5DULA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis in complex with nadph
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
375
Chain Sequence
b'SNAMKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRVTPISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
publication title 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis in complex with NADPH .
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 131
structure length 375
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5dulA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dulA01
1PQPA 1QYVA 2DBQA 3B1KA 1V6AA 1EUZA 3M1LA 1PQWA 1IPFA 3VPSA 2HDHA 4HNHA 3ZV3A 4BNXA 1HZZA 1T25A 4GGOA 4YJHB 3MOIA 2W98A 5GZ6A 2QYTA 2TMDA 3PZRA 5HS6A 1H6DA 1Q7GA 2B5WA 3K92A 3F9IA 2D2IA 1U2DA 3H2SA 3BYZA 4CQMD 4E13A 1EUDA 1E7RA 2YHUA 5TJ9A 1EE2A 1ZS2A 5A05A 4EEZA 2RHRA 3DZBA 2GZ1A 3PWKA 4YA6A 4J7XA 5A3VA 3ZHYA 4E4YA 3I4FA 3HJAA 2O48X 1C1DA 3GZNB 4B4UA 1R4NA 3ZH2A 3CZLA 3NGXA 4TWRA 4DIFA 1LDNA 2Y1FA 4AG3A 1LBEA 4B4OA 1QYXA 2CMDA 4DQVA 1DIGA 5CG1A 1CQJA 3ASUA 4R68A 4XQGA 1MP0A 1P31A 1SCUA 3TZQA 3ZNOA 3RUDA 1RM5A 1LLDA 1EFKA 5F5NA 5K6AC 5KVCA 1ZSVA 4L73A 1PQUA 5K6AA 2C2YA 4C7KA 1GQYA 4DIBA 4B8WA 3INTA 1I36A 1NVGA 1V3UA 1ZEJA 3BMQB 4PZEA 1K3TA 1YQXA 4CQMA 4QECA 1GYRA 3H7AA 1NXQA 4PIVA 2VWHA 3BZUA 1V35A 4J0FA 5F1KA 4RVFA 1FDUA 2A94A 3W6ZA 1U9JA 2XXJA 4RQUA 4YR9A 1DDOA 1KVTA 4XGNA 2WYVA 5G4KA 3K73O 1N8KA 4TRRA 4O59O 4R9RA 1GUYA 4CMGA 3W8DA 4U8GA 4J91A 4JP2A 3ZGYA 1XLTA 3P7MA 4YVFA 4K1LA 1WP4A 5JYDA 1VLLA 2YY7A 5BT9A 1N1GA 1P77A 2I9PA 2VOJA 4U6SA 2BELA 2ZIZA 1PJQA 4QXMA 3D1LA 4HNGA 1U8FO 5K0ZA 4E2YA 4IMPA 1Y81A 4Z0PA 1VSUA 3VC7A 4F46A 2GYYA 2NV6A 3DBVO 5TF4A 4XX0A 1HE2A 3QJ5A 3ZWPA 4J4HA 4FJ1A 3QVTA 4Z0HO 3TSCA 1H2HA 1G6KA 4PG6A 1DFHA 1HYHA 3F4LA 3LF1A 4UUPA 1P1JA 3EYWA 4ND2A 3WGOA 3MJ4A 5EIOA 2VHXA 3WYEA 3WLFA 9LDTA 3Q2KA 3LT4A 3EZYA 4P38A 2DFDA 2ILTA 3U9LA 4MKRA 1BVRA 5CDGA 3AM5A 2YFHA 5CPFA 5A9RA 1X0XA 2H9IA 3C7DB 4IXTA 5JBIA 1LSOA 5T6BA 4CL8A 1O94A 3UICA 3JQ9C 3QE3A 1WAMA 3JQ9A 2HK9A 3VH4A 1GTMA 2DBVO 1CF2O 1B2LA 5JAZA 4AJLA 2BFPA 1LDEA 3I9KA 4WPGA 4AJPA 4H3VA 2P68A 3U5TA 3ASVA 1YB5A 2Q2QA 1UXHA 3T4EA 1JW9B 1UP6A 5G0VA 4BOYA 1ULSA 4FN4A 4KDEA 1XKQA 3BTOA 3JYLA 5TS3A 4BNKA 2X8LA 3D3WA 3IIEA 4Q3DA 1P1KA 3WMWA 1BXZA 3ZV6A 3H5NA 4BL5A 3F6YA 3H3JA 4II3A 4B7CA 5B37A 1OZAA 3PQFA 4BNGA 1E1NA 4BNWA 1YJ8A 3RFTA 4I08A 3WFJA 4B4VA 2E6UX 2VZ0A 1NPTO 2D5CA 3ANLA 2GN6A 3H9UA 1LRKA 1Y8RB 2Q1WA 3QSGA 1Y5MA 3NTRA 1QR6A 1B3BA 3AU9A 1J6UA 1QKIA 5CDUA 3HWRA 5TGDA 4ZVVA 4XZ3A 1PGQA 5CEFA 2UYYA 5CG2A 3KOUA 2EJWA 2Q45A 3AY7A 3RCBA 4J1NA 3WS7A 3QQPA 3F5QA 1PGPA 3R3SA 1XYGA 3CTMA 3PK0A 2Q3EA 1F8FA 2OP1A 3ZW8A 5G0TA 5BR7A 3NV9A 2HRBA 1LJ8A 3OF2A 2X6TA 4E33A 1TT5A 5KKCA 4YB8A 4BNZA 3JQ6A 1I30A 1VKOA 3E1KA 3PTZA 4NFYA 1DOHA 1DFGA 4CM8B 2W2LD 3WR5A 1TI7A 3FBTA 2IYPA 2Z1MA 2HRZA 2ZB8A 1PGNA 1JN0A 4MINA 3OETA 2D5AA 1DRUA 1BW9A 1E3JA 2VRBA 4BNMA 4ESOA 2D1YA 2FWMX 4PLGA 3STHA 3Q9UA 3I5MA 4Q39A 5JY1A 2DAPA 3I9NA 3Q3CA 1YB1A 2W8ZA 3LU1A 1W0CA 3ZV4A 3I9MA 3ZHXA 3ULKA 1X1TA 1ZMTA 4KUEA 3OJEA 4KMSA 1YQDA 1A27A 4J16A 1VJ1A 5B4TA 1YOVA 4R1SA 2CDBA 1C0LA 1RM0A 1O0SA 3GG9A 1E1KA 3VDRA 3ZU2A 4CMJA 2AQ8A 3AW9A 1FXSA 5JE8A 3MTGA 4RQTA 3OJLA 3LT0A 3QVWA 5HBRA 4M87A 2W2LA 1JA9A 1VM6A 2OHXA 2DPGA 3FNGA 4JGBA 4NMHA 4Y6RA 4RF2A 1YWGO 1LDYA 2P5UA 3DZKA 4BNTA 4WE3A 4BQPA 3ZWWA 4DQUA 5JAMA 5KVSA 2RH4A 4I9HA 1ZJZA 5IDYA 1PL8A 2X5OA 5FI3A 4B3HA 1CERA 1X15A 5T64A 4ZQHA 4NFSA 1WVGA 3ZU3A 3O8QB 3V2HA 1E3WA 1HTBA 3EMKA 2OGUA 4CM9D 3RJ9A 3GNQA 4E2WA 3PVZA 3WWZA 4GGPA 4XJTA 1GY8A 4PCVA 1HDYA 3TOXA 3WGZA 1TA4A 4M49A 4PG5A 4DMMA 4S3MA 1F06A 3NKLA 2BF7A 4NFHA 3B70A 1B15A 1CEQA 1KEVA 2UAGA 3MJCA 4I8XA 3WYCA 5BNTA 3FNEA 1B16A 5TC4A 1QLJA 3UERA 1GYQA 1B14A 3EC7A 3VPXA 5TRTA 1LEHA 1Z7EA 4LMRA 4MP8A 5I7FA 3K5PA 3WGIA 3VKVA 3DC2A 2BD0A 5HWSA 4GAEA 5JCXA 1VC2A 5JDCC 4YAGA 2MAOA 3JV7A 3PGXA 1LLUA 2BI8A 3X2FA 3QY9A 4FLOA 1OMOA 2EF1A 4CLHA 3U3XA 4D0RA 2G82A 3C8MA 4CM9A 4E30A 5DOZA 1T2FA 1Z74A 4Z0TA 1X14A 1HL3A 1MC5A 5JNLA 1DIRA 2BFOA 5ER9A 5DCUA 2QRLA 3KYDA 4IMRA 4JXKA 2W4QA 1U3UA 2R2GA 3PYLA 4U6QA 3UVEA 5KVVA 2AMFA 2I65A 4IINA 3ZV5A 2NTJA 1ML3A 3D64A 4I5GA 1GUFA 4WKGA 4UUMA 4BGUA 4DA9A 2PA3A 2IZ1A 1SB8A 4BO7A 1YJQA 1P74A 4MO2A 1VJTA 2DLDA 4OKNA 4CUKA 2GLXA 3CMMA 1LQUA 5EERA 4RPJA 3DXFA 4WCFB 3A06A 5A04A 3I4CA 1UP4A 4NBWA 4AJIA 2D0IA 4WLUA 1M6WA 3HE3A 1TVEA 4YBZA 2PZJA 5GY7A 4GWKA 4II2A 4PG4A 5FYDA 5C7OO 3OA0A 1T2DA 3BAZA 1YGYA 1E6WA 2HSDA 1R0LA 4MVJH 4XB2A 5I9LA 2ZQYA 2ZTUA 2WJPA 4I5EA 3AJRA 3PWSA 4CLEA 2PD4A 3VZRA 1A71A 2Q99A 3E03A 1PZEA 2Q49A 4BNVA 3VH3A 4CPDA 7MDHA 2J6IA 2HK8A 1KY4A 2GN9A 3L0DA 2CDCA 3PXXA 3QWFA 4N5LA 1VSVA 4AJ4A 2JKVA 1ADFA 3UH1A 2NADA 1E92A 3JSAA 2ZCUA 4GSKA 3WIDA 2Q4EA 2FPIA 1JTVA 1NM5A 3ZNPA 1UJMA 2DTXA 1KEWA 5IF3A 1MVYA 3OEYA 2LDBA 3H2ZA 4GWGA 2WMDA 2GR9A 4CR8A 1BDMA 2OOSA 1FDWA 1C1XB 1JDJA 1GL3A 1P0FA 3GEMA 1NASA 4XRRA 2Q2WA 4IXWA 5I7SA 1E7WA 5BNIA 2O7SA 3JD1A 4CLDA 1EZ4A 1O89A 3EAGA 3HN2A 3QWAA 2R6JA 4R54A 3OSUA 1IZ0A 2NVWA 5T8KC 1JVSA 5T8KA 4U0KA 4FFLA 2ZTVA 4DPLA 4Y9DA 4Z9YA 1ZXBA 4OGWA 4HBGA 3WGGA 1CJCA 3UCEA 2YYYA 2JD0A 2NTVA 1ADBA 1H6AA 1U28A 4NU5A 1MG5A 1EVJA 4YJFB 5TIIA 3DBLB 1E3SA 1JWAB 1E0DA 2QRKA 3KYCB 4OO3A 1PS9A 2DKNA 3K8ZA 2E49A 4GLLA 3JQ7A 5JFOA 3DBHB 4MP6A 1NTOA 2RHCA 3FR8A 2ET6A 4RDHA 5CFZA 4UUNA 5F3RA 5A9TA 3NT5A 1EFLA 4UUOA 2POQX 2B83A 3RU9A 3LC7O 4ALMA 1BXGA 1ADGA 1P0CA 1PX0A 1YQGA 3OP4A 1HDOA 5TT1A 3FWNA 4DGSA 2C82A 3HDJA 4YJHA 2V7PA 3RIHA 3AUTA 3JQDA 4RPKA 4OQYA 3HUDA 3CUKA 4NU6A 4EJMA 1XHLA 1Z6ZA 4LCJA 1ONOA 1A4UA 4CV0A 1MW2A 4FJ0A 3KM0A 1QMGA 4BIIA 3PWZA 3ITDA 5L7WA 3L4BC 1OC2A 4A03A 2Q1TA 1XR3A 3L4BA 4DC0A 4W4TA 3GPDG 4XYEA 3RUFA 3ZN2A 1GPDG 1U3TA 2A4KA 1K6XA 2PGJA 5KOIA 2F00A 4GMFA 4RPGA 3QW2A 1NFFA 3GZNA 1UXIA 4WUVA 3LLVA 2WE8A 1WMBA 4XRGA 4MVJI 4RVHA 1HE5A 1NHWA 1IY8A 3GMDA 3DFZA 3CPSA 2W2KB 2JFFA 1Z7BA 3MOGA 2GO1A 3GHHA 2GNAA 3FD8A 2YW9A 4IDBA 4RJTA 2HQ1A 2B4QA 2J3KA 3GVHA 5U1PA 4FOOA 3AOEA 2MAPA 5IZCC 5IZCA 3FHLA 5EMHA 1PEDA 2Q4BA 3GNTA 4OAQA 5L4LA 1QXSA 1E7YA 1LRLA 1XIVA 2FRDA 2X5KO 1PJSA 3BMQA 3UW3A 4YT5A 4BVAA 4IZHA 1UDBA 1A5ZA 2ZTLA 4JBIA 3PHGA 3DEYX 4TSKA 3AOGA 1MG0A 1XCBA 4WCDA 1B7GO 3UGKA 1U1IA 1FMCA 1ZBQA 3WGYA 4NIMA 3RC2A 1LC0A 5AXAA 2WTBA 1N9GB 3S2IA 2A9FA 5ITWA 1Q0LA 2YV1A 1KC1A 5A4DA 1IE3A 3PYXA 4GVLA 3W4JA 2X9NA 1GAEO 3FTPA 5EN4A 4IQ0A 4CMIB 2Y0EA 1NVTA 3Q0EA 4W82A 4E31A 3VPHA 4GI2A 1WZEA 4R1NA 2Y1EA 1VRWA 2PZLA 2EXXA 1NQOA 5JO9A 3JQGB 4ALNA 3BMCB 3H5AA 4B3IA 3ZWCA 1T4DA 3HB4X 4HUJA 4Z6KA 3JD0A 4P4LA 1L1FA 3DQPA 4HFMA 4MPDA 2EW8A 4XYLA 4PVCA 2OXIA 3WMXA 3KYBA 1RM3A 1H6BA 1P44A 4MVJP 4UULA 3LC2O 4YACA 3A28A 3OIFA 4K9DA 3Q11A 2PV7A 4GBJA 2EV9A 4RVUA 2QG4A 5KNLA 4YXFA 5IFLA 1T1RA 2ZYDA 4YT4A 1RYDA 4E5YA 3HN7A 3RUHA 4JJIA 3ROKA 4IGEA 4TRNA 1X7HA 1LX6A 2JHFA 4OMUA 4DYDA 5L9AA 4FQ8A 2I76A 2CY0A 3VAZA 1WDKA 3WX0A 5A5EA 4CMHA 4PFJA 2V6FA 4CV1A 2FY8A 1N7HA 1Y6JA 3DDNA 4OQZA 3F1LA 1QORA 3PFWO 2ZYGA 1ID1A 4HKTA 4AJKA 1E6EA 3OFSA 1CYDA 1EMDA 3CMCO 4XGKA 3G17A 4KQXA 1A4IA 5L45A 1DHTA 3RASA 3DZGA 3K31A 2P91A 1KY5A 3IC5A 1BHSA 1HDZA 1LC3A 4BO0A 1JWBB 3U4IA 4LRSB 4DPKA 2JFHA 2IZ0A 3D5TA 2GF2A 2J5QA 1VL6A 3GUCA 3I9JA 3SC4A 3QWBA 4WEOA 4BNLA 3W8EA 4D3DA 1I2CA 1K0UA 1N1EA 1I5RA 2PKQP 3E9QA 5DP1A 1U8XX 2DM6A 2LDXA 3AI1A 3PQDA 4ZU3A 1Y8RA 2YQ5A 1H9AA 3SX2A 2NWQA 3KTDA 2GD1O 3KXDA 4D3FA 4Y6SA 2E82A 1BVUA 4JCOA 2H63A 3DZIA 3K30A 4E5NA 2PKQO 1WDMA 1E3EA 2I5PO 5AOVA 4YDRA 4WLEA 2BGKA 4J90A 2HU2A 2Y1DA 2FSSA 1GEEA 4XR4A 4J2HA 2A35A 3NUGA 1MA0A 3WFIA 1RP3A 2WD7B 3H9JA 4J4TA 5A9SB 1T2CA 3TPCA 1AHIA 1TEHA 2WYUA 3CINA 4MVJF 1UAYA 3Q9NA 2Y0DA 3CXRA 4G65A 3DAPA 2YUTA 4YJGB 1R15A 1DIHA 1Y7TA 4K6CA 3WJAA 4NJMB 1LU9A 4TVBA 1RYEA 1YONA 1X7GA 4F3YA 3TN7A 3K6JA 3ROQA 1DJQA 3KO8A 3F4BA 3ZDFA 4IUYA 4KWIA 4CM8A 4CL3A 4RF3A 5C37A 4ROSA 1A72A 4CLRB 4PLFA 4KUHA 4M55A 4XKJA 1J0XO 2DFVA 4PG8A 3JYOA 1T2AA 3TQHA 1XU7A 4AJNA 2VQ3A 3S8MA 3LT1A 2Y1GA 1VPDA 1V8BA 3I9LA 4LSMA 1DRVA 1YE3A 2VNSA 5IXSA 1H3LA 3I3OA 4HV4A 4L76A 3OECA 3TL3A 4FFMA 5C7IO 2XXBA 4MJLA 4FLSA 1LDMA 1O9BA 1V0JA 4NR0A 5K9ZA 2C59A 2HKIA 2WDZA 3DO5A 2G17A 1DEHA 3K2EA 3MJVA 5AYVA 1SOVA 3FNFA 5KJEA 2EWMA 1UR5A 1NYTA 3C85A 1GD1O 1M76A 4KWHA 3OQ1A 2NQTA 2I3GA 2IZZA 1TXGA 2O3JA 1L7EA 5AXDA 4RO0A 1GFSA 2JAPA 2QQ5A 1I32A 4L8VA 4GKBA 4I9UA 1MW1A 1SEVA 3DZHA 5L4NA 1GQQA 1E1MA 3NEPX 3VZSA 3M1AA 3K2BA 2AE1A 4YAEA 4OL9A 5JYEA 1RPNA 2TMGA 1RKXA 4O5OA 4A10A 4E32A 1X0VA 3LT2A 3ZI0A 1X7DA 2VRCD 3ZCXA 4AFNA 4CM7A 2C29D 4EDFA 3C1OA 4IQ8A 1AXEA 3CH6A 4LMPA 1I3NA 5JO0A 2YHIB 2Y66A 1OFGA 4P4NA 2Y68A 4M8SA 3OICA 3W1VA 4U0JA 1K2WA 3WGHA 3ITKA 3LZ6A 4ZRNA 1NAHA 3O8QA 4PLWA 4XR9A 1NAIA 1PGJA 4BB5A 4I9NA 2GERA 2X0RA 5GMOA 5G0SA 4OOEA 3GQVA 2C54A 1W8DA 1EK5A 1I3LA 1EDOA 2OORA 1T2EA 1NQTA 4W9NC 4W9NA 3D4NA 1NFRA 5CP8A 2OBYA 5AQ1A 5BSHA 2ZB7A 4BNYA 4Z3KA 4ZJUA 3H8VA 4FC6A 4O63O 4J9VA 3WTCA 4NH4A 3HDQA 3PLNA 4ALIA 2B4TO 2VRCA 3DZJA 2V65A 1I24A 3A4VA 2ZB3A 4RVGA 3UHAA 3NDRA 3ENNA 5BNFA 3INGA 1S46A 2P9CA 4LSWA 4EITA 3PP8A 3WSWA 2HJRA 2PD6A 4HP8A 3MWDB 4MKZA 5CDSA 2Q2VA 2P9GA 4CODB 1EVZA 2QRJA 4MKXA 3RBXA 4LISA 4OXYA 3D4OA 1BMDA 1Z82A 5JAQA 1IL0A 2C5AA 3QA9A 4D43A 3ABIA 4E12A 3DAFA 2UDPA 2XF8A 3HHPA 4WLOA 2P4HX 3MCVA 1XQ1A 4XQCA 1Q7CA 5A06A 2XOXA 4WCFC 3RJ5A 3M2TA 4WCFA 4A73A 5ITVA 1BRMA 2NVUA 2PH5A 1PR9A 5DDIP 5I7VA 4ITUA 1NQ5A 3RSHA 4YT8A 3RAJA 3TZ6A 1YL7A 4CM4B 2J8ZA 2O2SA 1QP8A 3M6IA 2O3SA 1ZSNA 1O95A 4BO4A 4ZICA 3M2PA 1HZJA 3H6KA 3GHYA 3I83A 1YS4A 4J1QA 4YTEA 3RI3A 3NYWA 3F1KA 2VZ8A 3V8BA 5LC1A 2VHYA 1PS8A 1ZXLA 2IXAA 1A9YA 2NACA 4QO7A 3SLKA 3ZNNA 4CMBA 4MVJM 5DNAA 3E48A 1LXCA 4RLHA 3JQ8B 5DP2A 3GEDA 4E21A 1G5AA 5JSFA 3FPLA 3OHSX 4BGVA 1B8PA 2HUNA 1R12A 2PK3A 4AL4A 4QFDA 2IE0A 1E3IA 4CMCA 2E37A 4J0EA 1UP7A 2CNBA 2VT2A 3GGPA 1B8VA 2GRAA 3RBZA 4FFNA 3GDFA 3OJ0A 2PZKA 4IDCA 2E48A 2WPGA 3V2UA 1TLTA 4WLVA 3IQDB 3ROPA 2AEMA 3SJUA 1GR0A 4OHUA 1K6JA 4ND5A 4PLYA 5AXBA 4AJHA 4D46A 1WNTA 2PFGA 1GEGA 3LVFO 4XQ9A 4JP3A 1C1XA 3HQ4O 3HZZA 4JNKA 4HWKA 3VTFA 3V5NA 2BRUA 4TKLA 4B7XA 1P9LA 1HETA 1IHYA 4MIEA 4XD2A 1GZ6A 2X0NA 2VUUA 1PTJA 4YQZA 3R1IA 4BKOA 3AFMA 1EEHA 5KKAA 1QV7A 3ZZNA 3TL2A 4CQLB 4PLTA 1AE1A 5HRUA 3GOHA 1DAPA 4CLOB 3ADOA 2FOIA 1DFIA 2J3JA 4RL6A 2O23A 4YPOA 3GEGA 2CVZA 2HCTA 1Y9EA 3QVOA 4L74A 4DC1A 5CEJA 2JCXA 4IS3A 4YJFA 5IDXA 3IUSA 3DBLA 3JQAB 4GX0A 2QX7A 3KYCA 4PG7A 5EQFA 4XA8A 4IIUA 2BGLA 2PH3A 4I5DA 1QV6A 4TMFA 1P1IA 4UVGA 4QTZA 3DBHA 3PHJA 3GVPA 3PHHA 3ZWMA 3NRCA 4EI2A 4XGIA 4XEHA 3OBBA 4HFJA 5G4LA 3KB6A 4YAIA 1PZFA 4QO8A 3H4VA 3WIEA 3GUYA 3VZQA 3ONFA 1I3KA 1U2GA 1WZIA 1JKIA 1Y5RA 4OH1A 2DVMA 1EBFA 1F14A 4I5FA 3NJ8A 3FSRA 1J5PA 3D3EA 4G81A 4P22A 3RUEA 3T7EA 4D44A 1UXKA 3WGQA 3NT2A 4BO9A 2YQ4A 1EUCA 3MJEA 1MLDA 1MW0A 4IZIA 2C5EA 3GZ4A 4M54A 3VPGA 4CMKA 3HSKA 4ZD6A 4FDAA 1ZMOA 2NLOA 3FR7A 1GYPA 1MV8A 2WEKA 3O9ZA 2NM0A 1SZJG 4J3FA 3RUIA 4CR6A 5L95A 1WMAA 1DO8A 2PLAA 4IM7A 4PGFA 3C24A 3DB2A 1CIVA 4RV9A 5J23A 3TFQA 1AXGA 3K9QO 1AN9A 1OI7A 3PDJA 1E1LA 1C0KA 4JK3A 5DN9A 3D0OA 3B1JA 1AUPA 3JQFC 3JQFA 2X86A 5JC8A 1B3RA 3JD4A 1E77A 1FDVA 3VKUA 2B4RO 3GAFA 1DAOA 2X5JO 5F1OA 1J4AA 2WE7A 2W2KA 3IMFA 3H3FA 2QZ9A 2CF6A 3UEQA 2RIRA 2Y1CA 3EY4A 2EW2A 3F47A 2VHWA 1DIBA 4JBHA 5JCJD 2FPGA 2VTDA 2GN4A 1DC3A 2O4CA 4FBGA 4R41A 2FZWA 4BO5A 1U5CA 3DAGA 1XDWA 3RWBA 4D0SA 3HFGA 3BHJA 2PNFA 3U0BA 1U4SA 2WM3A 1KERA 5JY6A 1WWKA 9LDBA 1B26A 4RF5A 1ISJA 2C7VA 3JQEA 4R5HA 4D3SA 2YDXA 1NVMB 1YVEI 5G0UA 1MFPA 1N9GA 4NK4A 1Q0HA 1HLDA 3EW7A 4GH5A 1AHHA 3BMOB 4FPXA 1I0ZA 3UAGA 4AVYA 3WBFA 2AHRA 4DMLA 3GFGA 2I6TA 3MJTA 3RKRA 4BQRA 4CMIA 3ICCA 3IL2A 1WDLA 3DMYA 3ZNQA 1PGOA 4K6FA 5B1YA 8LDHA 1Y1PA 1V3VA 1ZVMA 3C7AA 2I67A 4MIOA 3GRKA 5DT9A 1HSZA 5JCJA 2X23A 2VYND 3JQGA 1SOWA 2DQ4A 3B20A 3BMCA 4R69A 3W4IA 4J6FA 3DTYA 2X58A 2VUSA 3Q2IA 4NPCA 4Q9NA 1R6DA 3DBRA 2Y67A 4RVDA 4A2CA 3PHLA 1E6UA 2X1HA 1UH5A 3AUSA 4DQXA 4UAGA 4EZBA 1D4FA 4XIYA 2VCYA 4RLSA 3IUPA 5IN5A 3EZLA 4FC7A 4FJ2A 1SPXA 3KLPX 3CIFA 5I8ZA 5DULA 3GG2A 2B36A 1JGIA 3E5MA 4HX5A 2AG5A 1KVRA 6ADHA 4JLWA 3L4SO 3PZBA 2GASA 4TROA 2IEBA 4NJOA 1GV0A 1U5AA 3PI7A 1LSJA 5EINA 3QLJA 5ER6A 1IULA 2GGSA 2I66A 1PWXA 1ZKMA 1WW8A 5I9NA 1UDCA 3AK4A 4L75A 2YJZA 2AQHA 2EEZA 4ZQFA 1U3VA 1J49A 3SLGA 1ISFA 4J43A 3QVXA 2EIHA 2E4AA 1BTOA 3L6DA 5ICMA 1U4OA 2FSVA 3WQQA 2BI7A 4ND4A 1VI2A 1I3MA 2O4UX 4LK3A 3H65A 4YAKA 1PJLA 3JYQA 1UZNA 5COAA 4G5HA 4B7UA 1HDGO 5CHEA 4U7WA 5JMPA 1S7CA 3ICPA 1UDAA 5IG2A 3SVTA 4XYMA 2WD8A 2Q1SA 2H5LA 4J1TA 3U4CA 1H0KA 2O7QA 2B0JA 3CE6A 4K28A 4W7IA 3UFXA 5JLAA 4CM5A 1HE3A 5A3JA 1I2ZA 3TNLA 4Y98A 2Y1OA 5IZ4A 4Q3BA 4TZKA 1Y8QB 5A02A 4BKRA 2WD7A 1A9ZA 1VKNA 4NQWA 1I10A 5EQDA 3VVBA 3TZKA 3ZWOA 3VOSA 3IP1A 4YJGA 2QHXA 3KSDO 1KVSA 4FGSA 1ADCA 2YDYA 3EUWA 4NJMA 3S55A 3LC1O 2DUWA 1O8CA 3FCOA 3ADPA 3IKVA 4WASA 1KYQA 3PQEA 4W7HA 1Q0QA 1SEPA 1LQTA 1ENOA 4LVCA 4N7RA 1HT0A 1AGNA 4CLRA 5HS4A 1PJ3A 4NZ9A 3L77A 3QVSA 1JKFA 3SC6A 4BKPA 5C3MA 1C0IA 4A27A 1GCOA 3D4PA 1B8UA 3JD2A 3N7UA 4R9SA 5A03A 3B6ZA 2FR0A 3IJPA 1WXDA 3OJOA 3PPIA 1DRWA 3GK3A 4JJGA 3EK2A 1MGOA 4UEKA 1RJWA 2VWPA 2ZQZA 1D3AA 3DOJA 3JYNA 4GQAA 4PLZA 6LDHA 3AOEC 3PYMA 3I1JA 4OSPA 3JTMA 3PHIA 1Z75A 4IQGA 1C3VA 3H9GA 4CR7A 1ZZEA 1P1RA 1JU9A 1H94A 3D7LA 3PJEA 1JLLA 4J1SA 3K96A 4UEJA 4XCVA 5DF1A 4BB6A 1NFQA 2VNAA 3G3EA 4GKVA 4NHEA 4A7PA 1R4MB 1QYWA 3S1LA 3WXBA 1LLCA 5DZSA 1XA0A 1X1EA 5TLSA 4BUCA 1ZW1A 3VH1A 2Y0CA 3ZU4A 2DTEA 1HF3A 1N7GA 4IIVA 3GVCA 5EESA 4Q3AA 2D8AA 4NI5A 5U4QA 3ETDA 2HJSA 1NPDA 3FI9A 2JCVA 3GR6A 4LRTB 4CMAA 2VZ9A 2B69A 3N58A 3PFFA 4MP3A 4ZRMA 1K6IA 1NBOA 3FRJA 1GU7A 2RCYA 3OM9A 3V1YA 1R16A 2EKPA 5FEUA 3GC6A 4KDFA 3S2FA 3TDKA 3AFNA 3HADA 4GX2A 4P8RA 4BV9A 3ST7A 4H16A 5T67A 2V6GA 3DR3A 3VZPA 1D1SA 3R0IA 3LDHA 2PKRA 1GPJA 1UZLA 4L4RA 3P19A 4IDDA 3T0YA 4FLRA 5H81A 1H6CA 1ULUA 3BXXA 4KTVE 1GCUA 3SXPA 2X9VA 5THKA 1NHGA 2AQIA 3RUAA 3ROMA 4Y6PA 5T5QA 1ISHA 3U09A 3RFXA 1I01A 2VWQA 3AM4A 4IDFA 1BGVA 3VDQA 4F6CA 1QYCA 3GT0A 2YV2A 2NNLD 4CUJA 4BKQA 2G5CA 2NQ8A 2Z1NA 5L40A 5KVQA 3HDHA 3RQSA 3VTZA 3RKUA 4H15A 2F1KA 1ARZA 4D42A 4YCAA 3KRTA 1H9BA 3GN2A 4FFOA 4AICA 2RAFA 4Y8VA 3AY6A 3CKYA 3JD3A 3OQ6A 5DCWA 5TJHA 1EQ2A 5THQA 1PR3A 2DPHA 4IGFA 5EJ2A 3O38A 1YBVA 4GMGA 2PY6A 5BSGA 1DJNA 1EQUA 4BNNA 5BSEA 4UREA 4INAA 4ALJA 1DC5A 1HSOA 1OAAA 5T57A 3TWOA 5JC1A 2PGDA 1E7QA 3TZHA 3ZHBA 3FTNA 5IDQA 3I52A 3KV3O 4AJ2A 1PL6A 1CWUA 4BO6A 1RWBA 3O26A 5A5FA 4O6VA 3E82A 2B35A 1GV1A 1BG6A 1P33A 1MW3A 3MTJA 5CDTA 2AG8A 2AEJA 1DXYA 1NNUA 2BFMA 3GVXA 1U3WA 3NJ4A 3P5SA 3V1UA 4BO8A 3V2GA 4CM4A 1W4ZA 2UV8A 4WJZA 1GZ3A 4EJ6A 3F5SA 1QLHA 3EDMA 2CFCA 2RBEA 1PJTA 1TT7A 3FF4A 4DBZA 4WOJA 1SAYA 1SC6A 3LYLA 4XB1A 3KETA 4BNJA 3ANMA 4D41A 1ZIDA 2VTEA 1KVQA 3BHMA 4N18A 4O0LA 4IY1A 1DPGA 1I8TA 1LI4A 3JQ8A 2HMVA 1ZNQO 2O3RA 2OFPA 3MJSA 5JAIA 2BMAA 2HMWA 2WYWA 4BNHA 3KBOA 1BXGB 1UXGA 1MUUA 4TRMA 5EPOA 3DONA 2JD1A 3CZKA 3PGJA 4LN1A 3JQAD 1T1SA 3R6DA 1JAYA 4B8ZA 3T4XA 3JQCA 3ZWAA 1IOLA 2PZMA 1YL5A 2IYOA 4BO3A 1A7AA 4B3JA 3CZGA 3LF2A 2JJYA 4WNIA 3DTTA 3X2EA 3GN1A 3B1FA 3IDSA 4YYZA 4GPD1 4J7UA 4R5MA 3CZMA 5GZ3A 1MFZA 4R3WA 3NT4A 1KETA 4GLOA 2EG9A 1EVIA 4MIYA 2GUGA 1M75A 3CSDA 5TX7A 1JQBA 1ZK1A 3RD5A 4CMEC 1U7HA 2DBRA 4CMEA 4E5PA 4DIOA 3I9OA 3UUWA 1ENPA 4TZTA 4CQLA 2IDZA 5L3ZA 4FD3A 4CLOA 2C20A 4IDEA 1GDHA 3OIDA 4RCVA 5I9MA 3DHNA 4EJ0A 2EKLA 1W73A 2NU7A 2EGGA 5TT0A 4A26A 2C7GA 3QP9A 1UXJA 3ON5A 2VHVA 3HFSA 1PZHA 4NBVA 3C3XA 5TNXA 5MGBA 1ZFNA 4W99A 3JQAA 1MXFA 3NX4A 2OMEA 3EGOA 5TQVA 4PLVA 4HXYA 3PLRA 3WLEA 4QX6A 3I23A 4J9UE 2QW8A 1PSDA 1UAGA 1S6YA 2ZKLA 5KJ1A 1ZJYA 1LA2A 3EVTA 4I1IA 5KJ6A 3TF5A 1BSVA 2AE2A 4ALLA 4WLNA 5IN4A 2B37A 3LK7A 4M86A 4O1MA 2FHSA 3AY3A 1KBZA 4MOWA 4YT2A 3O4RA 3UCQA 5LDHA 3JCZA 4PZDA 3LSYA 4DLBA 2D59A 1PS0A 3PIDA 5H82A 4IJVA 2Z95A 1YH3A 4LGVA 4Z9XA 3CZRA 3ONEA 1ZH8A 2IEDA 4RVSA 5DOVA 2JD2A 3AU8A 3BA1A 4DLLA 3E18A 3C7CB 2O2YA 4DLAA 5IJZA 3WYBA 4CLXA 3BHIA 2V6MA 3HNPA 4EEXA 1M67A 4CM3A 5G2OA 4BMVA 2CVOA 1GADO 1FDTA 2HO5A 1HYEA 2OUIA 3ORFA 2HMTA 3E9NA 2OBNA 4N5NA 1C0PA 2OP0A 1IPEA 1PL7A 1SNYA 1HWYA 3LLSA 3VH2A 2WSBA 1LDBA 4RF4A 4DVJA 1A7KA 1NWCA 3V1TC 3BMNB 3ZU5A 3KVOA 1T26A 2FR1A 3HG7A 3UCFA 4FW8A 3NGLA 3DMTC 4WOKA 2J5KA 3DMTA 7ADHA 2UUPA 1FDSA 2GCGA 3OJFA 4PLHA 2P2SA 3WGTA 5GZ1A 5COQA 4CV3A 1R0SA 5FF9A 2EP5A 4WEQA 1CETA 1KIFA 4ALKA 2P5YA 1UZMA 3UKOA 4RDIA 1DSSG 3C1TA 4LUPA 5G0WA 4DPMA 4ND3A 2AQKA 4C7JA 2AXQA 2FP4A 2UUOA 2O3TA 2X9GA 3GRPA 4BNFA 3PJDA 3ZWYA 1OR7A 2O3UA 3WNQA 3BMOA 5CAEA 3AM3A 4OJNA 4PLPA 4C4OA 1PJBA 5LCXA 1F8GA 1ZCJA 4OXKA 3RUCA 3MWEB 3T7CA 3WDSA 4FLQA 2FN7A 4KUGA 2VOEA 3L6OO 2O3QA 2CUKA 3KSUA 3RC1A 4WECA 3L9XA 1Q1NA 4OYRA 5AXCA 4M1QA 1K89A 1VE9A 2OO5A 3TFOA 1D7OA 4MVJD 4E6PA 1ZEMA 5CEEA 1KOLA 3UXYA 4ZQGA 1KVUA 3FN4A 1O6ZA 5DCYA 2Q46A 4JBGA 3E8XA 3GDGA 4PZCA 3ANNA 3GH3A 5JXWA 2VYVD 4ND1A 1NQAO 4NK5A 3GNSA 2NTNA 1LSUA 2A92A 2CD9A 1VJ0A 3H5RA 4R4JA 1YRLA 1F17A 4RZIA 1ONNA 4GX1A 1E3LA 3GGGA 3KZVA 4BKUA 2J3IA 4JQCA 4P4GA 3W6UA 4BV8A 2EHDA 5KWEA 4U5QA 5ES3A 4JX8A 2JAHA 4CXFA 2VWGA 5IDWA 3OA2A 4OIMA 2HAEA 5JMWA 1L7DA 5ICSA 1LLQA 3O03A 4FOSA 4HADA 4YRAA 2HK7A 2I3AA 3D5QA 3L6EA 4BO1A 5I7EA 1C1DB 2O7GA 3GA0A 4ZGWA 4W6ZA 1R4NB 4OXNA 3QV1A 3L9WA 4MVJA 4MDHA 4Z9FA 3SBOA 3UF0A 3FPCA 4DWVA 3AUAA 3RC9A 5FFFA 3ENKA 4NBTA 1DBVO 2FZEA 4NDNE 5KJCA 3G1TA 1Q2XA 2FPPA 1LNQA 2D4AA 4CM1A 4FFPA 3QWHA 3TOZA 3ZWVA 1QG6A 5KJFA 5I8WA 1CDOA 2VYVA 3CZEA 4OKIA 4DTIA 1PJ4A 4IPTA 2C2XA 4WLFA 3VVCA 4RPHA 2B5VA 3U4DA 2YV3A 4XDZA 3RROA 3FNHA 3QWIA 4CQMB 3NAQA 4E3ZA 3G0OA 3LQFA 1PJCA 4NNJA 2AEFA 2NU9A 4JJFA 1UUFA 1EK6A 3QIVA 3JYPA 4IDAA 3JQBC 3JQBA 5G4KB 1FJHA 1ENYA 1YDWA 4E5MA 3MEQA 3DHEA 1XGKA 4UVHA 1HDCA 3NTQA 2VUTA 3PRJA 4DREA 5B4VA 1PIWA 5JS6A 1M2WA 4S1VA 1Y8QA 4Q3CA 3NDIA 2AA3A 5HA5A 1KEUA 1N2SA 3S2EA 3WWYA 3KEQA 2H1SA 4RZHA 1ZK4A 4L4SA 3EHEA 3ONDA 1ORRA 2D3TA 2Q50A 3ZWBA 1V9LA 3DZFA 1LRJA 1XU9A 4PRKA 3RC7A 2GPTA 3W4KA 4CV2A 3OQBA 2NU6A 4J2OA 4OSOA 3GMSA 5ENVA 1G0NA 4BMSA 3GF4A 4D7AA 4ID9A 1NR1A 2NSDA 4QT0A 1JG9A 3L07A 4HY3A 3P2YA 5DBGA 2ZK7A 5KCZA 4BMNA 5KTKA 2IODA 4E2XA 5L4SA 3I6IA 2Z5LA 1P1FA 3TZCA 4K26A 5IXYA 4GL4A 4F6LA 1PJ2A 1WPQA 1IUKA 1YB4A 2DC1A 3RVDA 3Q6IA 4H7PA 4DYVA 2PGLA 4AJ1A 2C07A 3IAHA 1YBAA 1EVYA 5L7YA 1NX6A 2JFGA 3F46A 4J7CA 4WGGA 3GLQA 4WNCA 4Q3NA 5JDCA 1OC4A 1MX3A 5C7LO 3ZHZA 4YEDA 2PR2A 2VN8A 2YFQA 4DUPA 4QUKA 4UVIA 1JVBA 3WG9A 1BWSA 1HKUA 5U9CA 4B79A 3QHAA 2ZJ1A 3D3WB 3DFUA 5ADHA 1R4MA 4JIGA 2ZB4A 4BGIA 1H93A 2BLLA 3WQSB 4RGBA 3DOCA 3FBGA 1PWZA 4LVUA 3WTBA 1NPYA 3GDOA 4FFRA 4TRJA 5ILGA 2FR8A 3BTSA 4QQRA 1LSSA 3CEAA 5F5LA 2HMUA 4DXHA 4UVEA 3PEFA 4UVDA 2X4GA 2X0IA 1DC6A 5MDHA 1IB6A 2GDZA 2W90A 1EE9A 2SCUA 2QZZA 3R3JA 4E5KA 1K5HA 4YRDA 3A14A 4RORA 3VPFA 1PZGA 3PJGA 1JKJA 4FSHA 1ISGA 5COBA 3E6AA 4BHTA 1XEAA 4MVJE 3OIGA 4J4BA 3GVIA 2NVUB 4BGEA 5FWNA 2AW5A 1Z45A 3NTOA 4EW6A 3WJ7A 3A1NA 1ISMA 4JROA 1DLIA 3EVNA 4X54A 3UOGA 1P1HA 1R37A 2DUUA 2FMUA 3PJFA 3WOHA 4AJEA 2DBZA 4KP7A 5CDYA 4Z3DA 3DOOA 4IS2A 1KEPA 4OOFA 4OM8A 3QRWA 1B0AA 3GAZA 1C14A 3DWFA 3AI2A 3HB5X 2C0CA 2BFAA 1TT5B 4E0BA 1M6HA 1T24A 3HDYA 5DBIA 4GVXA 2BGMA 4DL9A 2EP7A 3ZWXA 3DL2A 1YKFA 1R0KA 1IHXA 3UN1A 4B4WA 4PVDA 4L9RA 2BHLA 2GZ2A 4IJUA 2OZPA 2XPCA 1IZ9A 1BW9B 4TQGA 2G1UA 2NUAA 1FF9A 1SBYA 4KOAA 1NP3A 4A5OA 3H9EO 3ETGA 5LDGA 2DU8A 4IDGA 5JDIC 4BS9A 4QEDA 5JDIA 2VYNA 1YDEA 1HXHA 4PLCA 4E2ZA 2ZYAA 1M66A 1G1AA 4FR5A 4L0QA 5FI5A 5KIAA 1JAXA 1YO6A 4EUHA 3IOYA 1ONPA 4XYGA 4XQEA 4KZPA 2Y93A 3BTVA 3S2GA 1YOVB 4GSLA 4JN6B 1WLYA 2J5RA 4LCEA 2DT5A 3IJRA 2J3HA 3OH8A 2ZATA 1E7MA 2H6EA 2X7HA 3F3SA 4MVJG 2BKAA 2PWZA 2IXBA 1OBFO 3OMLA 4BO2A 1DC4A 1HEUA 3WQRA 3RFVA 5B4UA 4NBRA 4R3NA 1SMKA 2QYSA 4N54A 5F21A 5A9SA 3IS3A 4HFNA 1QSGA 3I6QA 4YAJA 4YRBA 4FB5A 1F0YA 3IP3A 1I33A 1E5LA 3P2OA 1SB9A 4UEOA 1D1TA 1R66A 4EGFA 1HLPA 4NBUA 1EDZA 1E3WB 1ZK0A 3E5RA 1P3DA 3VHRA 2PD3A 3OEWA 3DHYA 3WICA 3N74A 4G2NA 3KUXA 3U62A 4XWYA 3WNVA 5B12A 4IJKA 4ZHSA 4ZQEA 1W6UA 4D45A 2ZJ0A 2Y05A 1GZ4A 8ADHA 3A9WA 4YQYA 1N92A 5ENDA 2X0JA 2Y99A 1T4BA 1XSEA 4NQZA 3KEOA 5JPIA 5BQFA 2CF5A 1DLJA 2X22A 4R01A 1XELA 2EKQA 1I2BA 2RH8A 1HRDA 4AYSA 2OL4A 4LW8A 1PU2A 5CPBA 1DIAA 2NU8A 2GSDA 4RPLA 1YBMA 3AUUA 2PTGA 3WBBA 1BXKA 3C1AA 2ZCVA 3ZW9A 5A1TA 4PN3A 1H5QA 1U7TA 4XIJA 4IJWA 2G76A 4ZN6A 3SJ7A 1HDRA 2UVDA 3IKTA 1LTHR 1X13A 2ZTMA 3KSZO 4ZQBA 4YWJA 2DTDA 3U4HA 4NG5A 5L7TA 3W8FA 3KYDB 1HE4A 3ZWNA 4Y67A 4A0SA 1OOEA 2I99A 2Q1UA 1EBUA 2YHIA 1SO8A 2R00C 2R00A 1KC3A 2CZCA 1ZSYA 1G0OA 4DRYA 2EGHA 1TB4A 3RU7A 2VT3A 3GPIA 4AJJA 3FWZA 3GGOA 2GN8A 2JCYA 1DHRA 4Q3EA 4XJSA 4D79A 3H9QA 1CRWG 1KS9A 3KHUA 1ZUD1 1BDBA 1O5IA 5F1PA 4EBFA 1MXHA 4ZA2A 1IYZA 1ZO8A 4HFRA 2XAAA 3AWDA 1P45A 3BIOA 3GFBA 4YJDA 1CQIA 4TKMA 3WB9A 1D8AA 2NVBA 1HDXA 1ZK2A 4WK6A 3AI3A 2WWRA 4GX5A 1XQ6A 3PDUA 4DBVO 1Y9AA 1DB3A 4KTTE 1QYDA 3KLMX 3WSVA 4BNIA 4CJXA 4F45A 3TRIA 2VHZA 1NR7A 2JL1A 2HLPA 2G0TA 2EJVA 1E7SA 2HMSA 4R16A 1SC5A 4R51A 5DBFA 1LDGA 3E9MA 1ISIA 3DBRB 4L4XA 1NWHA 3PIIA 1FK8A 4QFCA 2YZ7A 4QSMA 1HYGA 1F12A 3SEFA 3BTUA 4FIZA 4URFA 4ILKA 2EERA 3COSA 1RM4A 4XDYA 1XWFA 5EL0A 4PRLA 3GY0A 4FCCA 4ONEA 1GUZA 4AJOA 3G79A 5C5IA 1MB4A 2CDAA 3BMNA 1E5QA 5L53A 3NDJA 5JW6A 2V6BA 3U49A 2BH9A 4R1TA 1VL8A 1YXMA 5IAAA 4M89A 4KQWA 5TSDA 2CSUA 1V3TA 2P4QA 2GZ3A 4N5MA 4R1UA 1VL0A 2JHGA 3UCXA 1ENZA 5AVOA 5HM8A 3ETEA 4EYEA 4FS3A 4TVOA 2P9EA 2IRWA 1H2BA 3RBVA 4BNUA 1QRRA 5H83A 1ZK3A 4J49A 5HTOA 5ILOA 2CVQA 1Z73A 1XG5A 3G1UA 3G49A 4FGWA 4CM6A 4EUFA 5BSFA 5L51A 1YL6A 1N5DA 3JQ7B 1LUAA 3MZ0A 1Q7BA 4IBOA 3TJRA 2QIOA 3INRA 4CUZA 2O50A 1MC4A 1GQ2A 4EUEA 4XYBA 3Q1LA
chains in the Genus database with same CATH superfamily
4U7JA 5BXYA 3PXUA 5IHXA 1E2LA 4BJ5A 3R24A 3RIGA 3EH2A 4EF4A 1HE8B 3B1KA 5EEHA 4BTLA 1E5DA 1Z5VA 1HGXA 3JWGA 4F4FA 3ORQA 5C8XA 3VPSA 1QE3A 4RLFA 2C8LA 3T4PA 1HZZA 1CIPA 4G1FA 1XTUA 4IGAA 4DSAA 1ONSA 1DG3A 4ZXPA 1L4GA 2XDQA 3GARA 1KS2A 3AI7A 4QUIA 4UBOA 1XFDA 1P2FA 1VG1A 2MSKA 2TMDA 1H6DA 3PZRA 5AKLA 4W63A 3A3YA 4EHFA 1ZN9A 5LMUB 3K92A 1QHFA 1CUUA 3B3AA 2HIHA 1KMNA 2ATXA 7MHTA 3LCVB 2FDCA 2GHIA 3BYZA 1KOJA 3MG9A 4CQMD 3CHSA 4RTQA 1RKVA 1E7RA 1T0PA 3ESAA 1ZS2A 1Z6AA 4EEZA 2IK8A 4C0QC 2RHRA 1UWKA 3GI1A 1TKAA 4CQJA 4UQLA 3VSDA 1UAAA 2GZ1A 2JARA 4JR2A 4YA6A 5GIOE 1Z0UA 1IPHA 1P4RA 1FB5A 4E4YA 4UFPA 2X8AA 3B7SA 2I78A 3GZNB 4MJXA 2XIQA 3TMAA 1M8FA 4RXTA 3CZLA 4UM8B 1GVHA 4UXIA 3FHCB 2CSXA 5MGNA 4MS4A 3H5LA 4UDNA 2Y1FA 3PCRB 2G72A 5JS6A 1KI9A 1QYXA 3O7WA 1WEHA 4ZDIA 2CMDA 1DIGA 2E4ZA 1CQJA 3RPEA 3KXIA 1G9TA 5LQMA 1X7YA 3ENVA 1VDZA 1OAOA 5E2AA 4R2JA 5JYCA 3RK0A 2JASA 5LKRA 1YMVA 2PJUA 3ZNOA 2ORYA 3RUDA 1H4QA 5E6SB 1I51A 3QPDA 5F5NA 1KZ9A 1ZSVA 4EEKA 3EFOA 1JLKA 2JCSA 3EFEA 5E3JA 3GEHA 3TQOA 4N3CA 5KPJA 1V3UA 3BMQB 5C8DA 4PZEA 1ZCAA 3R7WA 1BHJA 1XZLA 1IBSA 2GBLC 3KU1A 2GBLA 5T7BA 4KI0A 3H7AA 2VWHA 3BZUA 3PRHA 4M88A 3WKCA 2A94A 4BKMA 1A82A 1E79A 3G2JA 1OFVA 1R00A 1U9JA 1UJNA 2ZZKA 4G26A 4RIEA 1XJCA 5F52A 4XGNA 5G4KA 1Y1TA 2BISA 3K73O 4TN5A 4O59O 4Y6OA 3TCXB 3W8DA 2NZ8A 4A0HA 4J91A 4JP2A 2V3VA 1N0UA 3UO8B 2Y1WA 4XTRA 2J9FB 3O4HA 1L5ZA 1GU1A 1ZH4A 4MJ3A 2H7XA 4QOIA 5AUPB 1GGMA 3QUTA 4IWNA 4U7DA 4U6SA 3V3TA 3AR2A 3IV6A 4C4SA 2BELA 5FTNA 2C7OA 1SKAA 2REQB 3QITA 4QXMA 2LCQA 1M0WA 4O2RA 1R5OA 1L4EA 3D1LA 3I64A 4WRRA 2YWBA 1U8FO 2ZWOA 2DHEA 3GRUA 5BVGA 3ABSB 2HY7A 3TJMA 4BIMA 4F46A 1GFZA 2GYYA 1BNCA 2FEWB 3ZLJA 1SKYB 4A91A 2ODQA 1BN6A 3QVGA 3REGA 2F43B 4FJ1A 4PZAA 4Z0HO 3SI7A 1DG9A 1H2HA 5I48A 1OF1A 5BMVA 1HYHA 3F4LA 3LF1A 2I22A 4UUPA 2YMPA 2WU1A 3EYWA 3WYEA 4DF3A 2P1ZA 2R5FA 2VHXA 1QPGA 3BG5A 3OLQA 4MUYA 3Q2KA 5FRDA 4EIWA 1TAHA 1F9EA 2DFDA 3U9LA 4MKRA 4EKYA 1YS1X 3AM5A 2YFHA 5CPFA 8GPBA 1XD8A 3WSTA 1JG2A 3C3DA 3HVJA 1ZNXA 5I5EA 3T3OA 4IXTA 4UNPA 4BVHA 4MVCA 2X42A 4OP2A 2FG6C 1TEXA 3AKZA 4OSEA 1YZQA 2NZVG 1E3QA 1PG0A 2HK9A 1OILA 2QVYX 2AOXA 5DLLA 4V0KA 4BAZA 1D9ZA 4NYMQ 4BMXA 4YXWD 1V7QA 3ENWA 5JAZA 1XRPA 2BFPA 3Q7RA 4WPGA 4H3VA 2QSZA 3HR4A 1Q11A 1U0GA 4MW0A 4UMVA 3LPMA 1E59A 2OPBA 3AKCA 4LOKA 1MVLA 1UP6A 3T4EA 4BOYA 5GTDA 4H0NA 4OX9B 4C7OB 4BNKA 3THWB 2YZGA 3WZMA 4NYIQ 1JQDA 4P86A 2X8LA 1VCMA 4AY6A 3FPJA 4LWQA 4Q3DA 4HH4A 3DOIA 5TGTA 3U3OA 4EHDA 4B71A 4K81B 4J0DA 1FS4A 1WABA 3VC1A 2Y6UA 3HXPA 4EG4A 3F6YA 4MCHA 4N6GA 1TX4B 1U8ZA 4NMXB 2XVAA 3UAWA 1KYWA 3PQ7A 4B7CA 4BFZA 3A2NA 3OTHA 3SE7A 5LB4A 1WHTA 1VMIA 4A6EA 4A82A 1ZGZA 3M1YA 4BNWA 4V1CA 4I08A 1EDDA 2VLIA 4ARZB 2VZ0A 2X3UA 3DLTA 1Y6GA 3ZBQA 2GN6A 1KRHA 1T8WA 3H2YA 2Q1WA 4IIJA 5F7ZA 3LIPA 4I6JA 1KNXA 5G3ZA 3VKGA 3M6WA 3IQWA 1KWGA 1JF8A 1KQOA 5CDUA 2OG2A 2RHMA 3H04A 4FN5A 4BXOA 2WFLB 3HWRA 2HWYA 4OXXA 4ZVVA 3GRZA 4XZ3A 3EWIA 3AP1A 5CEFA 2UYYA 5CG2A 1WUTA 1GA4A 4UU7A 2CZGA 2Q45A 2QNIA 2WWWA 5G53C 3R7FA 3KPJA 1IHDA 3VO1A 1EB8A 2RGWA 1ODFA 3DWEX 3QQPA 3WS7A 1PGPA 3R3SA 4HH3C 1I6MA 5KU7A 3CTMA 4RENA 3PK0A 3RE1A 1F8FA 4OQPA 3LUFA 3ZW8A 5G0TA 2SKDA 5BR7A 3OF2A 1H9CA 2HHLA 4ENQA 3LE8A 1S2NA 2NUPB 4I36A 3P9IA 4YB8A 1DI0A 3JQ6A 1ZM7A 4UOQA 1YRHA 1U0LA 1XA4A 3PGMA 3PF9A 1RE1A 5KAMA 4F2WA 1S4QA 2QTVA 3ZLTA 5CGZA 4H60A 5SICE 3WR5A 3BM5A 4C4RA 1EP2B 4B3XA 1HYBA 1PGNA 2OXTA 3ZE2B 3HEBA 4CG2A 2PZEA 1AMUA 1BW9A 1T5LA 2ZSFA 4HQRA 1RZUA 2PEZA 3H86A 4TTIA 4NEQA 2WZBA 3OLXA 2ZJYA 3T34A 4XWOA 2PQ2A 4ZCRA 3B7TA 1A9RA 3MHPA 4M9XA 4ZPXA 1G2IA 2Q7OE 4TMKA 4IWYA 1F5NA 5GOTA 1OX5A 3STHA 3Q9UA 5C1OA 5BV8A 1XUOA 2H4WA 3D1VA 3I5MA 4M37A 4LYDA 2Q6LA 2QRNA 2XUKA 4H31A 2VSOA 3SF8A 1YB1A 2FW9A 2Q9CA 2W8ZA 3LU1A 1X7ZB 2AX3A 3I9MA 3ULKA 1JG6A 2F9MA 1X1TA 5GIPE 1GPBA 4KUEA 4X92A 5DMHA 4J16C 4C6TA 4YUWA 4J16A 1QS0B 1L5GB 3SQMA 4RY9A 5ETJA 4R1SA 4KE6A 1F1BA 4PQYA 3WADA 1SIWA 7REQB 4GXQA 5GINE 3FTYA 3OZTA 4QVKA 2FPUA 5EZQA 3ZU2A 2AQ8A 3AW9A 1FXSA 3UMMA 4JYBA 2VF2A 3OJLA 2CHEA 4HH0A 3ZE6A 5HYVA 4COOA 4F38A 3TRDA 1YZ3A 1MJGM 2VLAA 1UMCB 4KBYA 4DWOA 1C1HA 3FNGA 4NMHA 5K0TA 3GBPA 2OMKA 3B3GA 2OQIA 3OIWA 3HO1A 1P1CA 5AMXA 5CFPA 5LQUA 4RTKA 1JXMA 3OO1A 1FU4A 5B53A 3G9TA 1VIDA 1RAAA 3MB5A 3AXSA 5JAMA 3OQMA 4NBLA 1WV1A 4I9HA 3QF4B 9ATCA 5IKEA 3OCXA 3X2FA 1NW5A 3B78A 3IDOA 4RE6A 1IQUA 3ZXSA 1LZLA 4WI1A 3PX7A 3GDHA 1CERA 1X15A 3OLWA 1JJVA 1U2EA 1XDSA 2D1SA 3IAS6 3BF7A 4NFSA 4V3BA 4DUGD 3VJRA 3KUKA 3O8QB 4DC9A 3UJ6A 4LZOA 2OGUA 3PHCA 3RJ9A 4E2WA 3WWZA 2H3HA 4GGPA 5BVHA 1JE1A 4XJTA 1UFRA 1G5RA 3NNDA 4YRCA 3F9RA 3FYCA 2JFYA 4UCWA 1FFXB 5DLQC 4DMMA 1V8OA 1F06A 1QU2A 1YR2A 2BF7A 1SC9A 3QU7A 2HWXA 1B15A 4WESB 3MJCA 4C05A 1FDOA 2XYGA 3WYCA 5EJ6A 5TC4A 1WCWA 4AZ3B 4HAOA 1T8PA 5EIBC 4C07A 4CCYA 5JWRA 1RIFA 1UZUA 3BJEA 3T5CA 4Z2AA 1QGUB 3COZA 4X94A 5ERXA 1Z7EA 4MP8A 1AV6A 2LV8A 1ADJA 5ELMA 5K3DA 2BD0A 5JPDA 3QHPA 1NUSA 4QWWA 4RZXA 3KX2A 3QNWA 1VOTA 3CY6A 1L5RA 4AW9A 1CUEA 1LK7A 2JIRA 2BI8A 2H59A 3KQYA 2WTNA 3HCFA 1XRSB 2CNWA 2RGNA 4FLOA 3QY9A 3T99A 3VC2A 4I5IA 1OBHA 3AQIA 3QA3E 2LRHA 4WMLA 3UAVA 3C8MA 2X0FA 4AIIA 1Z74A 3DDZX 4RAQA 2JLQA 3Q7TA 4B6EA 1HL3A 3E23A 2XCSB 1LNSA 3BRQA 3DH0A 5J4HA 1PP4A 2XXAA 3MCTA 1URPA 2GEKA 5DCUA 3NGMA 4IMRA 5B58T 5HUJA 1LVGA 4LV8B 3FG9A 5SY4A 4QUHA 4LFAB 3A3PA 3ZV5A 1ML3A 3ESYA 3TJZA 1GUFA 4WKGA 3N0TA 4BGUA 4YRGA 4CT4B 4W5NA 4OHOA 1KRXA 1FQWA 2M1XA 3IE2A 3TZBA 4G1UC 4BO7A 3H6HA 1P74A 3NBZC 2CJYA 3FNBA 3GLHA 3G2IA 1E4OA 2ISCA 3GLTA 1EFRD 2WT9A 4D8XA 3A06A 2G67A 2PX0A 3B36A 3L7KA 1CR4A 1T3HA 1TF7A 3T54A 1QAOA 1M1NB 3KXLA 4EGQA 1XTJA 1UP4A 2P6NA 4AJIA 4WLUA 2WR8A 1PDOA 1TVEA 2BJWA 2JGLA 3F71A 4FXPA 3E22A 3OF5A 4XEUA 2XECA 5GY7A 2BGGA 3AF5A 2QVWA 2WHQA 1UK8A 3LHIA 3N2GB 2WSSA 3OA0A 1T2DA 1FEZA 4FSDA 4GNKA 2OZLB 1VHQA 1GPMA 3BAZA 1E6WA 4AMUA 4BVFA 3Q3JB 2BUAA 3TTUA 2HPVA 4MVJH 4CWAA 2YWXA 3FOFC 1H1LA 2ZTUA 4CHTA 2G9VA 1I1NA 3ISJA 1V9CA 3OT1A 1WKCA 5SZIA 1SUAA 2ZE6A 2PD4A 5TQ2B 3SS9X 5CYGA 3QU2A 4Y1EA 4JI3B 1G8JA 3HU1A 3E03A 3DMHA 1YHYA 3MUFA 4IWXA 4YCCA 2PQMA 2BF4A 3U9TA 2R7NA 2D54A 3E3NA 2JJQA 5TB5A 3B1XA 3W5UA 2QV7A 3F4KA 3L0DA 3PXDA 3GIWA 3PXXA 2XQIA 3HRIA 3QWFA 4N5LA 3WGVA 5F51A 3T9CA 3N2NA 1M1UA 1CR6A 3KB8A 4I4CA 5GJWC 2NADA 3DCJA 2XUIA 5EZYA 5FHRA 5G3YA 2A5DA 2IUEA 4XM1A 5K45A 2DT8A 5E4JA 3AVUA 5AI4A 2GCPA 2VJKA 1YE5A 3N2YA 2LDBA 3HACA 2ZRPA 1JFFA 1A9QA 3M33A 4FNGA 1NW4A 2Y0BA 3W06A 2DYKA 3OKCA 4R8RA 5KHLB 4LCBA 1C1XB 4TMTA 5I7SA 1NG9A 4JXZA 5TQJA 3MRXA 1AQYA 1E7WA 1FX0A 3RTAA 1OAKA 4CLDA 1N1MA 2IYRA 2QD4A 1LBIA 4GLJA 1OI4A 4B80A 1Z18A 3JQRA 2BP7B 3DDUA 5T8KC 1KE1A 1R8QA 5T8KA 3GLFE 1SXGA 2ZTVA 3HKBB 4PSUA 4DB4A 1QTRA 3Q7PA 4IF6A 4EQZA 1FYFA 2EZUA 3WK5A 2ZI3A 3WGGA 3EQ2A 2WJYA 5K3CA 2QAIA 2JKYA 3K2IA 2ZJ8A 4LJ6A 1RLIA 2JDIA 4KQ2A 1H6AA 1U28A 3A4TA 1VCIA 5DWQA 3U26A 4EL0A 3SQOA 2RKWA 3KDSE 1EVJA 1MAWA 3U37A 1IBLB 4BQIA 3MAGA 3RSSA 2QRKA 1E0DA 2R4UA 2XYPA 4OO3A 3F7OA 1PS9A 2HGZA 2I4NA 1XNJA 2PX4A 3IX7A 3MIIA 4P1ZA 3UOAB 2HN9A 1RJEA 2F3TA 2JGDB 2YHSA 2ET6A 4FYJA 4RDHA 3UAXA 1CQWA 2LW7A 2X2FA 3B5IA 4B73A 2H11A 3H2GA 1HMPA 4RHYA 4M7RA 2G9ZA 4UUOA 2POQX 1V1MB 3X44A 4QAQA 4F21A 3ZDBA 4ZCMA 1UKEA 4GS5A 4O4LA 3UT5A 4A2WA 5CJ2A 3AUXA 5FB3A 5J4LA 3G6KA 3LC7O 3PXBA 2EJUA 1ADGA 1IMOA 1P0CA 1QLWA 4QGGA 4TWAA 2Q5EA 3VNQA 4S04A 4MVYA 3PTLA 1GSHA 3HDJA 5K01A 3NM4A 2V7PA 3A25A 2AXPA 3G5TA 3AUTA 5FUVA 3K9CA 3V7NA 3VC3A 5AW8A 1L4KA 2GNOA 4OK6A 1D2GA 1Y3CE 4XSHA 4U4AA 4XUCA 3GZJA 1KKMA 1NE7A 1FTNA 2NO7A 3QXXA 1XMPA 4YP7A 1M5RA 1ONOA 4UNRA 2GAJA 3AIKA 3ZXYA 1MW2A 2QI9C 3KNZA 3VKHA 1ADYA 5BWNA 5GM2A 3R5HA 4B3RB 2IWHA 1UBGA 1NVXQ 2KHZA 2A1UB 3DT8A 1OC2A 4A03A 1OV4A 1QX4A 2Q1TA 2XA9A 4W4TA 1QRSA 1RXIA 3F6RA 3EGXA 2E87A 3IAEA 1K6XA 3G0CA 1X7WB 4MDYA 4UZFA 1WU7A 2C3YA 4FS8A 1Z4JA 2QL7A 3N39C 1OWPA 2ZUFA 1M73E 1UXIA 1DWPA 1B6TA 1VIMA 2GARA 5BV1A 4JBNA 3FROA 4AZTA 3KKLA 4MVJI 3NHYA 5ALQA 3CBGA 4BU1A 4CQNA 3IHTA 5FX2A 1H2ZA 4WJLA 4LY6A 4XWKA 3B6KA 5C4GB 3S3TA 2JFFA 1Z7BA 3LD9A 1PE0A 3FCXA 3MOGA 3CC8A 2WF9A 3EVGA 4IDBA 3A58B 3L0IB 3MWJA 1YRBA 2HQ1A 4N39A 3GVHA 2P0AA 2GZMA 4NDZA 2RKOA 2IYNA 2Z5VA 2MAPA 3FA2A 4U3JB 1L5OA 5TVGA 2Q4BA 2PH1A 4QPEA 2WTAA 1MVOA 2FRDC 1BDJA 2FRDA 4MW5A 4CDMA 1UDBA 3A1TA 2BM1A 1NBMD 1AN0A 3CZ5A 3OU2A 4GOXA 3CZ4A 4JBIA 3KT6A 3NC4A 3PHGA 3QEOA 3DNPA 5FT9A 3DEYX 2BGUA 3A2KA 4I3GA 3FUHA 5CYOA 2Y71A 1K9VF 4WCDA 5BT8A 2IEAA 4LGMA 1FMCA 4BFVA 5LMCA 2OFFA 3OF3A 4GI1A 5AXAA 1YDGA 3WGMA 1VCNA 2PUBA 1GN8A 1Q0LA 2O0HA 2YV1A 5GQSA 2DWUA 3USCS 5C81A 1DUIA 4LRWA 4FEAA 2QLJA 1EYZA 1KXZA 1Q3KA 4Y2PA 3PYXA 4GVLA 2BBSA 1WTAA 4UDOA 3ZLVA 1SRQA 1J2TA 4P3YA 4W82A 3VPHA 3PFHA 4DY6A 4MAMA 4EKIA 3DVLA 2HPOA 3VNVA 1BEEA 1PR4A 1K92A 1GCGA 3UM9A 1JDNA 4R1NA 5KQRA 5FUXA 4OREX 2PZLA 3UBMA 1NQOA 3JQGB 1A96A 4ALNA 1DDIA 3AVQA 3S68A 1P6QA 2D1TA 2EFDB 2C92A 4J94A 4Z6KA 1L4HA 4P4LA 2M6RA 5TVKA 4HFMA 1D2RA 1X87A 4PVCA 3P2MA 3KYBA 1RM3A 3WMXA 2CLKB 2OBMA 2WU4A 3HJHA 3H1AA 4IKPA 4KXLA 4RIIA 4UULA 1E9RA 4OBBA 2QTFA 1PR0A 3N7AA 4YACA 2XGMA 1I3CA 2CV2A 1KI6B 1WZUA 3QX7A 4GBJA 1E8DA 3DFMA 2QE6A 2GJ4A 4HSEA 1Y6QA 4YT4A 1RJ9A 2NUBA 2WUFA 2P41A 1DMSA 2WAXA 3HN7A 3Q3IA 1NF2A 3DYBA 4FW9A 1SG9A 2VDLB 4F56A 2G07A 1Z2AA 2PGXA 1CVLA 5EJ8A 3BRSA 1KZ4A 1TIKA 2PSFA 2I76A 4JB3A 2Z98A 4OPMA 1KJIA 5KTRA 3JAMA 1N33B 1BU8A 3HWWA 4FYWA 2QAGC 4PFJA 5LSAA 3OM1A 3IHWA 3ND8A 3IPYA 1Y6JA 2I6FA 3DDNA 3M5PA 3PFWO 4GKAA 3U40A 1U1EA 2A33A 3GX1A 4R81A 1G4AE 4HKTA 3O93A 3FCSB 4BCDA 1VE3A 2CLCX 4LSGA 5EP1A 4XGKA 3WDLA 1MC1A 1SR8A 1CUJA 3OE7A 4KQXA 1A4IA 4TTPA 1WUYA 1YS7A 1J0CA 4EHBA 2DPXA 2I7VA 5I47A 3IC5A 5KCMA 4BO0A 3F74A 4DPKA 5BXQC 5D1HA 3V2IA 1SUIA 2IZ0A 2OXCA 2QN2A 2GF2A 3GUCA 3I9JA 1LNZA 3COYA 3Q3GE 1RBQA 3QWBA 3LIIA 4MQFA 4D3DA 3W3AA 2PAAA 1VMEA 1WUJS 1IU9A 1BFUA 2O1WA 4ZU3A 1NY5A 4CEJA 1Y8RA 1DEAA 3B2QA 3IIIA 1E64A 2DPMA 2DRIA 4C3VA 3N0XA 3SMVA 1NMSA 2XF2A 3PLAE 5A2QA 3DULA 1RXYA 1HC7A 2PKQO 5EKSA 4M0MA 2AW3A 4C2BA 1E3EA 5AOVA 1LJUA 4WLEA 4YDRA 3U56A 2L19A 1QB8A 4R2KA 1Z47A 3QOYA 2ZUCA 4XR4A 3SK0A 4UPEA 3AERB 2A35A 1UIRA 3NUGA 3GEEA 4H27A 4QEKA 3I5YA 2ATVA 4PZPA 4ZAZA 4R5VA 3PITA 3P1JA 5A9SB 4J4TA 3ZZUA 4ZOBA 1NBEA 2R6AA 1TPYA 3TPCA 4F3KA 1GXSA 1AHIA 3DE7X 1AUVA 3MFYA 3CINA 4NV1A 3AM1A 1QTIA 2QA5A 3DAPA 2YUTA 3HYNA 1R15A 5LXTF 4ASUD 1DIHA 1TOAA 1XBTA 2MSNA 5CH8A 1JU4A 4D81A 1CT9A 4C29A 1AHPA 1LU9A 5GGXA 3E4DA 5JH7A 5DYFA 4WWHA 1PVOA 1DJQA 3KO8A 3A3NA 3OQVA 2Z3WA 4MWCA 3IMKA 2GVDC 4CM8A 1E2JA 4NHOA 3ZEAA 4CG3A 4CL3A 1FJXA 2D5BA 1Y34E 3BEOA 1Y3BE 2IYWA 2VDVE 4JITA 4I1VA 4YDHB 4RSGA 5DE3A 1KE2A 4X90A 4XKJA 3EPJA 1GQOA 1B2RA 2PUVA 2OBXA 3TBKA 4ZJPA 3DE6X 2XLCA 1QIMA 3A9TA 2VQ3A 3W5HA 4RY2A 3IUBA 4A8PA 4B45A 1VPDA 1SBZA 3TECE 5LMNB 1V8ZA 1U7WA 4DZRA 4TSFD 5DM1A 1K5DA 1H3LA 2Y6VA 1KJJA 1RRVA 4HV4A 4E3WA 2YWHA 4L07A 4KCGA 2TYSB 1EXNA 4QOHA 4PO8A 2WPNA 4FLSA 1UIMA 4MJLA 1V0JA 4P7FA 4KGZA 2C59A 4WK2B 4M1EA 4GMXA 4PSCA 1NVWQ 1N75A 2WDZA 2G17A 3I58A 4U63A 4X6YA 1SOVA 2EWMA 4BATA 1A9XB 1PKEA 2YBEA 4LYEA 1GD1O 2WKPA 3O84A 3E2IA 5ALJA 4KWHA 3ZIAA 2NQTA 3S2SA 4IV5A 2IZZA 4LXQA 3DOFA 1JLLB 2W6MA 4QTYA 4UU1A 1LBQA 4RO0A 3RYFB 2QQ5A 4L8VA 4GKBA 4I9UA 4XWAA 2PAFA 5CYFA 4MUHA 3O3OB 4IOLA 3TGPA 4UHJA 4UQOA 2AE1A 1O2DA 2C3MA 1II8B 1OLOA 1RPNA 4MS1B 4O5OA 4KVGA 4E32A 1JQEA 3H9CA 3LT2A 2FPXA 1XA3A 2IYQA 2VRCD 4G09A 1SCKA 1ZGCA 3TWOA 4R7GA 4L15A 2H52A 2AK2A 2HF2A 3I9V1 3BEDA 1PEYA 3H5IA 4IQ8A 3CH6A 2ZTSA 5KUTA 1QK3A 1DCFA 1E0JA 1KAGA 2PYZA 4Q37A 2V03A 1OFGA 2CMGA 3FX2A 1TW2A 3IMGA 3AETA 3OICA 4U0JA 2JFVA 3DLCA 5F2EA 4ZRNA 2IWRA 1NAHA 4XR9A 3REQA 4X8OA 2GSWA 3MINB 3OZSA 1R5BA 4I9NA 1J00A 2GERA 2X0RA 3EPKA 2E55A 2WHRA 2ZIVB 4R8MA 4TKVB 4OOEA 1E1RD 2RDMA 3L6BA 2QRVB 3L40A 1CEXA 2IHYA 3BSWA 2ZROA 3BVPA 4PWYA 2OORC 3HJTA 2OORA 1IY2A 1JU3A 1Z0IA 4KVAA 1NQTA 4W9NC 1TMOA 4W9NA 2HFJA 2RJ3A 5FI0B 4PSKA 1THZA 1XZKA 3YASA 2AMLA 5CVCA 4I55F 1IJEA 2OD7A 4UE6A 2NZJA 4RMNA 5GAJA 5K8IA 2I3BA 4O63O 4J9VA 1JHQA 4M9RA 2WTMA 3C6XA 3TD9A 3G0HA 2B4TO 3PCXA 3WBKA 4DIEA 3I2IA 4QNRA 1ZCBA 3DZJA 3BWVA 2QTZA 2V65A 3A4VA 4RVGA 2ZB3A 3V42A 4H7JA 3OHPA 4FMCF 5BPFA 1J0EA 1ZYUA 3EOZA 2F9FA 4MQ6A 4OMCA 4V3CA 1VLHA 3COPA 2P9CA 3SY8A 1BO6A 1P3Y1 1WSDA 1A8QA 3PP8A 3HNOA 1PD1A 2BGNA 1HS6A 1PNQA 2C9OA 1UPTA 1VKZA 2HJRA 2OWDA 2WRZA 1CUWA 1U3FA 1E9CA 2X77A 3ADBA 5CDSA 1FZTA 1FP4B 4U00A 3D7NA 2Z9DA 4URHA 3SJCA 3PPVA 2H51A 4RY8A 5IJ9B 2XB4A 3U7QB 5FYQA 4QZVA 1E3TA 4MKXA 1CXZA 3RBXA 2R59A 5EP4A 1M6VB 5P21A 1Q1QA 5AVUA 1NJ2A 3ROEA 3H11B 1QHEA 4YO7A 4EM6A 1J9ZA 2O2HA 3AILA 1RU3A 4LNAA 3UYKA 4S05A 1Q0RA 2QZJA 3CBQA 1CK4A 3DAFA 3IESA 4P6VF 2XF8A 5BWLA 3H4TA 3L1UA 1UBEA 4A8TA 4XFDA 1XQ1A 2X9LA 3LBFA 1OWNA 4R1OA 3WNZA 2BZ1A 2XOXA 4KR2A 4OLAA 3TEJA 3H0EA 4B9AA 2I4RA 4KYTA 5DM0A 4CT5A 1Y89A 2WF5A 821PA 3UOWA 4A73A 4AULA 1NP7A 2P7HA 1A2BA 4BFYA 3CKLA 4YT8A 3CLUC 1EJ6A 4E08A 1EUYA 3KZMA 1OXMA 3G0DA 4Q02A 5K8TA 1YL7A 2VAXA 4YLEA 2QK4A 2J8ZA 4Y2RA 1ZHFA 2QTLA 3FMFA 4HGRA 1ZQ9A 1WCIB 5LA6A 1KY2A 5AVVA 4EGJA 4ZICA 3M2PA 1YS4A 1U2QA 1DELA 5H7XA 3V8BA 4WCVA 1PLLA 3VJMA 2A88A 2Q41A 4L85A 1SUWA 5I9IA 1ZXLA 1G3QA 3B51X 2NACA 4PNZA 4ADSG 5GV8A 3SLKA 1BE1A 3TLXA 4D9NA 4HQ0A 1F7VA 2CXPA 4KMMA 5DNAA 3WLHA 3H8SA 1G5IA 4I8DA 3P9CA 4WL0A 4BGVA 4BFSA 3IE1A 4YRTA 4UHFA 1QVAA 1SU7A 1R74A 2IE0A 1GL9B 3CSSA 4G4SP 2E37A 2GXUA 4J0EA 2VT2A 2XCQA 2Z2JA 4Z3OA 4X61A 1FUEA 1J06A 5KYKA 2XB6A 1TCCA 1A8PA 2PZKA 4IDCA 3V2UA 4BP1A 3QLUC 4ZZ2A 5JECA 4JQYA 1KAHA 4OQXA 5JXGA 1C29B 5CITA 2F4VB 4PLYA 3SBXA 4D46A 5BR4A 4BEWA 1FLNA 1SIUA 3CLRD 4LHZA 5B1SA 4F60A 1WNTA 4C08A 1GEGA 2WZFA 1KZGB 4JP3A 1RI5A 2OCLA 2V7GA 3HZZA 3LQKA 4HWKA 2Z6AA 4AM8A 3VTFA 1OI2A 4EUKA 4LE2A 4TKLA 4EPXA 1IHYA 4XD2A 1U8EA 3E3AA 2GKSA 4BKOA 4LZWA 4O1HA 2ZJOA 2DFKB 2BR3A 2IPMA 2VP2A 3AFMA 3GLUA 4Z7QB 3ZZNA 3IP7A 4C7VA 4FONA 2N46A 4B3SB 3QU5A 5HRUA 2XRFA 3PD1A 4MO9A 4BN5A 1DAPA 2YZKA 3FIJA 3KVYA 2J3JA 3BCRA 1AQIA 1P29A 2H2GA 1ABBA 2O23A 3EZFA 4YPOA 4TN1A 3NC1C 1ULBA 4OLHA 5KHOC 2NU7B 2CVZA 2RARA 1GSIA 1S9HA 3RWOA 1HV8A 4L74A 1SULA 2K7ZA 2O5RA 3EF0A 4YJFA 1TUIA 3IUSA 4C21A 4PG7A 1BJKA 2ACWA 1CUHA 3K6SB 4IIUA 2BGLA 2PH3A 3D5EA 3LGAA 1TCAA 4I5DA 4C0XA 1J9EA 4TMFA 1PSWA 1KMQA 2B1RA 1XMJA 3KKZA 4F11A 4MR8A 3WL4A 4EI2A 5JMTA 2IEIA 3OBBA 1P2DA 2EJBA 4EPWA 4YAIA 3LO5A 4QO8A 1ZR2A 4Q47A 2RAUA 3H4VA 3S5JA 1P81A 1I3KA 1YR1A 1WXQA 1JKIA 1Y5RA 5HK8A 4V0QA 4ENTA 3D8SA 4WT7A 2GF9A 1J5PA 3IB3A 3V7WA 3UOGA 5KNDD 1T3LA 3M6XA 3Q5GA 3RRJA 1JIQA 1UXKA 4D44A 5I7AA 3IOEA 1HI9A 1M2VB 4JLAA 3WGQA 4BO9A 2G71A 2YQ4A 2RC6A 1EUCA 2G9QA 5CB4F 3C4QA 3R6GA 2VATA 4L9SA 1DPFA 3SR4A 4AMVA 1E66A 1VP9A 1RPTA 1MB0A 2C5EA 2VP0A 3GZ4A 1V1JA 5FBQB 3SNKA 4M54A 3NXSA 4JJAA 2C4NA 3R41A 2W2NA 4MW7A 3B8EA 2C2MA 4NV3A 2OAQ1 4RMHA 3MUEA 4R2XA 4BAUA 4EYGA 1KEEA 2GZDA 2HA5A 2GFIA 1ZMOA 3KZ1E 1MV8A 2WEKA 3RUIA 2E4XA 3TLYA 3MQ2A 2A0FA 1TM7E 3MD9A 4QLOA 1WMAA 3V4SA 3D7MA 3ZY3A 2HBZA 4IM7A 3QE9Y 2V97A 5F3DA 5IWCA 1CIVA 1EAYA 5P8WA 3TFQA 1JAIA 3K9QO 4IDPA 3UIEA 1DZIA 5KINB 1E1LA 4JFRA 3I5AA 4LG1A 3K9WA 2FF7A 2XQJA 3B1JA 3AR9A 5EWMA 1QGAA 1YUMA 1TCBA 1Z6GA 4L7QA 3MWLA 3FJOA 2D2XA 1JHUA 2IDMA 3GD5A 4HPXB 4IJQA 3L84A 3T9EA 1NT4A 1Y9JA 3DZCA 4ZCIA 3GAFA 3C1UA 3ELDA 2Q3FA 3CRW1 2WE7A 3VJKA 2W2KA 4BRZA 1N4DA 2CDNA 3BJZA 5BQOA 3KTFA 2KSQA 1RAEA 4P0TA 2QRQA 1HBJA 1T29A 2GK6A 2R2AA 2VHWA 2DWPA 2ZI9A 3D8RA 3IELA 5DKFA 2GN4A 3T1YB 5BRJA 4FBGA 4WKNA 3B9QA 3CPEA 2HHAA 3NORA 1U5CA 5JLJA 1NYQA 3L8FA 4XPIB 2QLNA 1KK2A 4V0MA 4WHMA 2BL4A 5FWQA 2FZCA 1ABEA 4MCIA 1RQNA 3GW8A 4P7JA 4I1PA 1U4SA 1E32A 1KERA 1DX6A 3EEYA 1ELOA 1B26A 2CNKA 4HI0E 4J6EA 4RF5A 4A8HA 5HILA 3STTA 1U9IC 1U9IA 1W4LA 3WLPA 4K8OA 2AFIA 2HPZA 1QAMA 4R5HA 4UOZA 3B89A 5TPZD 1SQGA 3PJRA 2E6KA 2ZW9A 5G0UA 3OZRA 1MFPA 2O57A 1EFVA 3C14C 4ZO6A 2ST1A 3IURA 4IVQA 4EB6B 3I5XA 1TCVA 1Q0HA 3MMNA 4G86A 1AHHA 2P2CA 2Z43A 2ZRCA 3FIUA 5CAEB 5KTYA 4DV2B 1PT8A 4KXYA 5FLKA 3WBFA 2PJDA 1UKYA 2WVGA 2CFRA 3CSUA 1V4BA 3CKMA 1K7CA 2I6TA 3NHKA 4CMIA 1EEXB 2OBLA 3ICCA 4ER5A 5CA1A 1P4HA 2B3DA 1PGOA 3ZVRA 3IUEA 1O54A 2HA7A 2YMMA 1Y1PA 3IHLA 4YH1A 3WQHA 1OVGA 2I67A 2YJ3A 4HWOA 4AAYA 4UNNA 2Q5LA 5JCJA 3OUTA 1UWVA 1W46A 5EEGA 4TXHA 5EZ5A 3B20A 2WG1A 5EWJB 1ZY2A 3DTYA 3Q2IA 2D6FA 3PDCA 3OJWA 2H0QA 4NPCA 4Q9NA 5L3SA 2I91A 1IM5A 1VJRA 4B7AA 1SXJB 2A0UA 2GCNA 1RYNA 2X1HA 2ZT5A 1UH5A 4YP1A 1XPRA 2IBSA 4MV6A 3L7AA 3TVTA 2BHNA 4F86A 2J67A 4RULA 1NN1A 3LOUA 1VE7A 3IUPA 5T3UA 3EZLA 3KLPX 3OZ7A 1I7PA 2B36A 3PA8A 2AJTA 3L7MA 3O2QB 4P53A 3L7DA 3E5MA 3MBKA 4HX5A 3V4PB 4TKZA 5CK5A 4JLWA 2GA9A 4X8MA 1KO4A 1Z5NA 2GASA 5LNK6 3GD7A 5FUQA 1P2SA 3GPBA 1QFMA 5JT1A 1GV0A 4H35A 3LOQA 3TNFA 5IULC 2MR5A 1ZU5A 2ENUA 1DCTA 5ER6A 4CTKA 1IULA 3WL8A 2W8BB 2FYTA 2I66A 1TM1E 3WLAA 5I9NA 3SFVA 1EM6A 2YZNA 4M76B 4QXPA 1P4GA 5G1NA 1OGIA 3GAMA 1HMYA 1UDCA 3ZU6A 4DCJA 5LXTB 2OXEA 4JLMA 4UHBA 4O4IA 5KQMA 1YK0A 1U3VA 2HTFA 2R1TA 3AKYA 4L2IB 4LQ4A 5KYUA 3SLGA 2E4AA 4GOKA 1NVAA 1CZRA 2FPPB 3BHNA 3I2YX 3P20A 4G97A 1U4OA 1X6VA 4KIFA 5ICMA 1XMIA 1YC2A 3WQQA 3OLCX 1M1ZA 3B85A 3FOCA 1RAGA 2OC4A 1EE1A 2AC2A 1RFGE 4V1CI 4K9QA 2FKAA 1MN6A 2I7TA 3LCRA 3RHTA 4MW6A 4GIBA 4MH0R 4NULA 2Q8PA 3S29A 4DA6A 1C0EA 1UZNA 3RYHA 2B1QA 1K8YB 1RHMA 3LCCA 2O1XA 1OJLA 1C3JA 2R8EA 2J7PA 1H2AS 5AW3A 3O94A 5AK5A 1UDAA 4NOMA 8OHMA 1JDTA 2ES4A 5FBHA 4ATNA 1UPFA 2Q1SA 3U4CA 4E70A 5B57C 2V9PA 5IYZA 5FORA 1ZUWA 3CE6A 3O4JA 4BN4A 5JLAA 2BE9A 3TNJA 3TNLA 4FYXA 2OESA 1BHO1 4KQIA 3RAPR 3VR2A 4YCMA 2ZUEA 1C4XA 2LUOA 5A02A 5CJPA 3GLRA 4DV1B 2WD7A 1A9ZA 1JG3A 1I10A 3VVBA 5EQDA 4KACA 2R5WA 2CL0X 5D3QA 1QNFA 5BWBA 2OVBA 3K1AA 3ZWOA 5EIEA 3B3JA 3C6KA 1OX6A 2A0XA 1ADCA 4NOLA 1S2LA 2PV0A 3ETCA 1FMLA 4NJMA 4U2FA 3HJNA 2DUWA 2KLBA 3FCOA 3S55A 2XMDA 2FI1A 721PA 4K5LA 2Z83A 3IKVA 3ZQ6A 5KOHB 5MN5A 4RQBA 3ROGA 2NU6B 3WKDA 5IMSA 4KFCA 1ENOA 2X0KA 1AURA 3IERA 4N7RA 1C30B 5K0FA 1PDWA 4UUQA 5CVDA 3PPWA 2JBAB 4QL3A 3SC6A 4F8JA 3LTEA 1K63A 3NHUA 4ENSA 1DO2A 5C3MA 4HZIA 2ERXA 4JD5A 4KG7A 2ORED 2XB9A 4A27A 5CIYA 1XV5A 2R8XA 3RIYA 3JD2A 3PL5A 1EGQA 1PT9A 2CXQA 3OJOA 4BWYA 3T15A 3PPIA 1HG1A 1NN0A 5LDDC 1V95A 3T7TA 1MGOA 3IBYA 3CCFA 4JI4B 2YS7A 8MHTA 1RLMA 1TEVA 1FC0A 3JYNA 1RLTA 5ANRB 5H59A 3OEEA 2RIPA 1OXVA 2AJBA 1C9DB 3AOEC 5BQ3A 4LS3A 4PPQA 3I1JA 5JSYA 1QX3A 3OO0A 3CRMA 5FKJA 2XNJA 4ZMRA 4UEQA 2GK7A 3F8SA 1C3VA 2WP0A 2IU3A 1P1RA 1JU9A 1L5HA 1H94A 4DWWA 2YKGA 1OQAA 4Z4GA 4YMUA 1GRNA 2P35A 1C7RA 4I55B 4R1QA 2FN3A 4UEJA 4F9EA 1SBIA 3REFA 1YKGA 1Y3AA 2VQSA 3CLTD 3V00A 4BB6A 2E5WA 2J3MA 2GA8A 3OY2A 2CVPA 3GJ7A 1R4MB 1QYWA 3U3RA 5FTLA 3C45A 2GBCA 3PD0A 1IZ7A 2Z2IA 3CG0A 5TLSA 3RJTA 1ZDMA 3O8DA 4LI0A 2J6HA 2JI9A 4FMCB 2WJWA 5JU6A 2JH8A 5J2UA 2FEPA 3BWXA 1N7GA 4QHPA 1AQLA 1T2VA 1UPCA 2Y9PB 4OCZA 1G63A 4TLDA 1U2RA 5U4QA 1A04A 2OV2A 5FBKA 2HJSA 1NPDA 3WMRA 4Z1OA 2FNAA 4LRTB 5J2TF 2VZ9A 1JJFA 1U6IA 2QYOA 2SCUB 2V5AA 3IPXA 4Y2YA 4D9BA 2WFMA 4FYPA 4ZI3A 4ZFNA 3L6RA 1GU7A 2RCYA 3C3BA 3OM9A 1R16A 3RF6A 3GLIB 5FEUA 1U9CA 2R7LA 1HYQA 4M6WB 5A5DA 2DWOA 1U65A 5K2MA 4S24A 3TAXA 3S2FA 3AFNA 3HAD