5DULA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis in complex with nadph
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
375
Chain Sequence
SNAMKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRVTPISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis in complex with NADPH .
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 131
structure length 375
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5dulA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dulA01
3RBVA 4M87A 1LDGA 3GVPA 1QKIA 1V6AA 1LDMA 3GFBA 5T67A 1UDCA 2PKQP 4CLDA 3FNFA 4LCJA 1C14A 4B3IA 1TVEA 2ZATA 1I5RA 4A0SA 4RCVA 4L9RA 5AXCA 1E3SA 2GASA 1NM5A 1JVSA 4IMRA 3OP4A 5FI5A 2Y1CA 2YV1A 5G0TA 4CLEA 2FHSA 1W73A 3FNHA 4L76A 4J9UE 2EW2A 4EJMA 3GAZA 5LCXA 1QYDA 4TRRA 2YQ4A 2AMFA 4QUKA 4CV1A 2D5CA 1VC2A 3B1FA 5F1PA 3WWZA 4YYZA 5CEJA 2VCYA 3EUWA 1BWSA 1QLJA 1SC6A 4NHEA 1P31A 4S1VA 3JQBA 2FPPA 2RCYA 1GPDG 3RVDA 1EUDA 3ZH2A 1N8KA 2ZQYA 3H5NA 3GG9A 4ZGWA 1X7HA 4YA6A 4OO3A 5U1PA 3K92A 5IFLA 3KTDA 1MXFA 2NVBA 4EITA 1Y7TA 5IZCC 2RBEA 3KBOA 1Z7EA 3E6AA 3FWNA 3LLSA 3S8MA 1PGOA 3L4BC 3GDFA 4FFPA 2ZCVA 1DIHA 4Q3BA 3CXRA 1U7HA 3DBLB 4CMEC 1E7YA 1HE2A 1YBVA 3MWDB 3PIDA 3GGGA 4CM7A 3PXXA 1V8BA 2ZCUA 2ZB8A 1C0PA 4XB2A 1PR9A 4CMHA 3PJDA 3E5MA 3FR8A 2CVZA 4ZJUA 4LISA 2PWZA 1KETA 3PIIA 1BXKA 1UXGA 4W9NC 4LN1A 1EE2A 5L7WA 4ROSA 1EFKA 4RPHA 4YJGA 2B5WA 2I3GA 4CMIB 1DHRA 3AFNA 1BXZA 3ZN2A 4NPCA 4E4YA 1Z73A 3NDJA 2EV9A 5CDTA 3JQ7B 2B35A 3ZWAA 4AG3A 3SLKA 5IXSA 2O4UX 4DPLA 5JXWA 1U2GA 1YBAA 3TFQA 3KRTA 2YYYA 1FMCA 1X1TA 2O48X 1UXHA 2QZZA 3FRJA 3Q3CA 1CIVA 4W7HA 5JC8A 1LQTA 2JHFA 1NHGA 3UCFA 3AU9A 2OBYA 1YOVA 3FHLA 1TA4A 4MVJP 5EN4A 4J0FA 3DTYA 3F46A 1YQXA 5G4KA 4R5HA 3PQDA 4BV9A 3OBBA 5DOVA 3RUEA 3RFVA 1F8GA 3MJVA 5I7VA 2O3TA 1IHYA 3HFSA 5T57A 4QQRA 3GQVA 2FMUA 4KQXA 1DJQA 4R41A 1IE3A 2J5KA 3ADPA 4L74A 4A73A 2HMUA 1I30A 3JQBC 3VPFA 4CR6A 3V8BA 5KCZA 1UR5A 1I8TA 4GLLA 2HK8A 2GZ1A 5EERA 2PV7A 3AW9A 4QO7A 1MW3A 2Y0EA 4GX2A 4IDEA 4XQCA 3INRA 3RUIA 3WX0A 1VL0A 3DFZA 5KJFA 1TXGA 1H9BA 3KHUA 4HNGA 4II3A 3K31A 3DMTA 2PKQO 1HYEA 1Y8QB 1JDJA 3HDHA 4G2NA 4RGBA 1E1LA 2VHXA 2VT2A 3B20A 4PVDA 5A1TA 2GD1O 3UFXA 4CXFA 3NDRA 3S2GA 3WG9A 4AYSA 5BSHA 2GN8A 3NAQA 1E3WB 2IXAA 1N1EA 4FC7A 4IMPA 1LXCA 2C5EA 1B15A 3GDGA 4XYGA 4N5LA 1MP0A 1UXJA 4RF2A 2B36A 4RF4A 3TQHA 1UDAA 1HZJA 4FFLA 3MJ4A 4XKJA 1PJCA 4RQTA 3SXPA 3DHEA 4QSMA 3F5QA 1NQOA 5ILOA 2ZQZA 4LUPA 4KUGA 4NR0A 4TWRA 1NVMB 1LEHA 3PP8A 2O2SA 3ULKA 1D7OA 3EK2A 3H8VA 2CVOA 2WDZA 3P7MA 4FB5A 5HM8A 3S1LA 3BHIA 2GGSA 3BMOB 5DCUA 3ROMA 4ID9A 5T64A 2VUTA 4BL5A 5F5LA 3JQAB 1ZVMA 2ET6A 3KYCB 4MVJH 3IKTA 5CEFA 2ZB7A 1YQDA 2ZJ1A 4CMBA 3Q9UA 5BR7A 1BRMA 2XF8A 1R12A 1EBUA 3RAJA 2Q1SA 2V6FA 4XZ3A 5FFFA 1EVJA 1Y1PA 3ZNNA 4J7CA 3VZQA 1LUAA 3K2EA 5KKAA 3DBLA 1GPJA 3IJPA 4PCVA 1PEDA 1PL8A 4RPJA 3DBHB 3FBGA 4E12A 3DHNA 5IZ4A 1NPDA 3W6UA 3CZMA 2F00A 3WGTA 4NBUA 5TGDA 3K2BA 1UAGA 3DMTC 4PFJA 4M86A 5DBGA 1KS9A 2YY7A 3N58A 4D46A 1JKJA 3MJTA 3DO5A 2CVQA 1DOHA 4JX8A 2EJWA 3GFGA 4CMIA 1I0ZA 3JQGA 4JJIA 1ISGA 5COQA 5ENDA 4KTVE 4B4UA 1PZEA 3AFMA 3E5RA 1LU9A 4DQXA 1S7CA 1R0KA 1Q7GA 3LZ6A 3GZNA 4PG5A 2E6UX 3VAZA 4GLOA 1OMOA 5ER6A 1XCBA 4FGWA 3W4IA 4YT4A 2ZJ0A 4WLEA 2RHRA 4RPGA 4WCFB 3ZNPA 4RLHA 4BKOA 3U3XA 1F06A 1E1NA 3P19A 2GN9A 4O0LA 3SJUA 3PWKA 1H93A 1MW2A 3ENKA 4GWGA 1VJTA 4Q39A 4ALNA 1BXGA 2JFFA 4BNMA 5B12A 5A04A 1FDUA 1XR3A 3B6ZA 5JE8A 3INGA 5L7YA 3M1AA 1E3IA 4KWIA 3GAFA 3LU1A 4J4TA 2P4QA 3O8QB 5TLSA 3KUXA 4DRYA 4MINA 3ZV3A 4J1SA 2GPTA 4X54A 4JQCA 3O03A 4Y9DA 5TC4A 4XRGA 5TNXA 3L07A 1Y8QA 2H63A 2XXJA 1EDZA 4FOOA 4AICA 2BFMA 1I33A 2I5PO 1Q0LA 3NTOA 4RVFA 3PEFA 5HA5A 5CDGA 4P8RA 1QYVA 2O3QA 1KVRA 3UCQA 2JAPA 1DLIA 4FN4A 3TDKA 1X1EA 2X9GA 3JD2A 3LYLA 1G6KA 2X23A 4OKIA 2YZ7A 4YTEA 2B83A 4MVJA 4PLFA 4R4JA 3NGLA 1GEEA 2E4AA 4I9HA 3GUCA 2Y68A 1DRVA 5C3MA 1DHTA 4GGPA 4UULA 2X5KO 3ZV4A 1QMGA 4Z6KA 3GG2A 4BO7A 1NFFA 1NWHA 5AXBA 3L6OO 4RJTA 4ZQGA 3QP9A 1E6WA 1CQIA 3ZWBA 4ALMA 3EW7A 3JQAA 3KYCA 3VPGA 2JAHA 1XWFA 1AGNA 1EFLA 4RVSA 1O89A 4OL9A 4NK4A 2GN4A 3KETA 1K6XA 1U8FO 3RKUA 1U1IA 2NQTA 4BQRA 2BD0A 4IPTA 4B7UA 4W82A 1JN0A 3QQPA 1VRWA 1Y9AA 4BOYA 1K3TA 2IZ0A 4PVCA 2Y05A 1PJQA 2NUAA 2ZTUA 3D3WB 3WGIA 1NWCA 1ZH8A 2AEMA 3WYBA 5COBA 1P0FA 2NNLD 3DZIA 3ZU5A 2YW9A 3INTA 4AFNA 1PS9A 2WE8A 3DBHA 2GSDA 3D4NA 1G0NA 2O7SA 4AL4A 4CV0A 5I8WA 1PGJA 2CFCA 4QTZA 3ZV5A 2AEFA 4H7PA 3V1UA 3ZW9A 3GOHA 3RBXA 2PGLA 3PDJA 3W8DA 3WR5A 1QXSA 3WICA 3PQEA 4CL3A 1ISMA 3G1UA 1DFGA 1EVYA 5JBIA 3VDRA 2X5JO 1CF2O 1PJSA 2DBVO 4D41A 1E7MA 1T24A 2E37A 1RM5A 3UH1A 3L9XA 3IMFA 1B8UA 5JPIA 2NU7A 4CMJA 4HFRA 5EPOA 2AQ8A 3HFGA 1HLPA 3LC1O 4AJ2A 3WFIA 4GMGA 3OFSA 1MGOA 8ADHA 1PGNA 4MKRA 4OMUA 1WAMA 1NPYA 2YJZA 5HS6A 3EC7A 2ZB4A 3L4SO 4EEXA 3WDSA 1UAYA 1N92A 3F6YA 2VWHA 4WCFA 3A14A 3C7DB 5EINA 3V1YA 3PGXA 3GDOA 2DAPA 3TJRA 1PL6A 3RSHA 3GEDA 1DXYA 3T4EA 4EJ0A 1KOLA 3U62A 2A35A 1JQBA 3O26A 4CR7A 2VYVA 3U49A 1LC0A 3UF0A 1ZIDA 2I3AA 2WWRA 3AI1A 1HZZA 3Q2KA 3QVWA 4NBVA 2BI8A 1GCUA 1NQAO 5F5NA 3O8QA 4M55A 1V3VA 2NM0A 4IGFA 4FCCA 4CL8A 1TT7A 1B7GO 1V3TA 2OBNA 3KOUA 3TWOA 3ICCA 1U8XX 4RO0A 1H6DA 1M66A 2VT3A 5CFZA 1LRKA 4ZRMA 3KZVA 1RJWA 3P2OA 4HFJA 2EWMA 4GVLA 3NV9A 3LK7A 2VWPA 5TRTA 2PNFA 5I7FA 1DRWA 4JBHA 1MG0A 4RQUA 4CV2A 4A7PA 4NH4A 1BW9A 1NQTA 4CUKA 4OH1A 2A92A 2Q4BA 4ALIA 2DBRA 1AXEA 1O6ZA 3ANNA 4KP7A 1Z45A 2Y66A 4MVJD 5LDGA 3ZWVA 4OYRA 3JYPA 4U0KA 2JFHA 2H9IA 4IS2A 3G79A 4N18A 2DQ4A 1EUCA 4RVGA 3BYZA 1HYGA 3ITKA 4WK6A 4O5OA 3CZEA 4A5OA 1ZK3A 3JQAD 5BNIA 3GVCA 4NQZA 1T26A 2G1UA 4BO2A 2IEDA 1VSUA 1WZEA 3CE6A 5TT0A 4YCAA 1ONNA 1AHHA 5B4VA 5A02A 2SCUA 1CDOA 2X1HA 4FFMA 3WNVA 3PZRA 3PJFA 4AJEA 1EK6A 2GR9A 3EZYA 4L8VA 5A05A 3ZWPA 4AJ1A 1X0XA 3MJEA 2IRWA 3S2IA 2BI7A 2PZLA 4WCFC 3VH3A 4BNZA 4L4RA 4ZA2A 4F46A 3CMMA 3JD0A 2QG4A 3RUDA 1IULA 1LLQA 3G1TA 2PK3A 3D3WA 1N5DA 4LRTB 4PG4A 3F4BA 4I9UA 4CR8A 1NXQA 1HT0A 4LVCA 3AM3A 3H65A 3I9OA 4CM9D 4TSKA 1ENYA 3PHLA 3DONA 1U4SA 3GZ4A 2EKPA 3ZU4A 1U3WA 3CMCO 1EVZA 4GQAA 5F1OA 4R69A 3QE3A 4J7UA 1U5CA 1XEAA 1DC6A 3MJCA 4PG8A 1I3NA 2WYUA 4WLOA 2P9CA 4RPLA 4D3DA 1C1XB 2WTBA 2WE7A 3DZFA 4BNVA 5CEEA 3C85A 3HDJA 3GK3A 4CODB 3H2SA 5L3ZA 4BB5A 2ILTA 2GNAA 3VKUA 3KLPX 4ALKA 3HQ4O 5JY6A 1H6CA 2D59A 3WGQA 4MIYA 1LSJA 4M1QA 5CDYA 1XELA 4OJNA 4YAEA 4ZHSA 4CMAA 1X7DA 4BNFA 1KVUA 2DKNA 3RJ5A 2FZEA 5ER9A 3VZRA 3QSGA 1D4FA 3AM4A 3WIEA 1JAXA 1PJ3A 4NU6A 1LX6A 2VYVD 5GMOA 4NFYA 5CDUA 3ETGA 3GVHA 5CDSA 1JWBB 1SAYA 3OM9A 5J23A 3WGHA 3AOEA 1SO8A 3D5TA 3TZCA 2VWQA 1WVGA 1X14A 2HRBA 4U0JA 3HN2A 2CF6A 4YACA 3GGPA 1GV0A 4I5EA 1NYTA 4YJGB 2DBZA 3TN7A 4II2A 3GN2A 1K6IA 3GUYA 3T0YA 1VKOA 3F4LA 3IP3A 4XR4A 2UYYA 2X0IA 2G76A 2X6TA 2VUUA 1JAYA 2UUPA 4Z9FA 4BNUA 4FSHA 4R51A 3LC2O 4PLCA 2X8LA 1KY5A 1KEUA 2EW8A 4QT0A 4KDFA 4MKXA 5F3RA 1ADFA 1HE3A 3I1JA 5KJ1A 4E5PA 3BMQB 4ZRNA 1HDOA 1LBEA 4U7WA 2E49A 2VTDA 4KTTE 2YQ5A 3PGJA 3H4VA 1PJLA 4FFNA 5DCYA 1P0CA 1ENZA 5EQFA 1MW1A 4E2ZA 2AW5A 3TL2A 3UW3A 5JO9A 3ZHBA 9LDTA 1H2HA 3E18A 3U4DA 2HMWA 4FPXA 4IQ0A 2YHIB 4WCDA 1BGVA 5JC1A 4MVJE 3X2EA 2FPGA 1R4MB 1P1FA 4UVGA 1PL7A 1WZIA 3WS7A 5I7EA 4E0BA 3ZV6A 1NP3A 4U5QA 2D0IA 5JDCA 2EHDA 4FOSA 4XGNA 4WLUA 4BO6A 4E2YA 4PZCA 2BLLA 4KWHA 1N7GA 1X15A 1PX0A 1P1JA 3RQSA 4G65A 3EAGA 3TZKA 1Y81A 3GNSA 3PLRA 3WGGA 1ZK0A 2I67A 5B4UA 1ONPA 3CEAA 1WLYA 2Y1OA 2GO1A 4BB6A 3DTTA 1LDYA 4YBZA 1R66A 3JV7A 1QYXA 1RPNA 2I9PA 1F8FA 3PTZA 2C59A 4GX0A 3JCZA 4HFNA 3LT0A 7ADHA 3AOEC 2V6GA 3E9QA 1GEGA 3NYWA 1IPEA 1LQUA 3FNGA 4M8SA 1B2LA 2B4RO 4N54A 4XGKA 4ZN6A 1Q7CA 2WEKA 4TZTA 3QW2A 4QEDA 5A5EA 1XYGA 3WJ7A 2EXXA 4JP2A 2POQX 2HJRA 2J8ZA 3EVTA 1YB5A 2NVWA 2VYNA 1D3AA 4NDNE 4QX6A 5L9AA 2BELA 1P1HA 1IPFA 1C1XA 3V1TC 5A3JA 1HDRA 1HDGO 3I4FA 4YWJA 3W1VA 4PLTA 2DBQA 3DC2A 4A27A 4CUZA 3E9NA 4YAKA 3VPHA 2WMDA 4Q9NA 3ZCXA 1QR6A 2PKRA 3ZNOA 1HDCA 3I6IA 4P4NA 3IUSA 3RUCA 3WOHA 5JMWA 4WLFA 3PHJA 5JLAA 2V7PA 3Q0EA 2Y1DA 1IOLA 1Y8RA 3Q9NA 4D79A 3H5RA 3H9QA 3WXBA 4Z3KA 3ZWMA 3ORFA 3FD8A 3K8ZA 2DVMA 4Z0HO 1PZGA 1ZZEA 2WJPA 3ZWYA 2Q4EA 4YR9A 4ITUA 4PIVA 2X22A 3MOGA 3SX2A 1M76A 1QYCA 4A03A 2CDBA 2WYVA 3HN7A 4Y98A 3C7AA 4FDAA 1DAPA 1KC1A 1NASA 2PD3A 4RF5A 5F1KA 5JDCC 5JSFA 5GZ6A 1E3EA 4NBTA 1G0OA 1LI4A 4E5KA 5I7SA 3WGZA 1J4AA 4J3FA 2JCVA 4BGIA 3AY6A 5HTOA 2O3UA 3KSZO 3RBZA 3TFOA 3JQGB 2NSDA 5DCWA 4DMMA 4WPGA 1SZJG 1ZO8A 4RL6A 2ZYGA 3BXXA 2I66A 4ND3A 4EEZA 3ITDA 2Y0CA 3GZNB 1QYWA 4YAGA 4N5NA 5KJCA 1DLJA 4BNTA 4GSKA 4J49A 1OI7A 1PIWA 4TROA 4Y6RA 1AN9A 3QV1A 3AUUA 1M6HA 3KM0A 5KVVA 3T7CA 1LDNA 3MOIA 3BMQA 5A9SA 5HWSA 2Z5LA 3ZNQA 1XA0A 1DSSG 4FJ1A 1BXGB 2Y93A 1BTOA 3HG7A 2JFGA 4LSWA 4UUMA 4CM6A 3EGOA 4EUFA 4KZPA 2H1SA 5A06A 2AQHA 2DTXA 3MTGA 1L1FA 3UAGA 1W6UA 1RYDA 2YHIA 1A4IA 1Y5RA 4GX5A 1FDTA 4CQMB 1DPGA 5EESA 4D3FA 4DIOA 1R4MA 4IJWA 5JCXA 3SLGA 1YL6A 4NNJA 5LC1A 3HSKA 4RVUA 5BNFA 4HY3A 3KYDB 4I5GA 4ONEA 4DMLA 2GN6A 4UVDA 3Q1LA 2P9EA 1DRUA 2C2XA 2VRCA 1LDEA 1UH5A 1W8DA 4YVFA 3SBOA 1H0KA 2LDBA 1A4UA 1MLDA 1MFZA 4Z9XA 3BA1A 3D64A 3C1TA 5ICSA 1GQQA 1PS8A 4BVAA 3QVTA 2HK7A 1O5IA 1GZ6A 2Q2VA 3PFWO 2UV8A 3ROKA 3NTQA 1U9JA 3M2TA 4MKZA 1CJCA 3OEWA 5JYEA 1YB4A 1E3LA 2G0TA 4GI2A 4GWKA 3OQ6A 2Q1WA 2Q2WA 3U0BA 1YH3A 1C3VA 1GYQA 5KVQA 4CM8A 4GX1A 4AJLA 4ZQBA 2HAEA 2VYND 2HLPA 3OSUA 3ROPA 3OF2A 3RC7A 1VJ0A 1R15A 4IJKA 3W4KA 5B4TA 2Y0DA 2CNBA 1NFQA 4KQWA 2BGMA 2JD2A 5U4QA 2OORA 5IJZA 2RHCA 2NTVA 1U4OA 3FF4A 1B8PA 3I83A 2JD1A 4Q3DA 1ISJA 5BNTA 1DEHA 3WB9A 1F17A 5BSFA 5KNLA 2VHZA 1ULUA 1PQUA 4UUNA 3GEMA 4MP3A 2FOIA 2IZ1A 4B79A 4BNKA 4E30A 4YJFB 3M6IA 2OO5A 2DUWA 4BO9A 3ZHXA 1RKXA 3ZGYA 4IY1A 5H81A 3DOCA 3FR7A 2P5YA 2X9VA 4BS9A 1Z75A 1SC5A 1PTJA 5IDQA 4JBIA 4R3WA 3S2FA 3HHPA 3F47A 5IDYA 2WD7B 5G0SA 4P38A 3D4OA 4G81A 1LTHR 1YXMA 3F1KA 1ISHA 3F9IA 4BIIA 2BRUA 3O38A 4YB8A 1EK5A 4XJSA 1GZ4A 3AY3A 5ENVA 3HZZA 4IXTA 2X4GA 3O4RA 1U3TA 3GY0A 1E92A 4DTIA 1W4ZA 3JYOA 4K26A 4EJ6A 4EI2A 3KVOA 3OQ1A 1HE4A 4XIYA 3U4HA 3UCXA 1IY8A 1NAHA 1ULSA 3BHJA 2C54A 2P4HX 1XKQA 3JQCA 4Q3CA 4RDIA 3VH2A 5C5IA 1RM3A 1N2SA 4NFHA 1L7DA 1IYZA 1EQ2A 1YL7A 1Y5MA 3GHYA 4D43A 1JU9A 1D1TA 4RLSA 1R0SA 1GDHA 2DTDA 3EMKA 1DFHA 1WW8A 3JQ6A 4IQ8A 1ORRA 4IQGA 3OEYA 3PFFA 1P33A 2XAAA 3NGXA 2X0NA 2O3RA 4J16A 2VHWA 5A4DA 2Q46A 3G3EA 1JWAB 5THQA 2PH5A 3H5AA 5TJ9A 5L4SA 2W4QA 2G82A 4EYEA 2JHGA 4CQMA 1YDWA 1DO8A 1XIVA 4UVIA 5DN9A 3B1KA 1C1DB 2W2KB 4IINA 1EUZA 5MDHA 3AUSA 2DTEA 4BKUA 1E1KA 3WSVA 1ZJZA 3LLVA 2XOXA 4L75A 2CUKA 3KYDA 3QIVA 4Z0TA 1QP8A 1WNTA 3BTUA 2FRDA 4FJ2A 1EBFA 4D3SA 1OFGA 3K30A 4FJ0A 1HYHA 3WTBA 1M6WA 4A2CA 1KVSA 2W8ZA 1BW9B 1E7RA 2RIRA 4GSLA 5IAAA 1C0LA 1U7TA 2O2YA 2BKAA 4DREA 1MC5A 5AYVA 4MIOA 2O3SA 1GV1A 2AG8A 2EGHA 4BNNA 2R6JA 3VPXA 4DIBA 3GF4A 3HJAA 2V6BA 3L6DA 4O6VA 3I9MA 3WGOA 2R00A 1A27A 3BMCB 2X9NA 4L0QA 4R5MA 2YFHA 4ZU3A 3PVZA 2B5VA 4BNWA 1T2AA 2Y1FA 4UUOA 4PZEA 1BHSA 4PZDA 1RWBA 1XG5A 3FWZA 3OJFA 4R9RA 4NK5A 2VRBA 4XGIA 3MZ0A 1YDEA 3X2FA 3PDUA 2OFPA 5IN5A 2PD6A 1JKFA 1E6UA 2VHVA 3E8XA 4W4TA 2EF1A 5JDIA 2J5QA 1LSSA 3QY9A 4BO5A 4CM4A 5BQFA 3QWBA 2Q2QA 1SOWA 1YB1A 3EY4A 1R16A 1RP3A 2VZ8A 2J3JA 2Z1NA 3GNTA 4ILKA 2C5AA 4CM3A 3U9LA 2VZ9A 1LLCA 1RYEA 2UDPA 5AQ1A 3O9ZA 4B3HA 2VN8A 4YJFA 1NPTO 3NKLA 3RUHA 3I9JA 4E31A 3GGOA 4BQPA 4HP8A 4E33A 2CY0A 3DB2A 3H9EO 2PY6A 4GPD1 2DPHA 4R1TA 3PHIA 1WWKA 3I6QA 3VVBA 3HB4X 4CLOB 4TRJA 4DBZA 2VWGA 4OXKA 4CMGA 4AVYA 1MFPA 3QWFA 1ADBA 1M67A 2WD7A 5FYDA 4BNLA 1HXHA 2O3JA 4FFRA 2NLOA 1IL0A 2C07A 9LDBA 1XDWA 4AJJA 2YHUA 3NRCA 1QG6A 4GH5A 4AJNA 5ITWA 1F12A 1T1RA 3E03A 4NJOA 4ALJA 4BGVA 4BMNA 3B70A 3DZBA 4WLNA 2AHRA 4IZHA 3CZKA 2FSVA 4CM1A 3JTMA 3DAPA 3ON5A 3I9NA 5ES3A 5CG2A 1K6JA 2O7QA 4JNKA 3U4CA 3AU8A 2P91A 3NUGA 5AVOA 1HTBA 1C0KA 1WDMA 4ND2A 3UGKA 1IZ0A 4WGGA 3RWBA 5ILGA 2R00C 1HWYA 1T2CA 3WBBA 1FJHA 1Q2XA 1I36A 3RCBA 5DZSA 2G5CA 2QIOA 3OIFA 1DAOA 1K2WA 3PRJA 3ZI0A 1SPXA 3WSWA 4URFA 2B4TO 4CQMD 5BT9A 4F45A 2GZ3A 4DWVA 3JD4A 4FLQA 4IBOA 4QFDA 1K5HA 3ASUA 2OGUA 3FPCA 5JDIC 1C1DA 2W2KA 4WKGA 5MGBA 2VNAA 2YV2A 2WM3A 4WNCA 4PGFA 5JCJA 3V5NA 1LRJA 3PHHA 3SC6A 3LDHA 2DFVA 3QA9A 4E5YA 1KBZA 3WFJA 1OC4A 1PZFA 3R0IA 4YDRA 2QW8A 3DQPA 4DQUA 4F6LA 4YT8A 3DAGA 5T6BA 5DT9A 3RIHA 4HX5A 2B4QA 3G0OA 1T2EA 1DB3A 5G4LA 2JCYA 3GR6A 2ZTMA 4KMSA 4HBGA 4MOWA 2JJYA 4LSMA 4KDEA 2Y1EA 1YE3A 3UCEA 4OOEA 4E21A 3FCOA 3ZHYA 3DOJA 1S6YA 4MVJG 1PQPA 4H3VA 4L4XA 3C7CB 3UEQA 5FEUA 1A9ZA 4NZ9A 4MP8A 1HE5A 1B0AA 3RFXA 1ZMOA 4B8WA 4CM5A 1ZMTA 4ND1A 3BMCA 2W98A 4W99A 1SEPA 3A06A 1ISFA 3IC5A 1HRDA 5BSGA 3ICPA 4FR5A 4Y6SA 5EIOA 3ONFA 4XD2A 3D7LA 4E3ZA 4W6ZA 1XGKA 1HKUA 4KUEA 3WJAA 4NU5A 1VPDA 4JBGA 1MXHA 1H94A 1OR7A 2BH9A 1O0SA 3WQRA 3LF2A 1E0DA 3NT4A 1P44A 1ENPA 3VH4A 4YPOA 4M49A 4PLWA 3ONDA 1LRLA 5DNAA 4BMVA 5CPFA 4YT2A 4J7XA 1XLTA 3A4VA 3W6ZA 1J5PA 1ZXLA 4YRAA 3FSRA 2HMSA 3RASA 5JMPA 3C8MA 2DC1A 4DPKA 3ZWXA 4CLOA 3VZPA 4IXWA 2AEJA 6LDHA 2O23A 1E7WA 5DP2A 4F6CA 2VTEA 3KYBA 4FS3A 5C7OO 5HBRA 2OXIA 3JYNA 4FFOA 4FGSA 4KUHA 3DZGA 5KVCA 3FBTA 4OQYA 2PFGA 2ZB3A 2C7GA 3OJOA 4WUVA 3PK0A 5T8KA 4XWYA 3BIOA 3OIGA 5AOVA 1YVEI 2CMDA 3OJ0A 3PJEA 4JIGA 5DP1A 5HS4A 3F1LA 4J4HA 4NIMA 3BTSA 4LCEA 1I2BA 1FXSA 3PPIA 4TVBA 5BSEA 4BMSA 3NX4A 3EYWA 2OHXA 3JQFA 5LDHA 1FDWA 2AXQA 4YT5A 1GCOA 3ZWNA 3W8FA 3RD5A 1V3UA 3PYXA 2IODA 5TJHA 1U28A 2Q1TA 3ROQA 1YL5A 2Q3EA 1A72A 4DLBA 1Y8RB 2EKLA 1RM0A 3DR3A 2OP0A 4O63O 4Q3NA 4BNGA 2DT5A 3KB6A 4FBGA 4BNYA 4K28A 5IXYA 2HCTA 2O4CA 4N5MA 3R3SA 4L4SA 1JKIA 4XYEA 4PRLA 4R54A 3OIDA 1EEHA 3W4JA 4NI5A 2VOJA 2NU9A 2B69A 1V0JA 4H16A 1XU7A 1KERA 2I65A 5H83A 3H2ZA 5JYDA 4OKNA 1UUFA 3GHHA 3UOGA 5JCJD 2P2SA 3QHAA 3IAHA 4HKTA 2YFQA 3NEPX 4F3YA 4E6PA 3COSA 2HDHA 1H6AA 2FR8A 5JAZA 3GNQA 4XQEA 5L51A 1BVRA 1H3LA 1U2DA 3IJRA 3K9QO 3S55A 1NFRA 4JGBA 2QYTA 1B3BA 3JD1A 2VNSA 5EQDA 4WOKA 4Y67A 3EHEA 5IF3A 3DEYX 4FC6A 3TRIA 1GYRA 3V2GA 2CSUA 5FF9A 2NVUB 3STHA 4DVJA 4GL4A 1SOVA 3KEOA 4NBWA 5A9SB 4MPDA 4QXMA 2I76A 3ETDA 1YO6A 1DIRA 3JYQA 1J0XO 4TRMA 2R2GA 5ITVA 3UXYA 3RU7A 5T8KC 4R1SA 3WYCA 4FQ8A 4IIVA 1NQ5A 3KXDA 4GMFA 1QV7A 1XHLA 2H5LA 3N74A 4CMCA 4UAGA 4RDHA 1EQUA 3JQFC 3UVEA 1H5QA 1KIFA 3L4BA 3OETA 3DBVO 1GQYA 3RJ9A 4D45A 1FK8A 4UREA 1HDZA 1MA0A 3AWDA 3HE3A 1AXGA 2ZTVA 4AJOA 4B7CA 3WQQA 1D1SA 4BO3A 5KJ6A 1KEVA 1UDBA 4DIFA 1LSUA 2C82A 5AXAA 3WIDA 3IOYA 3GMDA 3VTFA 2V65A 5GY7A 3BHMA 3IUPA 4J91A 3FTNA 2Q45A 2P68A 3IS3A 1LA2A 2BFOA 4PLHA 1PQWA 1TB4A 4LW8A 5I9MA 4ESOA 3WYEA 5EL0A 5HRUA 2D5AA 4JLWA 5ADHA 1HDXA 3G17A 4ND5A 4BKPA 3Q6IA 4IDBA 5TSDA 3NT5A 5B37A 2FN7A 1ZEMA 4I8XA 5TF4A 1P77A 2EEZA 3DAFA 1T2DA 1ID1A 1GUFA 2WYWA 4CM8B 1ZBQA 1TT5A 3V2UA 4J1NA 1Q1NA 2Z95A 3VVCA 4YAIA 3ANMA 4CQLA 7MDHA 1VSVA 1IZ9A 3GA0A 1AHIA 3ZDFA 1H9AA 2CZCA 1GUZA 4UEJA 3TPCA 3C1AA 4LRSB 1NR1A 4MO2A 5DULA 4D44A 4FD3A 4DBVO 3VOSA 1ZSYA 3HDYA 2GUGA 4RF3A 4YQYA 1PWXA 1TEHA 1R0LA 4RVDA 5A5FA 4IDGA 2E82A 4EUHA 1QSGA 4XQGA 2UVDA 4DQVA 1B3RA 3HB5X 2I6TA 4IJVA 3DFUA 4A10A 4D0RA 3QJ5A 1DIBA 1LLDA 2PZMA 4E32A 4IM7A 2JCXA 2QQ5A 4RZHA 3CH6A 4CJXA 2AE1A 3JQEA 3BMNB 3DZHA 4GKBA 4RV9A 4BNJA 2I99A 3TZQA 4L73A 4XEHA 1LJ8A 3PI7A 1GTMA 1UP6A 3JQ9A 4KOAA 4IZIA 2PH3A 1I01A 4EGFA 2IYOA 3GPDG 5FWNA 3CPSA 1B14A 5ICMA 3VTZA 1PZHA 1R6DA 3NTRA 1PGPA 1O9BA 2OZPA 2UUOA 3K73O 5B1YA 4BNXA 4R16A 4BV8A 4XRRA 1ZNQO 2D2IA 1ZS2A 3AI3A 2DFDA 1CYDA 1OBFO 1B26A 3UERA 2QHXA 1GY8A 1BVUA 3PZBA 4OSPA 1OAAA 1LNQA 2BHLA 4DGSA 4CV3A 1ZK2A 4B8ZA 2EG9A 1X13A 2AQKA 1PJ4A 1YJQA 3GRKA 3T4XA 4QO8A 4NBRA 2FWMX 3GRPA 1Y9EA 3QVXA 4RPKA 2PGJA 5L40A 4J1TA 3C24A 3NT2A 2JL1A 4W7IA 2NVUA 2IYPA 3KV3O 2X58A 3DDNA 4P4GA 1T1SA 3OQBA 1I3LA 3D4PA 4IDCA 1MVYA 4ZVVA 2PLAA 2BF7A 4OAQA 5KTKA 3ADOA 4LMPA 1VKNA 4MVJM 1KC3A 4IS3A 5K9ZA 1MC4A 1UZMA 4NQWA 1NR7A 2YV3A 4J4BA 1ADCA 3TSCA 2AG5A 2X0RA 5L4LA 2NQ8A 3DWFA 4WE3A 1UZLA 3PYLA 4INAA 2OP1A 1Z6ZA 5KKCA 3SJ7A 5IG2A 4BHTA 1JW9B 3JD3A 4TKMA 1YONA 5TS3A 1F14A 4DL9A 4EDFA 3AI2A 1SBYA 4GAEA 3GMSA 3CTMA 3MEQA 4BO0A 4IGEA 5L95A 1XQ1A 3K5PA 2HRZA 2FSSA 2B37A 3DL2A 4MP6A 4C7KA 3EDMA 3K6JA 2HU2A 3DZJA 4RORA 2GCGA 2J3KA 3LSYA 3FNEA 2WD8A 5DBFA 3IKVA 1T2FA 3KLMX 5KWEA 3WMWA 1I2ZA 4DUPA 1F0YA 3JQ9C 4J2HA 4JJFA 4NMHA 4PG6A 4D7AA 2AQIA 4H15A 1ZSVA 3QWAA 2DU8A 1GR0A 1HSOA 2P5UA 1E6EA 1EVIA 4ND4A 1PJTA 3K96A 3OJLA 1E3JA 3OMLA 3I52A 3WGYA 3TF5A 3L0DA 1Q7BA 1TLTA 3BTVA 1FF9A 2NACA 5L45A 5CG1A 1J49A 3L6EA 5G0VA 3Q11A 1I24A 3IP1A 2PGDA 4A26A 5THKA 1A7AA 4K1LA 5EMHA 2ZYDA 1DC3A 2VUSA 4WNIA 1JGIA 1AE1A 1OC2A 4CPDA 4U6QA 4BKRA 1M75A 1YKFA 1LLUA 1C0IA 1W0CA 4P22A 1VL6A 1QLHA 3WQSB 4CM4B 1G1AA 1KYQA 2BFAA 1ADGA 1WMAA 2EIHA 3L77A 4MVJI 1JVBA 4C7JA 3H9UA 1UZNA 3H3JA 1XSEA 2FP4A 4XYMA 5A9TA 1UXIA 4OXYA 4M89A 4R9SA 3I9KA 1H2BA 1ZK1A 2ZK7A 3H9JA 1EE9A 1MW0A 2G17A 5DDIP 2C20A 3ASVA 3BMNA 4AJIA 1P1KA 4UVHA 1E7SA 3C1OA 1DBVO 1SCUA 1CWUA 4C4OA 1E5QA 4JROA 1RM4A 3D0OA 5I9LA 4E13A 4J90A 1JG9A 3FPLA 3Q2IA 1P74A 1ONOA 4ALLA 1CQJA 3ZU3A 1GFSA 1N9GB 2D3TA 4HFMA 4P4LA 4MIEA 3TZHA 3RU9A 3WTCA 2PTGA 5JFOA 2NU8A 4TZKA 1P1RA 2HO5A 2EP5A 2W90A 4QFCA 2H6EA 5DF1A 2NWQA 5C7IO 1HLDA 2YDXA 3A9WA 4PLZA 1PGQA 2YDYA 3WMXA 4ZICA 4JN6B 3OHSX 3P2YA 1GAEO 3RROA 4HNHA 4GBJA 3W8EA 4WJZA 1ZW1A 1O94A 4XA8A 3CZLA 1Y6JA 2EGGA 5U9CA 4XIJA 2BMAA 4YRBA 3FN4A 3OA2A 1E5LA 3BTOA 4B4VA 3FI9A 4FIZA 3CUKA 3OICA 1T4DA 3GVXA 1MV8A 3QWHA 3P5SA 4DLAA 2AA3A 1HSZA 4RVHA 2ZIZA 4NFSA 1ZEJA 2QRKA 3PLNA 5KIAA 1PS0A 3EZLA 3JQ7A 2CD9A 2FZWA 2ZTLA 4IDDA 4E2WA 1N1GA 2IXBA 1JA9A 5F21A 5K6AA 2BGKA 2X5OA 5JNLA 4XDZA 1I3MA 3FTPA 1BSVA 1UJMA 3D3EA 1H6BA 2QZ9A 1Q0QA 4FLRA 4Z0PA 3RUAA 3RFTA 2UAGA 3LT4A 4JXKA 2VRCD 4BGEA 4O59O 4N7RA 4DA9A 1B16A 4EW6A 1A5ZA 2E48A 1EZ4A 2RH4A 2JD0A 4JJGA 4CLRB 4K9DA 1A9YA 4U8GA 2IE0A 1MUUA 4LK3A 4PLYA 3MTJA 1ZKMA 3H3FA 2HUNA 1WDLA 4WASA 5TQVA 1I3KA 1K89A 4U6SA 4YJHB 2Z1MA 4UVEA 3AK4A 4NG5A 4I5FA 4PLGA 1JLLA 5JAIA 3HUDA 1I10A 2IZZA 1OOEA 1TI7A 3L9WA 5GZ1A 2Q49A 3MJSA 1E3WA 3TL3A 2C29D 5TT1A 2PA3A 4E2XA 1SEVA 2FY8A 5CPBA 2A9FA 4IDFA 3GPIA 3IQDB 5G0UA 1VE9A 1OZAA 3LQFA 3HADA 3QVOA 3PHGA 4PLVA 4GGOA 2PR2A 3GN1A 5G0WA 5TIIA 1P9LA 2D1YA 2HSDA 3UICA 2V6MA 1CEQA 5TX7A 2QRJA 4ZQFA 1WPQA 4BUCA 3D1LA 2AE2A 4AJPA 2P9GA 4BO1A 4EZBA 1KVQA 3TNLA 3M2PA 4O1MA 2OOSA 1KVTA 3BMOA 4BNIA 4RZIA 4EUEA 3H6KA 4YJDA 5IDXA 3WNQA 3QRWA 1R4NB 3MWEB 3GVIA 3U4IA 5K6AC 2LDXA 3R6DA 4BNHA 3UUWA 3JQ8B 1LSOA 3MCVA 1Z82A 2RAFA 1CERA 1T4BA 8LDHA 5JO0A 1NVTA 2DM6A 3OH8A 3OJEA 4ZD6A 3A1NA 3AM5A 1VL8A 3LVFO 5AXDA 4YXFA 2BGLA 4MJLA 3ZZNA 1M2WA 4DYVA 3CKYA 1N9GA 3VHRA 1P45A 2OMEA 2NV6A 3N7UA 2TMDA 4UEOA 2D4AA 4LMRA 1NBOA 4HWKA 1R37A 1GQ2A 1PJBA 2D8AA 1YRLA 2BFPA 2CDAA 1GU7A 2GYYA 4PLPA 5KJEA 1D8AA 4XB1A 4CM9A 5IDWA 3CZGA 5I9NA 3IIEA 4OIMA 1QV6A 1IUKA 2PZJA 1ENOA 2GDZA 4PRKA 1NNUA 3G49A 4DPMA 2O7GA 3VPSA 4AJKA 1A7KA 1YQGA 4Y8VA 3T7EA 4XJTA 1UP7A 1EDOA 4R01A 2Y99A 4HADA 5JAQA 1YWGO 3PWSA 4BO4A 1BDMA 4J43A 3VDQA 2ZKLA 3OA0A 4XQ9A 4XYLA 4TMFA 3I3OA 3KEQA 1LC3A 3WBFA 4EBFA 4WLVA 3TOXA 4R1NA 4AJ4A 4FLOA 4K6FA 5FI3A 5T5QA 5JY1A 3H7AA 1P1IA 2HQ1A 3LC7O 1X0VA 5DBIA 3U09A 3WWYA 1YGYA 3I4CA 5L53A 3DOOA 5A9RA 3DBRB 3PYMA 2J3HA 3I23A 3WLEA 1UXKA 4J1QA 3DHYA 2CF5A 3JYLA 1HDYA 1QORA 1UP4A 1S46A 2EP7A 1PWZA 1HETA 4I9NA 5CP8A 3VH1A 4CLRA 1P3DA 2C2YA 5EJ2A 5GZ3A 4NJMB 2J5RA 1YBMA 1E1MA 3RC2A 3RC9A 4E5MA 1WMBA 2HK9A 1HL3A 1N7HA 3H9GA 1IHXA 1NVGA 4WEOA 3VKVA 4B7XA 2NTJA 2DPGA 4I1IA 3GH3A 4TRNA 3V2HA 5JAMA 4OHUA 3BZUA 3CINA 3R3JA 4WOJA 2Q50A 3S2EA 4DYDA 2Q99A 4LGVA 4YJHA 3VC7A 2QX7A 4R68A 3A28A 3UHAA 4M54A 4IDAA 1L7EA 4CMKA 4WECA 1J6UA 4G5HA 4TQGA 4J9VA 5L7TA 3RI3A 4Z3DA 5JS6A 2J3IA 2NTNA 3ZWWA 2W2LA 4YQZA 1DFIA 3PJGA 3ZHZA 3GLQA 3DZKA 3KSUA 1DIAA 4OOFA 2A94A 5A3VA 2J6IA 3NJ4A 1DC5A 4HUJA 1K0UA 1SB8A 2VZ0A 3ZW8A 1ZSNA 1GADO 3GT0A 1DC4A 4TKLA 2DUUA 4YRDA 3E9MA 2OL4A 4MDHA 3LT2A 3CSDA 4YEDA 3HNPA 1ZK4A 2X0JA 1U3UA 4IIUA 1SB9A 3RUFA 3C3XA 2WPGA 2PD4A 1EMDA 1R4NA 1YS4A 3PQFA 3VZSA 3NJ8A 4IJUA 2ZYAA 1ZJYA 1PSDA 2IEBA 3DXFA 3JQ8A 5KVSA 1YJ8A 1V9LA 1JTVA 1PR3A 1LDBA 1XU9A 2O50A 1TT5B 1NX6A 1MB4A 2HKIA 3KO8A 4Q3EA 3I9LA 3WLFA 4CQLB 4J2OA 2GZ2A 4BGUA 1Q0HA 4YAJA 5CAEA 2CDCA 1GD1O 1I2CA 4HXYA 4IUYA 4CUJA 3EVNA 2Y1GA 1PJ2A 1WP4A 4UEKA 4WEQA 3GEGA 2HMVA 4D0SA 1CRWG 2X7HA 3M1LA 3ANLA 6ADHA 3I5MA 1CETA 3QWIA 1GUYA 2XPCA 1BDBA 4B4OA 1G5AA 2FR1A 3D5QA 3AUAA 2PZKA 3F5SA 2B0JA 1ARZA 3E1KA 3QLJA 1MG5A 1AUPA 1V35A 1MX3A 1SMKA 3ZU2A 4DC0A 5C37A 2C0CA 2EKQA 2QYSA 3CIFA 3E82A 3HWRA 3PWZA 1NHWA 1PU2A 1DDOA 4OQZA 1O95A 2Y67A 1ML3A 3BAZA 1A71A 1BMDA 4XR9A 2GERA 3JQDA 4OXNA 2FR0A 5C7LO 2MAOA 1HF3A 2HJSA 3LT1A 4JCOA 4BKQA 4XCVA 4XX0A 3UKOA 2YUTA 1SNYA 1QRRA 2OUIA 5DOZA 3CZRA 2GRAA 4GVXA 2FPIA 2IDZA 3RC1A 2EERA 3GC6A 1Z7BA 2VOEA 5I8ZA 1U3VA 4R1UA 3E48A 3AJRA 4MVJF 4OGWA 4D42A 5IN4A 3AUTA 3AY7A 2TMGA 3DBRA 4I08A 4PG7A 3DMYA 4J6FA 2XXBA 2JKVA 1KEWA 3SC4A 1O8CA 1U5AA 1WXDA 2GF2A 1ZXBA 1ISIA 1GL3A 5A03A 1ZUD1 1E7QA 4FW8A 4OM8A 2X86A 3SEFA 4LVUA 4I5DA 3TOZA 4NJMA 4CLHA 1GYPA 5L4NA 3RKRA 2C7VA 3ZWCA 5H82A 4K6CA 3OECA 4R3NA 4DC1A 1B8VA 1Z74A 1VJ1A 3SVTA 4XDYA 3KSDO 4QECA 4DLLA 4OSOA 5K0ZA 4CLXA 1FDSA 1VLLA 1X7GA 4TVOA 4BO8A 2MAPA 2VQ3A 4DXHA 4JK3A 1BG6A 1ZCJA 2F1KA 5KOIA 1DJNA 4Y6PA 2NU6A 4ZQHA 1KEPA 4UUPA 4Q3AA 2A4KA 2QRLA 3LF1A 4E5NA 4PN3A 2W2LD 3F3SA 1FDVA 1YOVB 5IZCA 1NTOA 5JW6A 1I32A 1T25A 5COAA 4B3JA 3QVSA 1E77A 2VHYA 4S3MA 5G4KB 5G2OA 3U5TA 1GZ3A 1KY4A 3B1JA 1VI2A 2RH8A 1DIGA 2GLXA 3ST7A 4B4WA 3ONEA 4ZQEA 4CMEA 5CHEA 3NDIA 2WSBA 3JSAA 3TZ6A 1HEUA 3ETEA 3HDQA 4Z9YA 3UN1A 4JP3A 1XQ6A 3IL2A 4J0EA 1ZFNA 3ABIA 4XYBA 1NAIA 2Q1UA 1IB6A 3IDSA 4GKVA 4AJHA 1WDKA 2DLDA 3R1IA 2HMTA 2NADA 3ZWOA 3AOGA 2EJVA 4W9NA 3ENNA 4HV4A 1VM6A 4FLSA
chains in the Genus database with same CATH superfamily
4K8OA 4M87A 1F38A 1YVDA 2OLKA 3GVPA 4MKHA 1V6AA 1XYYA 1JG3A 2P75A 4CLDA 1UPFA 5HOQA 3FNFA 2XB9A 4RDXA 1T6XA 4NKRA 1TVEA 2GH1A 1C8BA 3C5HA 1IMOA 2XLCA 2ZATA 3DQQA 3JATA 3QELA 4V0MA 5BVGB 4CF7A 4HLUA 4UD2A 1RVDA 2Y1XA 3WHIA 2I2CA 2YZMA 4EVIA 3ICEA 1TMGE 1SVUA 2W00A 2V9PA 3CSUA 3OP4A 4MRRA 1DG3A 1QQBA 5CW1A 1NMXA 3AINA 4LTNA 2YIVX 3IAS1 3S81A 1X8JA 4L76A 1YR8A 2EW2A 4Q34A 4RHFA 3IFSA 4EJMA 1UT8A 5LCXA 1HT1E 2GESA 3LOPA 3SS8A 1KNXA 2ADFA 5G1OA 2H4HA 3G5TA 5JASA 5AVXA 2R87A 2BE7A 3WQHA 3OF3A 2AI2A 1RPTA 4CG2A 4Q47A 1TU4A 1OTYA 3NHAA 4IYRA 4S1VA 3FVRA 3KTFA 2H2AA 2GEKA 1EUDA 1AK2A 3MWKA 1N8KA 2C97A 2CXSA 1GKLA 2X2FA 4PQRA 1JYEA 1X7HA 4AX8A 4ZGWA 1FSFA 2B82A 1WXXA 2XVAA 3ZDAA 1IRIA 1MXFA 3I2HA 1Y7TA 5J5AA 3URKA 4AN4A 5TMPA 3FCYA 1Y3AA 3E6AA 4MWTA 3KZCA 1G7SA 1JR3D 1EB8A 1PGOA 2QW1A 4K86A 2NO6A 4ZU1X 3S8MA 4BV3A 2B92A 3L4BC 4BGDA 3NU1A 2HI0A 1L5QA 2BMDA 2VTKA 1N5IA 5AENA 3C6MA 4U00A 5E0OA 3E81A 4O8CA 5DFAA 4CMEC 2YV4A 1E7YA 3AO0B 4YGYA 5IJ9A 4XPIA 4ZPXA 5JNWA 4AZVA 5C52B 2OKCA 3GGGA 3PXXA 5DYIA 5AJWA 4X66B 2VNHA 1N77A 1BXRA 3KR2A 1PP4A 2AC2A 1CY6A 2C7OA 2UVPA 3CS3A 1RCTE 2AL7A 3PJDA 4IIGA 1QH8A 4RD4A 4B3XA 3ZZTA 1MJGM 4X0EA 2CVZA 3CN9A 2FPUA 4MJ7A 2GEBA 1RBYA 3D0KA 1M2NA 1BXKA 3JWIA 3PIIA 4P4SA 4PYMA 2DCUA 4LN1A 2CL0X 4W9NC 3KBBA 4RA9B 3A6FA 4QICA 4XCQA 4B6PA 3REGA 2O7NA 2I3GA 5KOHA 4HMPA 5EZQA 1CUSA 2WHXA 4XWOA 4M1KA 4LG1A 3UJ7A 5EJIA 4H3HB 5GJCA 4NV1A 1ZNXA 1U8CB 3KYIB 4JBYA 4NPCA 4X44A 3FJ1A 3TCKA 1L1RA 2EV9A 5CDTA 4U3JB 3JQ7B 2B35A 1Q16A 1SQSA 1VMAA 1U2GA 1YBAA 4HLUC 3KRTA 1MVNA 1X1TA 3RM3A 2O48X 2QZZA 6REQA 5JC8A 1LQTA 4MUFA 4D6YA 1DCKA 1OASA 1QHNA 1XDSA 2HFKA 2WU1A 3LQ1A 1XL0A 3OTQA 5IFKA 3AU9A 1QQTA 1RXUA 1TA4A 4I46A 5EN4A 2YYZA 2OGSA 4J8PA 4J0FA 1XLVA 5DSTA 4DDMA 2J33A 3DTYA 2HPOA 1YQXA 5IU6A 4NDAA 3ZY4A 3PQDA 4BV9A 2HT1A 4EHFA 3FJOA 1FQKA 1NBIA 5L3SA 3RFVA 4D3YA 2OQRA 2PV0A 3JWGA 4H18A 3HJUA 4PX5A 2VUIB 2OXRA 2J5KA 3ADPA 4D92A 2ZRBA 3KALA 5LJLA 9MHTA 2HMUA 2W48A 3EXHB 3VPFA 1TJNA 3EG9A 1YSCA 3V8BA 5MN6A 1TC2A 1LWNA 2AOXA 4GLLA 2AKAB 2HK8A 2WZDA 4XSGA 1VP3A 5EERA 2XKKA 3AW9A 1CS0A 1XMVA 3BB3A 1MW3A 3GLRA 1L1QA 4NBNA 3RUIA 1GDDA 3WX0A 1Q0PA 4Z2AA 4NU8X 1YAHA 4WK0B 3C74A 3K31A 1G3QA 3DMTA 4A0QA 2XD4A 2P0AA 1ZC4A 2DQYA 2XMPA 1JDJA 4KFSA 1JMKC 1E1LA 4FFMA 1OILA 2VT2A 4PVDA 3F71A 4QQ8A 3BK2A 4NV0A 4GUDA 3QEBZ 2BM9A 3HL0A 3H3XA 5DM1A 1Q83A 3PNPA 3UV6A 5M3BA 3MELA 4LFAB 2AN3A 5AHRA 4ZGBA 4G8CA 5TARA 3ZZ0A 2IXAA 4FC7A 1UMCA 5HM6A 1LXCA 5A5DA 3K5HA 1KP9A 3U7IA 4HDNA 1U6IA 4AMGA 2WILA 4JJ7A 5AWFC 3FHOA 4NZYA 3OCYA 4OFZA 2VHUA 4MI6A 4RF2A 2HEIA 4RF4A 4RESA 2XMGA 5BSMA 1I4LD 4OGGA 5BN4B 1E2DA 4MJ3A 2AJLI 4D9BA 3MJ4A 4B09A 2IKSA 1XPUA 2QMQA 1BMFA 1U9IA 1PJCA 3GLUA 4RQTA 3TNFA 2B1JA 3W2EA 5M34A 3F5QA 1PW5A 2DQSA 1NQOA 3ZWDA 5ILOA 1DXOA 5AO9A 4NR0A 3FUJA 2NSJA 1UJ5A 2J0EA 2QXTA 4ESVA 3H8VA 4FB5A 3PUXA 1N34B 3ZDRA 2B6HA 5HM8A 3BXPA 1JS1X 4ZT5A 1YRAA 2JLQA 3D4IA 4ID9A 3K8YA 1B74A 5FR2A 5GIPE 2VPIA 3KYCB 2OLJA 1TUIA 2DFKB 4GR4A 2XHEA 2ZB7A 1Q77A 4IR7A 2NYAA 1U2GC 4JA0A 5DNDA 5KKNB 2FKAA 2OZLA 4V0OA 3Q9UA 1VJ5A 2WAYA 3WLJA 5B30A 3ETLA 1L5HA 1P1BA 1GQSA 4K3VA 1NW9B 2QAIA 1UDRA 3RAJA 3DLBA 1E1CB 1AKQA 4AKIA 1NF9A 1KWGA 4P7GA 3I34X 3DNFA 2WY2D 5IUKC 2BCEA 2PGGA 1Y1PA 4YRRA 1AUOA 1XNQB 3UEOA 5AOBA 3BB4A 3DMPA 1T9DA 3DO8A 4J7CA 1LUAA 5UKDA 1QIJA 3IAS6 4NJEA 1ACLA 1GPJA 4LHYA 3SSAA 2B1IA 3G6KA 4PCVA 3MWDA 4I8DA 2BCJQ 2PZ8A 1ZHFA 3X1YA 4N6OA 4B4KA 1PE0A 4WN9A 1CVLA 4POOA 4UTPA 4OHFA 1NPDA 4TKVB 4AKGA 2QORA 3A6LA 2G9RA 1KKLA 3EIQA 3W6UA 3WGTA 5EP1A 3GU3A 5EUCA 1VJCA 1UL1X 2ZUDA 5TGDA 2XE6A 2O1WA 2BT4A 1MOSA 2EBWA 2FUCA 2WKQA 2YIJA 3DMTC 4IIXA 4IRXA 3I39X 1I14A 4J0DA 4XVQA 3AM1A 4JLSA 3ESDA 2GPWA 4Y0NA 1CEEA 1XT6A 3MJTA 4H08A 3H2IA 5HFAA 3BDIA 1X3SA 1ULTA 1LF5A 3OFNA 4CMIA 3IR5A 4Y2VA 3LUCA 2CL5A 1ISGA 3FUVA 5ENDA 2X4DA 3TIFA 1PZEA 3GV0A 3PFCA 3RSFA 1XQXA 1ZIYA 3WAJA 3WLTA 1SXGA 3E7DA 3QPVA 4Q4IA 1X1CA 3EQ8A 3AYZB 2X0EA 4GLOA 4K9SA 3VAZA 4BQEA 2QLBA 3RF7A 5ALIA 1VPTA 3QKRA 4Q7JB 1QLWA 2PXCA 1G55A 1CVIA 4WCFB 5ALQA 2E55A 4REMA 4GIBA 1F06A 1E1NA 3LFTA 5AUPB 1MN6A 4O0LA 2H9YA 4YLEA 3RTGA 2R48A 4HUQB 4L4UA 4ALNA 1ZW6A 4Q39A 1EYZA 3EXIB 4TMXA 1KI6B 1UBLS 1BXGA 3WLNA 1M2GA 1W581 5C8YB 1Q3KA 2RB4A 3HJBA 1P4HA 1R0XA 1XNGA 1WPGA 1T36B 1RJ9B 2VATA 3DE6X 3EJ6A 3A4NA 3INGA 4U7FA 5SZHB 3WO1A 3TGPA 4J4TA 2PT7A 1JKMA 3AFHA 3KQYA 4M37A 1WCYA 1BHO1 1JEQA 4R8MA 4MINA 1XCLA 4FZVA 4J1SA 1U0GA 3D0QA 2W43A 2XUFA 5TC4A 4IUBS 3L07A 2DFTA 1ECGA 2LUOA 2G36A 2NXWA 2ZBVA 1DCFA 2UZ3A 3BRQA 3ND8A 2H63A 4KBFA 4OLFA 1BYUA 4FOOA 4AICA 1UKAA 2ZRQA 4HATA 4MA5A 5AJVB 3RNLA 3OKFA 2H85A 1OROA 4EY6A 3P8ZA 5EJGA 2EYUA 4RVFA 3F73A 2JZOA 1MJGA 4L5AA 2O3QA 1TM4E 4EWLA 1EWQA 4UCFA 1GSIA 4TS4A 1OI4A 4B3MB 1OB5A 3O2NA 4I99A 4IXMA 4DOMA 1DLIA 5IKXA 4J76A 3TDKA 1X1EA 4U7TB 2XE4A 2NIPA 1OLUA 4XWWA 3CRVA 4EI7A 3LYLA 1GTL1 3JVUA 4JASB 4LK2A 1N7JA 1V41E 4U2BA 5HJEA 3O8OA 5J47A 3PQ6A 2YZ7A 1JHOA 2B83A 3HL4A 3M9LA 4YTEA 4F21A 5C8XA 2AFHA 1GEEA 4FX5A 3R9IA 5FPTA 2QX6A 1CJTC 1O94C 3LPCA 4ZYWA 2JFUA 1DHTA 4LF7B 2BVNA 3P2KA 1VTKA 4DRXA 2PKWA 4UDXX 3WE7A 2GCNA 5AXBA 1YF3A 3DOFA 2GEJA 5EIXA 2R8OA 1V1RB 4O2BB 4S2UA 5EZYF 1E6WA 4A0HA 1YS7A 5HQTA 5COBA 3EQ6A 2B8EA 3EW7A 4BECA 3KFLA 2VR1A 4EDHA 4O2AF 1AGNA 5BR1A 1Y7PA 3WGNA 1O89A 5AVQA 4PHHA 3VVMA 1JDVA 1HMYA 3O95A 1KY2A 2GN4A 1XV5A 2QTBA 2Q9UA 1NJ1A 3GEBA 4QQFA 3WL6A 2PKCA 4C6RA 5HYVA 4EECA 3RKUA 1TW3A 2PH1A 3L8GA 3HY3A 3I76A 4G1UC 3QQPA 5D3KA 2RGUA 3FUCA 3DLAA 4JI7B 1QFXA 5MN5A 2IZ0A 2IYVA 3R23A 3JSZA 1Z62A 1HK7A 1L4NA 2C5BA 2QN1A 2UZ1A 5TEWA 4KO3S 2AEMA 4L51A 3UHJA 3VYWA 2I7TA 3PF8A 1CNMA 1P0FA 3B3FA 2QM3A 3PFHA 1W96A 3K0FA 4FE7A 1TD1A 4TV9A 3ZU5A 2YW9A 4AFNA 1EP3B 1VMDA 4Q1AA 3QEJA 1C3OA 2I8AA 1SUEA 3D4NA 2QRNA 3GGDA 4BWVA 3LCRA 1ZUNA 1PGJA 2CFCA 4YV2A 3O73A 4GXRA 4UXHA 2BEUB 3CV3A 5CNKA 3ZW9A 3ZKAA 2VEDA 2WM9B 3AT1A 5HS4A 1DKMA 2PBLA 3K0KA 3RBXA 3LUFA 3W8DA 1EA5A 3G1UA 1UEXC 5K3FB 4D9FA 1P3JA 4A1OA 1I4WA 1T24A 3B53X 3GH1A 3OT4A 4D41A 1RM5A 4EELA 5CBPB 3L9XA 3IMFA 2ABWA 4CLOA 5HEKA 1QFJA 2NU7A 2R6AA 1W19A 4NICA 2J3DA 4KNYA 4NULA 2XH8A 1HTTA 3BH0A 3IEKA 2BPOA 3HFRA 2AJDA 3NBMA 2PGIA 1P7VA 3SIPA 1ZX1A 4AP5A 5DGXA 1F5NA 1PGNA 8ADHA 3HRHA 4OMUA 1WAMA 3CF4A 4NZPA 3FY4A 2XQGA 2YJZA 4QNRA 5DX1A 5HS6A 2QTCA 2XRZA 3B5JA 3T54A 1LBSA 2C5GA 4NDZA 3HRKA 1N92A 1SXHA 5D5QA 1K5DA 1RBZA 3BBLA 1B76A 1HFEL 1OWMA 1XVAA 1Y1QA 3THOA 1KR2A 4BCBA 3MNFA 2OZKA 3HXLA 1FP2A 3OZBA 2JCBA 3PGXA 4JVOA 2HSZA 3TJRA 2ZUEA 1KU0A 1DXYA 3T4EA 2ZU6A 2ZS7A 1GUDA 3GLHB 2V0CA 3V8MA 4ICIA 3CLSD 3O26A 4CR7A 2E7ZA 5D6OA 5TV2A 4E1AA 1DX6A 3V3TA 3ZX4A 3GFPA 3CJTA 4F06A 3IIMA 3AI1A 5DGDA 3QVWA 1GKIA 1Z8FA 5HXAA 4LXXA 2BI8A 2OM6A 2JLUA 5F5NA 3T9EA 3O8QA 1INLA 4ZOLF 2O1EA 2ZW9A 1V3VA 4WZBA 2CJFA 4Z4EA 4B3GA 6CHYA 4KWCA 4V0NA 3QPAA 1IBRA 3MINA 4NARA 3EZNA 4NBKA 4CL8A 1KO4A 1YASA 1V3TA 1RMQA 2OBNA 2NZWA 2OCXA 3CW9A 3H1GA 3KOUA 5H7XA 3TWOA 3GELA 3U44A 2YNMD 4X9XA 4YX9A 1KOGA 3TQOA 4C2TA 2VAPA 4HFJA 3D6AA 3PUWA 3WLMA 4L5YA 3NV9A 3LK7A 2MSEB 5K0NA 1QAOA 1DRWA 4HDRB 4RQUA 4CV2A 1IZYA 4OHBA 3QM1A 4E3WA 1T5OA 1NVVR 3WGMA 2ZIEA 1YJAA 3EF1A 4OH1A 1DTWA 1VE3A 2DBRA 5JJIA 3ANNA 4WZ6A 4P5EA 5LDGA 4JT2A 2KE5A 4KMMA 2V45A 4MR9B 3L7DA 4EX7A 5L6LB 3HKEA 4OYRA 4U0KA 4S2EA 4B46A 1KJ9A 2ORYA 5EXEA 2HXGA 3WFZA 3ZPXA 1RQXA 3G79A 4DCVA 1ZD1A 1DV2A 1RZUA 2J3EA 4RVGA 4HDCA 1ULAA 4ZTBA 1GG5A 1CY0A 2JCGA 1AN0A 1NUQA 2OZEA 4GO1A 3S27A 3DLHA 3BCSA 1TQ6A 4CEHB 4JEIA 5DWDA 3GVCA 1S4MA 4PBTA 5F9HA 1GGNA 1G16A 3OZGA 1VSUA 4FZJA 1WZEA 3OQHA 5ELLA 4C1NA 5F2NA 4WJKB 4YCAA 1AHHA 1I1NA 1QVRA 2OCGA 5BN5A 1XMIA 5A02A 3CO5A 1TYZA 7MHTA 4Q02A 2J45A 1F20A 1FVXA 3ZY5A 4G36A 1GQRA 4X7PA 4LF6B 3G0DA 3IT3A 4F96A 2ZRIA 3DE7X 4QU5A 1SXJA 1TVMA 3C6BA 1XRJA 3NBZC 1X0XA 5A05A 3ZWPA 3S2IA 1N36B 4OX9B 3BSFA 3Q7TA 4TWIA 3WIVA 3NOOA 2QMEA 5EFOA 1WP9A 4BNZA 1IWOA 1JYSA 3HA5A 1TCAA 3CMMA 2CLMB 4MO9A 2IU3A 2QG4A 2HJHA 4N3AA 1IULA 1LLQA 2ISQA 1E5TA 5JSZA 1MC1A 2EJCA 1FBNA 1N5DA 1MW9X 2YXBA 3CA8A 3OEHA 3D31A 4YHBA 1VCIA 2VNIA 2ETVA 4I9UA 4DHWA 1E0KA 1HT0A 4MQEB 2YWJA 5DW0A 4EGQA 4LVCA 3AM3A 5C3MA 5FTLA 5JUWA 3L4KA 2XNJA 3TLZA 1G18A 4QPPA 1X74A 4CM9D 2R751 3AHFA 3ESZA 4TSKA 3JVDA 3U1TA 3PHLA 3HKDA 5AM2A 3SR3A 4TWBA 2EKPA 1V9CA 3ZU4A 2FDRA 1R18A 1U3WA 4F1JA 4DV2B 2QZSA 3EQ2A 2JFNA 4GQAA 2B94A 2VPZA 2VLIA 3E5HA 1E18A 4J7UA 3S44A 3LBIA 3AVXA 2QX9A 4BP3A 3V7UA 1FYWA 3I1IA 1LPSA 2RHLA 3SSMA 2AMLA 4D3DA 2P79A 1C1XB 2WTBA 2H08A 3W3AD 3AR4A 1GUAA 3HY6A 3HDJA 2NPFA 2BHRA 3H2SA 1UT6A 2ERCA 5L3ZA 1T3HA 2J4CA 4JYPA 1YZHA 4OJMX 2JLZA 3KLPX 2NPOA 5JY6A 1ST2A 3O8LA 4KGVA 2DUNA 4HGRA 1H6CA 3I8SA 3UW1A 5L8VA 3R4CA 4I1SA 1MRZA 3P2IA 2I6UA 4M9UA 5JJLA 1G20E 3WGQA 4H1HA 2GXSA 1Y1RA 1LSJA 2C4HA 2X9LA 1ZOSA 3CNNA 3NUQA 3PX3A 5LSAA 2GB4A 3B3AA 1C8LA 3Q40A 4OJNA 2HA3A 1K1EA 3OPYB 1AOXA 4ZHSA 1VIMA 4V1CB 1KYIA 4CMAA 1BA3A 2GTIA 4IEEA 5CLQA 2H1OA 3QHQA 1L8LA 3AM4A 1PJ3A 4NU6A 2OESA 3GJ3A 3R7BA 4AC9A 2O0LA 3PDHA 3F98A 1JWBB 4RDCA 3WGHA 1VOTA 3OZDA 4H59A 3TZCA 2VWQA 1YULA 2QPAA 1QDEA 1PYGA 4A8PA 1BCSB 3HN2A 1VLJA 3KJEA 5INTA 3TUJC 3PUIA 1VJGA 4U9IS 3SE7A 1DOZA 1P9OA 2WLTA 4GXTA 4YJGB 4AU1A 1FS5A 5DO9A 2OTCA 1SXJC 5KQPA 2ZBEA 1SVLA 2QJTA 3HUTA 1EFVB 1SQFA 4D9JA 3FGOA 1NDQA 4DUGD 1VKOA 1Z0DA 4QGSA 4RKQA 4X6XA 4LYDA 4V0QA 4DIEA 2B8TA 2G76A 1SQ0A 2X6TA 4EHAA 1GZUA 2WZGA 2YJ3A 1NZJA 1Z4QA 4FSHA 4R51A 3DYIA 2Y27A 1WG8A 2NUTB 2X8LA 4ZZ2A 3ILSA 1GTVA 2GUWA 4FLMA 1ELOA 4KDFA 1DQSA 2BEKA 2VC2B 2RAPA 2EX0A 3QUAA 1ADFA 4LX0A 5LP1A 4DM7A 3LPDA 1L6RA 2A5YB 3HJRA 4ZZ1A 1IDOA 3BMQB 2H65A 4FINA 1SVNA 4KOEC 1JNYA 3FSEA 2AGVA 3H4VA 3U1BA 3RSSA 1I1OA 3COVA 2H11A 3KELA 1P0CA 1I51A 5DCYA 3VYUB 4XVHA 3B9QA 3EVCA 3FH5A 5EJ8A 2AOVA 4G5SA 1AA6A 4OXQA 4WX2B 5J58A 1SBNE 4G1VA 4G5GA 3RBAA 2FEAA 2ZSFA 4XN2A 9LDTA 1SBIA 4ARUA 1I4EB 1JYFA 1LPNA 1TVCA 1SCDA 3X2EA 2NXJA 3NOXA 1XZIA 1FMLA 3GJ5A 1IG0A 2CBGA 5JH7F 1RDFA 1D9ZA 3Q3EA 4U5QA 3TMKA 1A98A 1UJ4A 1QH1B 3CZ9A 3KUUA 4URXR 1NVAA 3WBKA 4KQIA 2XMZA 3TQSA 4BO6A 1T6BY 4E2YA 2BLLA 1X15A 4NYMQ 1PX0A 1P1JA 2OYCA 4XM1A 3TZKA 4PWZA 1SUFA 3V8NA 2NZXA 2A0YA 3PLRA 4HEQA 4Q9JA 3NI2A 3CEAA 3EBIA 2QT0A 4B3DA 2Y1OA 4CE6A 3DAOA 1H2YA 3DL0A 5LQKA 1GARA 1R0BA 3DTTA 1LDYA 3VJKA 4L5BA 3MCWA 4R83A 1R66A 3OM0A 1C1HA 2GZRA 3BX1A 4WHMA 3PTZA 5TMEA 4BC0A 3PXEA 5DXFA 4BMYA 4NSNA 4RVNA 2AUTA 5ESRA 4KV9A 3BD9A 1NW8A 4CKWB 3E9QA 5FHQA 4FCAA 2WQZA 2O0HA 1LQUA 5PGMA 3W06A 1U7ZA 3DDZX 4N54A 1M8PA 4K6OA 5C5DA 1JE0A 4NBSA 2BWJA 1P62B 1LPMA 3RFCA 3U26A 4ER7A 1KEEA 3NBKA 3H05A 3J7TA 1XYGA 3LKDA 3M33A 4UQPA 3TDMA 4EHHA 2EXXA 4ATNA 1ZESA 1JJBA 2POQX 3OQMA 3GEPA 2J8ZA 1T4CA 3IVRA 1UFRA 2GX6A 4KN8A 1D3AA 2ANCA 2E4VA 3VI4B 1KBQA 3AQ4A 2Z2YA 2WFZA 4H4DA 1IPFA 1JIKA 3RAGA 3V1TC 4NYJQ 4ZXFA 4BFSA 3W5BA 1HDRA 2MYPA 5AHWA 5BWBA 4A0RA 4PLTA 4ZARA 5DBOA 1Z25A 3MTEA 2JEOA 4YAKA 4I8IA 1VMIA 5ALGA 3VPHA 4O8ZA 2FWAA 2HRCA 4GYJA 4L0CA 1QR6A 3BRWA 4PPFA 1KQ3A 2TYSB 1GFIA 3SHWA 1W1IA 3ZNOA 1BOFA 5ELMA 1YC5A 3ZXUB 4DA0A 1NJSA 2BL4A 3IPAA 1B8NA 3M4NA 4D9HA 3RUCA 3H1TA 1W9MA 2JGMA 2WSIA 2WYOA 3DE1X 3NGMA 4AJ9A 4NXNB 2J9RA 3ZQ4A 1CP2A 3T1HB 1SFRA 1HFWA 1IOLA 4F2WA 3Q9NA 1UJ2A 4D79A 4C07A 3H5RA 4S0ZA 3ZWMA 3K1ZA 4YO7A 5E9AA 1QCDA 4OHZA 2HHHB 1CW2B 1N8SA 1Z4MA 2JVKA 3FD8A 3K8ZA 3NH6A 4F1WA 2VYFA 4YUWA 1M7HA 5B2FA 5A3RA 4DV4B 1UQRA 3HCPA 2QEQA 4KSYA 3ZWYA 4KYIB 2ECKA 3QUTA 3U6BA 3QMVA 4ZX3A 4A4DA 3WRYA 4EKEA 1RYNA 1U7UA 3W79A 4LY6A 3NHMA 4C88A 1PRYA 2IVFA 2ZSDA 1W59A 3HDVA 1T3LA 2V5AA 4MUJA 4AZ0B 4UTNA 5A0TA 1KC1A 3OPQA 3Q5DA 5JSFA 5F1KA 1L4HA 1RXYA 2KWIA 3G0IA 4MUMA 3AF4A 4NBTA 1LI4A 2IY8A 4XEUA 3CX4A 5CXXA 2JCVA 5IHXA 1IC6A 2O3UA 2R1VA 5EZYA 4AY2A 5F9FA 5BXYA 2BFEA 5DCWA 2VJAA 2HFJA 1UBMS 1ZO8A 4RL6A 2ZYGA 2I66A 4C4ZA 2JIZA 4Y2GA 1FSGA 1YCGA 4K2HA 1QYWA 3HBNA 2XTMA 4YAGA 5KJCA 5HQJA 1E4OA 4BNTA 3IAXA 4GSKA 1KK3A 1OX6A 1ZOOA 3TVYA 3HKBA 1KSGA 4I19A 1IB0A 1NU8A 4EQ6A 3AUUA 1O97D 2ZQ5A 4BMXA 2FF7A 5EMLA 4HWTA 3ETJA 5ED0A 3KKNA 3OUTA 3ZCSA 3D3JA 4QUOA 5BUCA 2SKCA 1Y5LA 2G77B 4ZOCA 1L5GB 4EFNA 2K6GA 2ECPA 4YONB 2PCJA 1Z0IA 3ESBA 2QXYA 3FSJX 4E94A 3LOUA 4J2TA 2JFGA 4LSWA 3HB0A 2BMJA 4IFTA 4NCIA 3G7UA 4Z4CA 4KZPA 2H1SA 2XF2A 1XJ0A 2XVXA 2YMPA 5EP2A 3UAGA 1W6UA 1NXPA 4GMDA 5KYVA 2FFJA 1EXDA 1FDTA 1Y33E 1Z6GA 1JQ5A 2Q6LA 2VH1A 3PT9A 2Q9CA 1QIIA 4KIGA 3TMYA 2O8BB 1R4MA 1ORTA 4JITA 3EVDA 5D00A 3R7AA 5AHOA 4QU8A 4ENUA 1UM9B 3HSKA 5IT5A 1FFCA 1QO0A 4RVUA 5BNFA 1D8TA 1ZYUA 4I5GA 1DUSA 1Z26A 4ONEA 4IVRA 3T1OA 1EFDN 2O8EA 3K5IA 1KNQA 3RIXA 3O47A 1MAVA 2P9EA 1IZ7A 2C2XA 2VBIA 1FS6A 3HCBA 1TFUA 2CCGA 4YVFA 3A36A 1QRSA 4O33A 1V8ZA 2FW7A 2XYHA 3T9CA 2LDBA 3OTHA 3U17A 2O6LA 3LMKA 1TMYA 4Z9XA 3UXEA 3BA1A 5M5BA 1QZUA 3VRHA 5LFAA 1KYZA 5BMVB 5EP3A 1G42A 1USGA 2AN4A 4EA6A 3ND6A 1S3GA 3PPXA 3R75A 4D7AA 3IUJA 2Q8NA 3V80A 2REQA 1TZBA 3PFWO 1OX4B 3JAKA 5JCZA 2UV8A 4QYIB 3NTQA 4ZVMA 4EF6A 2P8JA 3A6JA 2X4LA 3HP1A 4MKZA 3WRYC 3OUZA 4KITB 4GWKA 1ULZA 2RKWA 2W0MA 2XRYA 4GI2A 3UMRA 4KQEA 1U2TA 2QRVB 4DLRA 1W47A 2RIPA 3SC2B 1NUHA 1AZLA 1YH3A 5KVQA 2DECA 3MTBA 1Z0AA 2P9YA 3PEYA 3IALA 3STXA 3DBOB 2FVXA 2HJWA 4O4LF 1FRVA 1QGOA 3QF4A 4PAGA 4PW4A 1CQIB 4IJKA 4ZAGA 3PPVA 1T5IA 4F1KA 3GUUA 1BEEA 1NFQA 2VAWA 3O90A 1W1UA 3VYTB 1F60A 4HYYA 1G5QA 2A30A 4OATA 3OLYA 4WZAB 4ZOLA 2RGEA 4Z9BA 3X1ZA 4YIHA 4FYXA 3IQEA 1U4OA 1X7YA 4D6PA 2M1ZA 1NNSA 1B8PA 2GBGA 2R8ZA 2BGUA 1T2NA 3QOXA 2GBPA 4IVPA 2VF4X 2C2MA 5GONF 2QGZA 1XZAA 3MUFA 1AT1A 2C58A 1V96A 3F7TA 5KX5B 1GT91 3UBMA 3T3MB 3MYYA 2UZ4A 4L8YA 3E3MA 3A6GA 4MQ4A 1OA0A 3TW4A 3U19A 4HHEA 3DEIA 4B79A 1RYHA 1HURA 3VAAA 4BX0A 3V9AA 3M6IA 5D8DA 3O83A 1MQAA 3ZHXA 3C2QA 4X20A 4L72A 3I9V6 3SX0A 2F43B 1LD3A 1GWNA 3ZGYA 4WBNF 1FXWF 3FR7A 4KE8A 4JJAA 2JJMA 1N6HA 4TUYB 5G1PA 3ZK7A 1A9XA 3LC0A 5IKMA 1Z83A 5H8WA 5HGXA 1SC5A 1PTJA 1M1NB 1MT0A 2JAXA 1M1YB 2VYQA 4R3WA 2VRWA 1MO4A 3S2FA 3M34A 2AB0A 4A5SA 5ITZB 3ZYCA 5G0SA 1GO2A 4P38A 4RHTA 4PZYA 4G81A 1CR4A 1XBTA 1T5HX 3F1KA 1WETA 4NY1A 4ZVLA 5JZVA 1AGPA 1BMQA 1E2GA 3F9IA 4DM3A 1U9ZA 2BRUA 3O38A 4X1OA 4XJXA 4BVHA 1Y6GA 2PSFA 4XJSA 1GP2A 4XMXA 1SBCA 2HPZA 3M5CA 3AY3A 1YK0A 3OU2A 1MO3A 1DKRA 1FNSA 4X6YA 4GP6A 1FJXA 3A9SA 3LL7A 5AK3A 4WY2A 2C1EA 2PQ2A 1RKQA 3L8ZA 1KE2A 4Q6WA 3SN6A 3ZJ5A 3LWZA 2WIGA 1NI4A 3GNLA 4FYIA 2SHKA 3HA7A 2NO0A 2VP0A 4LYYA 4WAUA 4KX5A 2NN3C 3UCXA 1IY8A 1ULSA 4WKCA 2C54A 2P4HX 2PSSA 3JQCA 5JWHA 1FLDA 1X7XA 1Q2UA 3K4HA 1CQWA 1RM3A 3S1AB 3LIPA 3TTYA 4JVLA 5FBVB 4BZXA 2QTTA 1Y5MA 3KDSE 4D43A 1ZH2A 2C61A 4RLSA 2DTDA 1YZUA 4BZWA 2FPRA 4JP1A 2FQ1A 4A6DA 2H52A 2GZHA 3DXYA 4Z4FA 3OEYA 3PFFA 2IZ6A 3A6EA 2QN8A 3QUQA 2ZBDA 3NGXA 4E7PA 1HG1A 1JWAB 2OFWA 2XUGA 2KLBA 1UEJA 2YHAA 3G7SA 3IDFA 4GKAA 5KMGA 2WTUA 3TI7A 1SKUA 1KY3A 1MCZA 2AS0A 2W4QA 3GJ4A 4LQCA 4UHHA 3RABA 3U1VA 4DLKA 3CF6R 3IIIA 4CQMA 5IKOA 3CNEA 4N4AA 2HTFA 5DN9A 3B1KA 1BJTA 1C1DB 5CD1A 2W2KB 2GEFA 4C0XA 1NBME 2HWYA 4HH0A 1D9XA 1HORA 4JC8A 1E1KA 5IT0A 3WSVA 3LLVA 1JLSA 4L75A 4Z0TA 3KYDA 4DLTA 4KXXA 3W5AA 4DUZB 1QP8A 1Y6QA 2OR3A 3E9CA 4OBWA 3FLBA 3RVOA 1W85B 4GYKA 4LQ4A 1NL3A 3G0GA 3PFIA 1GPWB 5EWJB 1EBFA 2C9DA 3NOVA 4ZXPA 3MMNA 1YI1A 4ZWNA 3JXEA 4GS5A 5A0VA 5JQGA 1KVSA 4L8FA 1WPRA 2W8ZA 4MKGA 1II8B 5EJEA 1BW9B 1YQ9A 4MGEA 2IXTA 2RIRA 3C3CA 3PD1A 4HNAA 1JDPA 1ML4A 5EWMB 3QSYA 3H6HA 5CK5A 4C03A 3LTEA 3KCQA 5J59A 1M1XB 1PTJC 1U7TA 3JZDA 2ZM5A 3EFHA 5I7HA 4BNDB 3T4UA 5HLTA 1JLKA 4F84A 4OG2A 2RHBA 1XCPA 4TMYA 3OO0A 2DQ6A 3UWMA 3G2MA 4DIBA 1XPRA 2IOQA 1K5PA 1X80A 1DUIA 2V6BA 3ANSA 2BRUC 2QRQA 2G4LA 3ZVMA 2MYTA 4L9AA 3N0WA 4L0QA 2YFHA 2WSSA 2NZ2A 2B5VA 4UUOA 3EVZA 2BONA 4PZDA 4CEIA 4RXTA 4UOZA 4PYKA 1Q1AA 4HYQA 4DMFA 4NK5A 2VHTA 1PHPA 4XGIA 1CPYA 3QU9A 3X2FA 3HFJA 5IN5A 1C2YA 2C77A 4K1XA 2AMYA 2QLNA 4NH0A 1CR0A 4LZZA 2D7DA 2O06A 3BXZA 4PQFA 4EB0A 1OWPA 1Z5ZA 3QWBA 2Q2QA 3G6WA 3L0OA 1X9HA 1NQUA 3W2IA 4P3NA 5ICCA 1C9MA 1KHHA 4QPEA 1DWUA 1W5SA 2I22A 2VHEA 2Z1NA 3BGOS 4ILKA 5HK9A 4CM3A 4FDLA 3U9LA 1NJGA 1RYEA 6PFKA 1TAQA 2QRPA 1NN0A 3PFKA 4ZOEA 3RODA 3RS2A 4B3HA 3WLPA 3NKLA 4A8TA 2R70A 1H1LA 2AUNA 4Q7MB 5BRJA 2AFVA 2KB0A 3W5SA 3W2TA 4E33A 5ARCA 2P2NA 3NDPA 3BS4A 3SQLA 1O3YA 1WWKA 2ATEA 2H9AA 3I6QA 4OQEA 4FE3A 4AKEA 4CLOB 5LQJA 1ISSA 1N2CE 4QMEA 4WA7A 2IA5A 1KTVA 3T0FA 4OXKA 3UO8B 4DBZA 3W5VA 2IOYA 2X3YA 1NGSA 5CA0F 3BWYA 3T0GA 5JXIA 3ENVA 4A8JA 3M4XA 2HF2A 1BD4A 1ADBA 1MZPA 4BNLA 4OXXA 5JNRA 2C07A 3PFGA 3FDZA 1XDWA 4FOLA 4JC4A 1G8SA 2ZUVA 4P36A 3BQ9A 3LRTA 1T9GR 2ZXFA 3NRCA 2X5NA 1BQEA 1IONA 1QG6A 2GJKA 4PNEA 4JI2B 4BPRA 5K3CA 2YVUA 1DWOA 3LZCA 2DYKA 4NJOA 5EE5B 3U5ZB 4G5XA 2JIPA 2W6IA 4IHKA 4BMNA 4MHSA 4GP7A 1EA7A 1OVGA 1RHRA 5JH7A 1XP8A 3ZKWA 1J9EA 1A77A 2VJCA 3GFQA 5CR9A 1J5EB 5IASA 2ZI3A 3L8YA 3NFYA 5CYOA 2JI9A 1CY7A 3GJQA 5KDDA 3NP9A 3F6PA 2XUAA 1UIMA 4C22A 4FHGA 5JNUA 2O1SA 3H8JA 2P6NA 2G1JA 2P62A 3CC8A 3V1LA 1FDOA 3AU8A 1GSAA 3I45A 1HTBA 3IB6A 1OIVA 2Q6TA 4PZZA 3ZX5A 3UGKA 4AURA 1WXIA 5ILGA 4BTVA 3M70A 1T2CA 1BQ3A 4O0MA 2QDKA 3CZ5A 4HB3A 4QOGA 2QIOA 3OIFA 1XZJA 1RPJA 4JYBA 2CNNA 4D25A 2W4IA 1LZKA 1H8EA 4KIJA 1TM7E 1E61A 4DG9A 1QDLB 2OAGA 5IC4A 5GP1A 2QPTA 2BF4A 4DE5A 2QN6A 3SVZA 3HXTA 2VQDA 1ZJ5A 3FPCA 5B1IA 1VL1A 1RHKA 4I3HA 1OI2A 2VDNB 3BGDA 1HM5A 4NCBA 1KI2A 2A5DA 2A1TR 4K3UA 2HWXA 4HN4B 4LDQA 3V5NA 2R7LA 4NAHA 1TK9A 3CNBA 3SC6A 4F2DA 3FMVA 5HDQA 1VHTA 2CHEA 5EG5A 1OV6A 1PZFA 5C34B 4L7QA 3KDAA 4MRMA 4DQUA 3REQA 2PHZA 3ELUA 3DAGA 4YT8A 4R7ZA 1XNJA 3O3OB 4HGPA 1M33A 3Q3VA 1YHZA 2COEA 5DT9A 1UC8A 2NO5A 1B8OA 3DTVB 4Z54A 4GQBA 2F17A 1DB3A 5G4LA 1QP0A 4WK4B 4M9CA 4KMSA 2FZ4A 4HBGA 3WZLA 1TC1A 3V4SA 2HSWA 1G5FA 4LSMA 3QMPA 1NLUA 4KDEA 4O3FA 4R1LA 5EKUA 2YWCA 1JDBB 1Y37A 2VK4A 3EVBA 4AYWA 3ZHYA 3E22B 1S6YA 3I42A 4A8JC 2GK4A 2GEUA 2EDAA 2JIRA 3HCWA 4H3VA 4L4XA 4ZAWA 5SV2A 1Q7TA 3UEQA 3FNIA 2Q2OA 2J1LA 4JSYA 2XV1A 2GD6A 4PYIA 4YI3A 4QNNA 3AB3A 3IBYA 1A9ZA 4PX2A 3MTIA 1HE5A 4JXZA 1K92A 2NXCA 4JMLA 1P9NA 2APJA 4ND1A 1UIRA 1HE8B 4JB3A 2BFFB 3EWSA 3FWHA 3PDWA 3W1WA 3IUYA 4C4XA 4RFVA 2W2OA 1Q1QA 4L6AA 1A7UA 4TZ0A 4E07A 2OHFA 4A2QA 3D8HA 2F4NA 4XD2A 2WA2A 1IN4A 1KR5A 2BSXA 2FCRA 2IHZA 2QQEA 4M9XA 4NU5A 4AY3A 1I7QB 1VPDA 3DD5A 4ITVA 2N42A 3BERA 3GXOA 2HW8A 4KPUA 2CV2A 2Q3HA 5B7PA 3RYIA 1YBHA 1K63A 1P2GA 2BH9A 3N2IA 1FMTA 2PO5A 2H17A 4IL5A 1V4BA 2HWWA 1E0DA 4BB9A 3HLKA 3QE9Y 4LQDA 4OQPA 2R96A 4RFSA 1MRNA 1V6CA 4KJZA 1ETUA 1ZU5A 4I36A 4C5BA 2VJDA 4D9IA 3A2NA 2EX4A 1COZA 2JI4A 3ONDA 4OAOA 5IMSA 1NX9A 2HBYA 4FYHA 4BMVA 1BHQ1 1N5KA 1WKCA 1XMXA 4X1KA 4S1TA 1HYBA 4M99A 5CPFA 4BMOB 4YT2A 4AKSA 3AP1A 2C96A 3OHPA 4DR4B 1BX1A 4MUEA 3O82A 2HMSA 3RASA 1R3DA 4RK7A 4RTPA 4EYQA 2YN4A 3PD0A 4YV1A 1Q74A 3TNJA 4PINA 4Q21A 4FQ7A 3VZPA 2AV6A 2Q3CA 3H13A 2H2GA 3QEOA 4FHEA 5HQ3B 3F74A 2MYNA 1TPYA 4FS3A 4QM6A 1ZGZA 5JBQA 3JYNA 3UYKA 2QTAA 1QQ6A 1A8HA 4FGSA 3TLGA 2GJ4A 2VA8A 3DZGA 4FE4A 4ABYA 3EBLA 5KVCA 2K4MA 1G21B 1B1CA 3BREA 1SOAA 3H9BA 4UBOA 3UY4A 1UCFA 3OJOA 3TRFA 1DT3A 3PK0A 4RTQA 1Y89A 4XWYA 3ER8A 4MGHA 4A0FA 3KXLA 3WRXC 5AOVA 3OIGA 10MHA 4ZW3A 1XZNA 4JVNA 3TXYA 4FFSA 4JR0A 4JIGA 2UYCA