 A;  4AUX A;  4DNC A;  4EJU A;  3L7W A;  2R92 J;  2O5R A;  1KGS A;  3M1E A;  1TWA J;  3GUD A;  4AIK A;  3BDD A;  5F0C A;  1PUE E;  3HSF A;  2B7E A;  2BBY A;  1JGG A;  5F1R A;  1OCC H;  3RCO A;  1K79 A;  2K40 A;  3BJO A;  2XAQ A;  1HW5 A;  5JR3 A;  2JT1 A;  3DBH B;  2ID3 A;  3GEZ A;  4BNC A;  1VQ6 I;  3C7J A;  4KFC A;  1CF7 B;  3ZQH A;  3OR2 C;  1P7J A;  1T0F A;  2VJ4 A;  3GF2 A;  2ZJQ F;  5BPI A;  3B02 A;  1AKH A;  3HXL A;  4BE0 A;  1ZEL A;  2HOT A;  2RGV A;  2E5Z A;  1KZH A;  2W57 A;  3RSN A;  4KIT B;  3BQZ A;  4LGW A;  4AVP A;  4IJA A;  5GPA A;  3SYT A;  3VWB A;  1BBY A;  1ZRF A;  1U2W A;  3AG4 H;  3OSF A;  4J00 A;  4Y4R A;  4G7Z F;  3WGG A;  1V5E A;  1X3Z B;  1MBE A;  3O6B B;  2K5C A;  2EFW A;  4CUG A;  1J75 A;  2BGC A;  1K7A A;  2DMT A;  5K7Z A;  3C1D A;  4XOP A;  2FQ4 A;  1B8I B;  3HKZ N;  2VBW A;  2XKP A;  2H8R A;  2JUG A;  3QQA A;  2R5Y A;  3G3Z A;  4O5V A;  4XM3 A;  1YFH A;  1BW6 A;  2D2W A;  3VDX A;  2Y0S A;  2JQ7 A;  4U0V A;  2W84 A;  2ZCW A;  1M1E B;  1Q1H A;  3VOD A;  3LSK A;  2BXZ A;  2M2E A;  1QZY A;  1XMK A;  1GXP A;  3PM1 A;  4V2G A;  3OYE A;  1ZRE A;  5D8K B;  2RNJ A;  3CJN A;  3TBI A;  5GAH J;  2P5K A;  5GP9 A;  2L3D A;  3PQJ A;  2FE3 A;  2W24 A;  1O4X A;  1J59 A;  3I0T A;  3TMO A;  5FLM J;  2WTE A;  2QUF A;  3EUA A;  2DJI A;  5EEG A;  4X1E A;  4S0H B;  4C2T A;  1IXC A;  1FJL A;  2VIX A;  3KE2 A;  2KLO A;  2OV7 A;  3FHN A;  4BHC A;  4DW6 A;  4A5N A;  3F8F A;  1UZC A;  2HYF A;  4JX6 A;  2NOJ B;  1I3Q J;  1MD0 A;  2E71 A;  3S16 J;  2OQR A;  2OZU A;  4M6X A;  2X1D A;  2EFP A;  4WWC A;  1RUN A;  1LE8 B;  2Y0M A;  1FP1 D;  4ITV A;  2A6E F;  3J80 Z;  1DU6 A;  3CZ6 A;  3CCU I;  1SC7 A;  1W36 C;  1YG2 A;  2Q1Z B;  1EF4 A;  2KQR A;  4IHY A;  5FLX Z;  1T2K A;  1GV2 A;  3FMR A;  2OU2 A;  3BTL A;  3DV8 A;  3H9Q A;  4OIQ F;  4WK8 F;  3L2R A;  4HST A;  1YX5 A;  2FXA A;  1ZAR A;  2HKO A;  2ZME A;  4KN7 X;  2X51 A;  2P6S A;  3ABT A;  2VC1 A;  4JK1 X;  3KET A;  1A5J A;  3FZV A;  4RS8 A;  3OOU A;  5FRO A;  1S3J A;  5F0H A;  2NYX A;  2XAU A;  4UUV A;  4FET A;  4NNJ A;  1JUP A;  4GXO A;  4NDL A;  2YUS A;  1MW7 A;  3COA C;  4DQ2 A;  1OFC X;  2F4O B;  2LBF B;  3DFG A;  5GPC A;  1Z7L A;  4CCN A;  2GOX B;  3BZ6 A;  4WXH A;  1H89 C;  2WAQ N;  2JMW A;  2O7O A;  2LKP A;  5FRN A;  4F52 A;  1BC8 C;  2RC4 A;  4C3H J;  3K4K A;  3SFI A;  4ZZD A;  3DWL E;  4G9Y A;  5E1X A;  2WBM A;  3DEU A;  4RLF A;  4XSZ F;  1UCR A;  1Y1V J;  2RNG A;  2LC2 A;  5EF6 A;  5FGM A;  4WCG A;  4ZTJ A;  2X9D A;  4MO7 A;  1VI0 A;  2BVM A;  5E3M A;  5ED4 A;  1ZHF A;  4EAT A;  2QLZ A;  3DPU A;  3LA2 A;  2M0C A;  3S32 A;  4L9T A;  2R93 J;  3QPT A;  2JUC A;  1U5T B;  3Q0U A;  4OIO F;  4RAZ A;  2XRO A;  2XGE A;  3W2V A;  3ECH A;  5HDN A;  1R4N B;  1MBH A;  4KMF A;  1K6Y A;  4XOR A;  2LYC A;  1YW9 A;  3HIF A;  1F9N A;  2QBY B;  1SAU A;  2DXI A;  4ZYA A;  2DO7 A;  3WG9 A;  3L9F A;  3BG3 A;  3W3C A;  2VJ5 A;  2LH9 A;  3MN2 A;  4JBA A;  3SEZ A;  3A01 B;  3P9C A;  3CQZ J;  1MKM A;  4PJL A;  4ESF A;  2CW7 A;  5E1Z B;  4CCL A;  4XOT A;  3IKV A;  2K27 A;  4HBL A;  4M3G A;  1ZLK A;  2DQL A;  4FTH A;  1IDZ A;  2X85 A;  1ZGA A;  1SMT A;  3C2H A;  2DDA A;  3N97 A;  2QM3 A;  1FC3 A;  3V8J A;  1ZKG A;  4BE2 A;  1JKQ C;  4OWR B;  4UV9 A;  3E1S A;  4Q4Z F;  3LST A;  5FLX K;  2RRE A;  5FRM A;  4OIN F;  3CJR B;  1JI8 A;  2K7L A;  3OYH A;  4IOA F;  3KLN A;  5E3L A;  4XKW A;  1L0O C;  1BN5 A;  2GIV A;  2XGX A;  3AG3 H;  1RUO A;  3AG1 H;  4GDF A;  2F4I A;  1SAN A;  1G3S A;  3K69 A;  3OYD A;  1QQI A;  1P9Q C;  4XRS G;  2ICW G;  1A31 A;  1RET A;  1DP3 A;  4LOC A;  2JA2 A;  2V6C A;  3F9K A;  4KJZ A;  4JOM A;  4XKB A;  2E34 A;  2VQL A;  3BTI A;  3KFW X;  4JX4 A;  4GO1 A;  4BAC A;  2O3F A;  1PP7 U;  1O3T A;  2L0K A;  4R8H A;  3JCU C;  2KMU A;  5HLI A;  2HYG D;  1OCO H;  3K1P A;  1XB4 A;  4RGX A;  4XLC A;  4IHT A;  3ASO H;  3LA7 A;  3RI4 A;  4MTD A;  3Q9V A;  4AC0 A;  4C2M J;  3N05 A;  3FHZ A;  4MQV A;  3CUQ A;  2LRE A;  2E60 A;  1HC8 A;  2OD5 A;  1R71 A;  2BY0 A;  3FBN B;  2P5L C;  3L2U A;  2Y69 H;  3IAS 2;  3HBL A;  2JPC A;  1WKM A;  4LIV A;  3BT9 A;  2JJ7 A;  5K5O A;  3S8P A;  1K78 A;  2LRD A;  1QHH D;  4NC6 A;  1WVR A;  1ZH5 A;  3KP7 A;  4AWX B;  2K02 A;  1Y0U A;  2ELK A;  2G9W A;  2FOK A;  5FJ8 J;  3OYC A;  4OMY A;  2AQE A;  3S1N J;  4E7J A;  2L2O A;  3DTI A;  3AG2 H;  3AFH A;  2VJI A;  3MZ8 A;  1E0E A;  5ILU A;  2QCO A;  3RKQ A;  1FSH A;  1IAW A;  2CV2 A;  1B9M A;  1O57 A;  2VON A;  2WAE A;  2V1U A;  3JW4 A;  3HYI A;  2XPV A;  5F64 A;  3L09 A;  5IYB J;  4MFD A;  2ZFU A;  4XLF A;  5IT3 A;  1ETO A;  3HC7 A;  4ENM A;  4CCM A;  2VI6 A;  2HNH A;  3H5R A;  2VBZ A;  2RQP A;  4E7K A;  1A35 A;  1T38 A;  4M3F A;  4LIT A;  5LRR A;  1U5T C;  1K4S A;  5AIQ A;  2CUE A;  1F5T A;  2VN2 A;  2O8K A;  2HQ5 A;  2FUG 2;  1F4K A;  3H3Z A;  1HA8 A;  1X1A A;  1W5T A;  5DUK A;  2IGK A;  2L4M A;  1ZR4 A;  2X1C A;  3V4G A;  1PVE A;  4WF2 A;  1RC9 A;  4FE7 A;  4CDG A;  1XSX A;  3G73 A;  2R7S A;  2CG4 A;  3CCL I;  1VF9 A;  2DDB A;  3E6C C;  5IP7 J;  4M3E A;  3D5L A;  5EG0 A;  2UXX A;  4B8X A;  1K61 A;  4XLE A;  2VPR A;  1ACI A;  4KIG A;  2XHK A;  4HNU A;  3FMS A;  4RAG A;  5L3F A;  4JYK A;  4OIR F;  2TCT A;  4FHT A;  5LGT A;  1XX5 A;  2H6B A;  2QQB A;  4M6Y A;  3ML6 A;  4E7L A;  4W97 A;  1YO5 C;  2A6T A;  5J1U A;  2OTJ I;  3BG9 A;  2XV4 S;  5EJC A;  1FBQ A;  1UHS A;  4BBR J;  4BYY A;  1P7I A;  4OMZ A;  1EJ9 A;  1D0Z A;  2VC0 A;  1D1C A;  3WG7 H;  2WAD A;  1LQ1 A;  2R7R A;  1QO0 D;  3G1L A;  1X4O A;  3WU2 C;  1WH7 A;  1ZN2 A;  2ZFW A;  1ETK A;  2BE5 F;  1MND A;  2WA0 A;  4JX5 A;  2DPD A;  4B1R A;  3KYD B;  3JRG A;  1IRF A;  3BJA A;  1P4W A;  5M5W J;  2LDU A;  2XIG A;  3HSR A;  2EV0 A;  3U1K A;  1YS7 A;  1PDN C;  1REP C;  1D0X A;  1R1V A;  2W4S A;  4RGR A;  1MDM A;  3GBG A;  1N25 A;  3EUH A;  3FIS A;  1I1G A;  2DBB A;  3ZQI A;  4PSX A;  3S93 A;  5LLQ A;  2F4M B;  3LSJ A;  3R0A A;  4LD5 A;  1O7L A;  4BHP A;  3MKZ A;  1FMW A;  4PGG A;  4PJN A;  3IP4 B;  1J5Y A;  4UV8 A;  4UXN A;  3RKY A;  4Y3O A;  1QPM A;  3JTG A;  2W7N A;  4AVZ A;  2Z9O A;  3MCZ A;  2A05 A;  5J4Y A;  1B6A A;  2CRG A;  2MD5 A;  2JN6 A;  1LFU P;  3DKX A;  4CZC A;  4UB6 C;  2JTV A;  4XN0 A;  1HW1 A;  1TT0 A;  3GO5 A;  2RDP A;  3KCC A;  4CSW A;  2DMN A;  5FKK A;  1B1B A;  2ZNY A;  3SJM A;  1YJ9 I;  3PUB A;  1RNL A;  3QOD A;  5IP9 J;  3HRT A;  3RJP A;  3S1Q J;  1BOB A;  2CH0 A;  2M45 A;  4EGY A;  1VQM I;  4EVI A;  1NK3 P;  3ZR8 X;  3KYC B;  3MKY B;  2Z33 A;  2W1O A;  3OWT A;  3JRF A;  2EA2 A;  2JWT A;  1MBF A;  3DU5 A;  1ZK8 A;  5EDN A;  2UWM A;  1Y56 A;  2DMU A;  2DLL A;  4PZJ A;  3H0G J;  3K1M A;  4X0G A;  3FXM A;  2OZ6 A;  4LLG F;  1HBX G;  3CD6 I;  3CMM A;  5CQE A;  2QQ9 A;  5DV5 A;  3VFZ A;  3BPX A;  2ZSI B;  2IA0 A;  2KJB A;  1SD6 A;  4Y13 A;  2E5N A;  3KP5 A;  2VAS A;  2X1E A;  4UVB A;  3IAM 2;  1DUX C;  3CCR I;  4ETS A;  5H2F C;  3OS2 A;  5TGT A;  2DA7 A;  2NVX J;  3ZQF A;  1SVO A;  3ZQ7 A;  1TW3 A;  3K2A A;  4KIF A;  3K4J A;  1S29 A;  3G1O A;  3U21 A;  2DOE A;  1IO2 A;  2VB6 A;  2DT7 B;  1E2X A;  2KJC A;  4AIH A;  5LRS A;  1ORK A;  2Q2E A;  5F08 A;  4HLY A;  1FIP A;  3QYF A;  1WZ2 A;  2QBY A;  4NUB A;  1TBX A;  1ON1 A;  1K83 J;  2CGP A;  4OU0 A;  1BI1 A;  3HTU A;  3E5U A;  4PK4 A;  3QOE A;  1I39 A;  3I53 A;  3ONQ A;  1TWC J;  2HU9 A;  2G0E A;  1FOX A;  2L54 A;  2P8T A;  2VKE A;  2WAF A;  4EV0 A;  2FD5 A;  2L9S A;  2MBF A;  4C3I J;  3F8B A;  5F6F A;  3CCS I;  2IA2 A;  4I99 C;  1Q1V A;  3E5Q A;  2RAE A;  1ONV A;  4HPQ A;  2M3A A;  3E7L A;  1Y1W J;  1YTY A;  1MSF C;  3ZQC A;  3H5A A;  3DEW A;  1VQ5 I;  2J5P A;  5F0F A;  1D8K A;  3G4S I;  1FOW A;  1A6Q A;  3MQ0 A;  1YJN I;  2JZY A;  5DDG A;  2L02 A;  3HUG B;  3HPH A;  4MTE A;  4DGW B;  5DD4 A;  2JRM A;  3BRO A;  1TLH B;  5FB2 A;  3TGN A;  5A2Q K;  3HGY A;  1UJ8 A;  2R4G A;  2VQC A;  2YX4 A;  2ZXJ A;  5L3E A;  5LGN A;  3KP2 A;  3LFU A;  3LQQ A;  1W5S A;  2G7H A;  1MH4 A;  1NK2 P;  2R7V A;  3PNY A;  4XSX F;  1D0Y A;  1IN5 A;  4AU7 A;  3REO A;  3JRC A;  3OYL A;  3PIP F;  3B73 A;  2M5W A;  3CF2 A;  5IT9 K;  4CYC B;  4LIU A;  1VQ8 I;  3BR1 A;  3VEP A;  5BQT A;  1YE9 A;  3E3V A;  4BE1 A;  1MMA A;  3DTE A;  1PUF A;  2F5D A;  4UB8 C;  2X0L A;  4UY8 I;  1LUJ B;  1FEX A;  2KIF A;  3NWS A;  2F48 A;  3NWT A;  3WTZ A;  3R0J A;  4G7O F;  1E3P A;  4CCO A;  5IT9 Z;  3JAM K;  4JP0 A;  1O3R A;  1GHC A;  2VKV A;  5TIS C;  4HV5 A;  3X2Q H;  4YIF A;  2VOP A;  1P4X A;  1WJE A;  3DPT A;  1VZ0 A;  5CVV A;  2DA2 A;  1FBU A;  3SHF A;  3FX3 A;  3KZI C;  4FE4 A;  3KP4 A;  1SEU A;  2X6O A;  3KP3 A;  1T0F C;  1KQ0 A;  4CCJ A;  2GBY A;  1RKT A;  2Q2E B;  3QAH A;  5TRD A;  5E1W A;  4E7S A;  3C3W A;  2FJ1 A;  4I6Z A;  2I8D A;  5K1Y A;  2R7O A;  4YFN F;  1Z77 A;  2P5V A;  3VYR B;  2PLY A;  2DA5 A;  3MEX A;  4U88 A;  2QZ8 A;  3DEE A;  3CJT B;  3FBI B;  4DJA A;  4QIW N;  2CYY A;  2EIN H;  2QKM B;  2M0M A;  4HX8 A;  3KPH A;  5ICE A;  3MKL A;  4AD9 A;  3E6M A;  1ZTR A;  2N8G A;  1HST A;  3DPL C;  2HZD A;  2MH2 A;  3QP6 A;  3SZT A;  1H9T A;  2NVY J;  5LBQ A;  3LNQ A;  4A3I J;  1AHD P;  5CYV A;  3S2D J;  4ZJZ A;  5L3G A;  4Y52 J;  2CSO A;  4MFE A;  3RZD J;  1SAX A;  2HOA A;  2MLK A;  2P4W A;  1BR2 A;  2COB A;  3CCE I;  3OMY A;  1X3W B;  2XRN A;  5KNL A;  4O3M A;  3DLA A;  3V7S A;  4N9H A;  4PFP A;  3OSG A;  3IRQ A;  2ISZ A;  4NQW B;  2XF5 A;  3LSH A;  2IEK A;  5E20 A;  3SZG A;  4LG3 A;  2K85 A;  3KZZ A;  2MA3 A;  1XGM A;  2V9P A;  4YII A;  4Z6Y A;  2GZW A;  3LFK A;  5DYM A;  2XGD A;  4KNY A;  1Y8R B;  4A0Z A;  3MD2 A;  1B9N A;  2XGC A;  3WTT C;  1XG1 A;  4M9X A;  2QQ8 A;  2HWV A;  1B72 A;  3M4O J;  3S15 J;  2WAQ A;  4B3A A;  2ZME C;  3TKY A;  1SFU A;  1CF7 A;  3GCM A;  2UZK A;  2LVS A;  2Y2Z A;  4HQM A;  5M5Y J;  1SFX A;  2Y0S N;  2CJJ A;  3Q0V A;  4N0B A;  1R36 A;  3HOV J;  2EPF A;  2Y48 A;  4XRM A;  2LOO A;  2V26 A;  4BGD A;  1AWC A;  1MBK A;  1J2X A;  2FA5 A;  2KL4 A;  5H6R A;  2B0L A;  1Y0N A;  2L7M P;  4H4K C;  2VBX A;  3BG6 A;  2PBI A;  2KRH A;  1RPW A;  2Q0O A;  5J8F A;  2WWY A;  3DKW A;  3L2W A;  1TC3 C;  2NRA C;  1Z9C A;  3HDD A;  1KU7 A;  2DFH A;  3ELK A;  1AOY A;  1FY7 A;  4YRV A;  4L0Y B;  3ZPL A;  2HVS A;  2LG4 A;  3H3U A;  3ZMU A;  2DMQ A;  1RIO H;  2R7U A;  2E35 A;  1FTT A;  3HOS A;  3WOD F;  4EM2 A;  1IZ1 A;  1B59 A;  5F27 A;  4F55 A;  1ULY A;  2GA1 A;  2IPQ X;  4DYQ A;  3OOP A;  3WTW C;  4GCV A;  5GAG J;  4DBQ A;  1I6X A;  1V54 H;  1Y8Q B;  3QOP A;  2ZB9 A;  3KYL A;  4BXU A;  1KU2 A;  5JLX A;  2IVM A;  2JSP A;  4Q5S F;  1Z1D A;  2CQQ A;  2L9R A;  4ZYH A;  3ABM H;  1XMA A;  2VQH A;  3OYN A;  2ECC A;  3K9T A;  4E4H A;  4C30 A;  3W6K B;  1DPU A;  3O8G A;  2XUB A;  3K4L A;  4ZZL A;  3VYS B;  2ETH A;  4QWQ A;  3WTS C;  1ZGJ A;  2EZK A;  2LFB A;  4FQG A;  3LOC A;  3GTJ J;  3HZJ A;  2CO5 A;  5E8G A;  1HKS A;  1V3F A;  1WJC A;  2V1D A;  2NNN A;  4PUS A;  4BQO A; 
#chains in the Genus database with same CATH homology
 4G94 A;  2A68 F;  5D4S A;  4R79 A;  1PP8 F;  4HF2 A;  1Z7U A;  1OR7 A;  1Z6R A;  3ZN1 A;  4HDV A;  3DQV C;  3L2C A;  3CUO A;  3T8T A;  4JQF A;  3SFZ A;  2DI3 A;  5JVT A;  3EYI A;  3NQO A;  4PGH A;  3RPU A;  5FD6 A;  4ZYE A;  2FEZ A;  5DUI A;  4GYG A;  1YYV A;  5TJJ A;  1I1S A;  3HHH A;  4A0Y A;  5E17 F;  3LAP A;  1OYW A;  4I01 A;  4NB5 A;  4ENJ A;  4IRH A;  3QP5 A;  2XAH A;  4I09 A;  5LEK A;  3ZMZ A;  1KQ9 A;  2LF8 A;  3V7C A;  1XN7 A;  3JSP A;  2V1X A;  2G7U A;  1RZ4 A;  4I02 A;  2P7C B;  3WTU C;  3F6V A;  1ZG1 A;  3SXY A;  3LA3 A;  4HDU A;  3P9I A;  1OYY A;  1I27 A;  4S04 A;  1ZRD A;  2GXG A;  1UB9 A;  5CVR A;  5EEH A;  5AIP A;  3RPQ A;  5KK1 A;  1KYW A;  2EWN A;  2F2E A;  4MNU A;  3F8M A;  1XD7 A;  3CUQ B;  2MC3 A;  3FM3 A;  4Q47 A;  4ZYD A;  1HXD A;  1FWZ A;  3W6J B;  4Z2Y A;  1T6S A;  2XAS A;  1TNS A;  4L5J A;  3BP8 A;  3R60 A;  1TQP A;  2ZME B;  5ERI A;  1R1U A;  3CTA A;  5CVI A;  2HR3 A;  1ON2 A;  2M8E A;  3IRR A;  1QGP A;  4YFX F;  3HRU A;  5FD5 A;  1U8R A;  2QWW A;  5HS7 A;  3GVA A;  2OA4 A;  4KUM A;  4GYI A;  2V79 A;  3F3X A;  4RB3 C;  2HGC A;  1IN4 A;  5A2Q Z;  1L3L A;  3MWM A;  4MQ9 F;  3FF5 A;  1Z6T A;  2EFQ A;  3M7G A;  1XDU A;  1VTN C;  2OQG A;  4KN4 X;  3J81 K;  3LAJ A;  1HQC A;  3DXJ F;  3S2W A;  3HUG A;  3ULQ B;  1OMI A;  3E5X A;  4ZYG A;  4M9Z A;  4B09 A;  1IXS B;  2JRT A;  2JSC A;  4A5M A;  2XVC A;  4UVA A;  3MAJ A;  1R5G A;  2K4J A;  2ACJ A;  1W7P B;  4KT5 C;  5KVR A;  1WRJ A;  4IHS A;  3KP6 A;  4ESJ A;  3WE3 A;  3BOQ A;  1UST A;  3RYR A;  4KIB A;  4HQE A;  1C0W A;  2CFX A;  3O3K A;  3T0Y A;  3F22 A;  4U0W A;  1G4D A;  1ODD A;  1FZP B;  2W25 A;  1HKT A;  2IT0 A;  2JPB A;  2Y75 A;  4EJV A;  2PFB A;  1BI3 A;  1QZZ A;  4LJZ F;  4EGZ A;  1JGS A;  5ICC A;  1G6N A;  4U7D A;  3RYP A;  1IUY A;  1TQI A;  3ZMS A;  5DD8 A;  5D4R A;  4NQW A;  3I4P A;  1R22 A;  3GW2 A;  1S7A A;  4L5I A;  5JHU A;  1FPQ A;  4IRI A;  3M8E A;  5L3C A;  3Q9S A;  4RGU A;  2H09 A;  3F23 A;  5HLG A;  2DK8 A;  4F7Z A;  2RKH A;  2FF4 A;  4HF0 A;  3NRV A;  2W85 A;  3EYY A;  1ZG5 A;  3EQL F;  1G3W A;  2WV0 A;  2KRF A;  2YSR A;  1P6R A;  3F72 A;  1TNT A;  2RN7 A;  1K6O A;  3JTH A;  4MGR A;  3E6D A;  3PQK A;  2GAU A;  3EDP A;  4PDK A;  3RKX A;  2XAF A;  1JHH A;  3GX4 X;  4KYW A;  1O7F A;  1TTY A;  4ASN A;  4IXA A;  2HZT A;  3JSO A;  4P96 A;  3IWF A;  1BIA A;  1W7P A;  4I0B A;  3I59 A;  5ICF A;  4H0E A;  1W4M A;  2O8X A;  3FWE A;  3P9K A;  4CO8 A;  3FXQ A;  1RI7 A;  5ILS A;  4Y15 A;  1U6G A;  2O6G E;  3H92 A;  1FOK A;  2PQ8 A;  1TW2 A;  1LJ9 A;  3AAF A;  5LHI A;  4MHG A;  1USS A;  3RKW A;  4P5O A;  5CVJ A;  2PJP A;  4BH9 A;  4L9N A;  3VOE A;  1BM9 A;  4HZF A;  2WC2 A;  1XCB A;  5K5R A;  2H27 A;  3R61 A;  3K1N A;  2Z3Y A;  1X3U A;  4NHJ A;  1SD5 A;  2DTR A;  4O6J A;  5HLH A;  1SFE A;  2ESH A;  3LQR A;  4I7H A;  5ICG A;  2VOD A;  3CLO A;  4L9V A;  1LNW A;  5K5Q A;  1R5H A;  2EJR A;  5L3D A;  2K86 A;  4R1H A;  1MDM B;  1UHM A;  4CHU A;  1QBJ A;  5DEQ A;  2QYO A;  5LGU A;  3R6S A;  2GWR A;  5J6X A;  1XGN A;  4YFK F;  3J81 Z;  1WSU A;  2DT5 A;  4Q48 A;  1CGP A;  2EV5 A;  1P2F A;  4D0P A;  1FBS A;  5HDG A;  4CXF A;  5BS6 A;  2FQ3 A;  1MJ9 A;  1WWX A;  3CO6 C;  2A07 F;  4HAM A;  4YG2 F;  2IJL A;  1UFM A;  2ZKZ A;  4KDP A;  3R4K A;  1IW7 F;  1JHF A;  5DCF A;  3K2Z A;  1YLF A;  3E6B A;  2XAJ A;  2Z5U A;  1LB2 A;  2FML A;  4S05 A;  3LWF A;  4XLP F;  3SQN A;  4M74 A;  2E7X A;  1QNT A;  3TOB A;  1DDN A;  1I5Z A;  3Q5F A;  2H94 A;  1ZG3 A;  1JE8 A;  2FBI A;  2RVC A;  4HA8 A;  5J8C A;  3F8N A;  4LG0 B;  4LB5 A;  3PFI A;  1R58 A;  5L3B A;  2A61 A;  3GFI A;  4HW0 A;  1MZB A;  5DCM B;  1YS6 A;  4MEX F;  4EMS A;  4G8X A;  1HSJ A;  2BYV E;  2FNA A;  5CJ9 A;  1FLI A;  1J0R A;  5D5V B;  4CGZ A;  2PG4 A;  3KZY A;  4UVC A;  2DFI A;  4KMU X;  2A6H F;  4IPA A;  1LVA A;  5HOO A;  3BPV A;  5H20 A;  1IRG A;  3F6O A;  2ELH A;  1OYI A;  3SZP A;  3KEQ A;  1BC7 C;  2E1C A;  2ZJ2 A;  3I71 A;  2CWE A;  2EFO A;  3IKT A;  2DQR A;  2IP2 A;  2P6T A;  3GZ6 A;  2COM A;  2J5O A;  2ZNZ A;  2PEX A;  1XDS A;  1S7O A;  5D5X B;  4A6D A;  1MJB A;  1BOA A;  4EJT A;  1H9G A;  2BEO A;  3FXU A;  3KEO A;  1U78 A;  3E97 A;  2VE9 A;  2HTJ A;  4IRG A;  1FYM A;  3V8K A;  5LHH A;  4IF4 A;  2XAG A;  3J7A O;  1WI9 A;  3IHU A;  1LDK B;  4HYE A;  3DF8 A;  1NHA A;  2HTS A;  1KQ8 A;  4EM1 A;  2HQN A;  1P4A A;  1XSV A;  2M30 A;  2ZBK A;  4LK1 F;  3HRM A;  1YQA A;  1STZ A;  4GGG A;  4EJW A;  2FNP A;  2IW5 A;  2LSO A;  2ISY A;  5D8L B;  1Z05 A;  4LMY A;  1BI0 A;  5HDK A;  3T8R A;  1KA8 A;  2E1N A;  5E18 F;  2STT A;  3VB2 A;  1ZLJ A;  2M87 A;  1W7P D;  1V4R A;  4A0X A;  1S6L A;  1LEA A;  1ZAO A;  4MEY F;  4RB0 A;  5H6Q A;  2L4A A;  3ABU A;  2STW A;  3GYH X;  4RAY A;  4FX4 A;  2K4B A;  4U7B A;  1ZYR F;  2GA2 A;  5E8I A;  4HF1 A;  3J80 K;  1T98 A;  5HS9 A;  1R7J A;  2R3S A;  1KYZ A;  2MLG A;  2YPR A;  4M9S A;  2F5E A;  4AIJ A;  3U2R A;  1J7K A;  2DK5 A;  2HQR A;  1IN6 A;  2DW4 A;  4G7H F;  3F21 A;  3U1D A;  3NEU A;  2QEN A;  1EH7 A;  1J9I A;  3TDU C;  3FMQ A;  4XRF A;  1XSD A;  3EET A;  2FBH A;  3HOT A;  3BJ6 A;  2O61 A;  3GZ5 A;  3HSE A;  3M9A A;  4KA4 A;  4LLL A;  5BOX A;  3GFM A;  1YW7 A;  1H0M A;  4FT8 A;  3K0L A;  1P92 A;  3WGI A;  1IF1 A;  3WU0 A;  4IVN A;  1F1Z A;  4ZH4 F;  3T5X A;  3BWG A;  3IWZ A;  3ZP5 A;  3RDI A;  3I64 A;  2VOO A;  2CQK A;  1O3S A;  2C6Y A;  3TDZ C;  3TQN A;  3RIR A;  1BI2 A;  2VE8 A;  2PMH A;  1U5T A;  1R00 A;  4P9F A;  2Q8K A;  4A2U A;  2NS0 A;  2YU3 A;  3DP7 A;  2FRH A;  4U0Y A;  1YW8 A;  1JXS A;  2V9V A;  4I2O A;  1Z91 A;  4PCQ A;  1DP7 P;  2VXZ A;  2FMY A;  3ROU A;  1BJA A;  3QU6 A;  2KIM A;  2HS5 A;  3I58 A;  2DPU A;  4L0Z B;  1S8N A;  3CDH A;  4EM0 B;  4XLN F;  4ENK A;  4LB6 B;  2NAZ A;  1G3T A;  1MGT A;  3RTR A;  3WTX C;  1EH6 A;  3CUQ C;  2EB7 A;  1HKQ A;  1MJA A;  3GFJ A;  5ILV A;  4BQA A;  4M72 A;  1D8J A;  5D5W B;  3ZMV A;  4L9J A;  2D1V A;  1OKR A;  4OOI A;  3BY6 A;  3T1B A;  2F5F A;  2YX7 A;  3U9G A;  3F8C A;  3IL2 A;  5BPD A;  1FP2 A;  4WXD A;  2BV6 A;  3I59 B;  3ZN0 A;  4I0A A;  2O0Y A;  3ISP A;  3ZMT A;  1GVJ A;  2VT3 A;  5D6F A;  3OV8 A;  3TOA A;  2NNY A;  5BMZ A;  4FX0 A;  2YR2 A;  1FNN A;  2A5Y B;  4CZZ A;  3WGH A;  3FM5 A;  3GWZ A;  5AON A;  1O3Q A;  4ON0 A;  1U3E M;  2VBY A;  4G6Q A;  2LF7 A;  2DU9 A;  4L18 B;  4HX4 A;  1R23 A;  2ADU A;  2QVO A;  1D3Y A;  1D5V A;  5D6E A;  4LG0 A;  5JFR A;  2MH9 A;  4BAY A;  3D0S A;  3JAM Z;  2FU4 A;  3GFL A;  3TO7 A;  4K2E A;  4HV6 A;  1XGS A;  4HLX A;  4XBF A;  1UHW A;  2OAZ A;  2TDX A;  1LDJ A;  4ESB A;  2HKX A;  2IRF G;  1FSE A;  2HDC A;  2AS5 F;  4A12 A;  2PI0 A;  1EH8 A;  1GXQ A;  2A69 F;  2GQQ A;  3WTV C;  2EA4 A;  3N4M A;  1FYL A;  3WE2 A;  1ZRC A;  3HRS A;  3MFK A;  3GXO A;  3MZH A;  1XGO A;  5FFX A;  3C18 A;  2CW0 F;  2EFN A;  4E70 A;  5D5U B;  1G3Y A;  2R7D A;  3WU1 B;  4TV7 A;  5CVU A;  1FX7 A;  1SD4 A;  3IC7 A;  2PMU A;  3QRF F;  4G6D A;  3HTS B;  2KIU A;  2ZO4 A;  4BHB A;  2DAO A;  2P7V B;  2HOE A;  2X4H A;  2H6C A;  1HW2 A;  4N9I A;  2A3S A;  4UNO A;  1WQ2 A;  2OBP A;  4A6E A;  4RGS A;  2HEO A;  2EK5 A;  4P55 A;  5DCM A;  5LEJ A;  2VT2 A;  3TO6 A;  4CIC A;  3I5U A;  5HS8 A;  1BIB A;  2D45 A;  1EV7 A;  2FSW A;  3WTY C;  3O2P E;  2M1B A;  3I54 A;  2IA1 A;  3QU3 A;  2EV6 A;  1A04 A;  3FXR A;  3V8L A;  1B4A A;  1OPC A;  1FYK A;  2XKO A;  2R7F A;  4HOB A;  5HVQ C;  4EQQ A;  2UXN A;  1K78 B;  2LNB A;  1E17 A;  4M71 A;  2AXL A;  3ECO A;  4I98 B;  1DPR A;  5FO5 A;  4KIC A;  3ZMD A;  2FBK A;  3ERE D;  3TO9 A;  2PN6 A;  1SD7 A;  3M8F A;  1T39 A;  2L01 A;  4LK0 F;  1YIO A;  2O03 A;  1IXR C;  4LFU A;  4QLC U;  2GXB A;  4WXC A;  4P9U A;  4HX7 A;  3GLX A;  1IN7 A;  3P7N A;  4RB2 C;  5LHG A;  3MZY A;  4EJO A;  2D1H A;  2HFH A;  3QPH A;  2F5C A;  1KU3 A;  6PAX A;  1IN8 A;  4OIP F;  4WX9 A;  2Z99 A;  4RB1 A;  3V7R A;  1R1T A;  1LEB A;  3HHG A;  3CO7 C;  5JI6 A;  1LDD A;  4ENN A;  2E7W A;  4Y17 A;  2KKO A;  3KLO A;  2RV8 A;  4M73 A;  4LLN A;  1SMY F;  2QQA A;  5CLS A;  2ESN A;  4UHT A;  4CYD A;  1TQM A;  5FFZ A;  1XCV A;  1FT9 A;  1KU9 A;  3L00 A;  4DNC A;  4EJU A;  3L7W A;  1KGS A;  3M1E A;  3GUD A;  4AIK A;  3BDD A;  1PUE E;  3HSF A;  2BBY A;  5F1R A;  1K79 A;  3BJO A;  2XAQ A;  1HW5 A;  5JR3 A;  2JT1 A;  3GEZ A;  4BNC A;  3C7J A;  4KFC A;  1CF7 B;  1T0F A;  3GF2 A;  5BPI A;  3B02 A;  2RGV A;  2W57 A;  4LGW A;  4AVP A;  4IJA A;  1BBY A;  1ZRF A;  1U2W A;  4G7Z F;  3WGG A;  3O6B B;  2EFW A;  1J75 A;  2BGC A;  1K7A A;  3C1D A;  2VBW A;  2XKP A;  3G3Z A;  4O5V A;  1YFH A;  2D2W A;  4U0V A;  2W84 A;  2ZCW A;  1Q1H A;  3VOD A;  1QZY A;  1XMK A;  1GXP A;  1ZRE A;  5D8K B;  2RNJ A;  3CJN A;  2P5K A;  2L3D A;  3PQJ A;  2FE3 A;  2W24 A;  1J59 A;  3I0T A;  2WTE A;  2QUF A;  5EEG A;  1IXC A;  3KE2 A;  4BHC A;  4A5N A;  3F8F A;  2HYF A;  1MD0 A;  2OQR A;  2OZU A;  4M6X A;  1RUN A;  2EFP A;  4WWC A;  2Y0M A;  1FP1 D;  3J80 Z;  2A6E F;  1YG2 A;  5FLX Z;  1T2K A;  3FMR A;  2OU2 A;  3DV8 A;  4OIQ F;  4WK8 F;  2FXA A;  1ZAR A;  2HKO A;  2ZME A;  4KN7 X;  2P6S A;  3ABT A;  2VC1 A;  4JK1 X;  3KET A;  3FZV A;  4RS8 A;  1S3J A;  2NYX A;  4UUV A;  4GXO A;  3COA C;  4DQ2 A;  3DFG A;  3BZ6 A;  4WXH A;  2LKP A;  1BC8 C;  2RC4 A;  4ZZD A;  4G9Y A;  5E1X A;  3DEU A;  4XSZ F;  1UCR A;  5FGM A;  4WCG A;  5ED4 A;  1ZHF A;  2QLZ A;  3LA2 A;  4L9T A;  3QPT A;  1U5T B;  4OIO F;  4RAZ A;  2XRO A;  3ECH A;  5HDN A;  4KMF A;  1YW9 A;  3HIF A;  1F9N A;  2QBY B;  2DO7 A;  3WG9 A;  3L9F A;  4JBA A;  3P9C A;  1MKM A;  4ESF A;  5E1Z B;  3IKV A;  2K27 A;  4HBL A;  1ZLK A;  2DQL A;  1ZGA A;  1SMT A;  3N97 A;  2QM3 A;  1FC3 A;  3V8J A;  4UV9 A;  4Q4Z F;  3LST A;  5FLX K;  4OIN F;  2K7L A;  3KLN A;  1L0O C;  1BN5 A;  2GIV A;  2XGX A;  1RUO A;  1G3S A;  3K69 A;  1QQI A;  2V6C A;  3KFW X;  4GO1 A;  1PP7 U;  2O3F A;  1O3T A;  4R8H A;  5HLI A;  2HYG D;  3K1P A;  1XB4 A;  4RGX A;  4IHT A;  3LA7 A;  3RI4 A;  4MTD A;  3Q9V A;  3FHZ A;  4MQV A;  3CUQ A;  2OD5 A;  2P5L C;  2JPC A;  1WKM A;  5K5O A;  1K78 A;  1ZH5 A;  3KP7 A;  4AWX B;  2K02 A;  1Y0U A;  2G9W A;  2FOK A;  4OMY A;  5ILU A;  1FSH A;  1IAW A;  1B9M A;  1O57 A;  2VON A;  2V1U A;  3JW4 A;  3HYI A;  5F64 A;  3L09 A;  5IT3 A;  4ENM A;  2VBZ A;  2RQP A;  1T38 A;  5LRR A;  1U5T C;  5AIQ A;  1F5T A;  2VN2 A;  1F4K A;  3H3Z A;  1W5T A;  5DUK A;  2L4M A;  3V4G A;  4WF2 A;  4CDG A;  1XSX A;  3G73 A;  2CG4 A;  3E6C C;  3D5L A;  2UXX A;  4B8X A;  4KIG A;  2XHK A;  3FMS A;  5L3F A;  4OIR F;  4FHT A;  5LGT A;  4M6Y A;  2H6B A;  2QQB A;  3ML6 A;  1YO5 C;  2XV4 S;  1FBQ A;  4BYY A;  4OMZ A;  2VC0 A;  1LQ1 A;  1QO0 D;  1ZN2 A;  2ZFW A;  2BE5 F;  2DPD A;  1IRF A;  3BJA A;  1P4W A;  2LDU A;  2XIG A;  3HSR A;  2EV0 A;  1YS7 A;  1PDN C;  1REP C;  1R1V A;  4RGR A;  1MDM A;  3EUH A;  1I1G A;  2DBB A;  5LLQ A;  3R0A A;  4LD5 A;  4BHP A;  1O7L A;  4PGG A;  4UXN A;  4UV8 A;  1J5Y A;  3RKY A;  3JTG A;  1QPM A;  2Z9O A;  3MCZ A;  1B6A A;  2MD5 A;  2JTV A;  1HW1 A;  3GO5 A;  2RDP A;  3KCC A;  1B1B A;  2ZNY A;  1RNL A;  3HRT A;  3RJP A;  2M45 A;  4EGY A;  4EVI A;  2Z33 A;  2EA2 A;  2UWM A;  2DLL A;  4PZJ A;  3K1M A;  2OZ6 A;  4LLG F;  1HBX G;  2QQ9 A;  5DV5 A;  3VFZ A;  3BPX A;  2IA0 A;  2KJB A;  1SD6 A;  4Y13 A;  3KP5 A;  4UVB A;  1DUX C;  4ETS A;  3ZQ7 A;  1TW3 A;  4KIF A;  1S29 A;  1E2X A;  2KJC A;  4AIH A;  5LRS A;  4HLY A;  2Q2E A;  2QBY A;  1TBX A;  1ON1 A;  2CGP A;  4OU0 A;  1BI1 A;  3HTU A;  3E5U A;  3I53 A;  2L54 A;  2P8T A;  4EV0 A;  2MBF A;  3F8B A;  5F6F A;  2IA2 A;  3E5Q A;  1ONV A;  1YTY A;  2J5P A;  1D8K A;  3MQ0 A;  2JZY A;  5DDG A;  2L02 A;  4MTE A;  5DD4 A;  3BRO A;  1TLH B;  5A2Q K;  3TGN A;  5FB2 A;  2YX4 A;  2ZXJ A;  5L3E A;  5LGN A;  3KP2 A;  3LQQ A;  1W5S A;  2G7H A;  4XSX F;  1IN5 A;  3REO A;  3B73 A;  2M5W A;  5IT9 K;  3VEP A;  5BQT A;  3E3V A;  2F5D A;  2X0L A;  2KIF A;  3WTZ A;  3R0J A;  4G7O F;  5IT9 Z;  3JAM K;  1O3R A;  1GHC A;  4HV5 A;  4YIF A;  2VOP A;  1P4X A;  3DPT A;  5CVV A;  1FBU A;  3SHF A;  3FX3 A;  3KP4 A;  3KP3 A;  1KQ0 A;  3QAH A;  5TRD A;  5E1W A;  3C3W A;  5K1Y A;  4YFN F;  2P5V A;  2PLY A;  3MEX A;  4U88 A;  2QZ8 A;  2CYY A;  4HX8 A;  5ICE A;  4AD9 A;  3E6M A;  1HST A;  3DPL C;  2MH2 A;  3QP6 A;  3SZT A;  1H9T A;  5LBQ A;  5CYV A;  5L3G A;  2CSO A;  1SAX A;  2P4W A;  2MLK A;  2XRN A;  4O3M A;  3V7S A;  4N9H A;  3IRQ A;  2ISZ A;  5E20 A;  4YII A;  3KZZ A;  2MA3 A;  1XGM A;  2GZW A;  3LFK A;  5DYM A;  4KNY A;  4A0Z A;  1B9N A;  3WTT C;  4M9X A;  2HWV A;  3TKY A;  1SFU A;  1CF7 A;  2UZK A;  4HQM A;  1SFX A;  4N0B A;  1R36 A;  2Y48 A;  1AWC A;  1J2X A;  2FA5 A;  5H6R A;  2B0L A;  2VBX A;  2PBI A;  2Q0O A;  5J8F A;  2WWY A;  3DKW A;  2NRA C;  1Z9C A;  1KU7 A;  3ELK A;  1AOY A;  1FY7 A;  4L0Y B;  3ZPL A;  3H3U A;  3ZMU A;  1RIO H;  3HOS A;  3WOD F;  4EM2 A;  1IZ1 A;  1B59 A;  1ULY A;  2GA1 A;  2IPQ X;  3OOP A;  3WTW C;  4GCV A;  1I6X A;  3QOP A;  4BXU A;  1KU2 A;  2IVM A;  4Q5S F;  1Z1D A;  4ZYH A;  1XMA A;  3K9T A;  3W6K B;  1DPU A;  2XUB A;  4ZZL A;  2ETH A;  4QWQ A;  3WTS C;  1ZGJ A;  5E8G A;  2CO5 A;  1HKS A;  1V3F A;  2V1D A;  2NNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...