5DULA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis in complex with nadph
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
375
Chain Sequence
SNAMKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRVTPISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis in complex with NADPH .
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
total genus 131
structure length 375
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 5dulA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dulA01
2ZYDA 6LDHA 3KEQA 1J5PA 1EDOA 4OO3A 2JD0A 1HYGA 4BNIA 1R37A 3GZ4A 3GHHA 4BNWA 3K2EA 4FLSA 1TEHA 4CLXA 1BXZA 4LN1A 3RKRA 5U9CA 1MW1A 4CPDA 4NJMA 4KP7A 1PX0A 1QV7A 2NU6A 5HBRA 3S1LA 1EFLA 3M1LA 1E0DA 2X0JA 2XXJA 5IJZA 2QIOA 1SB9A 2C2YA 1R6DA 3KV3O 3TFOA 1V35A 4PVCA 1A4IA 1ZXBA 1YOVB 5AXCA 1Y6JA 3FWNA 1NFRA 2VUSA 2YYYA 3EYWA 4BHTA 1PGPA 2CSUA 2DLDA 2I9PA 3OJLA 5TC4A 4NDNE 3BTVA 3C7DB 5A3VA 2Y0CA 4I8XA 1BVUA 1TB4A 4O6VA 1VJTA 1EFKA 1B7GO 1PGOA 2PV7A 3AI1A 2B4QA 4OQYA 1DLIA 5JAQA 2HKIA 4Q39A 4IIUA 3DBHA 4R16A 1HE2A 1YH3A 1GAEO 3NDRA 4OIMA 1MFZA 3S55A 3WJ7A 1Y7TA 3T7EA 4PLZA 1FMCA 3EAGA 3OQBA 3ROKA 7ADHA 3GH3A 3AI3A 4CQLB 1PS8A 2R00A 4WASA 2VHVA 2FZEA 2NLOA 4PFJA 4MIOA 2V7PA 4XR4A 4X54A 3DZBA 1Z7EA 2CF6A 2Y0EA 3MWEB 4FD3A 2X5KO 3FF4A 3GGPA 3ZV6A 4BB6A 3A4VA 3UUWA 5KVSA 2ZQYA 3DBLB 4L4XA 3VAZA 3RUHA 5TX7A 4WLNA 4DGSA 5JCJD 1G0OA 5KJCA 5MDHA 4E6PA 3JD1A 1MW2A 4CR7A 4IBOA 1C1DB 2CUKA 2E6UX 2WEKA 5TT1A 3QRWA 4F6CA 4EEZA 3LF2A 1RWBA 2Y1DA 3QE3A 2ZB3A 1Z6ZA 5JMPA 1E5LA 4NMHA 4MIYA 1XCBA 1UXGA 5L45A 3IUSA 5JBIA 1E77A 2QG4A 4FJ0A 1HSOA 1WNTA 1ZZEA 3F4LA 4YJGB 1IULA 1NAHA 2OO5A 4AJNA 3DOCA 1ZBQA 4KTVE 5G4KB 5DDIP 4GGOA 5IFLA 1XWFA 1YBVA 3RUCA 4XGKA 2FR8A 2AXQA 2OOSA 2Q45A 1UDCA 3ITKA 5A5EA 3FCOA 2IDZA 4XGIA 2Y1GA 3K8ZA 4CLOB 3HZZA 9LDBA 4GKVA 4B8ZA 1UAGA 2C82A 2PY6A 3WTBA 4ALIA 1PJ4A 1Q7BA 4YDRA 1X7DA 2B83A 2YJZA 3RI3A 3UCXA 1P77A 4PIVA 1GPJA 4AJHA 3Q9NA 3JTMA 4IJKA 1JKFA 1F8GA 3LVFO 1O8CA 1ULSA 5LDGA 5IF3A 5CPFA 1U1IA 1WAMA 3H9QA 1WZEA 1JWAB 4NR0A 3TNLA 4J0FA 1U28A 1ISGA 4WCFB 3INGA 4IQGA 1NFQA 5EESA 4CQMA 4D0SA 3SLKA 3VOSA 1E1NA 2GZ1A 4YWJA 1HZZA 4RVGA 1H94A 3GG2A 1P1JA 4HFNA 1DRVA 4RF4A 5DBIA 3LSYA 3RASA 2DUUA 4QX6A 4PN3A 1XA0A 3JYLA 1DFIA 1H9AA 1ISHA 1NQOA 1RJWA 2V6FA 4NJMB 3QY9A 1BDBA 3RVDA 4D3FA 1GYPA 4E5PA 3SJ7A 3WWYA 1VE9A 4R69A 3WSVA 4S3MA 5TF4A 4Y9DA 3HQ4O 1NASA 4L74A 2IEDA 4Z9FA 4CL8A 3JD2A 1DPGA 1HDRA 2P5YA 4RDHA 4BO3A 5JS6A 1NPTO 1NX6A 4P4LA 4NK5A 2R00C 2A94A 5KNLA 3F3SA 3PWKA 4CMBA 2BLLA 3QVTA 5JY6A 3L9XA 1XQ6A 2Q3EA 4G65A 4NG5A 4CMIB 1KS9A 1Z74A 3H6KA 2BGLA 4XRRA 2JD1A 1H6BA 1KEVA 1ZMOA 3ZI0A 4FFOA 5TT0A 1KEPA 1PZEA 2RHRA 2IYOA 3D3EA 4R68A 1ORRA 3AW9A 3D1LA 3H4VA 3QJ5A 2W90A 3RBZA 3ZWOA 1KEWA 1M2WA 4M1QA 2QZ9A 2GNAA 2HAEA 2O2SA 1DIRA 1GV0A 2YFQA 1S46A 3JV7A 4B3HA 5KVCA 3N58A 2CVQA 3OSUA 5T6BA 2P91A 4J7XA 2P9GA 1NWHA 3A1NA 5CDSA 2RH8A 3UHAA 4Y8VA 3CMCO 2GD1O 3GGOA 3GVPA 3UF0A 3ORFA 2CNBA 2XOXA 1MG5A 3UKOA 3MWDB 4GMGA 3B20A 4B7CA 4DTIA 1YWGO 1E7WA 3H3JA 3P5SA 4FR5A 4MVJF 3FNEA 3UXYA 4ZQHA 2I99A 3ICPA 4K1LA 5FFFA 1U8XX 4BKOA 1FDTA 1MLDA 4O5OA 1DSSG 4D42A 5DP1A 3ZDFA 4NQWA 1C0LA 1ZKMA 5IXYA 1TI7A 3I9OA 2EJVA 1DAPA 2UUPA 1XSEA 1GZ3A 3KYCB 3PK0A 3DTTA 1ZUD1 4YJHA 3E18A 3GGGA 4RO0A 4AJIA 4EBFA 4ESOA 2NTVA 3GEDA 4CMAA 1R15A 2EKLA 4Z0TA 4CM8B 3UH1A 3KTDA 4OSOA 5T5QA 3BMCA 4JNKA 4KUGA 1YOVA 4W9NA 2QRJA 1MGOA 2F00A 2G76A 5EINA 2WYVA 2J3JA 2JCYA 4DA9A 2P9EA 4MVJG 2PA3A 2VT3A 3C7CB 3DO5A 4FB5A 3QQPA 1UAYA 3FR8A 4N7RA 3WFJA 4MVJE 3D4OA 1R0LA 4C4OA 2FP4A 3DAFA 5KJ1A 3JYQA 3DZFA 4YJGA 2VRCD 1O9BA 4OQZA 1I5RA 3C1TA 2VHZA 3QWIA 4FLOA 1BSVA 2EGHA 2YV1A 1LLQA 3P2YA 1U3TA 1JQBA 1UZMA 1MP0A 1SC5A 5IZCC 3D3WA 1DJQA 2YV2A 3KYDA 1T2DA 4DQVA 1QV6A 4BMSA 2JFHA 4PCVA 3PI7A 1Q0HA 1YVEI 4R5MA 2AEMA 2OORA 1SNYA 2HMVA 1R4MB 4BO5A 4YXFA 1WWKA 3W8EA 1BXGB 1QSGA 4BMVA 1EEHA 5A04A 1YQGA 4FN4A 1JA9A 3FTPA 1D1TA 1K5HA 1AE1A 1XIVA 4YEDA 4IDBA 1T4BA 5L7YA 3EC7A 1LA2A 1TT5B 3HADA 4O59O 1FDUA 4R5HA 2B5WA 4JP2A 2EW8A 4BO1A 1YJQA 3EVTA 3I83A 4GH5A 3FN4A 2W8ZA 2BFPA 2NV6A 1GQ2A 1A4UA 4FOOA 1B16A 2VUUA 2C54A 2D1YA 2WD7B 4D46A 3T4EA 3FTNA 1IE3A 3WQRA 4AYSA 2HQ1A 2X7HA 1MXFA 3PIDA 1E3IA 1O5IA 4Z3DA 4UVGA 4J4HA 1OAAA 4XIJA 2YY7A 2GLXA 2H63A 4J2OA 4CV0A 2ZATA 2FRDA 4GL4A 1TT5A 3W6ZA 5JDIC 2VHXA 1ZCJA 1A5ZA 3H2ZA 5F1KA 1E3JA 1E7RA 2G5CA 4DYVA 2Y05A 5JE8A 4E4YA 5CEEA 1H2HA 1SBYA 3M2PA 2W2KB 2X6TA 4ID9A 4YT5A 3IL2A 2OUIA 4IJUA 3O38A 1DJNA 4IDCA 2DM6A 1H0KA 4IZHA 4RVSA 3UVEA 2OGUA 3G49A 4FLQA 4KUEA 1UXJA 1DDOA 2GSDA 2JHGA 1QYXA 1YB4A 1YXMA 4NPCA 3TN7A 3GQVA 1JLLA 1CIVA 3NX4A 3I9LA 2ZYGA 3JQ9A 5BNIA 1T24A 4R3NA 4R1TA 1Y1PA 1C3VA 4HP8A 4S1VA 5AXDA 4BO6A 2AHRA 2Y93A 1YKFA 3PWSA 4CR6A 3SVTA 2B4RO 4QT0A 3KXDA 4E2XA 4I5GA 1B3RA 1XGKA 1JWBB 1A72A 1JDJA 1XU9A 1UH5A 1XLTA 3RU7A 1LLUA 4ZGWA 2DVMA 1JVSA 4MVJM 4NFHA 3DZIA 4DRYA 2GDZA 3NDIA 3RUIA 5CDUA 1WPQA 4FQ8A 4MVJA 4TVOA 4D43A 4KMSA 3GAZA 1LRJA 2EW2A 3JYPA 3WG9A 5KKCA 2AE1A 1DAOA 1JN0A 1HE3A 1ZK0A 1PEDA 2YQ4A 4RV9A 3PLNA 1F14A 3PZRA 2PD4A 2JCXA 2GASA 2BD0A 3MTJA 3GRPA 3D7LA 4E12A 1DIBA 3E5MA 3ZH2A 1UUFA 3BHIA 5IAAA 1NYTA 1Y81A 3TPCA 2G17A 1XHLA 2NVBA 1P0FA 1HEUA 3LU1A 3F47A 1E7YA 1LC3A 2IRWA 4R51A 3NTRA 3F4BA 3ZU5A 4GGPA 5KIAA 3BHJA 4CM7A 2OFPA 4CV1A 4AFNA 3LC1O 1P1HA 1EQUA 2X9VA 2XXBA 1HE5A 2DTEA 2PKQO 4MDHA 4J1QA 1I33A 2Z5LA 4D44A 4FFPA 1OC4A 3VHRA 3T0YA 3JQEA 2HK8A 2X0NA 1CQJA 4PLHA 3DZKA 3TZHA 2JAPA 5IZCA 4NBVA 1BRMA 2E48A 4R9SA 3WGQA 2Q2QA 1SEPA 1XEAA 3I6QA 4HFMA 3G1UA 4H3VA 1T2CA 2FY8A 3BMQB 5HA5A 4J49A 3C24A 1ISMA 1BXKA 3WX0A 3A9WA 4XCVA 1GUFA 1YQDA 5G0WA 4MKRA 1VSUA 3DR3A 4EJ6A 3H7AA 3WLEA 4LRSB 3AI2A 1U3VA 3U4IA 2JD2A 1I0ZA 4UREA 1I8TA 4XJTA 2V65A 1HKUA 3I9NA 4ZQEA 4J0EA 1YBMA 5B12A 4U7WA 1UP7A 1PIWA 4YTEA 1H6CA 2QRLA 1UZNA 3VH4A 2BI8A 2YHIA 4ALNA 5LDHA 5L3ZA 1L7EA 4NI5A 2V6BA 1JKIA 2DTDA 3DMYA 2YHUA 4WNCA 5K0ZA 2GPTA 3KHUA 3FRJA 4JBHA 1GPDG 1Q2XA 1Y8QA 2Y68A 3JD0A 4NJOA 3ZWMA 3EHEA 1E6WA 4BQPA 3L07A 1HE4A 1KVRA 4J1NA 2NU8A 4ND4A 4E31A 2VRBA 3AY6A 3WIEA 1KVSA 4RORA 1SC6A 2LDBA 3N74A 1L7DA 5L51A 3DC2A 4XRGA 1Z73A 3R3JA 4LSWA 3Q3CA 4D7AA 3FPCA 3MEQA 3TZKA 3MZ0A 4OGWA 3WQQA 1KVUA 1DC5A 1LRLA 4J4TA 4IS3A 4M86A 3NJ4A 3BTOA 3W8DA 1EBFA 1O6ZA 3GEMA 1W4ZA 5F21A 2VYNA 1E1LA 1QYDA 1ZW1A 3KSZO 5B4VA 1RYDA 3KBOA 2DU8A 4CXFA 2GERA 2OBNA 4PVDA 3JQ7B 3LT0A 1LQTA 1WXDA 3INTA 2NQ8A 4W6ZA 1RM0A 5H82A 3JCZA 1ZJZA 2CVZA 3EY4A 4GSLA 1LQUA 4F3YA 5T64A 2E37A 2PKQP 5A9SA 5L95A 3MJVA 3RJ9A 2I6TA 4JQCA 2P68A 4IJWA 5A3JA 1NPYA 4R1UA 1FJHA 2V6GA 2HUNA 4ITUA 4BQRA 3GF4A 4YRBA 1MG0A 3PPIA 3WR5A 1B14A 3TL2A 3ZWYA 2AMFA 4N5NA 3PGJA 1YRLA 4A03A 4ALMA 1E7QA 1FF9A 1EMDA 3OF2A 1X7GA 3IDSA 3AFNA 2FOIA 1EVYA 3NRCA 4II2A 3PYLA 3R1IA 4Y6SA 2YUTA 2YV3A 4GX2A 3Q11A 2Q99A 1PWXA 1EUDA 4HADA 4N54A 4XIYA 1IZ0A 4GLOA 2DBQA 2ZQZA 1I2CA 5CEFA 3WQSB 5JCXA 2VZ9A 5IXSA 4BO0A 4D45A 3QV1A 5C5IA 4U6QA 4DLLA 1TA4A 4MVJP 2EKPA 1I2BA 3CINA 3I4FA 2O7GA 4KDEA 2AQKA 3GLQA 3JQAB 3RU9A 5A06A 1I36A 4RL6A 1LDEA 4XD2A 4BGUA 4Q3DA 1GTMA 5I9NA 4LMPA 1UP4A 4RJTA 4WOJA 1JGIA 4JX8A 3PHJA 3ASVA 4WGGA 1B2LA 1YDEA 1EBUA 5KOIA 3WTCA 4B4OA 4LUPA 1WP4A 3RCBA 1X15A 2P4HX 1NQAO 1HDOA 4PG6A 1PSDA 1Q0LA 1A27A 1DB3A 5GMOA 1QORA 3HN7A 3TZCA 2VQ3A 9LDTA 2X86A 4DMMA 4F46A 2ZB4A 4BGVA 1Y5RA 1B8PA 4R01A 4W82A 4GX0A 5AVOA 4DBVO 2BKAA 2DFVA 1JTVA 1NQ5A 4TROA 4RCVA 4JJIA 2WPGA 4FOSA 3CZEA 2CDAA 5FEUA 4WLUA 2Q1TA 1GL3A 3PFFA 3AOEA 4K6FA 3HJAA 5L4NA 3GOHA 1KETA 3NTQA 4CLRB 1BDMA 1NP3A 2Q46A 4LISA 4WK6A 3RC2A 3KOUA 3HWRA 3IOYA 2WD8A 2WSBA 2JCVA 2H9IA 2RAFA 4QEDA 4L8VA 1AN9A 2BRUA 2VNSA 1AXGA 4HY3A 2PD3A 1PR9A 5IDYA 5L7WA 1U7TA 3O4RA 3NV9A 1N5DA 1F8FA 1UXHA 3VZPA 1PQUA 3GVHA 1P1IA 1R4MA 1D3AA 4R9RA 1MA0A 1R4NA 1QLJA 4D41A 5JDCA 3M6IA 3AUTA 3B6ZA 4P8RA 1NHWA 2GF2A 3M2TA 5IG2A 3ITDA 5G0SA 2EV9A 4GKBA 2J5KA 1ONOA 1OBFO 3D5QA 1XR3A 3OJ0A 3ADPA 4HV4A 2HMTA 1PJSA 1QYVA 1MW0A 2DPGA 3DMTA 3JQGB 4ZQFA 2JHFA 4CL3A 4Y67A 5GZ1A 3ENNA 1T4DA 1Y8QB 4B8WA 4Q3AA 3V1TC 2EJWA 4DC1A 3WMWA 1NNUA 4BNNA 1MFPA 3LLVA 1N1EA 3COSA 4KUHA 1R0KA 4JBGA 3DFUA 5F1OA 3TFQA 3V8BA 2FPIA 1EUZA 1AHIA 2HRZA 3LYLA 2NACA 4LRTB 1GQQA 4BNLA 4BKPA 5A9SB 4FFNA 5JLAA 2CDCA 3E9QA 3K92A 5TS3A 5IDXA 3ETDA 1T2FA 2YZ7A 4RVFA 2O4UX 3I23A 1F12A 5JY1A 1HWYA 2J5QA 4R3WA 4DYDA 4CM6A 5AQ1A 4E21A 3KSDO 5THQA 4CLEA 3QW2A 2CY0A 4CV3A 4RVHA 3ICCA 2DQ4A 3JQBA 2PH3A 4GPD1 3VTFA 1YE3A 1V3TA 2HMSA 3HSKA 4RZIA 3E8XA 1ENPA 3VZRA 1YB5A 3S2GA 3AUAA 3UN1A 3HG7A 4FC6A 3WS7A 3CZMA 4BGEA 2OMEA 4UEJA 4O1MA 3DZHA 1QKIA 1WMAA 3IS3A 2JFGA 1KEUA 3JQ9C 3K2BA 4GVLA 4YA6A 3U62A 2QX7A 3RBVA 5KTKA 1K6JA 1C1XB 4EUEA 1P44A 1ZSVA 3GMDA 4RZHA 1EE2A 4ROSA 2J3IA 5G4KA 4CMEA 4XYMA 3TL3A 3PJGA 1R0SA 5JC8A 2NVUB 2DPHA 3JQAA 3A06A 1C0KA 1DFHA 1U3UA 1U8FO 3RSHA 3MJ4A 3NJ8A 1P9LA 3W4JA 5G4LA 4UVHA 3WOHA 1JAXA 4JP3A 1TLTA 4OXYA 1ISJA 4K9DA 1PL6A 4TRRA 3UAGA 4BKUA 5B1YA 4ZVVA 4KDFA 4JK3A 1HTBA 3BA1A 3AFMA 3L77A 4E3ZA 3IUPA 3JQ8B 2W2LA 4YAGA 2GN6A 1PJBA 4OMUA 5LC1A 1LNQA 3L6EA 2JJYA 2WDZA 3NKLA 4PLWA 4EJ0A 3ZU3A 4BNYA 3JQFC 1I30A 4WEOA 4DIOA 1ZFNA 1I01A 4CODB 4I5EA 4NBUA 3VH1A 1P74A 1NBOA 2NUAA 3VKUA 4UEOA 3VPFA 4YAIA 1UR5A 5F1PA 3K5PA 1BHSA 5FWNA 2GZ2A 4O63O 1ZSNA 2E82A 1LBEA 4R1NA 5COQA 1VKNA 2QRKA 3KSUA 4GMFA 4CLRA 2A4KA 4YT4A 4BKRA 1IZ9A 3CZGA 2EXXA 3WIDA 3HFSA 4CMEC 2W2LD 4GWGA 4HUJA 1GYRA 5DN9A 2H1SA 3L6DA 3HFGA 3ZHBA 2O7SA 3ABIA 3FNHA 5GZ6A 3AOEC 3V2GA 3AM3A 3VVCA 1ADCA 1DFGA 1O0SA 5DT9A 5EIOA 1OOEA 2WE7A 3GUCA 3F46A 4YPOA 1PR3A 3GFGA 4WE3A 3VPGA 3CKYA 1ZEJA 1XG5A 4PLVA 4BS9A 3PDJA 1GU7A 1HDZA 4HWKA 4ND3A 2CMDA 4NHEA 4PG7A 2I3AA 5BNTA 3RD5A 3F5SA 3MJEA 3NYWA 3ZZNA 2VCYA 4AJJA 4OM8A 5JC1A 3D3WB 4BIIA 4CM4A 5BSGA 4TQGA 3CTMA 2B37A 3H5NA 2X5JO 4IGFA 5COAA 4MP6A 1XKQA 4Y98A 4BNJA 2JFFA 5CG2A 3TF5A 1YQXA 2C7GA 3N7UA 3QIVA 4K26A 4YAKA 4TKMA 4PRLA 5JNLA 4W9NC 4AJKA 2HMUA 1PJ3A 4YQYA 2PKRA 4CMHA 1U5AA 2PGDA 4DLBA 3ZWNA 4CQMD 5T8KA 1PJQA 4KTTE 5DZSA 2VZ8A 1MUUA 3GNQA 3PP8A 2AW5A 3GPIA 2AQIA 3RWBA 1RP3A 3NDJA 3NTOA 5C7IO 1P1RA 2IZZA 5G0VA 1ZS2A 3AM5A 2BHLA 5JPIA 4A0SA 4L9RA 2E49A 5KVQA 2YHIB 3GVXA 3W8FA 5TQVA 4DMLA 4FGSA 1RKXA 2AEJA 4IMRA 2GGSA 5CG1A 1H6DA 4BO4A 4J2HA 2J3KA 2GYYA 1DRUA 5B37A 1T25A 3UICA 1M6HA 4YT2A 3L6OO 5MGBA 2FPPA 4IDFA 1C1XA 5I8ZA 1N2SA 3H9EO 4ZU3A 2ZB7A 1E3LA 3QSGA 5FI5A 8ADHA 3UCEA 1AHHA 2VN8A 1NXQA 1OR7A 1A9ZA 4Z3KA 4CLDA 3H5RA 4BGIA 3BMOA 3TZQA 1NWCA 3OHSX 4BV9A 4I9HA 3PYXA 2EP5A 3ZWBA 4M54A 5TLSA 5JAMA 1K3TA 3FNFA 2UAGA 2QYTA 4G81A 5JW6A 1RM3A 5A9TA 4G5HA 5FI3A 1U4OA 1P45A 2Q1UA 4W4TA 4H7PA 4AJOA 3ZW9A 3DBVO 1CJCA 2HJSA 3V5NA 5ILOA 3PZBA 3DBRB 4WOKA 2Y1EA 1I3KA 1P3DA 4D79A 2NTNA 1EVIA 1PS0A 1GV1A 1LI4A 2NQTA 4LGVA 1LU9A 2Z95A 1NR1A 4AG3A 3E6AA 2H5LA 3H9JA 1E3SA 4CMIA 1ENYA 4NBRA 4A10A 2HU2A 3WLFA 2YQ5A 2X22A 2NSDA 4H16A 2Y0DA 3OEYA 2VT2A 3ONEA 5COBA 4II3A 1HSZA 3BZUA 4AJ1A 2B5VA 4XGNA 2NU7A 4HBGA 4BNTA 2NU9A 4AL4A 1ADBA 3VH2A 4BB5A 2BFAA 1GQYA 2XPCA 3GRKA 3WFIA 3ZCXA 3RAJA 4EI2A 1EDZA 3L4BC 1DEHA 1J0XO 3DB2A 4QQRA 4EZBA 3UCQA 3VZSA 1C0IA 3GFBA 3DTYA 1IHXA 4A26A 3C3XA 5IN4A 4YQZA 3OA0A 5KJFA 3ZNPA 2NADA 1EUCA 3UCFA 1VI2A 1YB1A 5EN4A 2JKVA 1X0XA 2AA3A 4FIZA 3S2IA 1Z45A 1ZSYA 1LJ8A 2VRCA 1EVZA 3LLSA 4OXKA 1D4FA 1GCOA 3HDJA 4PG4A 4R1SA 2VZ0A 4CLHA 1K6IA 4ZJUA 3DHYA 1DC4A 2I66A 2ZCVA 3H2SA 3ZWAA 1IUKA 4Q3EA 1KBZA 2Y67A 4XZ3A 4RF2A 1CQIA 1KVTA 5IDQA 3H65A 3STHA 4E5NA 4MINA 1KVQA 5BSHA 1AGNA 5FYDA 3KYBA 4M49A 3WGOA 1RPNA 1F06A 3NAQA 5DBGA 1XYGA 4BUCA 1LSUA 1QP8A 5AXAA 3DONA 3RJ5A 3DOJA 5JO9A 3EZLA 4TVBA 2NTJA 3DFZA 3RIHA 3S8MA 1D7OA 4N5MA 1P33A 4OOEA 2D2IA 5H83A 3L9WA 3BYZA 1U9JA 2Q2WA 3D4NA 1LDGA 1H5QA 1N1GA 3D64A 3K9QO 4NBTA 4GSKA 2I67A 3F6YA 1Z75A 3L4BA 1GZ6A 4OHUA 5LCXA 3ZV5A 1FDSA 5G0TA 1FDWA 3BMCB 1LUAA 3TZ6A 5HWSA 2PFGA 3U4HA 1GYQA 4EJMA 3VPXA 1J6UA 4NFYA 4FW8A 1U2DA 5ICMA 2IXAA 1DHRA 1J49A 1N7HA 3MJTA 4L76A 3UOGA 1NFFA 4FJ1A 1YS4A 3A28A 4FBGA 2ILTA 3KUXA 3K73O 4ZHSA 3E48A 3HNPA 1ADGA 3I1JA 4XWYA 2VWGA 5C37A 3WGGA 1Y8RA 1ADFA 3HDQA 5KWEA 1O94A 1WDLA 1BG6A 2J5RA 2OXIA 4A2CA 2C07A 2DBRA 3WXBA 3BTUA 3NGXA 1DC3A 3PHGA 4HNGA 3TJRA 3L4SO 4I9UA 2EGGA 3QHAA 1Q7GA 3KB6A 4CM8A 1GADO 3KYDB 3F5QA 5DBFA 5TRTA 1P1KA 4WCDA 4YVFA 1C0PA 3EUWA 5U4QA 3FWZA 3OIGA 1RM4A 5CEJA 2HO5A 2Q4BA 3BMOB 3W4KA 4DREA 2ZJ1A 1XU7A 1CF2O 2IZ1A 3OP4A 3IAHA 5AXBA 3S2EA 2AE2A 1HETA 4H15A 3OJEA 4IINA 3U0BA 1MX3A 4GAEA 2POQX 2VUTA 3L0DA 5K6AA 4WECA 3I4CA 3JQBC 1SOVA 4R41A 1NM5A 5JFOA 1CERA 4RLHA 5C7OO 1GCUA 4EUFA 2YDYA 5DCUA 3PVZA 4LCEA 1N9GB 2PGLA 1HRDA 1T2EA 1WDMA 5DULA 1QMGA 3DEYX 4U8GA 2BF7A 3ULKA 3AY3A 3IKTA 1PTJA 4URFA 4Z9XA 2OP0A 2J3HA 4IXTA 1KC3A 3MOGA 4IM7A 4I9NA 4BV8A 5DCWA 2QYSA 3GK3A 4IUYA 4B3IA 4CJXA 3ZWWA 3ZNOA 2G0TA 1R66A 5U1PA 1ID1A 3I5MA 4XYGA 3HDHA 3JYNA 5T67A 1BGVA 2D0IA 3IJRA 5L9AA 3BIOA 2UVDA 1I3NA 1ZNQO 4MO2A 4NK4A 1JU9A 1TXGA 3C1OA 1LXCA 3PFWO 4IDDA 3JQ7A 4XYEA 2D8AA 4PG8A 1YONA 2DBZA 2O3SA 2QW8A 1O89A 1QYCA 3ZWCA 3O03A 2O23A 1N8KA 3CZRA 3IKVA 4ZRMA 1HDXA 2AQ8A 1I24A 3CZLA 5ENDA 2X9GA 3IMFA 4Q9NA 1LTHR 1TVEA 3HUDA 3UW3A 1PS9A 3VH3A 1W8DA 3ROQA 1WVGA 3NT4A 1YL7A 3B1JA 2CF5A 3GZNB 3Q2KA 4NU6A 3ST7A 1HLPA 3LF1A 1MC4A 2C29D 2VTEA 1QG6A 3FD8A 4PZCA 2I76A 1QXSA 4YACA 4QSMA 1T2AA 3OEWA 3UERA 3OFSA 3RUEA 3S2FA 5IN5A 4TZKA 1IL0A 3JD4A 1YBAA 3ZWXA 5KJEA 4WLOA 5C7LO 5KVVA 3F9IA 4BOYA 4NNJA 4B3JA 3DWFA 5K9ZA 4E2WA 5BQFA 1DHTA 4RGBA 4ZQGA 1EVJA 4INAA 2Y66A 1VJ1A 3GDGA 3B70A 3EDMA 3KM0A 4OAQA 3OMLA 3AJRA 1V9LA 1F17A 1VC2A 5F5LA 4I5FA 1PWZA 2UYYA 3ZHYA 2PGJA 4UEKA 1LLDA 2BGKA 2NWQA 3GUYA 5DCYA 1ENZA 1VL6A 3PHIA 3W4IA 1EQ2A 4BNKA 2DFDA 4CQLA 3AWDA 3VPSA 1YDWA 5JSFA 1ZXLA 2CFCA 2WTBA 1E7SA 2VNAA 3HN2A 2BFMA 3LC7O 4L4SA 2G1UA 2QHXA 4WNIA 4M87A 4XR9A 4B4WA 1H2BA 2BI7A 2IZ0A 2ZB8A 4DIFA 5TJHA 1GY8A 4ZD6A 4E2ZA 3R0IA 4J91A 4ND5A 2PK3A 5BR7A 4IDAA 4J7CA 4ALJA 1BVRA 4YJFB 4IS2A 3ZWPA 3OJFA 4U6SA 3F1KA 4IZIA 1U7HA 3E82A 4DQUA 3RFTA 1KY5A 1DXYA 4HFRA 3CEAA 1EK6A 1X7HA 4IQ8A 2Y1FA 1HYEA 4XYLA 1CETA 3IQDB 1LSOA 4W99A 5ILGA 2A35A 4NQZA 3H5AA 1ZK1A 3GVCA 4GLLA 1AXEA 3W1VA 1ISFA 3M1AA 4E30A 2PH5A 2X0RA 4IY1A 4MOWA 5L4SA 1PZGA 5CHEA 2NM0A 3BHMA 3O9ZA 3R6DA 3IJPA 3HB4X 3QVSA 3GDOA 1C1DA 2QQ5A 4M8SA 4J16A 2C59A 4EUHA 4YT8A 2WYUA 4PZEA 2Y1OA 1LDMA 1CWUA 4DPKA 4OH1A 1DIAA 3C8MA 2MAPA 3EVNA 1HXHA 1SPXA 1W6UA 1ARZA 4CMKA 3DBLA 5B4UA 3RBXA 3JQ6A 4JJGA 5I7VA 1E92A 1B8VA 1XDWA 7MDHA 3ZWVA 1Q0QA 4LVUA 1LDBA 4UUNA 3BMQA 4HNHA 2ZTLA 2BELA 3QWHA 4BNGA 1NVMB 1VKOA 4YR9A 1UZLA 1T26A 3ZHXA 5DP2A 4PG5A 3LC2O 4TRNA 4L75A 3EZYA 1QYWA 2Q4EA 3AOGA 4QUKA 2X0IA 4HX5A 3VTZA 3WYBA 3PDUA 3CPSA 2DTXA 5ICSA 3DHEA 5CP8A 5JO0A 3OJOA 1Z7BA 2EF1A 4A73A 2WM3A 2YW9A 3CXRA 4QXMA 5KKAA 1E3WB 2PZMA 4MJLA 5A03A 1FDVA 1NHGA 4PZDA 4A5OA 5TJ9A 4E5YA 5KJ6A 4O0LA 2VYND 3CUKA 4E5KA 1N9GA 4WCFA 1LDYA 3O8QA 3JQGA 1MB4A 1ZK3A 4C7JA 2ZKLA 3UFXA 2OP1A 2NNLD 2FN7A 1B8UA 4MVJH 2PNFA 4M55A 2WD7A 4TSKA 3GAFA 4ZRNA 2F1KA 2CVOA 3FSRA 5AYVA 3TDKA 4BO7A 4RLSA 3WNVA 4BO9A 2PR2A 1ZEMA 3GG9A 1BMDA 3SC6A 4K6CA 3SX2A 1A9YA 1EZ4A 3WGZA 3NGLA 4CMJA 1M67A 1B15A 4N18A 4QFDA 3PRJA 1EE9A 3DDNA 2ZTMA 4FGWA 1PJLA 2D59A 4Y6PA 2SCUA 3MOIA 1M75A 4B4UA 3E9MA 3Q9UA 1OI7A 5BT9A 4YRAA 5L53A 1HDGO 4AVYA 1I3LA 1YJ8A 2V6MA 5TGDA 4CM1A 2GO1A 3RUFA 4EGFA 4AJLA 2EKQA 3SBOA 4W7IA 4DL9A 5IZ4A 4CV2A 3GN1A 3G17A 5F5NA 2CD9A 8LDHA 4XKJA 1V3UA 1BWSA 3H8VA 1U3WA 3X2EA 3GZNA 4JLWA 3V1UA 3SXPA 2A9FA 4QO8A 2Y1CA 4P38A 3ROMA 4QO7A 1LDNA 2D3TA 2E4AA 1WLYA 5JMWA 2VYVD 1NQTA 3HHPA 3U49A 1GD1O 4MVJI 4FSHA 3G3EA 2PLAA 3P2OA 2XAAA 1ISIA 1WMBA 1PJ2A 3DQPA 3A14A 1I2ZA 4WPGA 5GY7A 1HL3A 1S6YA 3JQAD 1DIHA 3LZ6A 3O26A 5KCZA 4PRKA 4ALKA 3IIEA 4CM9A 5F3RA 3KLPX 4E0BA 1QRRA 2WWRA 4PGFA 2TMDA 1OC2A 4XX0A 1BW9B 1K6XA 2B4TO 4DQXA 4OOFA 3KRTA 2EG9A 3GVIA 3AU8A 1A7KA 4MVJD 2VOJA 2W98A 1PQPA 3K31A 4WLFA 3U09A 1GEEA 5EPOA 4C7KA 4OKNA 1P31A 1PJTA 4KWHA 3WGTA 1LLCA 1IHYA 4FFMA 4NBWA 2RCYA 3E03A 3PQDA 4IDGA 3TOXA 3KETA 4IPTA 3AK4A 4L4RA 4J9UE 1BTOA 1DC6A 2FR0A 1LSJA 4FFLA 1HLDA 1BXGA 1YO6A 4XQGA 4BNMA 3I6IA 4JBIA 1Y8RB 4TRJA 3VDQA 1P0CA 1UJMA 4P4GA 1NR7A 4FS3A 1LSSA 3ANNA 3PIIA 4EEXA 1SMKA 5ENVA 3FNGA 4TWRA 4CMCA 3LK7A 3TSCA 1BW9A 4DWVA 1E1MA 2RBEA 2RIRA 3GR6A 2RHCA 4MPDA 1M66A 4RPGA 4WCFC 3GN2A 1GDHA 2EWMA 5HS4A 5A05A 4XB2A 3W6UA 5I7SA 5JXWA 1O95A 4CM4B 1ONNA 3GC6A 3WNQA 4NIMA 4BKQA 1MW3A 4GVXA 4MKZA 4IMPA 3TOZA 4MIEA 1QLHA 1N92A 3OIFA 3IP3A 3ZV3A 1GEGA 4IJVA 4F6LA 3F1LA 4QTZA 1DBVO 1ENOA 1K2WA 3IP1A 3BMNB 2Y99A 1MV8A 3EK2A 2D5AA 3KLMX 3BXXA 4PLGA 2WE8A 3NEPX 4AJ4A 4A7PA 1YL6A 5FF9A 5HTOA 1U4SA 2GUGA 3OQ1A 2A92A 3DHNA 4YBZA 4E32A 1WDKA 4BO8A 4CR8A 3FPLA 2ZJ0A 3PQEA 3WMXA 2EIHA 2VYVA 4I1IA 5IDWA 1K89A 1D1SA 3CSDA 3GY0A 4Q3NA 4GX5A 5EERA 1NVTA 1E6UA 3ASUA 2YFHA 1TT7A 2O50A 3OH8A 1VSVA 4R54A 5THKA 4BNFA 4EW6A 6ADHA 4E33A 5I7EA 1GUYA 4RF5A 3SEFA 2H6EA 4CUKA 1D8AA 1NPDA 1VJ0A 3VVBA 3X2FA 3RKUA 3EGOA 4ILKA 2FSSA 3OQ6A 4Z9YA 3T7CA 3VZQA 4BNVA 3MCVA 5I8WA 4YAJA 2DAPA 4XQEA 4U5QA 3WWZA 1KERA 2P5UA 1V3VA 1FK8A 4FPXA 4PLFA 5CDYA 4CQMB 4J3FA 4LK3A 5EQDA 4JJFA 4UAGA 4PLCA 5ER6A 5CFZA 1KYQA 5L40A 3GA0A 3D5TA 4J1TA 2GN4A 4RVDA 1KIFA 3GDFA 2IYPA 2HCTA 2Q49A 3RC9A 2X8LA 1I3MA 4I5DA 1N7GA 5TSDA 5HRUA 2PTGA 4J9VA 1CYDA 2R2GA 1SZJG 1IYZA 3U3XA 3GNSA 2HK9A 2VWPA 3HDYA 3TQHA 3ZGYA 1E3WA 3RUAA 5J23A 3LQFA 1DIGA 1RYEA 1Y9AA 3G0OA 3PJEA 4TRMA 3B1FA 4WJZA 2ZTVA 4DPMA 4GI2A 1CRWG 2PD6A 4JN6B 3O8QB 2BFOA 2VTDA 1GZ4A 2EEZA 3CIFA 3PGXA 4D3DA 1Q1NA 2DBVO 3UEQA 1UP6A 1Y9EA 1ML3A 4LSMA 1Q7CA 3WSWA 3AUUA 4R4JA 5BSEA 2IODA 3RFVA 4ND1A 3PYMA 3VC7A 2WYWA 4MP8A 3WBFA 2FSVA 4DLAA 2C5EA 1UDAA 1ZIDA 1X1EA 2QZZA 3D4PA 3FI9A 4U0JA 4EYEA 4YJFA 4GX1A 4KQXA 3P19A 1SOWA 3GEGA 3QLJA 5TNXA 4DPLA 1H9BA 1G5AA 4D3SA 4Z0PA 2FZWA 3RC7A 4YJDA 2I5PO 1ULUA 3CH6A 3E1KA 3WICA 2PZKA 3PXXA 4KOAA 4OSPA 2EERA 2D4AA 4XEHA 2MAOA 4GBJA 1IB6A 3DXFA 3IC5A 4J7UA 2JL1A 1NAIA 5BNFA 4XJSA 5DF1A 1ONPA 4CM5A 4Z6KA 4JCOA 4CMGA 1MXHA 1A71A 3ROPA 3DAPA 3BTSA 5EQFA 2HMWA 4NH4A 5CAEA 3UGKA 5CPBA 4QECA 1G6KA 3JD3A 3ZU4A 3QP9A 1YL5A 3H3FA 4KQWA 4ZA2A 3H9GA 3OBBA 2B36A 2O4CA 2OHXA 2XF8A 3B1KA 1SEVA 2O3JA 3K30A 4W7HA 4PLYA 1VL0A 3V1YA 4DBZA 5A1TA 1VLLA 4KZPA 1SAYA 4M89A 3E5RA 3OIDA 4CUJA 4FFRA 5H81A 1FXSA 3ZN2A 4PLTA 5GZ3A 4E13A 2Q1SA 5HM8A 1PQWA 2B69A 4A27A 3Q6IA 5I9LA 4TZTA 3VKVA 4E5MA 3WYCA 4XDYA 2IE0A 3Q2IA 3C85A 4FJ2A 1WW8A 3V2UA 2ZCUA 2B35A 3WB9A 3MTGA 2FPGA 1L1FA 4DVJA 5DOVA 3RC1A 1VPDA 1ZK2A 4UVEA 1X14A 3PJDA 4UUPA 3OECA 1UDBA 1M76A 3KVOA 3G79A 2IXBA 1HT0A 1X1TA 4ND2A 3ZNQA 2G82A 3PWZA 4J90A 1JVBA 4AJ2A 3DZGA 1E1KA 1R16A 3U9LA 2AEFA 1LRKA 3P7MA 3HE3A 4AICA 3NT5A 1IPEA 4DUPA 2AG8A 3PHHA 4G2NA 4ZICA 2R6JA 3FBGA 4F45A 2HRBA 4AJEA 2TMGA 1SCUA 2Q2VA 4L0QA 1I32A 4RQUA 4OYRA 5JYEA 2UV8A 1SO8A 1ZH8A 3OM9A 5I9MA 2EP7A 1IY8A 5T57A 5EJ2A 3T4XA 3TWOA 2O48X 1HDYA 2UDPA 3RQSA 3TRIA 4RPJA 3DOOA 1LEHA 1V8BA 2BMAA 5A4DA 4WEQA 1KY4A 4NZ9A 3LDHA 2YDXA 1PJCA 5L7TA 3ANLA 1W0CA 3LT2A 4BVAA 5I7FA 1Y5MA 1T1SA 5A02A 1H3LA 3CE6A 3ENKA 2C7VA 1IOLA 2VHYA 3GHYA 1U5CA 2NVUA 3MJSA 3R3SA 5JAIA 4LCJA 4WLEA 4BNUA 1JAYA 1VL8A 2FWMX 2C0CA 4HKTA 4I08A 4WLVA 5A9RA 3KEOA 1KOLA 1P1FA 3QA9A 1GR0A 4RDIA 4RPKA 3PLRA 2Q50A 3RFXA 2X9NA 5JDCC 3QVWA 2PZLA 1G0NA 3WGIA 4ZN6A 2Z1NA 2FHSA 4CM3A 2P2SA 3ON5A 4BNHA 4FCCA 4XQCA 3H9UA 3WGHA 1PZHA 3ZU2A 4LMRA 1E5QA 3WGYA 4N5LA 4J1SA 4P4NA 2RH4A 4UVDA 2AG5A 1F0YA 2Z1MA 4NU5A 2O3TA 1UXKA 3C7AA 2JAHA 2WJPA 3K96A 2HSDA 3DAGA 3KZVA 3LT4A 3NUGA 5L4LA 3SJUA 1U2GA 2O3RA 1DLJA 2NVWA 3ZW8A 5B4TA 4JROA 4ZQBA 1WZIA 3VDRA 3MJCA 3PEFA 1PGQA 2VHWA 2I3GA 1XELA 2X23A 5BSFA 1MVYA 3JSAA 3JQDA 2HLPA 3CMMA 3PHLA 2CDBA 2UUOA 2X1HA 3QWBA 4K28A 4U0KA 5ER9A 1OZAA 4XA8A 1X0VA 4OKIA 5JYDA 5JCJA 1ZMTA 3WJAA 3RUDA 3AUSA 5JAZA 2I65A 1CEQA 1HF3A 2O3UA 2GZ3A 2PZJA 2LDXA 3SC4A 5CDTA 2W4QA 4DC0A 3I9MA 4XDZA 4E2YA 2ET6A 4Y6RA 2PWZA 1SB8A 2AQHA 3OA2A 4OL9A 2D5CA 3FHLA 5T8KC 1PGNA 4JIGA 4XQ9A 1PU2A 3GMSA 2P4QA 3I3OA 1HDCA 4RPLA 2J6IA 1ZK4A 2HK7A 2HJRA 2Q1WA 3DZJA 5AOVA 2OBYA 4QFCA 4J43A 2X5OA 2ZYAA 4UUMA 3RROA 2BGMA 3GPDG 2DUWA 4UUOA 3BAZA 4XB1A 4CM9D 3AY7A 2X58A 2OZPA 4FDAA 4AJPA 4PLPA 1MC5A 4B7UA 2WMDA 3QWAA 4WUVA 3KYCA 4YJHB 5ITVA 2GRAA 4YAEA 3INRA 2P9CA 3FBTA 4B7XA 5ES3A 1OFGA 3U4DA 1E3EA 1DO8A 1LC0A 2O3QA 1ZJYA 4BL5A 4OXNA 4DXHA 1LX6A 2J8ZA 1M6WA 3I9KA 5G2OA 3WYEA 4IQ0A 1B0AA 4OJNA 3OICA 4NFSA 1PL8A 3K6JA 3ONFA 3GT0A 4HXYA 1RM5A 1JG9A 1DOHA 4YYZA 3DBHB 4UVIA 4CUZA 3DMTC 1S7CA 1H6AA 3QWFA 1C14A 5EMHA 1X13A 3ETEA 2ZTUA 1NVGA 3KO8A 4ONEA 4LW8A 1YGYA 3ZHZA 2VOEA 4Q3CA 3SLGA 4L73A 2GR9A 3EW7A 1AUPA 4MKXA 4TKLA 4KWIA 1ZVMA 4XYBA 2CZCA 3ANMA 2IEBA 1J4AA 3JYOA 3QVOA 1R4NB 4LVCA 4YCAA 4B4VA 1B3BA 2GN9A 1JW9B 5EL0A 3FR7A 1V0JA 3V2HA 3DL2A 1KC1A 3QVXA 2O7QA 2OL4A 1PGJA 2O2YA 3G1TA 3BMNA 3OETA 3D0OA 1Z82A 1NTOA 4RVUA 3ZNNA 4B79A 3NT2A 3JQCA 4MP3A 2DT5A 1H93A 4JGBA 3PJFA 3ZV4A 4EDFA 3U4CA 4J6FA 3EMKA 3PTZA 4EITA 1DRWA 2FMUA 3ETGA 4IGEA 4ALLA 1EK5A 3AU9A 4BO2A 4CLOA 3ADOA 1R12A 4HFJA 2GCGA 1HZJA 4RF3A 1HYHA 4FC7A 2EHDA 4GQAA 3VPHA 5CDGA 1XQ1A 3LT1A 1ZO8A 2GN8A 4Q3BA 5DNAA 4FLRA 5ITWA 1UXIA 2C5AA 4JXKA 5A5FA 3WDSA 2DKNA 4J4BA 2W2KA 5TIIA 2ZIZA 3I52A 1V6AA 3I9JA 4IIVA 2X4GA 2HDHA 4BMNA 4D0RA 2C20A 4UULA 1CDOA 4RQTA 4WKGA 1E7MA 3CZKA 1G1AA 4RPHA 4IDEA 2C2XA 3PQFA 4TMFA 1GUZA 2BH9A 2VWQA 1A7AA 1JKJA 3ONDA 3Q1LA 4DIBA 5ADHA 3U5TA 5HS6A 1IPFA 3E9NA 4IXWA 1W73A 1K0UA 1E6EA 1T1RA 3AM4A 4YB8A 1VM6A 5JDIA 4BNXA 4BNZA 1B26A 3Q0EA 5G0UA 3WBBA 3JQFA 2FR1A 1QR6A 3GNTA 4GWKA 4YRDA 1PZFA 1VRWA 5K6AC 2B0JA 5DOZA 3JQ8A 3DBRA 4P22A 1I10A 3C1AA 1OMOA 2ZK7A 4Z0HO 5C3MA 2DC1A 1GFSA 1PL7A 2VWHA 3HB5X
chains in the Genus database with same CATH superfamily
2ZYDA 4RHTA 3BB3A 2G7ZA 2WIAA 3RRZA 1J5PA 2BKVA 3PQ3A 1ID8A 5AOBA 3FB4A 2G36A 2WFLB 3W6PA 4EHBA 3ZCTA 4O1IA 5KNDH 2ZUWA 5LOVA 1ZCFA 4CN9A 3TIIA 1VKHA 3NFYA 3PDIA 1L5QA 4RESA 2AF3C 2XDQB 3K2EA 3L93A 4HH0A 2F17A 5E3IA 1SJ9A 1BXZA 2BUCA 2LCIA 1E9SA 1UEIA 5J43A 3RKRA 1P19A 1UBMS 5HMLA 1RYMA 2BL4A 2Y1WA 5HZKA 1PX0A 2H2DA 1YQUA 1LV7A 1TA0A 1UZAA 4PEVA 2H16A 4MR8A 1XHFA 2QK4A 2XXJA 4WVLA 1FUEA 5IJZA 1PL0A 4ZZ2A 4DNOA 1A88A 1SB9A 5CA1F 3NAMA 1JFTA 4FOLA 2C2YA 4R5XA 1V3QE 2O8NA 3H1FA 3N2IA 2BUBA 3KXLA 1JYFA 3N76A 4HXEB 4PVCA 4GVPA 1YOVB 4IDPA 4UDNA 4ZARA 4EA7A 2B7BA 4G4IA 5K7SA 3ONWA 3QJGA 2P62A 2NP7A 1NFRA 4OHWA 5D85A 2C9CA 4PYIA 3UV6A 2XITA 4PINA 4RZSA 1Q19A 2CSUA 2R47A 1RQPA 5TC4A 1AA6A 1SG6A 2BEKA 3CNNA 5JUWA 3R4CA 5ITSA 1GPNA 1WZUA 2ZI3A 3JSXA 5LZ5A 3WQHA 1BVUA 4GR4A 4MRNA 5FBVB 1R5OA 1W5TA 1VJTA 2F1HA 4LBYA 1KOJA 4Z7OB 3E9EA 4WZZA 4R7ZA 2G07A 4PZLA 4OQYA 1ECBA 2BP7B 4Q39A 1YZHA 4RY9A 1U1EA 1KQ3A 4DSAA 1HE2A 1WY5A 2TMYA 1WZ2A 5FNZA 1NL3A 2HU7A 3BWCA 1MVOA 4HDMB 1J8FA 1N7IA 1MFZA 3IIMA 5AJTA 3AFIA 4MR8B 1IUPA 4PLZA 2UVQA 1N5LA 3OFNA 1IM5A 3HA3A 4BFSA 1RPJA 3EAGA 3O93A 1R00A 3R5SA 5DTQA 2ODEA 5GADl 4F8JA 1OLSA 3QG1A 4X66B 4FWTA 2NLOA 3PSHA 1X1BA 1NTRA 2XEDA 3I37X 2MSCB 4PFJA 3Q2OA 1V4NA 3SSAA 1AKYA 4XR4A 4AR9A 2MINB 1Z7EA 1JAHA 5BMVB 2X5KO 3KQOA 3OBIA 1KDTA 1U0NA 4BB6A 1ES9A 1TUGA 3DEHA 2R3SA 5KVSA 2QBYB 1ULBA 2PRIA 4FDMA 3WLAA 5C8YF 1DKRA 5TX7A 1T5TA 3GCWA 3S3TA 2WJ6A 3LUHA 4GD3Q 1K68A 2FF7A 2GAFA 2LTAA 3RHFA 3ANYB 4M36A 2COKA 1XN4A 1Z0IA 3UANA 1JU4A 1JFFB 2JA2A 4NESA 4FHDA 2DHCA 1Y8AA 5E1BA 3UENA 2I6SA 3LQKA 4QT4A 4BLSA 5EKSA 3WO1A 4TLEA 4H17A 3R40A 1SXPA 5P21A 2V9CA 2XKAA 1XRJA 1KJQA 3E7FA 3ESDA 4LA4A 4DC9A 1EUQA 5AM1A 3HXPA 2WIDA 4LPKA 4P3OA 4Y2RA 4OFBA 2MSDB 4HS4A 2D06A 1G5QA 3DOCA 4HK4A 4YH1A 5DNYB 1ZBQA 3HBLA 5G4KB 3CA8A 2QMYA 3E5HA 4DARA 5JSUA 2FPKA 1ZG3A 4QUAA 5FO1A 2AN9A 2ERYA 2DUJA 1SKYE 1EH5A 3K5IA 4K5NA 4C3UA 1P61B 1SQMA 1H5UA 3RT1A 2OOSA 1P5HA 1HFWA 1Z2NX 3BWDD 4N5IX 3EGCA 4JOBA 2I80A 2YJTD 4XGIA 4D0NA 3K8ZA 4ZAGA 2JJ1D 9LDBA 5BVHB 4GKVA 4B8ZA 3HP7A 4L72A 3QFHA 4ALIA 1VOTA 2YFKA 4LNAA 2H31A 1V11A 1Q7BA 2CVHA 4FXOA 5CLQA 5BR1A 3WLRA 3HU2A 3UMCA 3IQIX 4XWOA 1JAZA 3EWIA 4WXMA 2EFHB 2P2DA 3FSGD 3O0DA 3QBEA 4RE5A 2JATA 1C1HA 3F7TA 2PT9A 4LEIA 1AS0A 1O8CA 3F8TA 3RUPA 1QMPA 1WZEA 2C7BA 4CRWB 1A2KC 1U28A 3OI7A 3L0CA 4Y6LA 1ISGA 1JHRA 1GQOA 1I4DD 3INGA 4D0SA 1CIPA 2PUCA 4JNDA 2VNIA 3K9NA 3VOSA 2WKRA 2I6FA 1LPMA 3TR5A 3OUUA 1ZU5A 3PFBA 2SNIE 1HZZA 4URHA 4X7PA 4YWJA 4D4HA 1P1JA 1V1MA 2QQFA 1P18A 1KO5A 4DR3B 2WPNA 3LSYA 2DUUA 4KH1A 1HOTA 3T7IA 3VUFA 2E89A 1H9AA 1RJWA 2V6FA 3D8UA 3F67A 4IXMA 4NJMB 4XVRA 4ZOEA 2GN1A 1RU3A 2REQA 4XWAA 5IHXA 3EPLA 5HNHA 4L74A 4U39A 4L15A 4YJ3B 2R6ZA 2Q1YA 2GK3A 4FFBA 4CF6A 5JS6A 3JSZA 3ILYA 4BMYA 4ID3A 4I36A 4NK5A 1E4OA 3C0KA 4PZ9A 2H1VA 3GARA 4ZXPA 5BURA 5AW9A 4FMDF 3F3SA 3GT3A 3KDPA 4ZZ3A 4G8BA 2VJBA 3A6EA 3IRVA 3PUXA 1EAMA 2PUSA 2Z2KA 2YOFA 3H6KA 1IRXA 4L8LA 1OX5A 1XCLA 3AXSA 3HUEA 3W5VA 1OX4B 3GGCA 1YIAA 1GUDA 5TT0A 1PZEA 2G04A 2IYOA 2OFWA 2VJLA 2ZE8A 3QJ5A 4MGIR 2ZJ7A 2W90A 3ZWOA 3E2PA 5CB4A 2DQMA 4QOSA 1M2WA 5AIBA 3D7RA 1DKQA 1JR3E 2HAEA 4D81A 1GZHB 2YFQA 2YH2A 4KHZA 4PFKA 4RTLA 5K0CA 3ECAA 3BIWA 4O4IF 4LXQA 2CVQA 3EIWA 4L16A 3B52X 3F8WA 3QFFA 1NWHA 2RH8A 1Z8FA 1C8KA 1UBGA 1XL0A 3FCYA 3CMCO 4Y8VA 1FYVA 3GVPA 3RR2A 3UF0A 2JI9A 3UWDA 4PSUA 2WOOA 1MG5A 3HNOA 3KYIB 3UKOA 4C2TA 1C3OB 3B20A 3BE5A 4DTIA 3GWGA 3U1VA 3CT4A 4MVCA 2H48A 3H3JA 5SICE 3RW9A 4B31A 4TKUB 4DV5B 2BFCB 2Z57A 4US1R 3CR8A 2YRWA 2FZ5A 1F38A 1GGFA 1NX9A 2R84A 1NXPA 1QHNA 1TFRA 1MHPA 1JPJA 3LFTA 4E11A 1J1UA 2ATEA 3EMBA 1CZNA 3MWEA 1QUEA 2F67A 3LFHA 2J4CA 3UOWA 2I55A 1UOEA 4TV8F 3ZDFA 1U6KA 4D4MA 1TI7A 2AYYA 2EJVA 1DAPA 2QLTA 2NUPB 4G9BA 2I8AA 1QPBA 1GZ3A 1SFRA 3KYCB 3DTTA 4IWNA 1P17A 3A58B 3GGGA 3IAAA 3K35A 1X87A 4IWXA 3TQCA 5LXTB 3OEEA 5AR1A 1WCXA 2VP9A 3AVVA 1FSFA 3JALA 4BPBA 1UKEA 4R8LA 4X64B 1IUOA 2HSWA 3IEVA 1YJAA 1M1XB 1Z25A 1L8LA 3VC3A 5FLEX 2F00A 2G76A 1PHPA 4EG7A 1S0UA 1Z0DA 2HD4A 3GLHB 4DA9A 5JBQA 5ICFA 2QTWB 5DGCA 1UANA 2VT3A 3DO5A 1AHPA 4O4HA 1HT2E 1UAYA 3TEMA 4P32A 3S8EA 1EFVA 2AN1A 3UT0A 4DCUA 3NBKA 3O6VA 1DUSA 1ND6A 3UMJA 1CRZA 1Y4AE 1ZOLA 2V7XA 1N6RA 2JH8A 4OQZA 1I5RA 3ZD6A 3X44A 4LZNA 3QWIA 4Q02A 4FX2A 1W5SA 3IUMA 4RFLA 5E38A 1NLFA 2R59A 1JQBA 1U8UA 1UZMA 2FRVA 5FNVB 3B7PA 4ESVA 3CEJA 3GDWA 1DJQA 2YV2A 5FPYA 4DQVA 1W36C 1QV6A 4PICA 2JFHA 5L3VA 2DHDA 4PCVA 4JD5A 1AQUA 3I9FA 1R4AA 4XSHA 1GKIA 4R5MA 4C89A 4YXFA 1SQ5A 1SD2A 1I2AA 1HT1E 1CULC 1WWKA 4F3RA 4A23A 3T5MA 4BMVA 1BJKA 1OI4A 4XDGA 3UAXA 5J4VA 1NBEA 1QPGA 3KKZA 1BS1A 2FW1A 1EEHA 1P0PA 3IO5A 4RDHA 2CLKB 5A04A 3DS8A 1RRCA 4BJHB 5EJEA 1LZLA 1B6SA 1CPYA 1AE1A 2ZJ5A 3PT5A 4O33A 3ZJUA 1XIVA 4HT3B 4F6RA 5CG2A 4KDRA 1S9DA 2ZP1A 4YEDA 4IDBA 5IP5A 5L7YA 1QQBA 1LA2A 3HBFA 2F1OA 5KYXA 3UAWA 2I71A 2ZJ3A 3FJOA 3AUXA 4MMYB 3ZLTA 5C7YA 4R5HA 1L5MA 1R27A 4J0GA 3FYUC 4KMRA 1ESEA 5CNKA 4B80A 4GR5A 1OZFA 4BO1A 4UTVA 1TJ3A 3FN4A 3LP6A 3W7VA 1FXWF 1UADA 3PFHA 3CLHA 4FOOA 3R7NA 1GO2A 2VUUA 2G80A 2XNSA 2C54A 2D1YA 4GU5A 3GUHA 6CHYA 1X74A 4D26A 3N2KB 1W88A 2IZOA 1WDWB 2X7HA 1ZNWA 3S44A 1XRQA 4MGHA 1E3IA 5JS8A 2QN7A 5J3JA 5C0OE 1RYBA 5DYTA 4J4HA 1Y5NA 1Y80A 2BGWA 2X5NA 4Q3KA 4XIJA 2IEYA 1AQJA 1SIOA 4CV0A 2ZATA 2FRDA 1XZIA 1ZQ9A 3BX1A 1DDGA 4HVCA 1JQAA 2C2GA 2VF7A 4MKTA 4N6NA 5KOJA 4V02A 3T4PA 5F1KA 1F8UA 1RC0A 2PKEA 3JR7A 3RQIA 3BT7A 4DYVA 2Y05A 4KMOA 4C6TB 5CEEA 2I62A 1NLYA 2EEPA 3TH5A 2Q7OE 3B5EA 4RPIA 2G8NA 2X6TA 3C8DA 4ID9A 3PXUA 4RD3A 2OUIA 3FZEA 3AFHA 3CV3A 3T1OA 3LPDA 3VSDA 1PG5A 4EELA 3C2QA 1E59A 1H0KA 1J2TA 3MUFA 1A5BB 4NABA 4TPKA 1VJRA 4C20A 2RJ3A 4RVSA 4D6XA 5FX2A 2OGUA 4RHYA 3ZZTA 2P6MA 5CTJA 1BYUA 1JBQA 3JZDA 1DDOA 1XZEA 1QE3A 1QYXA 2EL9A 3N6RA 3AYXB 4HATA 4WZBE 3BM5A 5EQJB 3M81A 4ZI7A 3K9HA 3GLKA 5B6PA 3WAKA 4MNTA 1OSNA 1SVUA 4ZT7A 2I7CA 2GWHA 1GP2A 2XNDA 4ZIRA 5BNIA 1K97A 5KC9A 2ZTHA 4R3NA 2QTVA 4QLAA 4CU2A 4S1VA 1C3VA 4Y18A 1N36B 2FFBA 1PR4A 2Y93A 3PWSA 1V8PA 2A2ZA 3SQOA 4KPYA 4G24A 3KXDA 5B1EA 4ITRC 5FA6A 2CWWA 4M7RA 1B3RA 4M0PA 3NHYA 1JWBB 2JLRA 5CLHA 1A72A 4ANFA 2IHTA 4TV8B 1JVSA 2Q5CA 2VP3A 1CZUA 3DZIA 2ZKIA 1T5SA 4QOFA 3ND5A 2WM9B 1WPQA 4N39A 4ESEA 4LVOA 4OG2A 4G0YA 3QUBA 4ZEVA 4GRAA 2WSSA 3WRYC 1RJ9B 3JAKB 4ND8B 1A2BA 1JJIA 2P9HA 5CX1B 3DT6A 3BICA 1DAOA 1JN0A 5ALRA 4L3VA 1EZZA 3RJTA 1ZK0A 1CQPA 1NUPA 3NEYA 4LHEA 3V4PB 2GPBA 2QLBA 4RVBA 4KQ9A 1QUFA 2P90A 4RV9A 1WCWA 3PLNA 5BW4A 2CV2A 1F14A 3FTFA 3RC3A 4ZYTA 1N2XA 2PD4A 2JCXA 4F8YA 3B2NA 3MTJA 5MN6A 4OA8A 3GRPA 2BP7A 1SG7A 3D7LA 4MRAA 3LIPA 3Q10A 1TC2A 3QMVA 4R1LA 1E20A 2IFTA 3ZIAD 4CDMA 1IVSA 2GILA 1WP9A 2XMRA 1P29A 1TO1E 3TPCA 4D8YA 4UU8A 4Y2PA 4ZZIA 2D1SA 1JFFA 3FZNA 5HQ3B 2WQ6A 3F47A 3GCGA 1FFDA 1PCXA 4GGPA 2QVXX 3V4VB 5K03A 4DAOA 2IEGA 4PXAA 4BQNA 3M5PA 4G0NA 1E5VA 1TQ4A 2RHWA 5HQTA 3F74A 3DV9A 1NJ6A 1PFUA 1QDUA 2XXBA 1U63A 2J0VA 4J1QA 1K9VF 1QVWA 2X3FA 3D6FA 4ZAVA 3VHRA 3UEOA 2BFWA 1NRXA 1QZTA 2HK8A 5BMVA 1QK4A 1ZPDA 1FFCA 3LI2A 4OB8A 5JTTA 1VL5A 1CQJA 4PLHA 4A8TA 1C1YA 2IZ5A 4N5HX 5FPSA 2ZULA 3DZKA 3GL9A 3COZA 3GEIA 3W5UA 1NN3A 1VTKA 4L4UA 2ZRQA 4HDNB 2PFKA 4HGQA 3WGQA 4C0WA 1T6XA 1XEAA 4JC0A 5HA5A 4LJ8A 2FY8A 4LWQA 4B3MB 3C24A 1J2EA 4TYWA 3A9WA 3EVCA 1AUVA 1REQB 1FLDA 1I9GA 1SELA 1URPA 3H2KA 4FR0A 5CBPA 2JH9A 1VSUA 2AFVA 2WU0A 4PRZA 4LRSB 3LQ1A 2A5YB 4JLDA 3IBYA 5IUJC 1GWNA 1NR5A 4TUYF 4YJ2B 4EMSA 1HKUA 4NOKA 4AY2A 4PU0A 4J0EA 4OXXA 4AUNA 1YBMA 1R6UA 1KKLA 1PZMA 4U7WA 2HNAA 3OCXA 2EC5A 2QRLA 2FLWA 1VIYA 2WF6A 2WWIA 5LDHA 1GPLA 4DHWA 2R25B 3PS9A 3RV3A 3H2HA 4EKGA 2V6BA 4HDKB 5AJUA 4F06A 1WULS 4KACA 4KXQA 3KE9A 2AT1A 4NAUA 1AQNA 4LE0A 2YHUA 3T9DA 5CDHA 2GPTA 3KHUA 3FRJA 3HRIA 4LY9A 1DP4A 1F6WA 4UMVA 2PWPA 1Q2XA 1Y8QA 5CIQA 1N6LA 4NJOA 4LBZA 1BKSB 1E6WA 1M7GA 2PL1A 3L07A 2J6HA 5KSYA 2QORA 3CLKA 2VRBA 1R0WA 1CKEA 1UFKA 2ZWMA 4WXEA 3ODPA 1ZGGA 1QH9A 4QIHA 3SY8A 1L7DA 2JGFA 2TRSB 1MNAA 2NZ2A 2O2DA 4LHSA 2WJZB 1M6VB 4LSWA 1TF7A 3FPCA 3MEQA 2XUOA 2P75A 1JEQA 4GZ5A 4OEHA 3CHOA 1Q50A 1U2PA 3LBHA 2A1TR 2ZBUA 3BKWA 4OGWA 4B3BA 3A6FA 1DC5A 2J09A 2YCBA 4I1VA 1DZIA 4IS3A 2HEGA 4J0HA 4M86A 3RWMB 4ZOBA 4CKBA 5I51A 4HYQA 1EBFA 2VK8A 3C6MA 3I2GA 1OXMA 5BW6B 1ZC4A 2JG3A 3AEKA 3WYAA 3T12A 4PVBA 3DEJA 1X8XA 1ZW1A 1EWTA 3FDZB 3KSZO 5CK4A 3P32A 5CH8A 4CXFA 2QUKA 1XYVA 1IM2A 1QHIA 1GAWA 3CWQA 4AP9A 2C8LA 1LQTA 1WXDA 1VYVA 2WG0A 5EKTA 2O8BA 4QPDA 3P26A 4HOYA 3SXJA 4BBZA 3SC2A 2C04A 3HMQA 3DLTA 3FUEA 4OBEA 5DLDA 3GWZA 1P2DA 4NC9A 1CEXA 1V7QA 1K5DA 2A14A 4GSLA 3WK7A 4G1BA 4TKVB 1W36D 2JRLA 1FUKA 4D3YA 2C9OA 2PKQP 5L95A 2XVYA 3DL7A 1D2EA 3RJ9A 4O4LA 2P68A 2ZSUA 3FKSA 4BMDA 4W8HA 4YRZA 1NPYA 4B34A 2WHQA 4BQRA 3UWPA 1RWKA 2RGDA 4YRBA 1TUBB 3VKGA 3NGMA 1B14A 1GQRA 3TL2A 1CDZA 1HDEA 1RHRA 3PGJA 1YRLA 1PR0A 3P2JA 4A03A 5TEWA 3TFWA 1SXJA 1E7QA 3MMZA 2NUAB 4YMHA 3IDSA 3UTDA 2Z8YM 2PX8A 5JIBA 1DGQA 3RIEA 3RAFC 4ZAXA 5HZGA 2YUTA 3FCEA 3LY8A 4M83A 4NJEA 3Q11A 3STWA 2Q99A 2R1TA 1YVDA 5GOZA 4EFMA 2J3QA 4ER5A 2XJ9A 2ECPA 1FFXB 4WQMA 1EUDA 2V03A 4HADA 4CMIB 4YUZA 4XIYA 1KPGA 4GLOA 3RJMA 1HEIA 2ZQZA 1I2CA 1J09A 1P5RA 5D5PA 2X13A 5C5IA 5KS2A 1Y5IA 2FX2A 2FSIA 4NXNB 3KSAC 3EG9B 4B35A 1FXUA 2W70A 2DYKA 1YI1A 5AKXA 4OUDA 3SR0A 1WABA 3CINA 2NN3C 4KDEA 3W2IA 1MNQA 2QTTA 5HG0A 3NG1A 3V8RA 5KTYA 1U2EA 4PAWA 3E35A 3U56A 3C5WP 3E0QA 3WXMA 1GTMA 1AKMA 1HBJA 1IB0A 4JS0A 4PPNA 4L9AA 1XLWA 3LK6A 3PHJA 4RTQA 3MTAA 3L1IA 3A04A 4WY5A 3PEYA 1B2LA 4F2GA 2PXCA 3T06B 3OOYA 1OVGA 4KQGA 3GAAA 4U63A 4W1RA 4V1CI 5AM4A 1YCFA 1HDOA 2QTFA 4ME6A 4RTJA 5HK9A 2DJIA 3PU6A 3G0IA 4JVMA 4B9AA 5LYJB 2KW5A 1AZLA 1DB3A 221PA 1IAQA 2CFSA 2MYNA 3D0RA 3HN7A 4FOTA 4J0IA 2VQ3A 3A4YA 3DLPX 3DP7A 5CH5A 4F46A 5IXSA 1FNSA 3THXA 1WV1A 5JYBA 1KAEA 5EG5A 4DBVO 5MGNA 3I05A 4PV7A 4MHTA 5JCOA 1RR6A 2DFVA 1JTVA 1KFJB 4YAOA 2PZEA 2GT1A 2VP6A 4H6VA 1NULA 1KXZA 2W2XA 5F76A 5EMJA 5K8IA 2WPGA 1Q74A 2Q3BA 3CZEA 1XAGA 2CDAA 5FEUA 1BZYA 4WLUA 3DAOA 2BHRA 4C0BA 3AOEA 1CUWA 1CLUA 2XKJE 3AXTA 3GJXC 3KALA 3HH8A 4FFSA 4AYWA 1GN9A 1Q0RA 2FSVC 3CRVA 1O6FA 3SR4A 4LISA 2Q46A 2RHOA 3SQWA 3TXAA 3VU8A 2GEKA 2SKDA 5IBPA 3RC2A 3CCFA 3L7LA 2HWWA 3KOUA 3T9BA 3IOYA 4LUCA 1RRMA 4QEDA 2VS1A 2IHUA 2WTAA 4L5BA 3CF6R 4L8VA 1IBLB 2P5TB 1FJXA 1LBIA 3ZPXA 1XAHA 1KFKB 2CUTA 4LXUA 2XRYA 5DGDA 1Z5ZA 1N5DA 1UXHA 4EFNA 3OMXA 3OQVA 4AF8A 1I5OA 2CHQA 5C1PA 4R9RA 4EI9A 1PSZA 1V5FA 1R4NA 4A6EA 4D41A 4Q5IA 5B36A 1OU0A 4K05A 5JDCA 3WA7A 5JQGF 1EDBA 1QO0A 3B6ZA 3LM8A 1DAMA 3LQ4A 3Q43A 4P8RA 4QFMA 3M2TA 3O4GA 1G64A 2PKYX 2ENUA 2RD2A 1MR3F 3Q87B 1RI5A 2EV9A 3USCS 2PUEA 4K6HA 4LDAA 2J5KA 1O4WA 5K4HA 1UIMA 1OBFO 1VMKA 3BXOA 4D4IA 1VJCA 3AVPA 1YI0A 1RD4A 3KJXA 1QO7A 1SM4A 4HV4A 2HMTA 1HNWB 4TWJA 1ZUNB 3ESCA 2PUVA 2VP5A 3DMTA 4MB0A 3AVQA 4LYFA 3ZCQA 2P1DA 5JQGB 2O6LA 3PUJA 4OMFG 2BTOA 1N2HA 1OYYA 4PONA 4DC1A 3WMWA 1NNUA 2OYSA 1MFPA 5A3QA 4IRUB 4R7LA 1N1EA 3FSJX 4C5BA 4KUHA 1PYGA 2YXBA 2I54A 2FPIA 1Q21A 5DMXA 1EUZA 1AHIA 1X9HA 1XCJA 2HRZA 3IB6A 2VPTA 4BPRA 3K1AA 5A9SB 4BVEA 3RSLA 5JLAA 1UPXA 2G28A 2CDCA 3EWNA 1TCVA 3K92A 4KAAA 5ESDA 4UOQA 1ZGBA 4I4IA 3ETDA 2CGEA 4J3JA 3T61A 1A9OA 4ZREA 2CXQA 5DEIA 5HUQA 1O97D 3SS7X 1R2QA 2G06A 1VLJA 2QGZA 4IZOA 1J1ZA 5AQ1A 2ADFA 3KSDO 4HPJB 4CLEA 1AV7A 5CCDA 2DQ6A 1TADA 2VH1A 4WK4B 4CV3A 2QJRA 3GJQA 1QS0B 4KO8A 4JASB 3HBAA 5TQ0A 1NM5C 1ODKA 1V3TA 1YE3A 3EGWA 4S0ZA 1BRTA 3VZRA 2R751 2HADA 3EZ6A 1JEEA 1U9ZA 3S2GA 1PN3A 3PNKA 2GYVA 3PNQA 4PYKA 1M54A 1SQ6A 4BGEA 2XVXA 4H31A 5CX4A 3LQ2A 1WMAA 2W7TA 3KXPA 1F1JA 2CNWD 1GLGA 2JFGA 1KEUA 2V5VA 2BC9A 4LOHA 1YK1A 2BDEA 4YA6A 4TYMA 5AVUA 1K6JA 5KINB 4EUEA 2JLSA 1R8JA 1ZSVA 3RRJA 2WJVA 1G5FA 4GMDA 1EE2A 1G6Q1 2AWNA 1HQDA 1Q15A 2HNKA 4TXHA 2J3IA 4IX1A 1Z68A 5G4KA 1T9ZA 4FFBB 4BFYA 2W11A 3D54D 4UD6A 4Y0AA 5E0KB 5K4AA 1SVMA 2IS2A 1SIBE 1VJGA 1ZJ4A 2ZR9A 2DPHA 4DYHA 3TVYA 1M2EA 2JBAA 3NJ8A 1PZNA 5AH0A 3NXKA 1UEJA 2XZTA 1E0KA 4HGNA 1H3FA 5G4LA 4WTOA 3FTXA 1G98A 4Q15A 5CTAA 1PL6A 4GZMA 1OASA 1FS6A 1MVNA 1LKZA 4KX3A 4RY2A 4KDFA 5DXAA 2IOFK 4NNPA 1KJIA 3DVSX 5EQTA 1HTBA 3P4UA 4EUNA 2IH2A 1VLQA 5L3SB 4E3ZA 1C4XA 1NY6A 2W2LA 2WICA 3H86A 4YAGA 1TC1A 2AR9A 2XF2A 1LNQA 3AR3A 2K87A 4PLWA 4MQLA 2DQKA 2RI6A 4EQ6B 4HZIA 5ITZA 2CEKA 1T15A 1I01A 1XF9A 4NBUA 4Q4CA 1P74A 2CMFA 1V7ZA 1I4WA 5MN4A 1XTBA 5HRAA 3E3MA 2B25A 1UR5A 4AMBA 4N1AA 5F1PA 3K5PA 4YAIA 2ZRHA 4I2NA 5ENZA 3HUTA 3Q88A 2CKMA 4BEBA 4FHGA 3FKJA 5FWNA 2GZ2A 3JVEA 4LY0A 4X0EA 3THSA 4YRSA 1QDLB 2WABA 4UZFA 5COQA 2QRKA 4HLUA 4AQDA 1MGPA 4DT1A 4NKRA 4DCMA 1LTKA 4PTZA 4DV0B 3ZCRA 2J9YB 1DKMA 3S6JA 1IXRC 2IYZA 2HR1A 3FHOA 1H4QA 3MFYA 3M9WA 5DYNA 3B13B 4C4PA 4OI2A 4CMEC 2HSGA 4GWGA 5CT9A 3UMVA 3WGNA 4Z49A 1U81A 4OQ4A 1WOMA 2X1LA 5JJ5A 3EEBA 1NXOA 3ABIA 1T5IA 4KQEA 4BVLA 4FQ5A 2PFSA 4OM7A 2D62A 1ADCA 1O0SA 1RACA 1TYZA 3FMOB 3SEQA 5B6JA 1C30B 1CVRA 3N8KA 1A8PA 1A1SA 3EQ9A 3F46A 3HR8A 3L6RA 3MELA 5JV5A 3ZJTA 1K08A 3CKYA 4AROA 4HTAA 4KNWA 1YA4A 3O4IA 3VYTB 2XVMA 3TAUA 5EXTA 2QX4A 1HV8A 1T10A 4NS1A 2HQOA 5LP1A 4F21A 2R1VB 3L0PA 5JSKA 3EVFA 1PF7E 2PX2A 1VZ3A 3V4OA 4UUAA 4CZ2A 1XP8A 3G6KA 3RD5A 4L95C 5BNTA 1QU3A 1GG8A 3GA7A 5IANA 3ZZNA 1T5BA 3NNSA 4AJJA 3FCUB 3I72A 2J32A 3JW8A 3PR3A 4RVNA 3HI4A 3WV5A 4BIIA 4RVCA 3RVLA 5LQSA 3WL7A 5BSGA 2HEIA 3WIBA 3OOWA 2DX7A 4IGFA 3CR3C 1HL7A 4FCVA 1XKQA 4GYYA 4MP6A 3KHKA 3S70A 3HM9A 4I4LA 4C7BA 1VKZA 2B61A 4MDYA 3E5NA 3BD7A 4MV7A 5CDFA 2ZIUB 2C7GA 1XHEA 1Y3BE 3L82B 3N7UA 4WN3A 5DBOA 5CCXA 2W00A 4W9NC 1GN8A 2MHCA 4HN2A 1BJTA 2R8RA 4RTPA 1G17A 3FMVA 1ZM7A 4LG1A 4OBBA 2C58A 5J5AA 1PNRA 3WQBA 3EFHA 4ZI7F 1G16A 3DULA 3LUAA 4GDMA 4JAVC 1VRVA 5U4XA 3D0QA 3GNQA 3RRNA 1DJMA 1EWQA 4EY4A 2R7AA 3DLHA 2ZRGA 3HCFA 3NDJA 3D7MA 2RB5A 2UKDA 3BD6A 3NTOA 4P7KA 3NWBA 5CLLA 5C7IO 5LJLA 2P40A 3GJ7A 3L7YA 3GRYA 2ONJA 4EHIA 5CFRA 5JPIA 1UDXA 2QN3A 4DJEC 3A2KA 2E4WA 3JWEA 4C0QC 1HX7A 2I4OA 3OKPA 1NMYA 2SKCA 4B32A 4EWLA 1ZESA 5K8UA 1ZVVA 2NMVA 4TYNA 5LIRA 2GGSA 1ODCA 3DHWC 1TF5A 3GMIA 2JI6A 3SJAA 4J2HA 2QNBA 2OSBA 2Q7DA 4CU5A 2GYYA 5KCMA 1TAQA 5MGBA 3ZE9A 3L6OO 1J8QA 1T34A 3WHIA 4F6RB 5K0GA 3V8VA 4LDRA 5I8ZA 5JS1A 5FV4A 4Y9RA 3H9EO 1QVAA 3PV0A 1Q1AA 1ZGJA 2H2HA 8ADHA 3TM4A 4M6WB 3VYRB 1AHHA 1NVVR 4V0ME 2QL9A 3SI7A 3COPA 3WGKA 1BVHA 4ZO9A 3RSCA 1KYXA 5JPDA 2YWXA 4CCWA 2PANA 4LRUA 3VJRA 3LHKA 1FRFS 3LL4A 3RVMA 3TZQA 3W5SA 4BV9A 5K8JB 4X93A 2FR8C 2EP5A 4OHVA 4Q7LA 3RRBA 3V1LA 5JAMA 3H8WA 4F97A 2UAGA 1EHIA 3LBFA 1UBJS 2QYTA 5AIAA 2AJ8A 5DHPA 1EBBA 1R0YA 3K6RA 4YI5A 3Q1KA 5DTJA 4ABYA 4C1BA 4DLWA 4YO8A 1PX2A 1V5GA 2H2AA 3K0CC 4DCGA 2IUEA 5ILOA 2Y2UA 2WG1A 2BF4A 3B3BA 3CNEA 1U98A 2IH5A 4AU1A 1QGOA 1Z12A 2ZROA 1BXRA 1JSCA 1KI9A 2A5LA 1EVIA 3LCVB 5IM5A 2YZGA 5F9MA 2IELA 2OXTA 3PFGA 2Z95A 3VO8A 3E6AA 3KYJB 4MW6A 4NE2A 5F7JA 3RVKA 4B83A 4EBBA 3N05A 4QYWA 5KOJB 4IXNA 1A5AB 1MB2A 4H16A 1UQRA 4BQQA 4CKYA 3QEMA 4PIPA 4CDRA 4GNKA 1H65A 3ZI4A 2P67A 1V2GA 3OM8A 3QUAA 5EZYA 3W8RA 3BZUA 4XGNA 3O1IC 1MO6A 5CB8A 2B9EA 1KOGA 4M1MA 1W87A 3Q3EA 3ZQKA 1M7HA 2NIPA 2CCGA 2NVOA 3HDGA 2P2NA 1VL2A 1W88B 2VYQA 3GRKA 5IZCA 4EAQA 3FLBA 5DM4A 4TTTS 2XUFA 4TXLA 1UJ2A 5IT5A 3PC4A 4A26A 4EGQA 1D1PA 1X2BA 2VJDA 3OCYA 4YACA 4ZI7B 5AHOA 2NADA 1EUCA 3DDUA 4H0FA 1NOIA 1CG6A 2E5FA 4YC7A 2I6XA 2DQSA 1DX9A 3G23A 4REQA 3TGWA 2V4UA 2JKVA 2H9AA 4FIZA 5T7BA 3S99A 1DT3A 3QA3E 1GPWB 4MS1A 3LLSA 2BFEB 4OXKA 3DUWA 3AVYA 4MO9A 4O8ZA 2IDMA 4OFXA 1G8YA 3DTVD 4G0VA 1E6KA 4MW4A 3TCXB 1E6LA 2XTZA 1OLUB 3PCRB 3MRVA 3TX6A 2ZCVA 1CUHA 1FRZA 4UU0A 1E3DA 4FYXA 3V48A 2XNKA 4WKNA 5E6UB 5JJCA 5IDQA 4E5NA 3CH4B 4MINA 5FYDA 1ZR2A 1WZNA 4DEVA 1OYWA 4XUDA 4AQ7A 3CR7A 2EWVA 5KHOC 3OCWA 4OCZA 5BWNA 1U8ZA 3HDVA 2X8AA 1LSUA 1QP8A 5CT4A 2FSUA 5CX1A 3LBNA 2VP2A 1ZL2A 4M1OA 3FF1A 4LJKA 5DASA 5ALEA 5C8XA 1U0HC 4OJKA 1KZYC 1YZ3A 2F6RA 2IY9A 3AETB 4TVBA 2NTJA 4YK7A 5KOHB 3PJRA 5K1ZA 4S1PA 2YHBA 3G0DA 2PKWA 1O94D 3M83A 4IG4A 1L9XA 1KK2A 4LJAA 4N5MA 1P33A 3IDQA 2QUZA 5K3EA 2NZWA 2D2IA 1JZTA 2HF7A 2MSEB 3C70A 1KBQA 1SUWA 2IXTA 1RBZA 2OO5C 2PJDA 2Q2WA 3D4NA 3D64A 4Q7JB 5E4TA 1JIVA 3SF0A 1EFHA 3R6GA 4MZXA 3VX3A 4YCCA 3A9RA 1DKPA 3A9SA 4JOCA 4OHUA 5E7IA 4O25A 2J85A 3KKKA 2XMSA 4LZLA 4MUJA 1T8SA 2MMCA 5D1NA 5E2AA 5GINE 2QTLA 3KCQA 3BMCB 1LD3A 1LUAA 4QYSA 3VC1A 1UJ5A 3VISA 1QQ7A 1VKRA 2GJKA 3ZHVA 4BP9A 4D0LB 2EP8A 2PFGA 3PNPA 4JI4B 3AM1A 1BCRA 1EX7A 4KMMA 3OZEA 2Q07A 4GOXA 5HP4A 2XUAA 4TTAA 1RJ9A 4ND8A 4RJLA 4IYJA 4A8JB 1J49A 1N7HA 3MJTA 4L76A 4M7OA 1NFFA 4PYRA 3VU9B 5EV7A 4FBGA 4CCSA 3DM9B 3E48A 2JANA 3HNPA 1RRFA 1EE1A 2R60A 4AG6A 4X61A 2PH7A 1U8YA 3KV1A 1WDLA 2A78A 1HY3A 1BG6A 2BFDB 1QONA 5KTMA 2J9RA 1F0PA 1SQ0A 3HYSA 3LAWA 2GX6A 1A82A 2I6UA 2CYBA 3OCUA 2WIGA 4M37A 4E51A 1V16B 4PF1A 3FLMA 3AONB 3TJRA 2H0AA 3LUGA 2O7NA 3HW2A 1DELA 4I9UA 1Q7GA 4RY0A 4YS6A 3UFBA 3WLOA 1N33B 1GADO 4UXHA 2EOAA 4KJXA 5TRTA 3RF7A 4YIKA 3EXFA 1QF9A 1UPUA 3RS2A 5A5VA 1HGXA 1Z26A 2HO5A 3AHEA 4KE7A 3BMOB 3C3AA 1Z3CA 3HUUA 2AOXA 5JISA 2ZJ1A 4RGQA 3LCRA 1CF2O 1E9EA 2IZ1A 4JKIA 1GSIA 3NS7A 3I5AA 1CS0B 3BF8A 3IVMA 3LYAA 4REOA 3S2EA 3QOFA 1Z37A 3OIUA 3U0BA 1JI3A 4GAEA 1MX3A 1RI4A 3F78A 3H2BA 3IIKA 4WZBB 5FQNA 4JR2A 5UKDA 1JI0A 2XD4A 3JQBC 3S27A 2ASVA 4F7WA 3I2HA 2YW2A 4XLZA 1RXEA 3DTNA 3EEIA 3OHPA 3CLTC 2IEZA 2RCNA 3GEHA 2ZYIA 4QVGA 3DYBA 4RLHA 3CF4A 4CKCB 1MMFB 3RFCA 1GCUA 1SVKA 4GPTA 4KV9A 4B85A 2YDYA 2W6PA 3DH0A 3LXXA 4U00A 4PCAA 3QPUA 1HRDA 3E22B 2B34A 3CHYA 5DULA 4OHKA 1JALA 2G9ZA 3Q3VA 4IEFB 3DAHA 5JSHA 1PTJA 3N9IA 3FNIA 4L0CA 4EB8A 4Z9XA 3U3RA 1ZS9A 1PFYA 2WAAA 3R5XA 4HNQA 4NWIA 2CNKA 3S0JA 5JXGA 5ICGA 4HZUA 1XMSA 1HC7A 4G56A 3ZWWA 4NVRA 1R66A 1HOXA 2Q6IA 1BNCA 3V80A 3ZIDA 4JLSA 2VQ6A 4U7TB 1ZCBA 3I5MA 5IKMA 2F3UA 4XYGA 3B1YA 1Z4MA 3R3UA 4MQBA 2RGNC 5DW3A 1RZRA 5T67A 4EFDA 1BGVA 4HNVA 4FEGA 1GQFA 3D02A 3LNTA 2IIQA 2L2QA 1Z9BA 4UEQA 3RTBA 1ZONA 2QYOA 1D0SA 4ZVNA 3C1OA 4IDDA 3MF4A 3GUUA 4QDJA 4ZOAA 2D8AA 1NOJA 2VJOA 2AOTB 3PPXA 4D5EA 4PG8A 2XTJA 1OFUA 4V03A 1EWVA 3IRUA 3ZWCA 2YN0A 2AIRA 2Y0BA 4WFIA 3IKVA 1N8KA 3CZRA 1MAVA 3DE3X 1U1DA 1OXVA 2YINC 1HDXA 4D3XA 3CZLA 1P0QA 2V0NA 2CYAA 2BGNA 4L2LA 3IMFA 1C7IA 1I4EB 3HUDA 2IIVA 4KQ6A 1W8DA 2J7PA 3PQ7A 3NT4A 3ROQA 3WWOA 2CF5A 2H1WA 3GZNB 2PA0A 3OTHA 3V8EA 3BGWA 1KFBB 1MC4A 3CUTA 5J2TA 4ABTA 1MC8A 2EZUA 4QOIA 1U2DC 1T9GS 3H04A 4C3ZA 4EO9A 2FUG1 1QOPB 1Z2PX 1WOYA 1QXSA 1GPYA 3A3KA 3BIFA 1UT8A 3DMPA 3E1GA 1T2AA 4IRXA 4RD4A 2HI0A 3UERA 1MJHA 1G21A 3IP6A 4CIYA 1IHPA 2AR0A 3S2FA 2YXLA 2XHZA 4HH4A 4UDYX 3ZWXA 2UUCB 4WLOA 2QMZA 2WUFA 3F9IA 3P9XA 2AOWA 3AKYA 3DWFA 3NIFB 4FCWA 4E2WA 1SKAA 3O8LA 4A91A 1DHTA 1VG8A 4RGBA 1RLIA 3DMGA 5IVHA 5GV8A 3TS1A 3GDGA 4KU4A 1WF6A 3IV7A 3R6TA 5AW6A 4PNPA 5EJGA 2IHVA 2WZBA 5CT8A 3WLPA 2VDLB 4UOZA 1V9LA 1VC2A 5LMZA 3MNFA 3C6YA 5MHTA 1V26A 3X43A 3ZHYA 1NN0A 4L27A 1LLDA 2BGKA 2NWQA 4F8EA 3QVJA 1KZHA 2IHYA 1HNXB 1FOEB 3W4IA 3O90A 2QB5A 1YV9A 2WUEA 4UNRA 2QVYX 5FH9A 3VPSA 1UDWA 1KK1A 5J5VA 2GXQA 1H2WA 4Q6WA 4A9AA 2TSYB 2VSQA 2CFCA 3KQYA 2D1RA 1FW6A 3AESA 4BC0A 2PL5A 1UT6A 4UFNA 1SKQA 4XD7D 3AVXA 1R64A 4L4SA 2YFYA