5DUPH

Influenza a virus h5 hemagglutinin globular head in complex with antibody avfluigg03
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
227
structure length
208
Chain Sequence
EVQLLESGGGLVQPGGSLRVSCTNSGFTFSNYAMSWVRQAPGKGLEWVSAISGTYYADSVKGRFTISRDNSKNTMYLQMNSLRAEDTAVYYCVRDDSYDGGGHYGLHNWFDSWGQGTLVTVSSSTKGPSVFPLAPSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title Comprehensive analysis of antibody recognition in convalescent humans from highly pathogenic avian influenza H5N1 infection
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1/2005(h5n1))
total genus 34
structure length 208
sequence length 227
ec nomenclature
pdb deposition date 2015-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH01
4K94L 4HUKB 3QNXB 2FO4B 5CIPB 3UTTA 1NCAH 4GW4B 1A7BA 3O4LA 4W6WB 4K55A 5CD3B 1UCBH 3HMXA 3FCTB 2Y6SC 1JJUA 5D1XB 3BRDA 4NQED 3QEUA 3I85A 2VNCA 4GRLD 3TCLB 4NZDA 1XIWD 1IKNA 2VDML 4HQQH 5KW9L 5CP7A 1QD0A 4OFIA 1BJMA 4GS7B 3Q0HA 2FWOB 2QSCH 4OZIF 4LSSH 3V6OE 3D39E 4JE4B 2IPTH 5IK3A 4G6MH 1CLYH 2UUDK 3TYGH 2B7DT 4WI8A 3UX9B 5LWYH 1P7QA 3AAZA 3T4AA 4NFBA 2NY2B 1U92B 3IFNH 2AJVL 4FABL 4HAGA 1CVRA 3Q5OA 3SKNB 2NW3A 2E7BA 2CDFB 4FQLL 2LV4A 4G8FA 4GQPH 4YDIL 1RZJH 5F8RC 5TH2B 3D39D 3DHJA 3OR6B 1WEJH 4AIZB 1AKJD 3T09A 1RUMH 5L0QC 3RWFB 3CLEL 2EDXA 4AZ8A 5EO0A 3U9PH 3KYOA 1HKLL 1UWEH 2C26A 3EYQD 1R3KA 4G7YL 3IETA 2OSLB 3MV9A 5H37G 3VGHA 1NBZA 3H9SE 3AS0A 1OGAB 3TNNB 4Z5RA 4KDTC 2VZUA 3MYJB 2AW2A 1NFIB 2Q1EA 1LDPH 2JELL 3PHQA 3ZHLA 5IFHL 3TWCL 2BZDA 3NGBC 2MKWA 4JAMA 4OB5L 3H9SD 1CFQB 3BZEA 4KGLA 1ACYL 3O8XB 2EYSA 5FYKE 2Z4QB 1BQHA 4HIJB 5IB5A 4P46B 3HUJF 5I75C 3AREC 3RWGA 2DMCA 1FE8H 2W0PA 3GI9L 5C1MB 5IKCA 5ALBH 2B4CH 3IFOB 5D96B 3PGDA 4I5BA 5EU7C 2XICA 4LARL 3RGVD 2C1PA 5ETUB 4H1LG 4PJXF 3K3QA 3WL9B 5FYKD 4LBEB 4NZTL 1PW3A 5C09A 1RJLB 1F3JA 1VDGA 2XA3A 3FONA 3BPLB 1CFVH 1VB9A 1FPTH 1WFTA 1U8KB 1QG3A 3QRGL 3T2OA 4YHLH 4HZAA 2AJSH 4F80A 2FO4A 5CIPA 2RB8A 5FM5O 4GW4A 3U4BH 4NQCD 4OCRL 4OD2B 1KIQB 4KKBD 5CD3A 4OF8A 1A8JH 2XTJB 2XG4A 3HTLX 3BUTA 4PJ5B 2XWTB 3FCTA 5D1XA 1A3LL 2WLZA 5JW4Q 1T20B 3KJ6L 3AROA 4PGZA 4XVSH 2J8OA 2C3GA 2V2TB 3TCLA 1AH1A 1RJCA 1MFAH 1Q38A 4O5LL 3RWHB 5ICYB 3SKUD 2FWOA 4KHXL 1EXUB 3RZCB 4I18B 4XNYH 2YD1A 1UB6B 4XI5D 5J12B 3ZL4H 1ACZA 3SGJC 1E4WL 1TQBB 4UTBL 1U92A 1CXLA 2XQYG 2IH3B 4MJ2A 5C08B 3SKNA 3U0WL 4HG4K 1YEDB 5FUZL 1HQRB 3MZGB 5HHOE 1HINL 5TH2A 5E2WL 1DBJL 4MNQD 2H1PL 3OR6A 4AIZA 2EEBA 4OLXH 5JW3L 3DX7B 1L0QA 1UGNA 3O6MH 2FIKB 3TCXA 2QADC 1JGVL 3GSNB 3IGAB 3SGKA 1OTSC 4XPHL 5I1CH 5DWUH 1A1MB 4POZC 4AH2B 2LTQB 5HHOD 2OSLA 1OCWH 1T1WB 1OGAA 4JFYB 3TNNA 2AK1H 4I1NB 5C70A 1B6UA 4EN3C 5BXFB 3CFKB 3MYJA 3FT2B 1PY9A 2E7MA 1A9BA 5GZOD 1I1AD 3SBWC 4L9LC 3QCUH 1JBJA 1MCOL 3FRPG 4PJ9D 1HIML 1CFQA 5C0EB 3LD8B 1S3KL 3ULVE 3VI3E 4Z8FH 2D03H 3O8XA 4CW1B 2Z4QA 3WNMA 4HIJA 5C2BH 1NCDH 4P46A 1Q72L 3WUWB 1E28B 4HS8L 3D6GA 3TJEL 1JGDB 3IFOA 2DQCH 3WSQL 3ZYJA 4WFED 2JIXB 2RBLA 4ENEC 3KPNB 4TUKH 5ESAB 5ETUA 3WL9A 4LBEA 4JGMA 2E27H 1JGEB 1RJLA 2DOCA 5CBAB 5HVHB 3RDTD 5J13B 1U8KA 2Z31C 4P4KB 5T33H 4F9LC 1MIMH 3F58L 1P7HL 3CDCA 3C6LD 3IDNB 2A83B 2CUIA 4PJFE 1JNNL 1EPFA 3N85L 5KZCB 4OD2A 1KIQA 1F58H 3JXAA 2ICWB 1WF5A 3IJHA 4PJ5A 2XG5A 1FH5L 1T21B 3K74B 3G08B 3DIFB 3K7UA 1T20A 5TQ0H 4OLWL 1ITCA 3W0WD 4RFNB 2V2TA 3R06B 4RMWA 3G04B 5EG6C 2CJUH 4M6NH 1ZHLB 2FNBA 2H26B 4GH7B 3RWHA 3MRNB 4QRRE 5ICYA 4CMMB 2R0LL 5DO2C 4XPTH 1EXUA 3RZCA 4I18A 4CDGC 2HTLD 4X5LA 1NC2D 4MD5B 1UB6A 1W0WB 2A9ML 1WWCA 2AJYH 1LO2H 3FT3B 1KXVC 1N64L 1G7JB 4Y5VB 4XP4L 5GGVL 2IH3A 3BN9C 2BNQE 5C08A 1YEDA 4QRRD 2R0WH 4JY4B 1HQRA 1Z9LA 3IF1B 4YQXH 3PP3K 4DN3L 5TGBB 3S37H 3OAZH 5CZVH 1FLRH 4DFHA 3DX7A 4PP2B 3LS5L 4K7PX 2FIKA 2DDQH 4K3DH 4F7PB 1Z5LB 3X3FL 3KLDA 1BQLH 3DXAD 3GSNA 3IGAA 4AENB 5HHQB 1J1OL 2NY1C 4R8WH 2FJFB 1KB5H 5C0BB 1K4DB 4AH2A 4DEPC 4ZNCD 1T1WA 4K94H 4JFYA 5D6DC 4U1GC 3CX5J 3DROB 2JJSA 4NWTL 4PPTA 2CPCA 5BXFA 3MGAA 3FT2A 4LIQL 5GS0C 2EH8L 2ENSA 5GGVY 1GJIA 1I3VA 3U7WL 3D85D 4P2OD 5C0EA 2VDMH 4CW1A 4Z7VE 5KOMC 5KW9H 2DLFL 5JO5B 4M1GL 4CDHA 1KB9J 1JGDA 3FN3A 4EBQL 1KYOJ 3P11L 3CX2A 5BV7L 1BF2A 4WFGE 4PP1D 2JIXA 5C0AD 1R5VB 3KPNA 5ESAA 3GUTB 4FABH 2AJVH 3OR7B 5L9DL 1JGEA 2MMXA 4UQ3A 4FQLH 4YDIH 1R5WB 1I85C 5CBAA 3QFJD 5E94B 4P4KA 3F7PC 1CBVL 1VFBB 4LSTL 4Z7WF 3KS0H 1AR1C 3C08H 3SE4C 3GRWA 2A83A 3W2DL 1R24B 4L4TD 4EXPX 4G7YH 2IPUG 4MXVE 2ICWA 3EOYG 3CDGB 3L5XL 4O02H 1T21A 3G08A 1XR9B 2CRYA 2Q86A 1KTRL 4XGZB 3VG0H 4XAKE 5MENB 2X1XR 1J88A 3G04A 3T3PE 1ZHLA 2JELH 3TWCH 1OD9A 3OX8B 4CMMA 3QXWA 1WJ3A 3RU8L 4OB5H 4MAYC 3M1BA 2QSVA 3GMNB 4MD5A 4YBLC 2PETA 4YDKL 1W0WA 5CD5D 4NC2B 1R3IL 4Q6IB 5FUCC 3FT3A 2OX5A 4AIXA 1LHZA 1I9EA 1G7JA 4Y5VA 4ZAKB 4OM0L 3RIFK 3NIFE 3GI9H 4BZ2H 4JY4A 1EBPA 2EDWA 1H15B 3IF1A 1QSEE 1JWSA 5CEZL 5TGBA 4QCIB 4TSCL 1MI5E 4PJ7E 1GGTA 2A73B 1U3JA 4NZTH 4M1CC 4PP2A 3H0TB 4GKSB 1I4FB 4F7PA 1Z5LA 2MQCA 5DMKB 4AENA 1YJDC 4QTHB 3MV11 4M7LT 2FJFA 1QSED 3QRGH 1K4DA 5C0BA 2ZUUA 3KPSE 3ET9F 4NUJB 2BC4B 2GJ6E 1MI5D 3IDYC 4LCWE 3DROA 4OCRH 3UTTE 4G80B 3WNNA 3O4LE 1G6RL 3OGCB 3QQ4B 1A3LH 3QXUA 3TVMD 4PJFF 1AHWB 3KJ6H 3KPSD 2GJ6D 4MQSB 4YHIA 2ICCA 2FSEB 1JYXA 4O5LH 3UTTD 3RL2B 5JO5A 4I8DA 3O4LD 2HFGL 4M8QB 3LKOA 5ICZB 1OL0A 2JJTC 4NNYB 5DJYB 3BO8B 1R5VA 1E4WH 1X4YA 4UTBH 3GUTA 5GPRA 2ITCB 3U0WH 1ZS8B 3OR7A 5FUZH 1DCLA 1J0ZA 3W11C 1R5WA 1MCWM 2DMKA 5E94A 5EC2A 1HINH 2ITDB 5E2WH 1X5AA 1DBJH 1CN4A 2H1PH 1VFBA 5C0DB 4ONHB 1J0YA 3K8LA 3ECBB 1P7QD 2DQJL 1FGVH 1JGVH 4JANB 4FMFA 1R24A 4L1DA 2GTZB 3WDIA 3ZDYE 2BJML 3CDGA 5IWLA 4F33A 1XR9A 5IGXH 2E7HA 3A0OA 3MV9E 4XGZA 2BNUB 1DBKL 5MENA 2VR9A 4PRIB 1A7RL 1REIA 4ODSL 3Q1SL 3X3GL 3HRZB 3QPQD 3ZE1E 2KPNA 1F5WA 2P8MB 3ARBB 3OKMB 3DVGB 1F45A 4Z7QE 2DJ4A 3OX8A 1MCOH 1MFEL 4HKXB 3T0WA 3W81A 2YRZA 1WFOA 2A0LD 1HIMH 1H5BB 1NAKL 3MV9D 3GMNA 1S3KH 4RFEB 3P0VL 4G9FB 4Q6IA 5IHUL 3TC9A 3O3DA 4ZAKA 2YKLL 4IIQB 3O6LL 35C8L 4HS8H 3TJEH 3UTSA 2HKHL 1H15A 4Y5YC 1JPFB 1CFNB 5A43C 4K07A 4Z7VF 3PXHA 1MJ7L 1URLA 4QCIA 4JKKA 2A73A 4ZO8A 3C09C 4FS0A 2ADJB 4ZQKB 2NXZB 1MREL 3H0TA 4GKSA 1I4FA 1KCVH 5MHSD 5DMKA 5C09E 3HR6A 1TZIB 5E6IC 4QTHA 2XRAL 5KS9E 4JFEE 4KK6D 4NUJA 3F58H 3SE3C 2BC4A 2WBJB 1JNNH 4B5EA 5FFLA 5HPOA 3N85H 3QA3B 4C56E 4G80A 3HPLB 1FRGL 2UY6A 5C09D 3AMKA 1FH5H 4KXZI 3C87A 4JFED 3OGCA 4PJCB 3QQ4A 2BCKA 1AHWA 4OLWH 5IBUB 2LFGA 4ZFFB 2JE8A 4HUNB 4MXVF 1MLBA 2FSEA 4XB8A 4OI7A 1UKSA 3RL2A 3MRGB 4RGOL 2C4FT 4PY8J 3I3BA 4DZBB 3EDEA 2Y06L 1PQZB 4R4ND 4Y7MA 5EWIL 1P53A 5ICZA 3T3PF 4NNYA 4WGWB 3I6LE 5D1XD 2A9MH 1CR9L 3BO8A 4XP4H 5GGVH 2ITCA 1ZS8A 2GKIA 5GRUH 2ITDA 3QPXL 1CFBA 2YPVL 3QJFB 4DN3H 1PVHA 43CAB 3I6LD 5D6CB 3WHE0 5ERWB 5C0DA 4GAFB 3NIFF 2OXHA 4ONHA 5T5NF 3LS5H 3ECBA 3X3FH 4ZNEE 1X4ZA 4JANA 3JUZA 1J1OH 2NY2D 2FEDD 2W9EL 1WZ1L 4PJ7F 4UV7L 2BDNL 2GTZA 3RWJB 1CE6B 1SY6A 3C9NB 4Y89A 2ZSVB 2BNUA 2CQVA 4NWTH 2QQQA 1BZQK 2AQ1A 2ZCHL 3HRZA 1HDMB 2P8MA 3ARBA 4LIQH 5LCVL 3OKMA 3VXMA 3DVGA 3UBXG 2EH8H 5DHYB 5MEQB 3R0NA 5DMJB 3QQNA 1H5BA 2XZCL 4RFEA 4G9FA 2DLFH 1HWGB 2EXWC 3T8XB 1WBXB 4M1GH 4IIQA 1JNLL 2HAZA 3RI5F 4JGUA 1GGUA 1T5XB 4GJTB 2I9LB 4P9MH 3SDDB 4EBQH 1JPFA 3P11H 1CFNA 5BV7H 2X4RB 5I73B 3V52L 4YC2C 1XCQB 3OZ9L 4M3JA 5E8NB 5K9QG 4ZQKA 5L9DH 2UWEB 3O8XD 1HSAB 1TZIA 2YZ1A 2NYYC 4P46D 4WCYL 4P48A 1CBVH 4D2NA 3WN5C 1QQDB 1QHOA 4LSTH 1GHFL 1R3JB 3CGTA 2WBJA 5I71B 3TP4A 3BUYA 5E99L 3QA3A 2H32B 2IPKB 4L29B 3W2DH 3JSSA 4R6UA 4ZOCA 3HPLA 3KXFB 4M5YH 5FV2A 3L5XH 3MJGX 1Z9MA 4PJCA 4JY6A 4XVJL 3BI9X 3HE7B 4YBHA 2CH8A 4RWYL 3MRQB 4KTEL 4D0CB 3NFNB 4LSVL 1G0XA 5A2KH 4ZFFA 3ZDYF 1VSCA 4LHQB 3MRGA 4WWKC 4DZBA 4IS6B 4OUOA 3RU8H 1PQZA 2XTJD 4G42B 4PJ5D 4MXWH 3UYRL 1KN2L 2VXQL 1FL6A 3VFSB 1GZQB 3WS6C 3ZE1F 4YDKH 3EYUL 1R3IH 3OKKB 3R8QA 5JOEA 2KQMA 3QHFL 4Z7QF 3RWCA 4OM0H 3O41B 2YC1B 1V7NL 1P9MA 2DS4A 1OAYH 4TSCH 43CAA 1TTFA 4HV8B 3AC0A 5FGSA 1WVZA 5D6CA 3HI5L 3WNOA 5ERWA 5HI5C 1D5MB 2ZCKL 5IJKC 1V5JA 4MDJB 4FQCL 1LE9B 5GJSL 6CGTA 2O5XL 5LGJB 2DQGL 4HPYH 4XX1G 5C08D 4KXZH 3RWJA 3C9NA 3TEUA 4N5EC 5D1QB 1XEDA 2ZSVA 3DO7B 3RVXC 5KS9F 1U91B 5LXGL 4KI5C 3FO0L 1QP1A 5GRVL 4ETQB 2CK2A 1MF2L 1KCKA 5KG9B 4LDEB 5DHYA 3ZT6A 2AK4E 4MS8C 5MEQA 3MRDB 4WI6A 4E42B 3JWOL 4KH2A 2XKNA 2QR0B 3D0LB 3N0PB 3T8XA 5DJCB 1QRNE 1WBXA 4UU9B 4CVZB 4N9OB 1FDLL 3HN3A 1T5XA 2I9LA 1UYWL 5GJTL 3SDDA 5J89A 4NQXB 2X4RA 1Y6MR 1XCQA 2NY6B 5T1MA 1G7LB 5E8NA 3VMPA 4D3CH 3F6LA 2UWEA 5F72S 1HSAA 4Z7NF 4XMLL 1CGYA 1QQDA 1NAMB 5B39B 2VAJA 1AGEB 1R3JA 3CFJB 4CNIB 2DQJH 2JIXD 3V8CA 2H32A 2IPKA 4L29A 4QHUB 4HK0B 3SDAB 4MA3B 5FOBB 4DVRL 4I2XB 3KXFA 3VDCA 2BJMH 2WZPD 3GIVB 3MLVL 1KCUL 3LN4B 3HE7A 1GIGL 2GQHA 2PYEB 3MRQA 4D0CA 1PGRB 3NFNA 5C9JB 3ESVF 3P0YL 4P4KD 1DBKH 4HG4J 1A7RH 4ODSH 1T03L 3Q1SH 2NTSP 4U2YA 3X3GH 5C0ND 2DM2A 4X0KB 1MCWW 2MCPL 1DQML 4ZFGL 5KZCD 1U8PB 5J3HC 1MFEH 4IS6A 4LHUG 3S35L 2VZ1A 4G42A 3D3VE 3QUZC 2NR6D 1NAKH 3SY0B 4DW2L 1ROWA 1S7UB 3VFSA 1GZQA 3CXHK 3WNLA 2G60L 3P0VH 3OKKA 3S36L 5C8JB 2HN7B 2V9TA 1WFUA 3LIZL 3P73B 5IHUH 1NMCC 2P5EE 5MP6L 2YKLH 1QRKA 35C8H 3ZDZE 3O41A 4U0QB 1E4XL 3AM8C 4F9PC 3T3ME 4WDIA 2HKHH 2YC1A 2YPKB 2X44D 2J5LC 1MJ7H 2EDFA 2P24B 3C5JB 4HV8A 2R2BB 4HKZB 5CS7A 1MELA 5SWSB 4Z76B 4Y4FC 1MREH 4MDJA 5C07B 4AM0B 1LE9A 5LGJA 5F1NB 1GGCL 4BFBD 1ZLWK 2XRAH 4HUXB 3MA7B 1CLZL 1G6RB 3MBEC 4OGZA 4UT9L 1CS6A 1ADQA 1PX4A 25C8L 1IZJA 5EBMB 4Q9RL 1FRGH 1FFPB 4ETQA 3S4SG 3SO3B 1FC1A 4I3SL 5KG9A 3MRDA 4DUVA 5IV2B 4E42A 1RUPL 5C0BD 5KSVB 3BP7B 1X5GA 5AZEL 1ZAGA 2H8PB 3U46B 3QI9C 1H3TA 2QR0A 3D0LA 4Y16A 4P3WA 4XNZC 2IJ0C 4UU9A 5DJCA 3V5HB 4Y8DC 2QKIB 2Y06H 4CVZA 1D5IL 5EWIH 2FGWH 3P4MB 3DYOA 4NQXA 4U7SA 5FXCH 2IAMC 2F19L 2P49B 2F5BL 3ALWA 1G7LA 4BJLA 2ATKB 3OB0H 3UDWA 3QPXH 4DTGL 3EYVA 4N8VG 3F6IA 1NAMA 5B39A 3VXTB 1G9EA 1AGEA 3CFJA 2HP4A 4CNIA 4LLQB 4PJ8B 2GSIB 4ONGL 1MCFA 4QHUA 2W9EH 3HB3C 1WZ1H 4HK0A 4MA3A 4I2XA 2JCCB 4OFDA 2BDNH 4UV7H 5FOBA 5TF0A 4QT5B 3GIVA 3JWOC 4N1HB 5D1ZB 5DXWA 2EICA 1MVUB 3LN4A 2FD6L 2PYEA 4F3FB 3MJ9L 4E41E 3A6OA 5C9JA 2WIIB 1IGML 4XCFL 2DIAA 2ZCHH 3BZFB 4YE4L 5D2NB 4X0KA 1J0KA 2OR7A 5LCVH 1QHPA 2NY3B 1U8PA 5I1LB 1N5YL 2HT3C 3VGAB 4L3AA 3IDJB 1PBYA 3SY0A 2IANE 1S7UA 1A6UL 4YDLB 5IMOB 2X41A 2HN7A 3VXSA 3P73A 2F53B 4EI5B 5MEND 4JRYE 4EOWH 4FQXC 4RSVA 3LKRB 3TH4T 4RMVA 1U2CA 2YPKA 5KAQF 3BW9B 2D7OA 1TLKA 2IAND 3V52H 2P24A 3C5JA 2R2BA 4LLYB 4HKZA 4LHJB 5IHLB 1TVDA 5SWSA 4Z76A 1F4XH 4DK3A 1J10A 5C07A 4AM0A 1E4XI 4JRYD 5F1NA 4ZAKD 1BVZA 8FABB 4HUXA 4WCYH 1UEMA 3MA7A 3GSOB 5JXED 1G6RA 2F54B 1GHFH 3VI4E 1JP5A 1WCQA 3NACL 4XHJD 4B7LA 1BLNB 5HHVL 5E99H 3QBTB 5EBMA 5FGRA 1FG9C 4LGSB 1FL3B 4N90E 1FFPA 1K5NB 4OF5A 3VGBA 3MUY1 2VDPL 4RWYH 4LSVH 5FOJA 5IV2A 3DV6B 5KSVA 3BP7A 2BHUA 5T3XL 5B3NA 2H8PA 2CXGA 3U46A 1WIUA 1IZKA 4LF3B 4OD1L 1Z0MA 2PKDA 4YGAB 1JTTA 3V5HA 2QKIA 5E9DB 4F7TB 3R8BB 1U8HB 1TFHA 4YBQD 3P4MA 3ZHDA 3UYRH 3GSVB 2VXQH 3HNVL 3QWRD 1J5OL 3EYUH 5CSZB 2FDBP 3QHFH 1RIVH 4JPVL 4IRSC 3BH8B 5IFAH 2R1XB 5IF0B 2ATKA 1K8DB 2HH0L 1KFAL 4HCRL 3HI5H 3VXTA 3ZDZF 2ZCKH 1EEUA 4LLQA 4RA3A 4PJ8A 2ZSWB 2GSIA 2O5XH 1FFOB 2QV2A 2DQGH 1J11A 1NGQL 2JCCA 1MCLA 3BVNB 3G6JB 3D69B 1NCNA 1OSZA 4QT5A 5CHNB 1BVKB 3T04D 5D1ZA 3TJHC 1MVUA 4F3FA 4LDLB 4ZO7A 3A67L 1DBAL 4ESKA 5KSAB 2WIIA 5LXGH 3BZFA 3FO0H 1GZPB 5D2NA 5DC9B 4PRIE 2EIDA 5DHXB 4KDVA 1MF2H 2OZ4L 2BX5A 5I1LA 5FK9B 2VQ1B 4M93B 3JWOH 3IDJA 3NCYS 5F6HJ 4X6CB 3V79C 5IMOA 4F37F 4K23H 1VERA 1D5XB 1FYTB 2F53A 3GI8L 4EI5A 4PRID 2J7LA 4WHTB 1XMWA 1FDLH 3RPIB 3O3BB 1IEHA 3ARBD 3LKRA 1UYWH 3R1GL 4M6OL 5FGCE 4JFOB 5FHBL 1I1YB 2WUBL 2AJXL 3BW9A 3HC3L 5GZNC 3PV7A 2NY4B 1EDQA 4Q2ZB 32C2B 4LLYA 1B6DA 4JREB 4JR9L 2FJHB 1QFWM 3AGVA 1NQBA 4XMLH 1DZBA 5A2IH 8FABA 3GSOA 5L6YH 2F54A 4NN6B 4TVPL 2VLLB 4O4YH 1JHKL 1G7HB 1BLNA 1RU9L 4DVRH 4IM8A 3ZTNH 4Y1AB 4I3RL 1K5NA 3BIAX 4GFTB 3MLVH 1JF6A 4JY5L 4U6HB 3VFVB 3AXLB 4RRPA 1GIGH 4YO0A 5I9QB 2OI9C 4PJCE 2JJVA 3DV6A 3P0YH 4ZFZB 3PE9A 1I1FB 1T03H 5ISZB 4PJAB 4WV1C 2MCPH 2WBJD 1DQMH 4ZFGH 3E8UL 5I1EH 2FO1A 1YPZB 3PJSB 5E9DA 3DETD 4F7TA 4OLVL 1U8HA 1A64A 1Z9OA 4BKLB 4DW2H 3GSVA 4MA1B 2G60H 5CSZA 3S36H 3LRGA 3LIZH 5MP6H 2V5YA 5D72L 3BH8A 1MCRA 4GBXB 5HHPB 2R1XA 5IF0A 1K8DA 3K4AA 1X5ZA 3P4NB 1BPVA 1A7OL 4KK8D 4KFZC 1GGCH 1I8KB 1FFOA 2YD5A 3GMRA 3BVNA 3G6JA 1CI5A 4NO2B 3D69A 3ARGB 1BVKA 1JGLL 5F7YC 2X05A 1EFXB 2CDEB 4WNQB 5SV3A 3VRJB 5HYQB 25C8H 2MHAB 5KSAA 4Q9RH 2AABH 1GZPA 2I25N 1RUQL 3VI4F 1RPQA 1T04B 4I3SH 5FK9A 2VQ1A 1AD9B 1RUPH 5AZEH 3W9DB 1N0XL 2FX9L 4X6CA 3TT1L 5GISH 3QIUB 3U2SB 4RCAA 1D5XA 1FYTA 3TZVC 4I77L 4WHTA 3RPIA 3O3BA 1M7DB 4MMXC 1A9EB 5ENWB 3UAJD 3E2HB 3GK8L 4JFOA 1I1YA 4Z0XB 1G9NC 1C5BL 4Q2ZA 2AXFA 5D5ME 2F5BH 4R97C 4Z9KB 4BUHA 2W0FB 4EJ1C 2FJHA 3T0XA 4RBPH 3W5NA 2X89A 4NSKB 2AQ2A 1LO4L 2EDBA 3HHRB 4ONFH 4QKXB 3Q5YA 5D7JC 3GZKA 1KPRA 4JPWL 1G7HA 3PL6B 5I1KL 5IROC 2AJUL 1SVCP 1RK0B 5IVXB 4FQIL 1T7ZA 4Y1AA 2Z93A 3KXFE 4KTYA 2WWMD 4U6HA 3BJLA 3AXLA 3VFVA 2FD6H 3VWJC 1LEIB 3MJ9H 4XNXH 3E6HB 3ZKXC 4ZFZA 1RURL 1I1FA 4EQ2A 5ISZA 4XCFH 1IGMH 1X5JA 4PJAA 4YE4H 4POYA 4M7KL 1A6PA 1N5YH 3TLRA 1YPZA 3PJSA 1NBQA 5I8OH 1UADC 3MV7E 5LVEA 3KXFD 5E1HB 4WW2B 1U8NB 5FHAL 4NJAL 4BKLA 3BPOC 5ICXB 1RIUH 3HE7D 4MJ5B 1I3GL 5F3BB 3WIHL 1CF8L 1QR1B 4BYHA 2AEIT 4K7PL 3QG6B 1UACL 1V3JA 4OM1L 3PWPB 5HHPA 2CUMA 4KKCC 4WI7A 1Q9OB 4PJIB 2NZ9D 2VZ3A 4ZTOL 4ODVL 3OWEA 1I8KA 2VAAB 2HT2C 1J9CT 4NO2A 3UO1L 3ARGA 1FZKB 4D9RE 4LIQE 1EFXA 3NACH 2CDEA 4WNQA 3VRJA 5HYQA 5HHVH 4K3HA 1UJ3B 2MHAA 3KHOA 3VFNB 1T04A 3BJ91 4UNTA 3BMVA 2VDPH 2R1WB 3KPLB 4HJJL 1AD9A 2OYPA 1FJ1A 1MCEA 3W9DA 3WFBL 3DTXB 2H2PD 3PGCB 2VL5B 3QIUA 5I16B 3C2AL 4OD1H 5D1QD 1JF5A 5CBEB 4L5FL 4KUCD 4PJCF 1ZVSA 3UC0L 4OGAC 1M7DA 1A9EA 3HNVH 1J5OH 1F6FB 4Z0XA 1P4LB 5BZDB 4QOKE 4KHTL 1BVLB 3LH2L 2XA8H 2W0FA 1DANU 1AQDB 5IG7A 1P5UA 4NQDE 3F65A 1YEEH 3EDDA 2D7PA 4GKNB 5JW4N 1KFAH 1IFHL 4HCRH 1CT8B 2YA2A 3VFWB 4P57A 2LVEA 4M7LH 3PL6A 3RX5A 4GQ9L 2XWBB 5EZOL 3SE9H 1RK0A 1GH7A 2OL3L 3IDGB 5IVXA 4P59L 2FEEL 3IS1X 4I2XE 1LEIA 5ADPL 2Z35B 3BH9B 3E6HA 5EU3B 1DBAH 2MWCA 5L0QB 4CU8A 4F15C 1YMHA 1HHHB 2OZ4H 3V5DB 1FNLA 3SDAD 1U8NA 1HHKB 3HMWL 5ICXA 3LB6D 4ELMB 4MJ5A 2W9LA 1BWWA 5F3BA 3B83A 1QR1A 2B39A 4HJ0D 4P49A 1P1ZB 3QG6A 3VE0B 3PWPA 3R1GH 4OCSL 3NGBB 1I9IL 1OAQL 2AEQL 1N0LA 2AJXH 3ROLB 1VFUA 1J1PL 1Q9OA 3IDMB 1GAFL 4PJIA 3RTQC 5ID0B 3PWVB 3BDXA 4N0YL 5B4MC 1NGYB 4JR9H 3ARQA 5CEZD 4YHMH 1CICD 5I75B 3AREB 5C07E 4PG2A 2VAAA 2BY3A 5D5MF 5JOPD 3P9LB 3SN6N 4TVPH 1FZKA 4TQEL 2YWYA 1JHKH 2L4OA 1H8SA 5F9AC 2OR9L 3S96B 1RU9H 1UJ3A 2YD8A 5FCSH 5SWSD 3VFNA 3TO2B 1EMTL 2X4TB 4I3RH 1UH4A 5C07D 4OQTL 1WBZA 4JY5H 3VWKB 1WK0A 3LQMA 4JFXB 2R1WA 4U6VL 1J8HB 5TF1H 4NN7C 1FIEA 2DI7A 4HMCA 1J1XL 5JMRA 2V7NB 3DTXA 3PGCA 2J6EL 4YX2H 5I16A 5JHDA 4YEEA 4H1LB 4YZFE 1INEL 5JLZA 2XZQL 4L8CA 4WIQA 4XVTL 4U7KA 4P23C 3P4LA 3KPOB 3CSYB 1S78D 2O5YH 3U0TB 4XHQA 1P4LA 2APWA 5BZDA 5KTEL 4QGTA 1X5HA 2FLRT 5SWQB 3FZUD 1BVLA 3WE6B 5D72H 1JGUL 1RZFH 1AQDA 1IARB 4HC1A 1OP3H 4GKNA 4KRLB 2K7PA 2VB5A 1BMGA 1ZA3B 2XZAL 3ARVA 1CT8A 3FOMB 3VFWA 1T66C 4NHUB 1ITBB 2X1WL 4XWOC 4HULB 5JORB 5M7QA 3IDGA 2J4WL 2R2CA 1G0DA 1JGLH 1U8JB 1SBBA 2Z35A 4DGYL 3ABZA 3GNML 5EU3A 1Q9WA 1ZT1B 4K71B 5JNYB 4X6DE 2QADB 3RBSA 2DQHL 3BEVB 1MJJB 2DKUA 1HHHA 4LOUD 4PJ8D 3V5DA 2FEEI 4LSUH 4BSWB 1SBSL 2UZYB 5E95B 4G6KL 1HHKA 1N0XH 1BZ7B 1W2KT 4KUCF 3TN0B 4ELMA 5D1ZD 3TT1H 4KDTA 1U3HC 3KLAB 3MV8E 4I77H 3NCFB 2F53E 4XCCL 1P1ZA 3TH3T 5H2BB 3RAJL 1YC7A 4QWWC 3MOAL 1DVFC 4LAQL 4D94A 2NY3D 4XNMB 3ROLA 3CFBB 1C5BH 3IDMA 5ID0A 1WAAE 3PWVA 3MUGB 1NGYA 2WBWB 1ZANL 2A6IA 2YUZA 1KJMB 2F53D 3AREA 1GL4B 4OUUB 4RMTA 4HUMB 4Y19B 4EI5D 1LO4H 2XXCB 3DBXB 1QPPA 2V7HB 4C83B 3WHXB 3GIZL 4JPWH 2F54E 2X4UB 4B7IA 4LK4A 3S96A 5I1KH 5E2JA 1U95B 1HK6A 2AJUH 3EFFB 2L0DA 4KKAD 3TO2A 3V7AG 4L3CB 4FQIH 2X4TA 4U3XA 1HI6B 3U6RB 2Z31B 4P2CG 3VWKA 4ETYA 4JFXA 1J8HA 4IRZL 3KYNB 2F54D 4KI5E 3FB7B 2V7NA 4MHHI 4KK9D 1IGJB 1VA9A 4GAYB 4H1LA 4XX1E 4JZJC 2NNAB 5FHAH 3B9EA 4NJAH 3KPOA 3CSYA 3U0TA 1CLOH 5EIVA 2PXYB 2VO5A 3ROOA 5SWQA 2OK0L 3WIHH 4HGKC 1CF8H 1OPGL 2CKNA 3OAZK 5DQDH 3WE6A 4BA8A 4WI9A 4K7PH 4PJEB 1UACH 4V2BA 1RUAL 4OM1H 3QDMB 1MCBA 3L3IB 2XT1B 3OKLB 4MXQC 3B5GA 2R0KH 3RX8A 1KNOB 5E9DD 4HEPG 1V05A 1ZA3A 3HAEG 4ACPA 3FOMA 2C3HA 3RUGE 1IE5A 5D7IE 1RUKL 2OMNA 4ZTOH 1F4HA 4NHUA 4ODVH 3OAUL 5JORA 2HFTA 4LKCB 1DDHB 3UO1H 1F6AB 2YHGA 3QULB 1HE7A 3QFDA 5CSGA 3RY6A 1AP2B 2XQYK 1P84K 1CXHA 1ZT1A 3QUXB 1MCCA 5JNYA 2XV6B 4ODWB 1MAKA 1MJJA 4BSWA 1F42A 5F96L 3FAXA 4HJJH 4DEPB 3SDXB 4ZUWB 3RY4A 1T0NB 3WFBH 1BZ7A 3TN0A 3ZE0F 5E8DL 1HN1A 3C2AH 2VLKB 3KLAA 4L5FH 2QHLA 3AY4A 1HSBB 3TO4C 5KSAD 3SBWA 3UC0H 3VFOA 3K8KA 5H2BA 5AUMB 4XNMA 1NL0L 3ILPB 3CFBA 3VMNA 4KHTH 1N3NB 4YZFF 4KK5D 3MUGA 1FFRA 4X5WA 4KJWC 5DRZA 1LO0H 1WLHA 1KJMA 1FYTD 4OUUA 4Y19A 5F9DC 4DKAA 4JO4L 1IFHH 5JPMB 2ESVE 2AJZB 4NCC2 3DBXA 3GM0A 2V7HA 4C83A 1FO0L 3FRPA 1T83C 3GB7B 2NY4D 3GSRB 4MQXC 1U95A 4GQ9H 3EFFA 4J3VA 2OL3H 3ISWA 1Q8MA 1NFKA 1NEZG 3F5WB 4P59H 1MCSA 4G8EB 3CSGA 1HI6A 3U6RA 2EEDA 2Z31A 1RZKL 2X89D 2FLBT 4NO0B 5ADPH 1KT2B 4F9LA 3KYNA 5ACMA 2VYRE 3GMQB 3N9GL 1RZ8B 4OLZL 5ISZE 1EEQA 5EOQL 1IGJA 4PJAE 4GAYA 1A7QL 3PG2A 1RVFL 4U31A 1FFNB 3LKSB 4ZFOL 2NNAA 1EHLL 3HMWH 3QIWC 2UZXB 4OTXL 3KVQA 4P2RE 2CUHA 4X6DF 2EE6A 3CCHB 2PXYA 4Y5XB 4JEGB 1A4JB 3JZ7A 5ISZD 3PDOB 1UWXK 2YXMA 2P5WE 1G7QB 4PJEA 5JQ6L 3QDMA 2YUWA 3OKEB 4PR5B 1OAQH 2AEQH 2BSED 3DVFA 3L3IA 3OKLA 4MAYB 3WCYA 1B0RB 1KNOA 3OJDB 1J1PH 1GAFH 4F8TA 4X6EB 1ZHKB 1XAUA 4N0YH 4RGNC 1J12A 1EUUA 4Y4KC 2P5WD 3KJ4C 1QUNA 4UDTB 4EKXA 3FQXA 2P44B 1DDHA 4LKCA 1F6AA 3KHQA 3QULA 4GBXD 4UBDC 3VFRB 4TQEH 4AQ1B 3PP4L 3SDCC 4OIIL 1WUNT 4ODUB 4PJGE 4OIBA 3O45B 2P45B 1INDL 5IFJA 3BD5A 2P42B 4MZ3A 5DZNA 4ODWA 4OQTH 5D93C 2EC8A 2BSTB 4U6VH 3C2SA 4OFVA 1E4KA 4U2ZA 5E1AB 4ZUWA 4H8WC 3ARGD 1J1XH 1T0NA 5DRNB 2H3NB 2J6EH 4NJ9L 1EFXD 4JHAH 2R69L 1VGKB 4H5SB 3HAEH 2VLKA 1INEH 1HSBA 2XZQH 3BMWA 5A1AA 5C6PB 3TPUB 4XVTH 2G2RB 4P5TC 1EV2E 5AUMA 3P0GB 5J1AA 5KTEH 3ILPA 1FYHB 4GRWB 2R29L 4FTVB 3MC0A 4KJQC 4YAQB 2ZOLB 1JGUH 2PO6B 3QIUD 5GGSB 1FAIH 2BOBB 2GAZA 1WISA 5JPMA 3FFCE 2AJZA 4RA0C 4GAJH 3MROB 5DJ0B 4N0CD 2D4DA 3GB7A 3GSRA 1P6FA 1H3GA 1A7PH 3CZJA 5LBSL 2GW5A 5DVKA 2J4WH 4KVCL 1I85A 3F5WA 2C3WA 4G8EA 5D7IF 4NO0A 1KXQE 4DGYH 1KT2A 1TPXB 3GNMH 4W6XB 1YNLH 3UZVB 3GMQA 3TA3B 1RZ8A 1HILB 3G6JF 1WZLA 3PL6D 1ZSDB 1SBSH 1FFNA 3P9WB 4G6KH 3LKSA 1JNHA 5INDB 4J3XA 2A74B 4KMQA 1H3PL 1S7WB 4KJYB 1YMME 5MEOB 2IPUK 4NQSB 2R9HD 3MJ7B 1A4JA 3PDOA 2J88L 4XCCH 3QZWG 1G7QA 4UTAL 2EDRA 3WJLA 3RAJH 1LVEA 3OKEA 3TM6A 4PR5A 3MOAH 4LAQH 4J3SA 1IGTB 3KAAA 4MAYA 4X6CF 1B0RA 3OJDA 3K4ZA 3PWPE 4PS4L 1ZHKA 4X6EA 3WFZA 2EDKA 4AEIL 1ZANH 3K81A 1QSZA 2B2XH 2ERJC 1LWRA 4UDTA 4ZG1A 1TMCB 1IMHC 3PWPD 3DWTA 4CVWA 5B3JE 4K8RC 3DO3A 4W81A 3HNTL 3IAQA 4CN1A 4ODUA 3O45A 5GQBA 1SJEB 3MUHL 1CK0L 1FC2D 5E4IA 4F7EB 2D7TL 3NCYP 3QUYC 2J12B 5EN2B 2CRZA 5E6IB 3MV01 2BSTA 2XFXB 1JTPA 4IRZH 1JTOA 5HPMB 5E1AA 1T3FB 4PY7B 3OJVC 2IQ9H 2Y23A 5DRNA 2H3NA 4LQ1A 1VGKA 1WGOA 4H5SA 4JG1L 4XTRD 5KANI 4M6AA 4BELD 1P5VA 3TPUA 1NBYB 2G2RA 2VXVL 5KVGH 1O5DT 5DD1L 3WXVL 4YR6B 4TNVF 4PJAF 4YXKL 3O0RL 3BGFC 4FTVA 1OPGH 4YAQA 2ZOLA 2APXA 5C0JA 2PO6A 5E24E 5GGSA 1OF2B 2D9QB 2BOBA 1MY7A 4BH8B 1XIWC 2JJTA 5KVDL 1CFSB 2MOVA 3KLHD 2WWKO 3MROA 5DJ0A 1TQCC 3OAUH 1KACB 3QEQB 4O9HL 1HCFX 2G5BB 2E9BA 1EO7A 2WQ8A 5DUML 2PTTB 1BF8A 1SEBB 2KDGA 2HVKA 2KZWA 4S1RL 2VMFA 3TA3A 3V6OC 4PIRF 1ZSDA 2R4RL 3CSBA 4NO3B 1IGYB 5F96H 5FGBA 5INDA 4WI5A 4PJGF 2A74A 1S7WA 2OXGA 2EO9A 5E8DH 5MEOA 4NC0B 1UA6L 2YR3A 4NQSA 1U41A 3MJ7A 5C0GB 2VZOA 4I4WB 2EE2A 1RJYB 1X3DA 1QKZH 2M8XA 4MSWB 4QRSB 3PUCA 2BVQB 1IGTA 1NL0H 1W8OA 4Y2DB 4WY7L 2BRRL 5MI0C 1OAKL 5JXAH 2ARJA 3VFGL 3WD5H 5C0IB 5B8CB 1X5XA 4OZGB 4JO4H 4CN6A 2ZKHL 2W92A 5I8CB 3UBXB 1JVKA 2VLRB 1KN4L 5I1GL 2X6MA 4U05A 1C16B 5FF6B 5FUOL 3L3KA 4UV4L 1SJEA 3S3JA 5GGUB 4F7EA 1KIUA 5T3XE 4HF5L 1DUZB 5E6IA 2XFXA 2F58L 3ARED 2WANA 1LEGB 3RGVC 3QUML 3RGHA 1ZGLB 5GS3A 4WUKH 5HPMA 1T3FA 4PY7A 3N9GH 4K8RH 4OLZH 5E70A 5EOQH 5F7WC 1A7QH 1RVFH 5T3XD 4WUUB 4HBCL 2ICES 4R0LB 1NBYA 1EHLH 1ES0B 1R0AL 4XT1C 2YN3A 3EOBB 4OTXH 2X4OB 5DVOA 7CGTA 4YR6A 3VWKD 1Z2KA 1PSKL 1WTGT 1I9JL 4KKBC 1J8HD 5L2JB 1YEIL 1FVDB 1R6VA 4JHBA 1ERNA 3N1PC 1RFDL 5JA9A 3GBLA 5JQ6H 1OF2A 5C0CE 4HH8A 3MLSL 4WW2F 4YHPB 4Z7UB 4BH8A 4JKMA 2X1QA 1PZUB 1LGVA 2FBJL 1CFSA 2VSDA 1UC6A 3J8F7 1M05A 3EZJB 1IC7L 5HYFA 3QWOB 3WHE1 3HI1B 3QEQA 4JDZB 5C0CD 4XI5C 1QSFE 2CR3A 2G5BA 2V5MA 3RZWA 1C8PA 2PTTA 3PP4H 4YLQT 4OIIH 1INDH 1CXFA 5DHVB 3MO1B 1X4XA 4UOW0 1ED3B 5B3JF 5CEYB 3SJVB 4NO3A 5HD8C 4YHOL 5DEFB 5FECB 4BQCA 1S7XB 3FN0L 3UP1A 1FNSL 4NJ9H 2YA0A 1PJ9A 4HKBB 2R69H 3QB7C 1T22B 5IVNA 2GSGB 3HG1B 5C0GA 4I4WA 1RJYA 3GSWA 2QADD 4MSWA 4QRSA 1IM9A 2EIEA 2BVYA 3O4OB 4P5MB 1BEYL 1TETL 1CCZA 2BVQA 4TSAH 4Y2DA 3HI6L 2YK1L 2R29H 2UYLB 1F00I 5GZOC 1I1AC 2ICWJ 3TN0D 1FO0B 4G6AD 2DQIL 4TVPE 5B8CA 5C0IA 4TOYL 2XI9A 4MD4B 4XP6H 3CDYA 4PJ9C 3WEXB 5K9JH 1KG0B 4OZGA 5SWZA 5L2KE 4JVUA 2B1AL 3UBXA 2VLRA 2MKLC 1GSMA 2ZUWA 1JPTL 1C16A 3R4DA 5FF6A 4IMKA 5LBSH 1GPOL 4NN5B 1FVEB 4PRBB 4TVPD 4HD9A 5GGUA 3QQ3B 1AXTL 1LP9B 1DUZA 2J3SA 1WBYB 1CXIA 4Y19D 3MOQA 1ZGLA 3K0WA 5IVOA 1N8ZB 1BJ1H 2N56A 1F4WL 3RDTC 3BGMB 1X6NA 1KXTB 4WUUA 5I8EB 4R0LA 4XB7A 3C6LC 3QCTL 1ES0A 1H3PH 2AI0H 3EOBA 4NWUL 2X4OA 1CTNA 3DJ9A 2Z31D 1YYLL 5IBTL 2R56H 5FYKH 5L2JA 5FYKU 1FVDA 5HVGB 2GJJA 4UDUB 3T0VA 2J88H 2YD2A 4UTAH 3BZ4B 3PIQB 1FZJB 1E6JL 3D87B 3NTCL 4YHPA 4PJEE 4ELMF 4Z7UA 3F7YA 3QUZB 2WUCL 2DD8L 5GSRB 3LMJL 4LFHD 2AXHA 5HI3D 2PXYD 2AS5M 4U6XB 4ZTPL 3QWOA 3HI1A 2CK0H 4JDZA 4PTUB 5I8KL 4LLVB 4EEEA 3QDMD 2Z8WC 3NFSL 5CJQL 2ARWA 4EUPG 3WNPA 3EHBD 1CD1B 1T89C 3HNTH 3E6FA 5DHVA 3GGWB 3MO1A 5EUOB 1CK0H 5J56B 1JZ7A 1FFQA 1I7TB 4IJ3B 3LSOB 1ED3A 1XGRB 2DWDB 2QHRL 3HMXL 4LPVA 5CEYA 5DEFA 5FECA 3WFDL 1FN4B 2DL2A 4OCXL 3S3SA 1S7XA 1T80A 1KTDB 4JFZL 3SDXE 4J12A 3V2AR 4HKBA 5DVLA 1XCTB 4JG1H 4NCC1 1T22A 4L4VB 3IFPB 2GSGA 3HG1A 2CO6B 2VABB 1A6TB 1YDPB 3QUXD 2VLKE 2VXVH 3MLYL 4P5MA 5DD1H 5EBWB 1EIBA 3OB0K 2ORBL 2EYTB 3PNWB 2HG5B 3QI9B 2DAVA 2UYLA 2VIRB 5CZXD 1FO0A 5TE6H 3RIAF 4R3SA 3BFOA 4XNZB 4MD4A 2VLKD 2APBA 3WEXA 1KG0A 5BRZB 3AS1A 4OZHB 4P2OC 5GS0D 5KVDH 3S4SB 3I6KB 4Y4HC 2P46B 1EHXA 1K85A 5HHXL 3ZKNC 2F5AL 1ZHNB 4YFDB 4PRBA 1FVEA 4O9HH 2VWEE 4XPBL 3QQ3A 1OAUL 1LP9A 4XMPH 4PP1C 3ARUA 4OT1L 5DUMH 4HXBH 4NRZB 3H2WA 2HLAB 2GK0B 4S1RH 3MA9H 1MQKL 3EYSL 3O2WL 2B8OT 3DX9B 4QRPB 3BGMA 5I8EA 2H6PB 3LPGA 1CDYA 3HZYB 3GEWB 5F7KC 3LRSB 2Y07L 2BERA 4PRPB 3S5LG 4N8VB 2BVEA 4NO0D 1UA6H 1AXIB 5HDQL 3UCRA 4UDUA 4HGWB 4HLZG 4QNPE 3BZ4A 3MLZL 3PIQA 3ARYA 1FZJA 1K4CB 1PYWB 1H8OA 4RMRA 3HZVB 3QUZA 4WY7H 2BRRH 1FBIL 1D5ZB 1OAKH 4PGJA 5GSRA 2OJZL 1QFWH 2J8UE 3GSUB 3VFGH 1LNUB 1F90H 3HKFA 2DLGA 4U6XA 4F9PA 3AM8A 2YWZA 4PTUA 4OGXH 2ZKHH 4LLVA 2DTSA 4H25B 5CD5C 1EHAA 5SV4A 5C0FB 1KN4H 2JJWA 3FO9B 5I1GH 2X9XA 1IAMA 5T5NG 1CD1A 2L7JA 5FUOH 4UV4H 1KCLA 3L9RB 3GGWA 5EUOA 3F7VB 4Q6YA 1I7TA 4HF5H 2VLJB 2DQDL 3LSOA 1XGRA 2DWDA 5GHWL 2F58H 5D7LB 3NAAL 4ZS7L 3QUMH 4I0KA 1FN4A 4J6RH 2Y36L 4G5ZH 3KS0J 1UM5L 2X40A 2C3XA 3MCLL 4JQVC 5GXBB 1A21A 1XCTA 4L4VA 4HBCH 2VABA 1A6TA 1BBDL 1YDPA 1R0AH 2VDKL 1K3ZA 5EBWA 3VD7A 1FZOB 2EH7L 1WSST 1PSKH 1I9JH 2EYTA 3PNWA 5HHNB 1YEIH 2HG5A 3OV6A 3QI9A 4KRPB 2VIRA 4V2CB 2IBZX 2X4NB 4FTVE 4KKNA 3TVMC 3MLSH 5BRZA 4OZHA 1PKQB 3LV3B 5E8PB 3S4SA 2FBJH 3I6KA 4KUZH 2MPAL 2D0GA 2E8YA 4PJEF 1IC7H 2I27N 1VGEH 5DR5L 1ZHNA 4FTVD 4IRSB 1M7IB 2PO6D 1N7MH 3M8OL 5TDOB 4NRZA 2HLAA 2GK0A 3H3BC 3H9HB 4UI2A 1UM6H 3BAEL 1P7KA 1TNMA 1GC1L 2R15A 2EDTA 4PLJD 5DK3A 4NP4L 3DX9A 2B5IB 3CUPB 2YD7A 4QRPA 4YHOH 2H6PA 5DT1L 3UPCA 3W11D 4MX7B 3CX5K 5EOCL 3LRSA 3VW3L 2W07A 1MAML 3WLBB 2VLMD 4PRPA 3BWAB 1FNSH 4N8VA 5AWNL 5EBGA 4WEMB 3TIDB 3EGSB 5DJZB 1HNFA 4XH2B 3QWQB 4N0UE 4HGWA 3TA3D 3JWNC 1VEMA 3SDXF 2DKSA 1BEYH 1K4CA 1TETH 1PYWA 3AS2A 3HZVA 3HI6H 1K2DB 2YK1H 1D5ZA 4G6FB 1QEWB 4KGJA 2APTA 1NDGB 2DQIH 3GSUA 3K46A 1LNUA 4TOYH 4X7TB 4ZOBA 4GMSL 5CGYD 4O58L 4RDQF 3DECA 2A0LC 4XVUD 1KYOK 3VH8G 2EDEA 1F3DH 2WQRA 4H25A 1JHTB 5C0FA 5GGRB 3FO9A 1BQHG 3LPWA 1JPTH 2QTEA 4NOBA 4WEBL 4WO4C 3NZHL 3OHXB 3L9RA 3PWLB 3F7VA 2I9TB 4RIRB 1AXTH 2VLJA 4RAUB 4ZXBB 1S9YB 5AYUL 5D7LA 4PRHB 3P3YA 4HLZH 15C8L 2ZPKH 1CDCA 4LPUA 3VCLB 5DYOB 1E4JA 3OGOE 4LAJH 1F4WH 1KCRH 3V0VB 4H0GA 4U1IB 5D2LA 4KK6C 2Y7QB 3QCTH 3HE6D 3MXVL 2OI9B 4Q7DA 1FZOA 5IBTH 5HHNA 3HNSL 4DGIL 4WV1B 2X4NA 3ETBF 3MLXL 1E6JH 2Q6WB 4IDJL 4LMQI 1KULA 3FN9A 4X9HA 1PKQA 4XNQB 3LV3A 2FHCA 5J11C 3WIFB 2DD8H 1ZV5A 3LMJH 4QNPF 3ZYIA 2I5YL 4R4NC 4ZTPH 1L7IL 4IRSA 3THML 5I8KH 3GSNL 2DQUL 3GHEH 5D1XC 2YN5A 4HXAL 3NFSH 5CJQH 1GVIA 5TDOA 3GFUA 4WTXA 4XXCA 3H9HA 2VDOL 1KC5H 1UB5B 5ANME 3JUYA 4HT1L 4AK1A 1BM3H 1OQXA 2CDGB 2QHRH 4GS7C 3HMXH 5EFIB 1RJZB 3CUPA 3NCMA 4MD0B 3QEQD 3WFDH 3B9KB 4MX7A 4OCXH 5D8JH 4FG6D 3WLBA 3BWAA 1HOCA 2VXUL 4JFZH 4UINH 1VESA 3RWIB 4RNRB 3TIDA 2FEDC 3EGSA 5DJZA 1Q9KB 4XH2A 5DMGD 4XMKL 3FQTB 2VDLL 3MLYH 4TTDD 5DDHA 4MGXA 3T0EE 4KTDL 1OB1B 2ORBH 3DUHA 1K2DA 4BSVA 1OD7A 4FQ2L 1NDGA 3O81A 3SGKC 3TZVB 4X7TA 4U1KA 3UTPE 3QDGB 3WO4B 3MOBL 4RGNE 4HUWB 1JHTA 4C59B 5HHXH 4Y2DD 4JRWA 4XWGL 4QHNB 3GRWL 4XPAL 3OHXA 3PWLA 4XPBH 3NCEB 2I9TA 4RIRA 1OAUH 4RAUA 3UTPD 4ZXBA 1S9YA 4OT1H 4DZ8A 4PRHA 5AAWA 2RFXB 5F44A 3DOSA 4JFQB 1G0YR 3MJ6A 3VCLA 1VKXB 3O8XC 2VLRD 1MQKH 3EYSH 3VDBA 5DYOA 1S5HB 5E4EB 3MMEA 3V0VA 4P46C 3O2WH 4U1IA 3DV4A 2VXSL 3G6AB 2Y7QA 3QHTC 1OW0A 4IRJB 5ESVB 5D96C 2Y07H 2ILLA 3VWJB 5ID1B 2NYYD 1NKOA 1TCMA 1VFMA 5DF0A 3T0BA 1BD2E 5HDQH 4IOSD 4WV1A 3FFDA 1F13A 1U42A 4DOHB 3BPLC 2Q6WA 1JZ8A 2RR3A 3CFEB 4WUUD 5I6XB 3QAZB 1J87A 4XNQA 4LP5A 1MUJB 3BPNB 2A6KB 3WIFA 2X2YA 3TF7C 1JWUB 5DGQA 1I7RB 1EGJL 2XTJC 1IEBB 1FQ9C 1DEEB 3SCMD 4EDWH 3INUL 5CKAA 5F9JB 3JVGA 1EAPB 5CIPH 1UB5A 3HUJE 3L1OL 3QEUB 1FORL 5I30L 3FO1B 4BQ8A 1B2WL 4PGCB 2CDGA 4CU6A 5GHWH 5EFIA 1RJZA 4MD0A 3GJFB 4ZS7H 1G84A 3B9KA 1RZJC 1WQVT 5J12C 3SJVE 2Y36H 5I0DA 1UM5H 3MCLH 3G9VA 3RWIA 4TNWF 4RNRA 1G1YA 4KQ4L 1Q9KA 1BBDH 4LCYB 5F70A 3FQTA 2VDKH 3IXTB 2A1WL 3SJVD 5KSBA 1OB1A 4UILL 1HKFA 1QLEL 5GS1B 4K3EL 4N5ED 3NPZB 4YXHH 3PHOB 4P3CH 4TSBL 3TZVA 1JRHH 4ZS6D 3HG1D 3QDGA 5DUBB 2LTQC 5KAQG 4HUWA 2MPAH 3S7GA 1C5CL 3MLPA 3QHZL 3WUWG 4QHNA 1U0QA 5DR5H 3HCVB 1EX0A 5AAMA 3M8OH 1DL7L 4XBGB 3DHMA 5EUKB 1C1EL 2RFXA 4JFQA 3LD8C 3D25A 4GG8B 3BAEH 1S7VB 2ATPB 2E5EA 2FHFA 1Q0XL 1S5HA 4NP4H 5IROA 3U48A 3QT2A 3G6AA 4IRJA 5DT1H 2ARJQ 5ESVA 1KJVB 5EOCH 1G9ML 2G5RA 2Q8BL 3VWJA 5ID1A 4DJMA 5AWNH 4UZGA 2F8XC 4OZFB 4ZODA 4F15B 5IHBA 4AEFA 4R4FL 5J13C 2D0FA 3IU4L 2LAAA 3SQBA 4M02A 3CFEA 5CP3A 2E7CA 5C0NC 2A6KA 1LE5B 2EEAA 5DC0A 3I6GB 1JWUA 5DD0L 1JI1A 1I7RA 4GMSH 1T5WA 4O58H 4HBQA 5DMIL 2APVA 1CU4L 1IEBA 1I1CA 4M00A 3MNVB 1DEEA 4NHCL 3CC5A 4JQIL 4LGRB 4RFNC 4WEBH 4LEOB 3NZHH 5F9JA 3GJFK 2PYFB 2XIDA 1EAPA 4PUBL 4DKEL 4TTGA 4F57L 1A7NL 3ZE2E 2DLHA 1T6WA 3QQ9D 3FO1A 1IRAY 4JDTH 4PGCA 5EUOE 5AYUH 1UXWB 5I19L 4KPHH 3GJFA 5A2FA 5DGRA 3LN5B 3MNWB 4NNPH 2VSCA 4LP4A 3RWDB 3RKDD 5FM5M 2ZZUT 3B2UD 4P2QB 4Y5VC 5EDXA 4HKJB 4XP9L 5CSBA 4ODXB 3BP6B 4LCYA 4OZ4B 3IXTA 3MXVH 4NN7B 1OP3K 1M7XA 2YBRB 1IJ9A 3HNSH 3DRTB 4DGIH 4NYLB 5FO9B 5GS1A 2VN7A 3MLXH 3PHOA 1MCJA 4IDJH 4L4VD 4RGMB 4QHLB 3NOIA 4UT7L 2XOTA 5DUBA 4P23B 2XQBL 4OZHE 2R1YA 4PRDB 4JFDB 2DICA 5JZ7C 3VXRB 2I5YH 5IHZB 1PDKA 1L7IH 1L0YA 3HCVA 3PP3H 1JMZA 3GSNH 2DQUH 4NDMB 4HXAH 4UB0H 4XBGA 5EUKA 1A9BB 4ZSOB 1SY6L 5CEXB 3PGFL 5BRZD 4GG8A 1C7TA 2VDOH 5I1DB 1S7VA 2ATPA 2KZ1B 5DD6B 5IB2B 4HT1H 1IGCL 3V0WH 5JUEL 4FFYL 1W72B 2JKXA 2D7MA 3KPQB 3VA2C 4R4BB 3QRFM 1KJVA 4J1UB 2VXUH 3HC0B 4OZFA 5C6TL 3LKNB 1MHHB 4NRXA 5E56A 1RZIB 1L0XA 4XMKH 1NUFA 2VDLH 1FNFA 1F4AA 4NQCE 3DUSB 4KTDH 4QRPD 3V6FB 1JZ6A 5FYJD 1LE5A 5F3HB 1U3HB 3I6GA 3EDJA 3HFML 4N0FB 3MOBH 1DVFB 1I7ZB 3MNVA 1PEZA 3IJHB 1N5AB 3UTZB 4LEOA 4XWGH 2PYFA 3GRWH 4XPAH 4WFHE 3LKPB 1LK3L 4N1EA 2NXYB 1IL1B 1I8LC 1SJHB 1UXWA 3NIGE 4TYUA 3UMTA 4L8SC 4MNGE 3WUZA 4CBPA 3LN5A 3MNWA 3DI2B 1YYML 1BP3B 4Q6IC 3RWDA 3KPTA 3WIIL 3L5JA 4P2QA 4MNQE 4PRAB 1DTUA 4WFHD 4HKJA 5JXEC 4U1MB 4GXVL 4ODXA 3BP6A 3ORJA 4OZ4A 2VLJD 3MODL 4XCNB 2YD3A 4XHJC 4Z7WE 2IMMA 3UEZA 3B5TA 5D7LD 1DUYB 1JYWA 2YBRA 3DRTA 4NYLA 3Q48A 4K94C 5FO9A 2A77L 5E8OA 1E0OB 4P2YA 3RVVD 4JZJB 2I24N 5FA3B 3OKOA 4QHLA 3DPBA 5I1HH 5E08L 3WFHB 4P23A 1FNAA 4R2GB 1PKQE 4PRDA 2O93L 1RK1B 5C71A 3FQRB 4JFDA 3VXRA 1EGJH 4W4NA 5IHZA 2E6PA 3JTSB 4KRPD 4X4ME 2DKMA 2JK5B 4NDMA 2XKSA 4ZSOA 4QRTB 5CEXA 1OP5K 1CQKA 1TJIL 3MRMB 5D7SL 5I1DA 3L1OH 3BSZL 5DD6A 5IB2A 5T1DH 1FORH 4WFEE 5I30H 4UAOB 1CXKA 1B2WH 4FN0A 2W91A 2D7QA 4LNRB 1W72A 3LKQB 3KPQA 1KCSH 2K1MA 4IRSD 4R4BA 1VEPA 1XZ0B 3ZE2F 1MY5A 4X7SL 4J1UA 1BZ9B 1BFOB 1KEML 5EUOF 3HC0A 2YD4A 4LEXH 3LKNA 1CTOA 1MHHA 1RZIA 4X9IA 2CKBA 1ZMYA 4WVRA 4FXGB 3DUSA 2A1WH 4UQ3B 4MCZB 3V6FA 4UILH 1G1CA 1MQ8A 1B88A 1QLEH 3CDFA 5DJ8B 4K3EH 2X1PA 4KKLC 5F3HA 1U3HA 3W0WE 4TSBH 4N0FA 2BRQA 4QEGA 4YGVB 3DX6A 5DURB 3KYMB 1DVFA 1I7ZA 4RX4D 4AEHL 1C5CH 3OPZH 1N5AA 4KZEL 3QHZH 3KGRA 4APQB 3UTZA 3MRPB 2Q86B 4J3WA 1FL5B 1UT9A 4JN1L 3LKPA 3V4UL 1L6ZA 1IL1A 1SJXA 3QJHB 4OZHF 1DL7H 1SJHA 4X98B 1C1EH 1N59B 1U9KA 3JV5A 3T4YB 4MQTB 5HGDA 4LSPL 3PHSA 1Q0XH 3M1BB 2WBKA 4PBXA 4PRAA 3VXPB 4QXTB 4U3HA 1H3WM 4U1MA 2DL9A 4PJDA 3B5HA 1EO8H 4HX1B 5MERA 1JHLL 2Q8BH 4ZXBD 4XCNA 3DXAE 4PRHD 1DUYA 1FAKT 2OP4L 1JWSB 3GHBL 5HDOA 2C7UB 2R2HB 4JB9L 4R4FH 2VDRL 2NX5B 4JZJA 5FA3A 4G7VL 3IU4H 3EYFA 3WFHA 3QIWB 1UQSB 3ZKMC 4EXKA 4KAQL 1QR4A 4KZDL 3V8OA 1RK1A 3BKYL 1MFNA 5GGQL 3B6SB 3FQRA 5DD0H 3G5ZB 3DGGB 3DETC 4F7CB 5DMIH 3JTSA 3FHQA 4UOJA 3H3KA 5K33A 2JK5A 3C8HA 5JIHA 2JTDA 4RMQA 4NHCH 5J9PB 4JQIH 4QRTA 3NH7L 4N0RA 4JQXC 5F7EL 3O6FB 3MRMA 3EAKA 4PUBH 4DKEH 4B0MM 4F57H 1IKFL 1A7NH 4DAGL 3N06B 1ADQL 2ED8A 2JF1A 5C0AE 4YHIB 1JPGB 3KJ4B 3QXVA 5FKAB 3DX8B 4LNRA 5I19H 3LKQA 4KV5E 1U8LB 4OZIB 4HS6B 1XZ0A 4WTZG 3IJYB 3NVQA 4KK8C 3QFJE 1BFOA 1BZ9A 1I1RA 3LKOB 4ERSL 4LVNB 3MGTB 3U7AA 5DQJB 4XP9H 3NIGF 4HWBA 2RHEA 3MREB 3STLB 1TITA 4FXGA 3CXDL 4JPKL 4L4TE 3RA7L 2E6QA 4JM2B 4MCZA 3REVA 2CR6A 4W4OA 3B9KD 1F02I 5EC2B 5DJ8A 3PWJB 5IB4B 1BGXL 4G8GE 4PYHA 4EZMA 4CADB 2W0LA 4UT7H 4YGVA 5INCB 1D6EB 2O26U 3CLEH 2O61B 3DARA 3KYMA 1HKLH 3QDGE 2XQBH 3S9DB 4K9EL 1F4YL 1NAML 4F33B 2G9HB 4APQA 3I3EA 3MRPA 1DN2A 1FL5A 4G8GD 4PGBB 1OT1A 3UAJC 3QJHA 2J2ZA 4NRYB 4LVHB 1AO7A 1MCPL 3TZVD 4X98A 3C60B 1N59A 1SY6H 3W9EB 3ZTJH 3T4YA 3QDGD 5IFHH 1T83A 1IGCH 5JUEH 4FFYH 3VXPA 1ACYH 3Q6FB 4QXTA 2VDQL 1A5FL 4HX1A 3O3DB 2Y9RT 4JZOB 5MEPB 4P9HL 1F11B 3UTSB 1DANT 4J4PC 5C6TH 4EVNA 4MVBC 3SKJL 2C7UA 2R2HA 4LARH 2WWMC 3QP3A 1Q1JL 1EGJA 2NX5A 5CMAA 3RFZC 2Y4SA 3M07A 4KQ3L 4DOHE 4ODBD 1NEZA 3QIWA 1UQSA 4IRJD 3SDYL 4PJHE 5I71C 5D7KD 1L7TL 3B6SA 3Q2CA 3HFMH 4I9WE 1EVUA 3ARFC 3G5ZA 5CLWA 1JYVA 3DGGA 5E0QA 4F7CA 4JG0L 4KROB 2IG2L 3D9AL 3HE7C 5J9PA 3SKOA 3O6FA 2BCKB 4I9WD 1LK3H 4J3UA 2NCMA 4Q9QL 1JPGA 1MLBB 3EJZC 5FKAA 3DX8A 1NMBL 1U8LA 4OZIA 4HS6A 2NZ9C 2LU4A 4KKCD 3IJYA 4KHXH 1YYMH 3WIIH 4CMHC 3SE8L 4E9LA 3KNBB 3MGTA 5DQJA 3M45A 5BS0B 3TH2T 4FQJL 2FATL 4GXVH 3QUYB 3AUVA 3MREA 3STLA 5JOFA 1ZA6B 1UJTA 1YECL 1SMAA 4GSDL 3GDBA 2K3TA 2DI9A 3BISA 4JM2A 3EOTL 5T1LB 4NKOB 3IXAB 1RHFA 3IKCB 3PWJA 3OKYA 5IB4A 2IALB 4PLKC 5JW3H 3LS4L 4CADA 1T7VA 2PNDA 5INCA 4KRNA 1D6EA 5E08H 4Y0GA 2I07B 2O61A 4XPHH 4MB3A 1PG7X 5D4QA 2VC2L 5D1QC 4RISL 2G9HA 2R39A 1HHIB 4HK3J 4PGBA 4F2MA 1PY4A 4NRYA 5GRXG 1YEGL 3C60A 3W9EA 2XTLA 3VXMB 1TJIH 2UV3A 2Z8VC 5BV7C 1QA9B 3BSZH 3QYCA 2APFA 1TIUA 3Q6FA 1JF1B 5B39G 1YC8A 1C7SA 1YEJL 5MHSE 3JV6B 1Q72H 4JZOA 5MEPA 1F11A 1L9NA 1KEMH 3CFCL 3WSQH 3L3DB 4KV5F 3U1SL 4UIMB 5IW3A 5BO1L 4M6ML 3UDWC 2CLZB 4K9EC 1HH9B 1A22B 5JA8B 1QYGL 4AQOA 2B0SL 3LHPL 3EYOA 1A02N 2A6JB 2FL5B 3HZKB 4DGVL 2NPLX 2DTML 3BUYB 3ILQD 3LB6C 4M1DL 2YS4A 4AEHH 4O51B 3LCYA 4KZEH 5ALCL 4JY6B 5J4MA 1BQSA 4HJ0C 4QRUB 4Q0XL 1ETZB 3NFPB 4JN1H 5JPNB 3V4UH 2A9NL 5FEBA 1Q94B 2H32H 3GKWL 2BXZA 4X6BB 1K6QL 1TZGL 3TFKD 2R0LH 3KDMB 2OBGA 4LPYA 4LSPH 3BP5B 1CICC 3KNBA 3GKZA 3FB6B 4LMQE 1FL6B 5BS0A 4Z7NE 2CRMA 4I0CC 3QUYA 3RWCB 1N64H 4S1DC 1ZA6A 1JHLH 1DSFL 1WT5A 4FZEL 3BQUB 5T1LA 4NKOA 2OP4H 3GMMA 1L6XA 3IXAA 3IKCA 4JB9H 3MGOB 2IALA 4JPIB 4P2QD 4PV8B 2I07A 4S11A 5L8KB 3OKNA 4KAQH 4R7DB 4WTWA 3BE1L 4KZDH 1I8IB 5E2UL 2MSPA 5DD5L 3BKYH 5GGQH 4JFDE 3VXRE 1HHIA 3DMMB 1OGAE 4PJHF 5F7EH 3NH7H 4P23D 3OTTA 2BFVL 1QA9A 4HFUL 1A3RL 3U7WH 1M1SA 3VRLE 1ADQH 4JFDD 3HLAB 3DSNA 2VISB 3VXRD 1OGAD 2XKNB 1JF1A 9CGTA 3UJIL 4M7ZC 3JV6A 3WNKA 3L95B 2DQEL 3L3DA 3AB0B 4UIMA 1AGBB 1T66D 4GRMB 4N8CL 5T1MB 4NBYB 1MCQA 3CXDH 2CLZA 4JPKH 3K2MC 3RA7H 4ALAL 1HH9A 4IOIB 2ZJSL 1AJ7L 4PJ8C 1BGXH 4LOUC 5E6ZA 2A6JA 2DN7A 4M03A 3IVKB 2FL5A 3HZKA 1S9VB 1QBAA 2IGFL 1VEOA 4Z6AT 5B22A 5JHLL 4K9EH 3MRRA 4O51A 1F4YH 1NAMH 3MBXL 2XTJE 4PJ5E 1IBGL 4QRUA 3EO0B 1ETZA 3NFPA 5DRXB 5JPNA 1UWGL 1Q94A 2NY3C 1DQDL 1GGBL 1MCPH 2LABA 3H9SA 4LKXB 4X6BA 2CLRB 4LVOC 4WWID 4TULL 5GIRB 3KDMA 4QWWD 1ZVHA 3VGEA 1DVFD 4YDLC 5J7CC 1UFUA 1OTUD 6FABL 1NLDL 4ZO9A 1ZGLM 3BP5A 4EI5C 3FB6A 2PW2B 5EZJB 1MRDL 5BVPL 4MB4A 5EO9B 1A5FH 2NXYD 2V17L 5HDBF 3MRFB 1MPAL 4P9HH 5JW4M 4WDIB 3BQUA 1N2RB 5C08E 1V3MA 2FGZA 5CEZH 1AQKL 3SKJH 3RDTB 3RZCD 3MGOA 4RRPG 4JPIA 1Q1JH 4EIZC 3ELAT 4PV8A 3VGFA 4KQ3H 3X13B 1FHGA 2DM4A 3C6LB 3VRIB 4HW6A 3SDYH 2WP3O 4R7DA 2VQTA 5JDSB 4KK9C 1I8IA 4LLUB 4NIKB 1L7TH 4JG0H 1HHGB 2IG2H 1MIEL 3DMMA 5E8EA 1PD6A 5LKNA 4Z77B 1G6RH 1V3KA 4PGEB 3H7LA 2AEPL 4R2GD 1DJSA 4JRXB 1CE1L 2P47B 4Q9QH 3HLAA 2VISA 1UCBL 4JLRA 2JLLA 4Y16B 1NMBH 4MJ6B 1S7RB 5DD3L 1OTTD 4L8CB 1X5IA 2HFGH 4UOW1 2XYCA 3SE8H 3L95A 2YMXL 1FNGB 4FQJH 1AGBA 1BIIB 3CVHB 4LSQL 4GRMA 5ESQB 2QSCL 1YECH 4LSSL 1S5IL 4FOMA 2AKRA 2WK2A 4WHDA 3IDIB 4IOIA 1CLYL 1NEUA 3O3UN 3EYVB 4J7RA 5KVMC 2BNQB 5CKGA 4EUPB 2Q3AA 4P99A 3ZSSA 3IVKA 3LS4H 3O11B 4LCCB 1S9VA 1LD9B 5HHOA 4EI6B 3EJYD 5BCAA 1C08B 4PLOB 2VC2H 4RISH 1KJ2B 4ZUTB 3Q5TA 1XFPA 5KSAC 4KDWA 2F74A 3EO0A 5DRXA 5IBLC 4HUUB 5LQBL 4M93C 2QSQA 4LKXA 4IHOA 4P2OB 3CMGA 2CLRA 4L8DB 4KK5C 3B8SA 4Y4HB 5GIRA 5DURD 5FV1L 3X14B 3T2NL 3EFDL 2PW2A 4APQD 1HYSD 3OBAA 1LDPL 5EZJA 3VXSB 5EO9A 5BJTA 4O2CB 1KBGL 1YEJH 3O6LH 4OJFL 3MRFA 4K3JL 3VRLF 2NY4C 1E27B 3CFCH 4Z7VB 1N2RA 1A14L 1LEKB 4JREC 5I2IB 2LAGB 3U1SH 5BO1H 2HJLB 3RDTA 2CO7B 3OSKA 1MLCB 2OQJB 3IJSB 2HLFD 3X13A 3WLWD 5ALBL 3C6LA 4NN6C 4V1DB 3VRIA 2ID5A 4U4BA 1WWWX 3MACL 5JDSA 1QYGH 1RIHL 4LCIL 4LLUA 3LHPH 2CXKA 5KOVC 1CDJA 5C0BE 4H26B 5CILL 4DGVH 1HHGA 5I1AB 2DTMH 1UXSA 1JMXA 4M1DH 4BK5A 4Z77A 4TRPL 1ZEAL 5I9QC 1XGPB 4PGEA 2ZOKB 4IMLA 2AJSL 5ALCH 3QIWD 4YDJB 4Q0XH 1IM3B 3HZMA 3S5LB 4JRXA 5IUSA 2A9NH 2AVGA 3U4EB 4MNHB 1V7ML 3MR9B 1NC2A 4LVEA 4MJ6A 1MH5B 3IYLW 4RGOH 1S7RA 4M9PA 4MA1C 3WJJA 3BT2L 1EUTA 1FZMB 1ODAA 1S7QA 1TENA 4A6YB 1FNGA 1XGQB 3O6FD 1VENA 1UG9A 3VXNB 1CR9H 1VACB 4GBXC 1BIIA 3CVHA 3AFLA 5ESQA 4U0RC 1CDUA 1DSFH 2ZG1A 4S0SD 3IDIA 4JJ5B 3UROR 4B41A 4IEFB 2YPVH 2BNQA 4EUPA 1XT5A 2F9BT 4CU7A 4GT7A 3QNZB 4OV6F 1FP5A 4JO1L 4M8VA 1JZ3A 3O11A 4LCCA 1LD9A 2Z0BA 3ARGC 4EI6A 4HC1L 1C08A 1CIDA 3BE1H 5E2UH 3BDBA 1KJ2A 5DD5H 1OSZB 5LGHL 4ZUTA 4JM2D 1VFAB 1I9RL 3U30C 3RVWD 3NA9L 1X5LA 4HUUA 1CD0A 3FB5B 5MENE 4MA8L 1MOEA 4P2OA 4L8DA 4LCWB 3F62A 1OCWL 3TT3L 4Y4HA 5FO8B 5EZLB 3QIUC 1OOAA 4HFUH 1WWBX 1FSKB 4D9QE 3X14A 4R26L 2XZCH 4DN4L 4IOFD 5GS2D 3BPCB 4O2CA 2AGJL 5HI4D 1BFVL 3ZT5A 3UJIH 4WHYH 3E2HC 5J1SC 1JNLH 1QTYT 1TZHB 4N0CC 3C60D 1E27A 4Z7VA 2DQEH 1LEKA 5I2IA 3UTSE 4D9QD 1I8MB 2HJLA 2YRLA 4N8CH 4NPYB 3OZ9H 1J05A 1MLCA 2OQJA 4H88L 3IJSA 1NCWL 1VCAA 2DQCL 4V1DA 5FB8B 2ZJSH 1AJ7H 1D5BB 3ULUD 3UJJL 3PL6C 2D31B 3UTSD 1BFSA 1LILA 1JN6B 2UZIL 4M5ZL 4H26A 3NN8B 1YY9D 1O7VA 2IGFH 5I1AA 2DIJA 3ESUF 1YEKL 1ZLVH 5JHLH 5T33L 1XGPA 3MBXH 3QIBB 2ZOKA 2R9HC 4XVJH 1U3YA 4YDJA 1TJHL 4KTEH 1IM3A 4YO0B 2GJZA 3S5LA 1UWGH 2OM5A 1KPUB 3U4EA 1DQDH 1LDSA 4MNHA 1GGBH 1MWAL 3MR9A 2Y1VA 4KROD 1Q9LB 4WW2C 1MH5A 4TULH 4UNVA 1J7VR 6FABH 1NLDH 2NMSA 1FZMA 4WO4B 4A6YA 1KN2H 3FO2A 1XGQA 2G75A 3VXNA 1MRDH 5BVPH 3OMZA 3L3OB 1B4RA 5BS0E 1PX3A 1VACA 5F21B 2V17H 1MPAH 3CU7A 3VH8B 4XRCB 4JJ5A 1V7NH 1AQKH 1J8KA 3QNZA 5D9SB 3QXDB 3FT4B 5BS0D 4PG2C 2BVOB 1T4KB 4FQCH 5GJSH 3QUYD 2Y25A 3GMRB 5CZVL 1FLRL 1UJ3C 4NZUL 5T1LD 3FQNB 3RIFF 1VFAA 3TBYB 5KS9B 1MIEH 5L8JB 1Q0YL 3FB5A 1YQ2A 4MLIA 1ZK9A 3OL2A 4LCWA 4X99B 5FO8A 4C56B 3NIDE 5EZLA 5K9KB 3RI5K 2AEPH 1OARL 3VXME 1CE1H 1OVZA 3LAFA 3ARDC 5J57B 5DQ9B 2OJEB 1KENL 3BPCA 1LQSR 5DD3H 4G9FE 3KLHC 3V95A 1TZHA 3QUKB 2UY7A 4ISVB 1H3UA 2YMXH 5GJTH 3VXMD 2X9WA 4L1HA 5TDNB 1I8MA 1XF4B 1OAXL 2AXFB 1BQUA 1Y18B 4LSQH 4NPYA 3FJTA 1S5IH 4G9FD 5C3TA 1MRFL 2M26A 5FB8A 2IFFL 4MLSA 1D5BA 3DRQB 2D31A 1JN6A 1KPRB 2PTVA 5HVWA 1H3VA 3NN8A 3N1FC 2A6DB 3VMOA 3ME0A 2EDHA 5HYEA 4JM2F 1RI8A 4M61B 4LPTA 5A3ID 2DB8A 2NXZD 3QIBA 1JIBA 2R4SL 2Z93B 4XXDB 5CJ8A 2HFEB 3C08L 1KCUH 3J7HA 1YZZA 1B3JA 1VPOL 4ZUVA 5LQBH 1K3IA 1KPUA 1OY3B 3VD5A 4O02L 1Q9LA 3D2UB 3O2DA 4K3GA 5CJBA 3KYKL 5J6HB 1P4BL 3IS0X 2DJSA 2ZUYA 3VG0L 3S35H 3CAFA 4GAGL 4WO4A 4A2MA 3T2NH 4MJ4A 1EA9C 3EFDH 2GEEA 4GXUM 4JKPL 5IMMB 3L3OA 1KBGH 4OJFH 5I15L 4K3JH 1E4XH 3C6SB 3VH8A 5DEGB 4XRCA 1A14H 1UCTA 3MZTA 5DLML 5D9SA 2IWGA 3QXDA 3FT4A 1BBJB 3I75B 5IW1B 4BZ2L 1XH3B 2VE6B 3ULUF 2BVOA 1T4KA 4CJ1A 4OD3L 3RY5A 3RBGA 1NUDA 1I3RB 3MACH 3E3QE 1RIHH 3DLQR 4LCIH 1CLZH 2Q8AL 3BQUD 2D7NA 3FQNA 5CILH 5HYJB 4UT9H 3TBYA 5A2LH 5KS9A 4JFEA 4PRNA 1FNHA 2JB5L 4JGJA 5BZWB 4TRPH 3VWKC 1ZEAH 1BREA 3TGXA 2VR4A 3EKCA 4X99A 3V0AC 3QNXA 4C56A 5K9KA 3D18B 1FJ1B 1ONQB 1EVTC 1FVCB 1MHPL 5F7DB 2HTKD 2IFGA 5DQ9A 1V7MH 4XPFL 4YK4B 2OJEA 1IGIL 3DMMD 2BXYA 1BECA 1D5IH 1ZVSB 3QUKA 3BT2H 4ISVA 2RCSL 1B9ZA 4I0PC 5TDNA 3REWB 1XF4A 2F19H 1Y18A 2VITB 4ODTL 5F6IB 1KLUB 5I1IL 5GS0L 5IG7B 1TJGL 1D7FA 1OWRM 5DEZA 2UWEE 3U79A 4DTGH 5E03A 1WWAX 2N7BA 2R23B 3DRQA 5GRWA 3RQ3A 3SDDD 5BOZG 4JO1H 4PLNC 2GCYB 2CDFA 4P57B 2A6DA 4POUB 4HC1H 4ONGH 3AU1B 4M61A 3RY6C 2X4QB 5HD8D 4J2XA 5LGHH 2FH6A 4XXDA 4ZNEA 2HFEA 3D48R 4K71C 1I9RH 3RWFA 1FGVL 4P5KB 3NA9H 2VUOA 3VXOB 3ZYZA 4MA8H 1ZLSL 4R90L 3D2UA 1YMHB 2EXYD 5IGXL 3TT3H 1NGXB 5J6HA 3OAYH 3TN0C 2FB4L 4G6AC 5EU4B 3LDBB 4NC1C 3PDDA 3CK0L 4WI3A 4R26H 3AY4C 3QEHB 1A6UH 4LLMB 1NFIA 3S3PA 2AK4B 4DN4H 5CLTA 5IMMA 2EE9A 4KC3B 2P48B 4NZRL 2AGJH 1BFVH 3NIDF 5B38G 2EDLA 3C6SA 1XGYL 5DEGA 4C54A 1NUGA 1QRNB 1Y6NR 1A47A 5GGTA 1BBJA 3I75A 4JHZA 5IW1A 4H88H 1NCWH 1XH3A 2VE6A 4HWNA 4QYOB 1I3RA 3UJJH 3ULVD 5H37H 3RVUD 1S9WB 2UZIH 4M5ZH 1UENA 3U82B 1KF9B 1CZ8L 5HYJA 2IC2A 1KCVL 2LU7A 3RL1B 4LFHG 5EH1A 5BZWA 1YEKH 2L7UA 4N1CA 5F9OL 3MFFB 1WBZB 4PD4J 1TJHH 4QY8B 3D18A 4K7PY 1ONQA 5F7DA 1FVCA 5T3XH 4WFFE 4JVWA 2XY2A 4JRXE 3T1FB 1MWAH 2MQ3A 2XWTA 5JHDB 1YJDL 5JLZB 5J8OA 2DI8A 5HI3C 2PXYC 2LE9A 3K8MA 3WBDA 2XY1A 3K4DA 4FQQB 1W0YT 2H2SC 3REWA 4WFFD 4H1LH 4JPVH 3D3VB 4JRXD 4OKDA 2VITA 1KLUA 1R5IB 3EHBC 1TXKA 4JM4L 4Y16D 2P5EB 2HH0H 4I48B 5BMFL 2V5SA 1BJ1J 2R23A 4FP8L 2B1HL 4HFWB 2GCYA 2FH8A 4U1LB 5GRUL 3CMOL 3AU1A 2Q87A 3ZLQC 2NY6D 3V9FA 1NGQH 2X4QA 2YOCA 2VERN 3ARRA 5DJXB 4NZUH 1YQVL 2EDQA 3QUXC 1UH3A 3R0MA 4RDQG 2BNQD 3A67H 4P5KA 1Q0YH 1WFNA 1Q9WB 2PYEE 3VXOA 1A1MA 2NY0C 1MJUL 1E4KC 5L88L 4OGYL 1NGXA 5CZXC 5EU4A 1OARH 1YUHB 5JIKA 4M62L 3CFKA 3QEHA 4LLMA 1T6VN 2AK4A 2PYED 3U9UB 1KENH 1IILE 4NM4L 3GI8H 3PQYB 4U7MA 3VD3A 5EB9A 5CEZE 3VXSE 1S8DB 4NFCA 3SOBL 4XBPB 3P2TA 5GGSY 4JJHA 4NGHL 5IESL 1QFUL 4M6OH 4F58L 1KELL 5FHBH 4Y4HD 1QRNA 2WUBH 3HC3H 5JOPE 1OAXH 2C3VB 3ZKND 3WUWA 1E28A 1MRFH 2A6IB 4P9ML 5SWSE 4J23A 3VXSD 2IFFH 5EIQA 4QYOA 3FB8B 4V1DE 2NLJB 5LJYH 2VWEC 3V4VL 1S9WA 2W9DL 1NBVL 1MJ8L 3OB8A 3RL1A 2UWEF 1NUNB 4FFWC 1X6LA 2YZ8A 2GY5A 4P0DA 3ZE0E 1MWAB 4N9GB 4PV9B 4WFGD 4ZDHB 2R4SH 3MFFA 4V1DD 2X4PB 3IDNA 4QY8A 4TUOB 1VPOH 4Z0BL 1I75A 3PWNB 4OI8A 1F3RB 3T1FA 4M5YL 4E41B 1V8HA 3DIFA 3E8UH 3KYKH 1P4BH 2BSSB 3F12B 2B20A 4OLVH 4Y5XC 4GAGH 2XN9B 3R06A 2BY0A 4JKPH 2H26A 4FQQA 5HSFA 3ROOB 3WJLC 3RVTC 3MRNA 5D71L 3D3VA 2IANB 3QISA 5I15H 1R5IA 1F97A 3OXSB 4MXWL 4L8SB 2EZ0D 2PCPB 4FFZL 1II4E 2BMKB 1U8OB 2P5EA 4MWFB 4XAKD 2ZUQC 1PG7L 2Q7YB 4I48A 4JRYB 3LOWA 3DURB 4GMTL 5DLMH 4JKLA 2A2QT 3TBVB 4HFWA 1A7OH 3ULVF 4U1LA 3VI3F 4OD3H 1GYAA 4OAWB 1OAYL 1KB5B 2Q8AH 1UWXH 5DJXA 2JCCE 3QFDB 5E5UB 4UQ2B 2JB5H 5HHQA 1ZLUH 4HPYL 3C8KB 3N1QC 4F37K 1RUQH 3UPAA 2BK8A 5K93A 5D2NE 1RY7B 4OQ1A 4EQ3A 1YUHA 1C12B 1MHPH 1EFQA 2FX9H 4XPFH 4X7FC 1IGIH 5DFVC 3U9UA 2V5RA 3O3AB 3OXRB 4EN3B 5I66B 3RNKB 3PQYA 1OAZL 1A3QA 3N1GC 3B2VL 1S8DA 4NCDA 4L9LB 3VFOB 2RJMA 4XBPA 2RCSH 4LCWD 1TNNA 3GK8H 3SEPA 2PO6C 5IMKB 5A40E 2C3VA 4ODTH 12E8L 4X5WB 2BHYA 5I1IH 5GS0H 5BQ7B 3GBNL 4X4XB 3TNMB 1TJGH 5DRZB 1ORQB 4MJIB 2V2XB 1XF3B 3FB8A 2WW8A 4PLJC 2NLJA 4AL8L 1G7PB 4LRIC 4D3CL 3L5HA 4PBVC 1GOFA 1T7YA 1UH2A 5E5RB 4L8BB 4LSRL 2PR4L 3SGDI 3C8DA 3CD4A 4LASL 1MWAA 4N9GA 1TPXC 4PV9A 4ZDHA 2X4PA 5SX5H 3TA3C 4TUOA 4C58B 4MA7L 4MQ7B 5I74C 1RURH 4ZMAT 3PWNA 4LLDB 2R0ZL 4QLRA 3QO0B 5FGBC 1ZLSH</