5DUPH

Influenza a virus h5 hemagglutinin globular head in complex with antibody avfluigg03
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
227
structure length
208
Chain Sequence
EVQLLESGGGLVQPGGSLRVSCTNSGFTFSNYAMSWVRQAPGKGLEWVSAISGTYYADSVKGRFTISRDNSKNTMYLQMNSLRAEDTAVYYCVRDDSYDGGGHYGLHNWFDSWGQGTLVTVSSSTKGPSVFPLAPSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive analysis of antibody recognition in convalescent humans from highly pathogenic avian influenza H5N1 infection
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1/2005(h5n1))
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 34
structure length 208
sequence length 227
ec nomenclature
pdb deposition date 2015-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH01
1JI1A 1YEKL 3OAZH 3TN0B 4ZD3H 4N0CC 4QXGH 2JK5A 3D18A 1OP5K 3WBDA 1IGIL 2DL2A 1S9XA 3JWDC 3SE4C 1D5BA 3EUUA 1EEZA 1MIML 3THMH 2AQ3A 2R69H 1E27A 3QUKB 4XCYA 1FNHA 3SE9L 2BNUB 3B5GA 4D9RD 3IJSB 1CI5A 1CR9H 1AQDB 2FX9H 4NRYB 1RZFH 2G2RB 4L9LA 3ARDC 3ULUC 2Y07H 3IDMA 3DURA 4ODBD 4N5UA 1JWSA 1KCLA 2EO9A 3VGBA 1RUAH 4LSPL 3MNWA 3LEYL 1X5FA 2P5EA 3FAXA 4LVEA 4PJ9A 2JB6B 3QRGH 3PGFH 5ISZA 3SE3A 4M1CD 1F8TL 3ILPA 2CK0L 4KMLB 2V5TA 2CUHA 2JCCF 4KKAC 3VI3F 1DZBA 2R0LH 4NO2B 5IBUB 3QUZB 4NN5B 1FL5B 5JW3L 3FHQA 3ZLQC 1C7SA 4AEFA 2VXUL 4WHTB 4HWBH 2BSRB 1U36A 3MLZL 1HEZA 2NY4D 1QLEL 1MNUH 1YJDC 1BIIB 3GO1L 5DT1L 2C1OA 1XR9A 3Q5OA 3SPVB 3K4ZA 4JFFA 1LO5A 1JGLL 3F6IA 3DX9A 2Y6SC 4PRAA 4X6CB 1TJIL 4OCXH 3QUZC 1SY6H 5GRJL 2PW2A 2ZJSH 1Q94A 4U1LB 3WIFB 3F6LA 4Q2ZA 5ICYB 3KPSB 3DRQA 4QOKB 5GIRA 1Q0YH 5IB5A 1YA5A 2GAZA 5GS0D 1NGXA 5FKAB 4NSKB 4U1NB 5F7MC 5D9SA 2APBA 4U7MA 3FQNB 2FJGA 3G5YB 5I74B 1A4JB 5F3BB 1XGTA 2DTML 1T5WB 3Q1SH 5KVEH 2DF3A 4YE4L 2Z31B 1WAAA 3TVMB 4HQQH 2ID5A 5FOJA 1KFAL 3BGAA 1P4LB 2H1PH 4ODWA 2VE6B 3ZE0E 5J13C 2YD6A 4OLWL 4WUKL 1IGYB 2ENSA 1T5WA 1JN6B 3HS0A 4LPVA 3QWOA 1SEBA 4XC1L 5AYUL 4KROD 5DHVB 3DUUB 5L6YH 1LDPL 3PWVA 2VZSA 4H8WC 3V8CA 3RU8H 1HHKA 3SCMC 3DTXB 4WNQB 3MLYH 4G9FE 4U1NA 3BZ4A 3MUY1 3DGGB 3HC0A 1R3HA 1U3HD 2VAAA 4M6AA 4WU5A 4V1DD 3OR7B 5J13B 2MQ0A 4WFHE 4LSTL 1KCSH 1AGFB 1T6WA 4YLQT 4QCIA 5LGKA 1KB5B 2BC4B 2ICEB 4YAQB 3BEWB 4TUJB 3T0EB 4KRPD 1IARB 1DVFC 2Z4QB 5J3HD 4XPGH 5E7FA 2V2XA 2QHRH 4BFIB 1XCQB 4I0KA 1VERA 1TVHA 3TVMA 1BFOA 2NLJA 4LNRB 5GGSY 5SWSD 4Y2DB 2EH7L 1CZ8H 4HG4J 4TNVK 4U1IA 5FYJH 1R5IA 4P2QB 3W0WD 4ALAH 4ZYKA 3SE8H 3HN3A 3C9NA 4G42B 3D39D 2VWEC 3OF6A 1X7QB 4F7TB 2F74A 5KBNC 4QGYA 4X4YB 4BFIA 2R4SH 2YEZA 4IRJB 3ARED 4MQXC 2FO4B 4LLVA 2BX5A 4P23D 3GBML 4ODXB 4QRPB 1K85A 3ROLA 4CNIA 2VR4A 1EHAA 4D2NA 2NY5L 5TE6L 1IE5A 1A6VL 1K2DA 3OR7A 1ZVHA 4WFFD 1KEMH 5ISZB 1U93B 2EDJA 3P4MB 1PEZA 1IGFH 4JE4B 5IGXH 1N5AB 4MJIE 1DQTA 3C08L 5E4IA 3KLHC 2D03H 3R0NA 3TO4B 5KZCD 4UTAH 4QOKE 3V52L 2I26N 2BRQA 1F2XK 4ZAKA 3UZEA 5MENA 4OGAD 5MP6L 2IANE 3RWCA 5B8CC 4NQTA 1OTTD 1D5BB 1RIVL 3OB0H 1UZ6F 3NZHL 5FO8B 5AAWA 3ZMRA 3BO8B 3V5KB 4NN6B 4MZ3A 4YHIA 3MJ6A 1WCBB 4YEEA 3VJ6B 5FYKH 3S37L 5DMKA 3NFSH 3FCTB 4PJCA 2ZG1A 1OQOA 1GL4B 1IGMH 1ZLWH 2FEDD 4GAGH 4KKBC 4OFPA 4LKXB 3T1FB 1ZEAH 1A7RL 2HLAB 2Z91A 3QEGL 3RVXD 3EYQC 4MXVE 3N9GH 5GIRB 1FSKC 5LGJB 4NZRH 2XT1B 2Y6SD 4BYHA 1MCRA 3T4AB 4JN2B 4EN3D 1TFHA 3SKJH 3BKCH 5A40E 3VXNA 1MCNA 2ZUUA 4U6VL 4BSVA 2F53B 4Q9RL 4JM2A 4MLSA 5TE4H 2P24A 3VXME 4KAQL 4P2CG 4Q0XH 3EDFA 2IFGA 1R6VA 3D39B 2YPKA 1ZVSA 3S36X 5A3IC 4HUVA 3FFCE 4OAWB 1P2CB 4G6JL 2AI0H 1MH5A 2X7LA 1YN6A 2RR3A 5H37G 1RUKL 4ONOA 1BVKA 3HMWL 3T3ME 3MGTB 5TFSL 3KPMB 5DMKB 5I1HL 1WWCA 3MRRA 4KUCF 3HC3H 1IT9L 3AXLA 1TCRB 1NBYB 2AEIT 3P4NB 4P4KA 2NY2C 1MRFH 3QFJE 1HSBB 2EICA 4Y5YA 4U49A 4ZQKB 3CFJB 1YMMB 4XCNA 5K9OB 1CDCA 4HIEB 2CDEB 5F1SA 1BD2E 4TSCH 3G5VA 3HI5L 1FNSL 1IQDA 2NXYD 3QWQB 4C59B 2EC9U 3E6FA 3T0ED 3RZCA 4WEMB 2DL9A 2X4SB 5HDBF 4JPWL 3DGCR 5KG9A 2E8ZA 3LQAH 1DFBL 4JFQB 1LEIA 4MX7B 3HI1B 4JB9L 4Y5XB 5F96L 1EXUB 1LK2A 3D85B 5IW3A 4Z5RB 4X4ME 3NZ8A 5FO9B 4PFEA 4OZGE 1K8IB 3L5XL 3TBTA 3BWUC 4ZNEA 3PQYA 4LP5A 3SKNB 1PEWA 2JK5B 1RURL 3D18B 5HGHA 5F9AC 3ROLB 1UJTA 1DANU 3C6SA 3EYOA 5J11B 3G5ZB 4RGMB 4EN3B 2IANB 4LLQB 1RJZB 3FRPG 2F53D 5I66A 3MO1A 1QR1A 4RZCA 4OCNC 3W81A 1XIWB 3FO9B 5CSGA 1G9ML 4YPGB 5HYSG 5E08L 1BVLB 1IGTA 43C9A 1VFMA 5D7JB 3SDCA 5JMOC 3U1SL 2R56L 4EI5C 4RFOL 3HZMB 5E8DH 4LPUA 4HH9B 4RISH 2XKSA 4EI5A 4A6YB 3PWLB 3WFDL 3IFOB 1I9JH 3LKPA 4DUXA 3PWJB 4PJ5B 1CYGA 1P7KA 3GNMH 5FYLL 3MRKB 3IDGA 4QWWC 3NIDE 4M1DH 4ONFL 4PJCB 3UBXG 5K9QI 3KYKH 3STLB 3DARA 1JPTH 3O6FC 4ODVL 4KTDH 4JKKA 5JDSA 3RTQC 5E6IB 4KVNH 4UIMB 5HHPA 5EUOE 5FA4B 4XWOD 4PJEF 3VGAB 3CGTA 3K4DA 2H8PA 2OTUB 3U2SA 2YPLA 1WF5A 3LZFL 3GUTB 1ACYL 4HXAL 4K71C 3UTSB 2ZG3A 5DJ2B 4RMRA 3ULSA 2VDMH 5F70A 1QG3A 2PYED 1WWBX 4NNXA 4Q7DA 2H45A 1W72H 3IT8D 1N4XL 5JZ7D 4KKBD 4L3EE 3QRFM 5E5RB 3GJEB 3D9AL 4NO0A 1WVZA 3KVQA 2DLIA 4M48H 5DJXB 1T2JA 3LOWA 4D9QE 4KJQC 1QQDA 1CDJA 3SJVE 1CDIA 1R5WB 5EZIL 4U1IB 4EDWL 4A2MA 3KHOA 2CIIB 3H42L 4DUVA 3SDCC 1EK3A 3I50L 1TCMA 4IS6A 2WMPA 5IV2A 5MEND 4LIQE 2ICCA 4M93C 2PXYD 5I8EB 2A6JA 2ZUTA 3ZE1E 4LSRH 3RAJH 1LDSA 5D6CA 4KMTH 4HZAA 4QCIB 5E8PB 2Y7QA 2VE6A 1KEGH 1BBDL 3P11L 4Y5YB 2NY3D 2GTZB 5LXGH 5CINL 1EFQA 2H8PB 5GS2D 3DUHA 4UNUA 4F8QA 5CJQL 3EDEA 4OFVA 2LE9A 1UVQA 3JUZA 1Z3GL 2LTQC 4YDIL 3BZFB 1QRND 1QBML 3WNNA 1F3DJ 1TNMA 1XEDA 3NACL 4CRPA 3BP5B 3F7RA 5J1SC 3I3EA 4NWTL 1MOEA 4ZPTB 2BVTA 3A67L 4PJHE 3GO1H 1KPVA 5J6GB 4F9LA 2X44D 4GSDL 1KCUL 3AREC 1MPAL 4L3ED 1ULVA 3D39A 2H9GB 5L8LB 1KJ2B 4R9HA 3N1PC 4MHHI 1ZA6A 1F5WA 3PDOA 5T1KA 3TYGL 2R1XB 4OJFH 1NQBA 4HUUA 2XWJA 2ITCA 1WIUA 4ZFOL 5KVDL 4GBXA 2QSQA 1IAIH 5DHXB 5MEPB 2P5WD 2WBKA 1MFEH 2AXFA 4KTYA 3DYOA 2P43B 4FG6D 4PJAE 5IQ7L 3GMNB 5I9QB 1AXTL 1G7MB 3IJHB 2CDGB 4ZFOB 1VFAB 1Z0NA 3LD8C 4FFYH 1SMAA 1MJUL 1B90A 1NCWL 1HH9A 3CPLA 2IAMD 5JTWA 4UV4L 4WFEE 5C8JB 1NBZA 1FYTB 5DJ6B 4KTEH 4KI5D 5CEXA 2X1PA 2NW2B 1EIBA 4FABL 4MVBD 1XF4A 4Z0XB 2EKSB 2PXYB 3N1GC 4H88H 1F6AA 4Z77A 4WEBL 1MH5B 3HPLB 1FBIL 1SJEB 2OI9C 4G6KH 1C16B 3MV9E 4JY4B 1DLFL 5T5FH 3MGTA 1PG7L 4Z7UE 3PABA 1BOYA 4OUUB 3UYRL 1MEXH 1IM3B 2NZ9C 4NQEA 3VXNB 4AL8L 1OM3L 3G5XB 3S96B 3MA7A 3MOBH 3OAZK 1G9MC 4HWZB 3V6ZA 4GQPH 5CD5D 1ZHBA 3SBWA 2YSSA 1GPOL 2AJYH 4LLMB 5C6WH 1XF2A 2QSCH 1OAYL 2WANA 4OI7A 3UDWA 1MY5A 1ZVYA 2JELH 4D94A 1WTLA 2PN5A 5EU3A 1I7TB 5CJQH 5E9DA 4YC2B 5A2JH 1ZHLA 1DQJB 3IF1A 3QDAA 5C70A 5DQDL 4HW6A 1NJ9A 4OI8A 1IGCH 1M05A 2PYFA 4UTBL 3T0VA 3KLSA 3VDCA 1T2XA 1G6RB 5HYSA 3GIZL 5CP3A 4NM4H 2JB5H 1DDHB 5ESVA 4D0DA 3TO2B 4ZS7L 5HDQH 1PX4A 2XRAL 3U7AA 1BWMA 2YD5A 3HC0B 4YFEA 1AGDB 3WIHL 4YR6A 4WHYG 5FGSA 4LSSL 4YK4B 4I0PC 5IKCA 3SDCD 3RHWK 3VXTA 3QISA 2AJSH 5AAMA 2FD6H 4MJIA 2VXVL 3O8XB 3ULVC 4JCMA 2D9QB 1NBVH 4QT5B 3NN8A 3MV8D 2E9JA 4X4XB 1HKFA 3QUXB 1YEGH 2NY3C 5JPNB 4ODWB 1ZS8B 3LS4H 4U4BA 1AFVL 3RNKA 1QFUH 2G5BB 5JOEA 3ZKSD 3PWUA 1HHJA 1BX2A 3F12B 1RVFH 4BH8B 1EDQA 2VISB 2Y1VA 3O3AA 3SCMB 4NQEE 1NANI 3REWA 2UWEE 4NO5A 4KPHL 4O2FA 2NNAB 1Q72H 1TETL 4Q58C 1KIQA 2CLVA 3O8XC 3WFBH 2FGWH 2XZQL 4LHUB 2IBGA 3WIHA 2X09A 1BX2B 4U1GC 4M62H 4ZPVB 3RIAK 5IW1B 4NJAL 4F9PC 2FH8A 4UINH 4RSVA 2VDKL 4QHUA 5IBUG 1A6ZB 1WZKA 4X6FA 1PKQE 2H2SD 4MB4A 4TUJA 3T0EA 1W8NA 5C1MB 2YOCA 4OCRH 1IVLA 5BV7B 4XMKL 5DJ8B 1FGNH 4UU9B 4HKXB 1BZ9A 1ZV5A 4DJMA 1BMGA 2X4RA 1OP3H 3BUYB 5D7SL 1DTUA 2BHZA 2YN3A 5KSBA 1FJ1B 3JV5A 1KG0A 2DYPB 2APVA 4OLYH 5GHWH 4GG6E 4PRPD 4FQXD 2JE8A 3PL6D 2AJXH 4MQ7B 3SJVD 1S7XB 1NEZB 1YUHA 4YDJB 1QSZA 3IDJB 5I75B 1JJUA 2DMKA 3OZ9H 3QJHA 1AJ7L 1DBKH 2FHBA 3NCMA 5EU7C 2YA2A 2A2QT 3SGJA 5DJZA 1J8HD 4XWGL 3HI6H 2DQEL 4K94L 5EG6C 4GKZB 3S88L 4N8VA 3PNWA 3BESR 3EGSB 1KTRL 5B8CB 1ITBB 3K2UH 1FFOB 3F7YB 4LSRL 3RAJL 2CGRH 4L4VE 3AMKA 3SCMD 4TVSa 1LILA 2E9WA 3IAGC 2OL3A 1X5YA 2Y25A 3VGHA 1XR9B 4OZGA 5DD1H 3GZKA 1A7BA 3O81A 5I71C 3P0VL 5J1TC 2R1YB 3S4SB 5CEYB 3MGAA 3HR6A 3NCCB 4U3HA 4NKIH 3L6FB 5JHDE 3NCBB 2FR4A 5ETUA 4IEFB 3QI9A 3RPIB 3DX7B 5T3ZE 5D1ZD 3D3VE 3C2AL 1IKFH 3O4LB 5C0CE 1BOGB 1NGXB 4ZAKD 1CE1H 2AGJL 1H5BA 4KKAD 4DGIH 2QLVB 5LG1A 3RVWC 4PV9B 1NAML 5I1DB 1JGUH 4DAGH 5MERB 5IR1A 5DURD 2GKIA 3FB6A 5SWZB 3MLRL 1HH9B 3CPLB 2ICWI 4OLUH 4Z8FH 4LEXH 3KS0H 4LCWD 4ZUTA 1MLBA 3FQWB 1QSFB 4WI3A 2H32H 4XVJL 3ILQC 1VHPA 4R7NB 3G9VA 4PJBE 3BDXA 2GQHA 5EU6E 5A2LH 4EIZC 5L8JB 4TQEH 3CSYA 4LVHC 3AREA 3FZUC 3DURB 5GGTH 1LO0H 1MLBB 3I6LE 3DX7A 1D6VL 1FGNL 2VN7A 1N0LA 5EOQH 4GUPB 1T66D 3UDWC 4KJWD 4P3CH 1ACZA 2DQIL 5KSVB 3L3HA 5AZEH 2D0GA 2B39A 2X42A 3IXAA 3AB0B 5M7QA 2X1WL 1A6ZA 3RIFK 3LPWA 3UAJC 3TIEB 2IAMC 2BNQA 4ODUA 4S0SD 4HIJA 5IW1A 4ACPA 1IEAB 3KXFE 1MFDL 5JQ6L 1Z5LA 1A1MA 4GG8B 1UACL 3VE0A 1ORSA 4Q74A 5I19H 1A6WL 3C60D 3MCKB 2HT3C 2C3VB 1I3RB 2AK4B 1HIML 2J6EL 2CDFB 1ZA3A 1JP5A 4E42A 3ULVL 1GZQA 1U8JB 2IADB 3T0BA 3L7EA 2Q3AA 3LS5H 3J7HA 1T83A 3SDXF 3VG9C 1BAFL 2MWCA 4JFFB 1UADC 3RNKB 5IWLC 2X4UB 5GQBA 2DQCH 1BREA 3EYOB 2X9YA 2KKQA 1UYWH 2HH0L 4ZTOL 5ADOH 1FLTX 5JDSB 2LV4A 1KEML 2Z93A 4L9LB 4JDVA 1RU9L 3LEXA 1QFWL 1UM4L 1MAMH 3MCLL 5B21A 3UTZA 4HSQA 1TQCB 4GFTB 1U6AH 3RGVC 1SJVA 1X5KA 2FATH 3IDJA 2ZSVB 3MR9A 3EOAB 5DO2D 3QFDB 3QHZH 3SO5A 3GFUA 4PTTA 3S3JA 4F7MB 5IOPB 5GS0L 1DQQB 4D3CH 3IDYB 4L3CA 4UTBH 3ZDZF 3TWCH 1SYVA 2HRPH 5E00A 2NY6C 1JK8B 4GRMB 1NFIA 4XBGA 2A6IA 1B0RA 3BZEB 2HMIC 2YPVH 4PTTB 2H26A 3D2UB 3CMGA 3N06B 1LDPH 1UWGH 3DX8B 4XVTH 2VL5B 4YDLC 5C0FA 1OM3H 4UDUA 2NNAA 4QO1A 3B5TA 1JIBA 4NZUH 4KKLD 4M8QB 1PGRB 1VGKA 4CVXA 5CEZH 4K71B 2DD8L 4HWNA 1ZHBB 5L2KD 3TESA 3C60B 5TGBB 4DQOH 1GIGH 1EEQA 3L3DA 4LSVH 2F19L 4FP8H 4LVOC 1HCVA 1FVEB 4ZSOB 3IS1X 4G8GE 4JM2B 4LFHD 3VGEA 2XTJB 4XVUD 3QUMB 4BH7B 3RA7L 1XZ0B 4QRRB 5FAAA 1ZHLB 3CUPB 3JZ7A 5F93C 1CGVA 3BZEA 3N50A 4Y5VC 4JPKL 4DVBB 3I9GH 3MLXL 2VTFA 1KJ3L 3DI2B 3MBXL 3B9KB 3QHFH 1UEYA 2B4CL 4QYOA 2ICWB 4XPHH 3HB3D 4YXHH 3G6AA 3GI9L 4YX2H 4JM2C 4IRSD 3TZVD 5IVNA 4HJJL 5GSRA 3LD8B 1FLRL 3DXAA 2GITB 3OZ9L 1EJOH 1EEYA 4IHOA 3ARGA 4RWHA 5SWSE 1G7MA 3VXRE 3DROA 3Q6GL 3GSVB 2CJUL 3D6GA 1X4XA 3RNQA 3MRBB 5DXWA 3WE6B 2B0SL 3ARFC 1BIHA 2VDLL 3GSQB 3JWNC 1UQSB 3TN0C 3FHAA 2DQDH 2DBJA 2Y5TB 4D0CB 1XF4B 4Z0XA 1NL0L 1VGEL 2XWTB 5D7LD 3DXAD 4IOSD 4RBPK 3FQWA 4FFVC 4HFUL 4WO4D 4P5KB 3UJJL 4J6RH 1MFNA 3ARFB 4RMTA 2A73B 4AH2B 5K33A 4OUUA 3EJZD 1DQMH 2UVFA 5EFIA 4GRLB 2Z93B 3RDTD 4RGND 2F74B 4PS4L 4JEGB 4X7TA 4PJXA 4R97C 5F7EL 4F58H 5F21B 3KPRB 4PGBA 2NX5D 1IM9A 2GFBA 1MHPL 4KDTC 3L5WB 4Z7OE 2P8MB 3QT2A 3IYLW 3GMMB 3TJEH 3RZWA 5DD1L 3DBXB 4FFZH 3MRDB 3UROR 1R3HB 2VR5A 4ZO8A 4MNQD 3QAZB 3QCVH 4EDXA 2R1YA 3EOBA 4KQ4L 3S4SA 3P4OB 5SX4H 4BELD 1FFRA 5IFJB 1NGWB 4KDWA 4WI8A 2YRPA 4HIXH 1XF3A 1K3ZA 4P99A 3L5JA 4WO4A 5F7YC 3UTPE 5IFAH 5B8CA 2HKHH 3VXUD 3DXAE 3L3GA 4KUCD 3H3KA 5I1KH 5I1HH 4JZNA 1G9NH 4DVRH 1X9QA 3VCLA 3QQNA 4TUOB 2ADGA 5T5NF 3RVUD 5INDA 5HGGS 2V2WB 4ZFZA 2IPKA 3GKWL 4OZGB 2WUCH 2Q3ZA 3AAZB 3BIBX 5FHAL 4LLAA 3T0EE 1OSPH 2E6QA 3MUGB 4LRIA 2YPLB 3LQAC 3X3FL 5GGRA 1LO2H 1MHEA 3DUSA 3MRLB 1PD6A 2BXYA 5H94B 5DVLA 4YNYB 4CJ1A 1N64L 1FG2A 3O8XA 3CFDB 3MROA 4XBPB 1BHGA 3RVXC 1AXSA 1T03H 3MZTA 1OW0A 3G6JB 4NIKB 4Z7UF 5I73B 2DM4A 4JQVC 3P4LA 3GMLB 1T7YA 1MCPL 3BW9A 2DIAA 4YHKL 3V4PH 2JJTC 2CMRH 4DEPB 1W2KT 3ECBB 1HHJB 3CZJA 1F3RB 1OD7A 4U1LA 5ICYA 2CJUH 2WWKT 1CDBA 3B3IA 1JTTA 3O6FA 5D6CB 4M1CC 5I73C 2OK0L 4XWOC 1FNLA 5GGSB 4MD4A 1CLZL 2XPGA 3AS0A 1LHZA 1RIVH 3DV4B 3L3OA 4NKMB 1FGVL 1T89A 4WHCA 3QIWC 5C0AA 4R7DA 5TH2B 5LVEA 3B83A 3OJ2C 4NUJA 1XGRB 2YXFA 1F2QA 4PREA 4F33B 1AGDA 4QLRA 3QIBA 1Z0MA 4O02L 3NVQA 3K2UL 4HWBA 4UQ3B 1EAJA 3BPCB 4L1HA 1WC7A 1Q9OB 4WW1B 5BQ7B 3OGCA 2X4NA 3H7BB 3TLRA 1A0QL 3VXUB 5T1DL 4ETQA 2ZUVA 5IBLD 4OCMC 1DSFH 4P46A 4Y4HC 5C0NC 3BWAA 1FVCA 2APTA 5JPNA 4HBCH 4PB0L 5I1EL 1EXUA 4WNQA 3ARFD 4L8DB 1Q9LA 1IAOB 5F9OL 4RAHA 1O0VA 32C2A 4MQ7A 3TEUA 1KBGL 3RA7H 4UZGA 5B38B 3BN9C 4AK1A 1C5BH 3OAYK 3VD7A 5DMJB 3QIUD 2BOCA 1MI5E 3TBWB 3TT1H 4J8RA 4ODTH 4L4TE 4M6NL 1BEYL 5CILL 2CR6A 4QEGA 4YDKL 3G5ZA 1JRHI 1A3RL 4TSAL 4PUBH 4GXVH 3ZDXE 4BKLA 2RFXB 2EDDA 5ENWA 4ZFFA 2I9LB 1U3HB 3ZL4H 1UB5B 1NDMA 4MHHG 1A47A 1YEIL 2I25N 1FL5A 1FYHB 2AKRB 4P9ML 3D5OF 2BNQE 3HI1A 4U0QB 1U0QA 2HG5A 2A0LC 4HUXB 4LDOB 3RBSA 5C6TL 3PWLA 3RDTA 3JV4A 1KTKE 2ED9A 5L0QC 1PG7X 1FORL 5CINH 5CUSH 3P77B 1RU9H 5BRZD 4WUUD 5GGVY 5D6DA 4EJ1C 1H8OA 4YHYC 1QLRB 4K7PX 4Y1AA 3V6FA 5CP7A 3BP4B 3WLWC 2R0ZH 4PJGE 3TFKC 5E2WH 5D5MF 1RJZA 1NCDH 1UWEL 3O3BB 4ZUUB 5ITFA 1KNOB 4NFCA 5EPMB 5DDHB 4RMSA 5GZND 4OIIH 1JGVL 3NIFE 3OGOE 3UYOD 3C8HA 3HLAB 3H8NA 2F8OA 4WW2B 5GXBB 1XF5B 4JRXD 1MVUA 1XF1A 3VFWA 5IESL 3DX6A 1FG9C 5DC0A 5DEGA 4RRPA 3CAFA 3DVGA 4V1DB 4PLJC 1KJ2A 3VXTB 2YPKB 4M61A 3SJVA 1DEEA 5D8JH 5KVEL 4KUZL 1AKJD 4ODHH 4LCIL 3DPBA 2GK0A 2HVKA 5E6ID 4M7LH 4OB5H 3IB4A 1I8IA 3OWEA 3JV0A 3WD5H 1DUYB 3VXUE 1KT2B 3B2UC 1ZGLP 3LKOB 4GAYA 2BVYA 3QNYA 4BZ2L 1CFSB 1MJUH 2GK0B 4BZ1L 2NW3B 2Y36H 5KN5B 4IRZH 5TQ2H 4FFZL 5DTFA 3KLHD 1AXTH 4X5XB 1MRDH 2OL3L 3V0AC 1WIPA 5D2NB 3UXFA 4U1SB 1VA9A 2M1KA 5C8JA 4UMGA 3D69B 5C86A 4JFHE 4HWEH 4OUOA 1OAYH 5I1DA 1IMHC 3FQNA 2ZCLL 3INUH 5FK9B 2QJDA 5K9JL 3FT4B 1AHWB 1JRHL 2P8LB 2ZCKL 4HBQA 4ZYKB 2W9EL 5FYKE 3CMOH 3QULA 5F6IB 3B2VL 1QEWA 5ICXB 3VXMD 1BFOB 2NLJB 4X4ZA 1CZ8L 1GJIA 4PBXA 3MBEA 1YPZB 2Q1EA 4WENB 1MJ8L 4LPXA 2WM0A 3RWHB 5DD6B 2HFGL 4U6XB 4J3XA 4IMLB 4HZLA 1FE8L 1GRWA 2BNRA 1OSZA 4F80A 3BSZH 3KPTA 4HIJB 1OD9A 2CDGA 4ZFOA 3MR9B 4MJ5A 3TBVA 2J1KA 3MLUL 1RUAL 4PJGA 4HJ0C 1DL7L 3MV8E 4MS8C 1KN2H 2F5AL 1S7UB 5GGRB 2NY5C 1CD8A 3MV9D 4E0RA 3IDIB 3BISA 5F71A 2WIIA 4CVZB 5HVHC 3CSPA 5J06A 1RHFA 2EEAA 2ITDB 4YZFE 5FXCH 3KJ4B 2W1NA 2XKNA 5DJDA 3OGCB 3TIDB 1PZ5A 2P1YA 4G5ZH 4UOJA 4HGMA 3QXAA 5CEZD 4KI5E 1BFVH 3IFLH 3SKMA 3C09B 4GAJH 3QJFB 1WICA 1JI2A 4OIIL 4LLDB 1A7QL 1X5XA 4PJIB 3RTQB 2QTEA 4ETYA 3EOTH 4OFIA 3HI6L 4ELMF 1S7QB 2R2HA 5A1AA 4X8XA 4OGYH 1K4CB 4PY8I 4KJPC 2AXGB 3MRDA 4Z6AT 3I75B 4PJ7B 1FZKB 3MYJB 1AH1A 4QRSA 5IVXF 4A6YA 3MJ7B 1KACB 3EOBB 4XP6L 2NY6B 5DEZA 4QTHB 4QHNB 4R4BA 1WC7B 5JW5B 3DX9B 3ZDXF 1XCTB 4QRSB 2ZKHL 4XMPL 1BGXH 1BEYH 1AKJB 4MGXA 5CILH 3UJJH 4EOWL 2GT9B 2YK1H 1B2WH 4MCYA 5D2LF 5GZNC 1M4KA 4C56B 1KT2A 4M62L 4WU7A 1TJHH 2WBWB 4ZFZB 1SEBB 4PP1C 3OAUH 3D85D 1UB6A 2GSGA 5I8EA 1H15B 3WFBL 2UYLB 5IB4A 4DKFH 1VFOA 2VXTH 4IIQA 4GXVL 1FZKA 4NRZB 1RHHB 3BZ4B 3MFFB 3ULVH 4UINL 2IAMA 3P9MA 3NN8B 5DS8B 1Q38A 4U6YA 3JTSB 1NFDF 3VW3L 2R2EB 1P84K 2DQEH 4K94H 1I1FB 3RZCB 4ZNCD 3MJ9L 3BYYA 4PGCA 4DKDC 2DQCL 2BNUA 1P7QB 4MAYB 1AO7E 3VXPA 1GOFA 2QR0A 1F3JB 4QYOB 5EN2A 1OT1A 3IAQA 5JW4R 1T20A 3DVGB 3QXUA 3W11D 3T2PA 5IUSA 5MHSD 4LSQH 1A3LL 5FHBH 5GRZA 5T1KD 3WKNA 3HE7D 4YJZL 1NCTA 4Q9QL 3GSUB 3HMXH 1DUYA 3IXTB 4HWUA 1V3LA 3BYTA 3VXOB 4DOHB 2I24N 4FQ2L 2K7QA 4CMMA 4RIRA 1X5ZA 3FOMA 4XP4L 2EH8L 2EDKA 1Q1JL 3RY5A 4WI7A 1NC2A 3ES6B 4WDIA 3HZMA 2APFA 5C2BL 2W91A 1LD9B 4TPRH 4Q6YA 4WJ5B 3P0GB 1QTYT 3MLRH 3KDMB 4KGJA 3VG0H 2DQGH 2GY5A 1G7JB 4AQ1B 3CIQA 4IRZL 2PXYC 1O7VA 2FIRT 2D31B 3E0GA 1CGSH 1U8MB 4Y16A 2WSKA 5GS1A 1U8LB 5J0BA 1UA6L 1IAMA 2XXMB 3OG6B 3O2DA 5ACMA 3UAJD 1N5AA 4JGJA 4MD5B 4P9HH 5KOVC 4NDMB 5EZJB 5E4EB 1K4DA 3CU1A 2BFVH 4RQQA 5D7IB 2VDOH 1P4IL 3RGHA 4OLWH 4ZMAT 4OSUL 2BK8A 4YXKL 3MA9L 4WCYL 4CVUA 4MA8H 3TA3C 1C12A 2XICA 2Z8RA 1EJ6A 1C08A 4LKCB 1T21A 5EOCH 1V3JA 3FMGL 4OQTA 2DYPD 5D7IA 5F7DA 2ZOKA 3TPKA 3T0WA 3CVIL 3LKNA 3O3BA 4ZUUA 4FQIL 4PLOB 1EAPB 4OD3H 1IC1A 4M9OA 1OAUL 5TDOA 5IT2H 5HDOA 4C56D 5F7KC 5D2LA 2K7PA 5BMFL 4H1LA 1LEGB 3BN3B 3ZDYF 2EYTB 4LLMA 1G7LB 1R24B 4NZTH 3B5HA 3MRRB 1WLHA 5GHWL 5EOQL 3MLUH 5IMLB 4N0FB 4OLYL 3MRPA 5D1XC 2HN7B 2QQLL 5F1KC 4NNYB 2Q6WB 5HY9B 4L8BB 4J4PD 3U0PA 1BD2B 1CL7L 4HLZG 3IU3A 2PF6A 3IFPA 3FQXA 3K8LA 4HKJA 3ARZA 4V2CB 3VWKC 2PR4H 1VGEH 3I6LD 4PY8J 2W38A 3ARXA 1SM3H 3ARDB 5C3LD 1NAMB 2HFGH 3BWAB 5JHDD 1FCGA 3TCLA 4JN2A 1G9MH 2M2DA 3QXAB 3ECBA 1CXFA 5DMYA 3S35H 2X05A 5EIIB 5C09D 5ADOL 3EO9H 1ZANH 4YGAB 3IDUA 2RQ8A 4U1MB 2IQAA 5LBSL 2PO6B 4PJHF 2VZTA 4R7DB 4F7PA 1JWUA 3GBLA 4PJHA 3M45A 3EFFA 4O9HL 5DMGC 4GBXB 7FABL 2VC2L 1MFAH 2Y07L 1BBJB 3FQUA 4Q6IB 4UDTA 4P2RD 2YUVA 3U30C 4E41A 2UZIH 4JZJA 1K9TA 4MAUL 2NY1D 1UKQA 1RSFA 3FB6B 2R1WA 4FZ8H 1H3XA 1LP9B 4WDIB 3DVIA 3K1DA 2VDML 1I1AB 2C3WA 5D7IE 4J3VA 3VFMA 4OCLC 4TNVF 4Y0GA 2P46B 1NC4A 1BZ9B 1H8NA 4PJ8A 4IRSC 4NZUL 4CVZA 4YHYB 4NKOB 3CC5B 1YEKH 2HKFH 3HNTL 4JJ5B 2CKNA 1DQLH 1QNZL 1BLNB 3SDAA 3FMGH 1T22B 3H3BC 4OM0L 5GGTL 3VFVB 3W5NA 2EYSB 2X9WA 2ZUYA 4XPBH 3DVNB 5GGQH 2BVPB 3DYMA 3H9ZA 1TENA 5FYJD 3SQOL 3IDNA 3SDDD 4JR9H 1I1CA 5I0DA 1N59A 1YQVL 2YMXH 1FCCA 2HFEB 1HNFA 2EC9T 3ZDZE 4HS6B 1EBPA 4NGHL 5C0EB 2P8PB 4NC1E 1HEZB 3UPCA 4P5TA 3VFRB 2DI7A 2X4QA 5HHOD 1P4BL 5C0AE 5IFHL 4JRYE 2HP4A 1I3VA 5EUOF 4CN4A 5BZWA 4P2OB 2RB8A 1ITCA 5IEKB 1I8MB 4RDQG 4RAVA 2VH5L 3WFEL 1F3DH 4GKSB 4CAGA 5T3XL 4FQLH 4OD2A 1SEQL 2X4PB 4XCEB 2DDQH 3MX0A 1G9NC 3S37X 1WISA 1T6VN 1Y6KR 3HMXL 5I76B 1ZTXL 4YWGL 2ATPB 2R56H 4CADB 2VLJE 1RUML 4AEEA 2UUDH 5DTFB 5B39G 2H1PL 2VQUA 4YBQC 4MNGE 3VXSE 1GCFA 3SGEI 3MRLA 3L5XH 15C8L 5CJXC 4R26H 1M71A 3ZSSA 3STLA 1RUQL 2Z31A 5MEOB 1VKXB 2V9QA 2CLZB 3GHBL 1QD0A 2ED7A 4DN3H 3HA0A 3CLEL 1QBAA 5GS1C 3JWOL 1TIUA 4LDEB 4FFYL 1J8HB 1DEEB 1W0WA 2AV1B 1JE6A 2VXVH 2FX9L 4HKBB 2UZXB 1G7PB 4Y2OA 1QVOA 5AD0B 5DD5H 4XP9L 1A5FH 4HK0A 1RIUH 2XG4A 1S5IL 3RWHA 1BQHB 1S3KH 2NX5E 2FZ3B 3KYNA 4PRIA 4JRWA 4Y4KA 2FL5B 4QXGL 4OZGF 4ZO6A 1IGJA 5GS1B 4Y4FC 4R3SB 1MCHA 4FZEL 1MUJB 3LQMA 5SWSA 2KQMA 2W60A 1LVEA 4G8IA 4HJGB 2CO6B 3RKDD 4FQCL 4NHCH 3G08B 3DXAB 4WY7L 4N5ED 2BY0A 3VD4A 3L9RA 5CHNA 3N1FC 4DTGL 3I2CH 2DD8H 4Y8AA 4JKPL 2Y5TA 1URLA 1D9KA 2K3TA 4ZO9A 1LEIB 3KPLB 4JRYA 4ZXBB 5CP3H 1CF8L 2KDGA 3MOQA 3CCHB 3NFPA 5FYJU 3HE7A 4CW1A 4BUGA 3HCVB 1KYOK 3BH9A 3HUJF 1X6LA 4Y5XA 4OLVL 1U42A 2ARJB 1UB5A 3OKOA 3I02B 3VD9A 4JG0H 3D25B 4PRBB 2YXMA 1ZLUK 1DLFH 1XH3A 3G08A 3FRUB 3T2NH 5FCUL 2Q8AL 1OOAA 2EC8A 4LEOB 4X9FA 3L3KA 4NQSA 4NQCB 5DSCA 5CBAB 1J1PH 3EZJB 4MNHA 4FQHB 2AV7A 2YD1A 3KJ4C 2V9RA 4OM1L 2VOTA 2HJFB 2V7HA 3ZKXC 2X1QA 1ETZB 4JO1L 5DUML 4MMZC 4XWGH 3U0TB 5C0ND 4U6HB 4CU8A 4ZFGL 2F53A 3M1BA 2MCPH 2YRLA 3QDMD 5IOPA 3OX8B 4XAWL 1WEJL 1XGQB 3S88H 4P23A 1AQKL 1IC4L 3WIHH 3JV6B 4L3CB 4S1RL 2CXGA 5FDYA 1A1NA 3S96A 1OF2A 4JPIB 3V7MA 3O2VL 1UZ6E 5HVWA 3WUWG 5E2VH 5JORA 2J8UA 3RY6A 1J0KA 3L5HA 4JFFD 2NW2A 1KF9B 4RFNB 2VL5A 5E2WL 5HHNA 4ORGA 4XI5D 3CVHL 1CFTA 4MAUH 4G43A 2EO1A 3H9SB 3SBWC 1RK1B 5FUZL 3RVUC 3T8XB 3ZYOA 5I8OL 4PS4H 3KPSD 2GYSA 1JMZA 4MAYC 5F7EH 4DW2H 1DBAL 4F58L 1ES0A 1UXWB 2FCBA 3VH8G 5TDNB 5F44A 3UC0L 4FXKB 4MA1C 1OAQH 4OJFL 1U8OB 1ZT1A 4RFNC 4DCQA 1Y0LB 1DQDL 3DETC 3DX8A 3EYSH 4ZUSA 5I2IB 4P9HC 3X14A 5KANG 1XF2B 3LCYA 1RD6A 5EC1A 3V4VL 2GK2A 1YNKL 3TH3T 4GJTB 1MELA 3O11B 5KSAB 1HSAA 2A9ML 4LSPH 3RGVD 1QFWI 3BFOA 1MUJA 5JA9A 1WBXB 4YO0B 5DMGD 1S7SB 1EZVX 1YJDH 3PIQB 1RHHA 4HD9A 4YDKH 1MCKA 5F1IB 1P1ZA 3GSWB 3OR6B 3AAZA 1ZSDB 1JZ2A 2VIRB 4G8IB 2Q76B 3RZCC 2LU7A 4NJAH 4NT6A 2V2TA 3E6HB 3U7YL 3RVWD 2ZSWA 1NC2D 1OSPL 1WT5C 2CDFA 3BP5A 1ZA3B 5KSAC 4ZXBD 1OAXH 5CZXC 2FH6A 3KNBB 4XT1C 5DYOA 2BC4A 4M02A 4PJGB 2Q76A 2Q86B 2VN4A 2VDQL 1R3KA 3MRNB 1X5IA 4EXPX 1U3JA 2CRZA 4HKBA 3D0VB 4X6CE 4NC0B 1ND0B 2QR0B 4JO1H 3OHXB 3EO1A 3ZE0F 4DN3L 4LMQE 2FBOJ 3W0WB 4URTB 2ZJSL 3C5ZB 3KYNB 1MHHB 4CN1A 3PQYE 3UP1A 2VSCA 4CADA 1T7ZA 3HG1E 8FABB 5IMMB 2V7NA 1CCZA 1VFBB 3MJ9A 4XGZB 1MFAL 3DMMA 4FFWC 2H32A 4PRNB 1BF8A 3S7GA 3GI8H 1DBJH 2A9NL 1GC1H 3UO1L 3CX5J 2OTUA 5CJOH 3FO1A 3GIVA 5ISZE 1WBZB 1WJ3A 3GIZH 3QAZC 4BFGA 1MLCA 2OP4H 3W9EB 1SEQH 1L9NA 3NFNB 4GW5A 4ELME 1UXSB 3DSFL 2NY2D 1ZGLB 5KSBE 5CCKH 4M1GH 4Z9KB 1CDGA 3MJGX 3VFRA 1N7MH 1U2CA 4F15B 4GAGL 2VLRD 4JG1L 4EUPG 5E6IA 2FJHA 3U83A 4YUEL 2MSPA 3P30L 1IAKA 2LTQB 1YMHB 1JGEB 3BKCL 3U9PL 3L3GB 1QO3B 5TJWK 4XTRC 1U2HA 3ARTA 1E0OB 5IMKA 1HOCA 3LDBC 3MRMA 2VZ1A 5E2UL 1JCKA 1P7KB 1X4ZA 4JKPH 1XIWD 3JWDH 1U58A 2GJ6D 4PY7B 4X6EA 3BRDA 2E7CA 4F15C 1IKFL 3QUYA 3FO9A 5D7JD 1U8NB 3DGGA 4OFYA 4YHPB 5FUOL 1MVUB 2IGFL 4X4XA 2GIYA 3K46A 3LSOB 3TFKD 5HI5D 5E8OB 4UU9A 5GRUL 2BRRL 5CJBA 4UB0L 2WLYA 4TUKL 2HVJA 1YY8B 4MDJA 4X5LA 4X7EC 1YN6B 1ZOXA 2RCSL 3S34L 4N0RA 4WUUB 4C4KO 5JQ6H 2QADD 4AG4L 4HUVB 3VWJC 4PJDA 1FIEA 1J1OL 5HYJE 4DK6A 4WI4A 3MUGA 1FNEA 1HQRA 4QHLB 2AJVH 4P48A 4C83B 3TO2A 3V79C 2O5ZH 1A6AB 5KSUA 4FXLA 1GGCH 25C8L 4F7PB 2C1PB 2YA1A 5KAQF 1HSAB 2G9HA 3QDGA 2CXKA 4JFPB 3GDBA 2YZ1A 4Q6IC 3O9WD 3JSSA 4TSCL 3VXRD 1HE7A 3RNQB 3EO0B 3QDHA 2NTSP 4JRXB 4ORZC 1C1EH 3QNXB 1UWXH 1MCWM 3ARPA 3KLAA 2FEEL 1SJXA 5IK3A 4P59L 2EXYD 1Q9WA 1REIA 1ZHNB 1NGPL 1IZJA 1SVCP 4MNQE 2DQIH 2XN9D 1ZT7B 3EHBC 1QSED 2CLRB 1WSST 2B0SH 4I4WA 3V7AE 3WHXB 1N0XL 1NFDB 5ABDE 4PJDB 1QP1A 2EDXA 3ARVA 3RWFB 4R90H 4NKOA 5MENB 1DBJL 4X98B 4UQ2A 4GO6B 3ARBA 2E7HA 4NQSB 4NQCA 4EBQL 3VXSA 3QPQC 4LHUA 1DE4B 2YWYA 4Z95L 4D3CL 3DSFH 4I5BB 3A67H 3GK8H 3M17B 4GBXC 3MXVL 2OTWA 1TDQA 1N5YL 3CDGA 1T5XB 5T1LA 3Q48A 3VE0B 3DRTB 1EHLL 3BRFA 2N4IA 3G9AB 3HE6D 4IDJH 4X98A 1LP9E 3RIAF 4EIGB 3BMVA 4NZRL 4PJIF 1FBIH 4KJYB 5HYJA 4HWZA 4NWUL 3R4DA 5IROC 3U4AA 2DJ4A 4AQOA 4EUPB 5I8CB 3T3MF 5GZOC 1LD9A 4E5XB 5EU7E 5B4MD 1WBYA 3B4NA 1A21A 4R0LB 1S7VA 4RGNE 3X13B 3MFGB 1CXKA 2AV7B 3U7WH 4G9FD 1S9YA 4HT1H 4NJ9H 3LZFH 4Z7UA 4RGOL 5E00B 4HS8L 4KTDL 1KLGA 3D0LB 1E27B 4KHXL 3O9WB 4UILL 3VWKD 1T21B 4WO4C 1S7RA 3OKLB 2LVEA 5EOTA 2EE2A 5GJSH 3L5IA 5D2NE 2M8XA 5F88B 1ACYH 1NEUA 3QG6B 3WJLC 4MXVF 3FN9A 3MLWL 4U7SA 2VLJD 1JL8A 3GJFK 1VACB 1YNTB 4G6AD 4RMUA 3NIGF 4LDLB 4P3WA 3TO4D 3HZVB 3RL2A 1QSEB 3P4MA 2VZOA 1MHCA 3RL1B 2VXUH 2HFFB 2AJ3A 4KWUA 1P5UA 2A6DB 3K3QA 4UNVA 4Z78B 4R0LA 3LVEA 4BSWA 1W0WB 2AV1A 1FG2B 1T1ZA 3E6FB 4XBPA 2X4QB 1F00I 5EBWB 4OCXL 1G6RA 4X9HA 3U36B 3RKPA 4G7YH 4U1KA 3ZKMD 1LQSR 4OCWL 4X8JB 4L3EB 5IMOB 1CLOL 4JFEB 4WUUA 2EDWA 4Q9QH 1QR4A 3FT3B 5BRZE 5KSUB 1T0PB 3Q6FB 4KC3B 3V5DA 2VDLH 3MV7B 1OT2A 1FNEB 1I4FB 4LGPB 3GGWA 1A3LH 5FHBL 4IS6B 3F8UB 1U3YA 4BM7A 1HYRC 5BVPH 1DN0B 4AMKH 2ILLA 1JF1B 4JFHD 4I0CC 2DLFH 3WV0A 5IMMA 4PP1D 3O4LA 4HUKB 4NKMA 2DICA 1OPGL 5ACZA 1MAJA 1HXYB 4FQQB 3NABL 1KULA 2BHYA 1ND0A 3LKSA 1G6RL 4X7FC 4H25A 4O02H 5GRXG 2EDRA 2CPCA 3G6JA 1GHFH 1CD9B 1T20B 4LSSH 2DKMA 2R69L 1FV1A 3AROA 3O2VH 1MFEL 1PQZB 5F9JB 4LMQI 1IGIH 1KN4H 2R23B 2UUDK 4R7NA 2KZWA 1KPRA 4N0YL 5DJCB 5HGAB 3WIIL 5KS9B 5JO5A 4JM4H 3MV11 3E3QC 2WWMD 4XB8A 1NGYB 4XC3L 1LE5A 1IFHH 2R2BB 2OZ4L 3EYUH 4KK9C 3DVFA 1FNAA 5DRZA 3OR6A 3ZKXB 2EDHA 3X12A 3PL6C 3HAEG 3IJHA 1KYOJ 3BKYH 2YBRA 4JJ5A 4JDZA 1AO7A 4LGRB 3OAUL 3AY4A 4HH9A 2P5WB 3W39A 2EYRA 4XVSL 2JIXB 4KVCL 1V7NH 2FSEB 4XVTL 4PTUA 1V7ML 4E0RB 4C56E 4O2EA 2EDYA 1CIUA 3DHJA 4TOYL 3GSVA 3SKUD 3ZO0A 1LO2L 2P8PA 4KI1A 3MMEB 4G7VH 4K55A 4DN4L 3T3PE 3D0VA 1ZT4A 2N56A 4W6YB 2ESVE 1N6QH 2XA3A 4X6DE 4P2YA 1V5JA 4OF3A 8CGTA 4XPBL 4R2GD 3FJTA 3C6SB 3GSNA 4XX1E 2EYSA 2BHUA 2HJLA 2FWOB 4LPWA 2P7TA 5BZDA 1FAIL 3GI8L 3UYPA 5HI3C 3NA4A 1GGIH 4RZCB 5D1ZC 2NR6C 4YFDB 4KRPC 3GKWH 2QQNH 5A43C 1N4XH 5BW7A 3V52H 1I7RA 3G6JE 1T1XA 3IAPA 2Q7NA 2G5RA 4DCQB 1OB1A 5KJRH 2VDPL 4G80B 2UZIL 3HPJB 4QY8A 5T1LD 4I18B 1JFQH 1HQ4B 2E27L 4KPHH 1AIFA 1AJ7H 1CGXA 5I1JL 3DLQR 5GGUA 4D8PA 5SWQA 3WLBA 1FZMA 1BOGA 4C54A 3PGDA 1HKLL 4MJ6B 1GSMA 3REVA 4JHBA 1ZANL 3DO3A 5IMLA 2OX5A 3NCFB 4PRHA 5KS9F 2BVOB 2J8UB 3QPXH 1S9WB 4OFKA 3CFKA 5C0IA 1EERB 1IGYA 2AJSL 3NAAL 4KJWC 3CFJA 2PYEB 4U1SA 2X89A 1QLRA 3EHBD 5D1XA 3CK0L 5DWUH 5EZJA 1WZLA 1CFNB 4N90E 4Z7QF 1P7HL 3MODH 3LH2H 3VFGH 1R0AL 4GKNA 3GSXB 4HC1H 5I8CA 1B88A 1INEL 2NX5A 1FO0B 2EH7H 5B22A 5JPMA 5MI0B 1J05A 1M7XA 5GJTH 2FRGP 1KXQE 3CUPA 3DRTA 5K9JH 1TQCC 4HXBL 4NNPL 4EZMA 4JRYB 1KIQB 4OZ4A 1ED3A 3MLWH 4IMLA 5ALBL 4P2OD 4OI9A 1YMME 3MLYL 2Q87A 2C7UB 3VGAC 4P4KB 1R5VB 1U95A 2EDLA 4EUPA 4NGHH 5I17B 3AC0A 3B6SB 2IALA 1OGTB 3NA9H 1QRKA 2MNUA 3G5XA 4F7EA 3MRBA 4TRPH 3FTGB 2NXZD 2OXGA 3ZSTA 1J10A 2CGRL 2L7UA 1XGPA 2FDBP 2VSDA 1T4KA 4M6NH 1G7HA 4MJ5B 4LCWB 1MRCL 1R3IL 3U7WL 2ZNWA 3Q3GB 2IALB 4M5ZH 5DJ8A 1U8QB 2VAJA 4QXTA 3G5VB 2I5YH 3SGDH 6CGTA 4OV6F 3C08H 1JUFB 1YC7A 2MQCA 1J87A 3WUWB 1CGTA 3KJ6L 4R4ND 2EDQA 4N90D 2WUBH 3TCLB 1P9MA 3FRPA 4R2GB 2AJXL 4Z5RA 4Z7WF 5CSZB 4H26A 5ICXA 3CXDH 3GMRB 4X5WA 5FOBB 3BGMB 3PWPE 4ODXA 5TE6H 2HMID 1M05B 2PYFB 3CDGB 3K80A 3JTTA 3AU1B 5I16B 4U1HA 1PJ9A 3QEHB 2BY1A 3C87A 1IGFL 3BI9X 3FTGA 3FONA 4B53A 1WFUA 2WAHA 3DO7A 4LLWA 4DZBA 5FYJE 3BP4A 1V05A 3FQRB 5DVKA 4AIXA 3AM8C 4MSWA 1Q0YL 3ULUF 3A6BH 2D7OA 1L0QA 4XPAL 4G7YL 3DMMD 1IJ9A 3WNLA 4U6HA 5SWZD 4LQ1A 4E42B 3DOSA 2H2PD 1RUKH 3UBXA 2BY3A 3QIWA 3MRCB 5FB8B 4R90L 5ID1B 4TNWF 1LO0L 1AGEA 1U6AL 2DQTH 3GM0A 1NPUA 4HK0B 4LL9A 4AM0B 5IB3B 1JYVA 3WLBB 4H26B 4QTIH 2BJML 1P6AB 3VFMB 3V6FB 2FYYB 4LQFH 3ULVE 2DWEA 2FGWL 5D7LE 1NEZG 3V0VA 1R0AH 3FO2B 4OZIE 4ZDHA 3H0TB 4MMXC 1P7QD 1YEEL 3OB0K 4RDQF 2J4WH 2IH1B 1SYSB 5HHOB 4XHQA 4TTGA 1S8DB 2F58H 1WAAE 3MRIA 5D1XB 4R96B 1A6PA 1QUNA 4OB5L 3X12B 3VDAA 1U3ZA 2R2HB 2O61B 5F1NB 5HHPB 2ADJB 1DFBH 5IHZB 2GW5A 5CZVH 3CX2A 4M7JL 2CLRA 1ADQA 1I1FA 4PJEB 1NSNH 3QQ9D 1T0MB 1NCBL 1XCQA 5DJZB 4KZDH 3LQAL 2G75A 4WIQA 4HCRA 5JOFA 3JTSA 2VLJA 1UM5L 5DUMH 1QQDB 4OLEA 2O61A 4QRUB 4POZC 3H42H 3SQBA 5BCAA 4XP5L 2VLKE 3BXNA 3PWNB 3QEQA 1MJJB 2B8OT 3TP4A 1XAUA 3MJ9H 2E9BA 3U0WH 1FAIH 5DO2C 1RZJC 4JN1H 3BAEH 4H25B 5JXEA 2C1PA 3T2NL 3PP4H 5TFSH 5E0QA 3L3OB 1HQRB 1KJ2L 4PRAB 4Y4KB 2HJLB 5FUCE 3DUUA 1XGYH 3F7VB 4OTXH 1PVHA 1MRFL 3NCEB 4G8GD 3MV8B 2NXZB 3RUGE 1QKZH 1RZGB 4KFZC 2R0KH 4FTVD 2XACC 3DRQB 4QOKA 1LO3L 1OP5H 4ZTPH 3QZWA 3S5LG 1OGAE 3LKSB 2JKXA 1JNNH 1FNGA 3EYVA 4LRNL 2YPVL 3NIFF 3EGSA 1B0WA 5C2BH 2E7BA 1PY4A 4GKOA 2VQ1B 4NN7C 2ZUSA 3IVKA 4OGYL 1KPRB 4NQCD 4IRSB 1W72A 2ICWJ 3T09A 1CGSL 1KEGL 2AK1L 2AI0L 4B7IA 1L0XA 3W11C 2CLVB 5I16A 1V3MA 2VQ1A 3MRJB 2FATL 4IM8A 3QDMB 3IDXH 1QSEA 3DROB 3X11B 5F7WC 1L6ZA 5ADPL 3LIZH 2PUQT 3IRZA 4PJAA 3OSKA 2HTKC 1NCCH 1PZ5B 4NHCL 1A7RH 5HI4D 2ED8A 5IM7B 3HB3C 4WFGE 4FXKA 1T1ZB 4OGXH 4X7TB 1T7VA 5BOPA 3RFZC 4XB7A 4HXAH 1QFWM 1CGWA 1O5DT 3QDGD 2I60H 3TH2T 3O9WC 4I9WD 1A14H 2EDFA 1KN4L 3LY6A 4ODSH 4Z7UB 5EU5A 3GI9H 5C0BD 1N6VA 2R9HC 4Y2DC 4QRTA 4PRPB 5CZVL 4P5KA 4BK4A 2DOCA 3LB6C 5JDJA 2DJUA 3H0TA 4M1DL 2IG2L 4NQDE 5GS0C 4G6ML 1S7RB 4FFWD 3V0VB 1OHQA 4IOFD 5FO7B 2LAGB 1NCNA 1I1YA 3U4BL 2IGFH 5GJTL 5BS0B 1MREL 3MRQB 1CFTB 5C7XL 2R2CA 3HZVA 1OTSC 3KNBA 3DJ9A 5FO7A 5EZLB 3LQZB 2E8YA 3ZYIA 4NNXB 2XV6B 4HF5L 5DEGB 3EYFA 2FEDC 4S11A 5C08B 5ERWA 4NM4L 2OP4L 4QXTB 3NACH 4YHNB 4MA3A 1WFOA 3PWUB 4K8RC 3EW3B 3FAWA 1KIRB 5FA3A 3EJYD 5K9KA 3O2WL 3TBTB 3OB8A 2MKLC 1UKSA 3WUWA 2OMBA 3KYMA 1VADB 1CT8A 2IFFH 1N7ML 2I9TB 3X14B 2VLRA 1WBXA 4YO0A 4BQ9A 1I7ZA 3PL6B 1FL3A 1J1XL 3LKOA 3H9HA 5AYUH 5I75C 4K2UH 1U3HC 4O51B 3O3DA 3H2WA 1WFTA 1KIPA 4LCWA 1MCQA 3GJFA 1CK0H 3SHSA 4OQTH 1GOGA 3BQUD 3BN9D 3DIFB 3IXTA 2F15A 5EB9A 2IBZX 3T8XA 4IJ3B 4N8VG 4C57C 1A64A 3QR2A 5E8NA 5JLZA 4U3XA 4HIHB 2BMKA 4PRHE 3H3PH 1CFVH 4YXKH 3WEXB 3ES6A 3GSQA 4XHJC 2YD9A 3KHQA 5D1ZA 1NDMB 3C8KB 4G6AC 4PREB 4F33A 1XGPB 1ZWIA 1MIMH 1F90L 2N7AA 1CFQA 4P23C 3UTPD 5FM5M 4AM0A 1NFIB 2NXYC 4XBGB 1ZLUH 2G5BA 3WNKA 1YYML 3QFJD 3TNMB 2VDRH 2XZAL 5D1ZB 2A0LD 3UCRA 1P84J 3WL9A 4L4VD 5CHNB 4KQ4H 4LSVL 3G6AB 1F4XL 3AS2A 4XNZB 1NC2B 1NLBH 4TRPL 4D0BA 5TQ0H 2NY2B 1I8KB 5HYJB 2AK4D 4JO4H 4NUJB 2GI7A 4WWKB 4NYLA 3SGKA 1T4KB 2WP3O 2HJKA 1JPST 3P9LA 4HGWB 2BJMH 5EUOB 3KPRD 2HA1A 5DFWH 5BV7L 5CBAA 4I77H 1SY6L 2VLKD 3K1KC 1N6UA 4QXUH 4HDIB 4JANB 4ONHA 2R0LL 1INEH 5DJ6A 4RX4D 2QSCL 5DK0A 2JIXA 5D93C 2QL1A 4CMMB 3VMOA 3E2HB 4Y5XC 2C4FU 4S0TD 5IQ9A 4WTZA 5C3TA 5GGUB 1TVDA 3SDAD 4MWFA 4Y4FD 3N1QC 4Z7OF 4LCCC 3IKKA 1IQWL 3QPQD 1ZGLA 4GSDH 4JLRA 3OXSA 5BOZG 1B3JA 3CH1B 3ZL4L 1KJ2H 2A6JB 4OZHB 3HR5A 25C8H 2J3SA 1UB6B 2AABH 2GSGB 1Q0XL 1UJ3B 4KRPB 5FO8A 5JIKA 4KRMB 2AJVL 2DM7A 3ILQD 4KZEL 3KPOB 1IAKB 4LNVA 5T3ZD 4NC2B 4UOW1 1H9VA 4M3JA 1H5BB 3QEUA 3DUSB 3QUYC 4P2QD 1S9VB 4OZFA 3P9LB 5EUOA 2YSSB 5FGCE 5DFVC 3KPSA 2YPLE 4OV5A 2FGZA 3VRIA 3DWTA 3X3GL 4QY8B 5D7JC 1R3JA 4BZ2H 2J7LA 2H6PA 4UIKH 5ALCL 3BW9B 4ENEC 5IM7A 3D3VA 2B7DT 1N3NB 5EU4B 4M6MH 3W0WE 3CJJA 5KVFL 4YXHL 3GMQA 4PJFA 4LHJB 2FBJL 3IKCA 2MTPA 4MA3B 3KPQB 2EIBA 4PD4J 3VD5A 1NGWA 3F7VA 4LKXA 2X4OA 1PG7W 5HD8D 4JO2L 4X9BA 4UUJA 5DRXA 1QRNE 5D72L 3GSUA 4MD4B 5GGSA 3Q1SL 5E8PA 2NYYC 2WK2A 5C9JB 3HAEB 5JHDA 2CK2A 4M7LT 3O6FB 5HVHB 3D69A 3KPQA 3VCLB 4FQ1H 4GXUN 3PWPD 3U46B 5KS9A 2KL6A 1QSFE 5KVDH 4NWUH 4I9WE 1HXMB 1IM9B 2DWDA 3DIFA 3O6LH 3ISWA 3DI3B 3GBMH 1R3JB 2R2BA 4NP4H 5GRVK 2C3HA 3C09C 4P9MH 3ELAT 1KTLA 1PSKH 4UDTB 4PRIE 3W9DA 3SKOB 5T33H 2CLZA 3ZKMC 5C6TH 2A73A 4DGVL 5HI3D 2P5WA 4OD1H 3W39B 5AZ2H 4LOUC 4TYUA 1BJ8A 3CDYA 1JNHA 3PQYD 4YHOH 4XPGL 3MLTB 2OZ4H 2CRMA 4XBEH 3MRGA 4P49A 1LE5B 2OQJA 3C5ZC 3P0YL 1CD1B 5A16A 3L3JA 1NAMH 1ZMYA 4JZNB 3HNTH 1EBAA 1HYSC 4IRJA 1IGJB 3O2DL 2QSTA 3C5ZA 4ZNEE 1QLFB 4Y5YC 1BFVL 4QHUB 4XCCH 1U8IA 3MNWB 4PGEA 3QQ4B 4AL8H 2XY2A 2XA8L 4FN0A 2IPUK 2XTJD 4XNUL 4DGYL 5C0AB 4IOIB 2WWKO 4OM0H 1QRNA 3QH3B 4KZDL 1OSZB 3BQUA 2XNAA 4AJ0A 1GAFH 3H9SD 4YGVB 1UZ8B 3B9KC 4CVWA 1A1NB 1TJGH 3ARQA 3DBXA 2NPLX 3MOAL 4O9HH 4KXZI 4JN1L 3GSRB 3PGCB 5ANMA 1JZ6A 4YHML 2WWMC 2BVPA 15C8H 4XVUC 2NY4B 1RY7B 3FO2A 4UIKL 4JQXC 4UV7L 2X10A 5L2KE 3KPPB 3QEHA 3FN3A 1MCSA 1I1AA 4Z7QE 4Z7VE 4PJ5D 4AMKL 4EBQH 1S7XA 3VXSB 1UJ3A 3BGMA 4ZOCA 4MNQB 2Q8BH 1LEKB 2F53E 1BD2A 2MKWA 5DA4A 4L4TD 3SKMB 2HT3D 4K3JH 5KS9E 3VFSB 1B9ZA 4PD4K 1FN4A 2CSPA 5JIIA 1TZIB 4XH2A 1FH5H 2W92A 1AI1H 5HGBA 4LSDA 4Z76B 3B9DA 5EBWA 3VFWB 2XKUA 3VRIB 3L3IA 3MNZB 2A6DA 4YBQD 1J0IA 4HGKC 5C0GB 3PWNA 2R0WH 4OIBA 2Y36L 1LE9A 3SO3C 35C8L 3LKNB 5EU3B 3MTRA 4P46B 4YDVB 1SYVB 1FZOA 2XI9A 4MWFB 3L3IB 4CMHB 4G6MH 4L3EA 1JPGA 1I9IH 2K9UA 2XN9E 5GSVA 1R24A 3OPZH 1L7TH 4IBLT 2YRZA 2NR6D 5EO1A 3QDJE 2W0KA 4UQ3A 2NTFA 5HHME 1HDMB 5IF0B 4KVCH 5GJSL 3GEWB 2JJVA 3FQXB 3E6HA 3MA7B 3H9SA 4DGIL 4CN6A 2HVJB 4MDJB 3HMXA 4NYLB 5FFLA 1ZWIB 1I3GH 1SHMA 3O3DB 1ZSDA 3ARDA 1E6OL 1AY1H 5DF0A 5E8EB 4L3AA 1QFPA 5A2FA 4PGJA 1PKQB 1ZS8A 1I1RA 2B4CH 4LASL 1CD0A 1H0DB 2YUXA 4UT7L 4QHKI 5LWYL 4BSVB 3UBXI 2F5BH 1NUDA 2XZAH 5LCVH 4HAGA 3K81A 3PQYB 5JW4N 1ZVSB 4NUGH 4A6YL 2ZPKH 1CTOA 5SWSB 4Y4KC 4J8RB 3TV3L 3NZ8B 4JPWH 3U6RA 3T77A 4MJ2A 1NC4D 1X6NA 5ID0B 5I18H 5DVOA 1KIPB 1H8SA 3TVMD 4Z7VA 2X40A 5H8DA 2YUZA 1NCDL 1UWEH 5F6HI 2I07A 5JXAH 2DQUH 2YD4A 3S8WA 1D9KB 4AT6A 2IMNA 3GSOB 2AERT 5CSZA 2AJUH 5J3HC 4AIOA 3RWGA 1M1SA 1RIHH 3QG7L 2ZNXA 5BXFA 4W81A 3RX7A 1NFDA 3JTTB 3BJ91 2R2EA 5DMIL 3RZCD 3I6GA 5TE7H 2QADC 3GSOA 3UMTA 1OARL 1WAAF 2BZDA 2GJZB 3O4OC 1E6JL 2NY3B 5E2TH 5F6HJ 1E28B 3FFCA 4I5BA 4J6RL 3SDDA 1ZEAL 1QA9B 3SN6N 4K7FA 1T1WB 1JGDB 2EKSA 3QPXL 5CP7B 3ULVF 1WIOA 4M5YH 3RPIA 2JJUA 3QIWB 4RFOH 1T2QL 5TQ0L 3KYAA 2OYPA 4JM4L 1G7QA 3OHXA 3H9SE 4PJ7F 4N0YH 1FVDB 2JIXD 5BJTB 3LH2L 2ZUQB 4IRJC 3VFSA 3FFCD 2EE3A 3MV9A 1M71B 3RWJB 3FQRA 5MEOA 4KK8D 5E6ZA 3T0AA 2OR8A 1NKRA 3KPRA 4N8PA 1WTGT 4LF3A 3K74B 3CFCH 3O6KH 2OR9H 4LAQH 1AC0A 5IVXA 2IH3B 1RZ7L 1S7WB 4FFVD 1EHNA 1LWRA 1NCWH 1XH3B 2ERJC 4OKVB 5HHMB 1I7RB 3P73B 4WGWB 2X5PA 1KJ3H 4M03A 4LIQL 5EUKB 4YHIB 5SWZE 4L4VA 2GT9A 4WGVB 3UTTB 3QA3A 5SWQB 5H35A 3V6BR 2VXTL 1EHXA 4QHLA 3QFJA 4NO0B 1J5OH 2C4XA 4Q97A 3ULUL 1G0XA 3O2DH 1YEEH 4M48L 3T2QA 4KZEH 4P2QE 4XCCL 5ESAB 5EU6B 4DKFL 4GG6B 2YZ8A 1KTDA 2VYRE 4HUMB 5KSAA 5HVGB 1GAFL 5IBLC 1YMHA 1JGEA 4HV8B 4ZS7H 5CS7A 4NFDA 1ORQA 2VAAB 5ETUB 4NN6C 2AW2A 5H94A 4CBPA 2MPAH 2EIZB 5FCSH 5B4MC 4PJHB 1X5GA 5AZEL 2JCCB 1NLDL 2HWZL 1EUTA 3C2SA 4OCYL 4RX4A 4YH6A 4YHOL 2VXQL 2ESVB 1YMMD 3LN5B 2W9LA 4PJDF 5IHUH 1ZAGA 4CDGC 4NBZB 4P4KD 2NXYB 3V9FA 2L0DA 1S78D 4JHAL 3VD3A 1E4XH 1PLGH 1HXMA 2EEDA 3QEQB 5L0QB 2DMBA 3MUZ1 2XWBB 5GGVL 4G42A 5DQDH 1HQ4A 1EH9A 2W9DH 3MACL 4M4PA 4LGSB 2A9NH 3S36L 4F2MB 1NC4B 2O5YH 4APQA 1AKJA 1U8IB 3VU2A 2D7NA 3MRHB 1XGYL 4OTXL 3AS3A 3I84A 1AQDA 1Q8MA 4O4YL 4O2FB 5ID0A 3W0WA 3U82B 3PDOB 4G9FB 5T1KB 1ZLSL 3UJIH 1QEWB 3OKKA 2FIKA 1RJCA 2XNAB 5E24E 5H2BB 1KFAH 4I8DA 5HY9A 5C09E 1FYTE 2Q6WA 3U0PB 4G8FB 1FH5L 3O11A 5ESQA 5HHMD 4B0MM 1BFSA 3OQ3B 4KU1A 4U6XA 1FQ9C 5FYKD 1FNGB 4S1SH 4G5ZL 1K8DA 2DLHA 1JWUB 2UY7A 5MEQA 5DQ9A 3V2AR 1M7IA 3WLWD 4I13B 4NO5B 3WXWH 1NCBH 3ZE2F 4UV4H 1YECL 5E5UB 4OBRA 4I1NB 4FXGB 4PJFE 4H5SA 3EDKA 2VZVA 5L9DH 1NFKA 2DTMH 4PJ5A 2A1WL 2J4WL 5EULV 1A2YB 2OJZL 4Z7WA 2XKNB 1S7SA 4TUKH 1MWAL 2Q86A 2ZP0T 4Y8DC 1HK6A 1IRAY 2BRRH 4PLJD 5C07D 4F57L 3HNSL 5EOTB 3TJEL 1T7XA 4NNPH 5FIEA 2XFXB 1UC6A 2JJWA 2CO7B 2ZSVA 3A0OA 3I3BA 4JVUA 3CSGA 4JDTH 4RMQA 5IHZA 4GMSH 4APQC 4KK6D 2GAZB 3ZHKA 4RGMC 4EN3C 5SV4A 1CU4H 5DK0B 3LKPB 2AK4E 2NY5H 1P6FA 1BJ1H 1C08B 5FGRA 1A7NH 1M7IB 1G7HB 3OX8A 3V4UL 5BO1H 4G8GB 3VMPA 1XIWC 3IGAB 5CD3B 1CGUA 2DQJH 5DRNB 4QKXB 4U2ZA 4YPGA 2MHAB 5E1AA 1JUFA 5H35B 4K3DH 1CL7H 1N2RA 3QXWA 3MCG1 1TCRA 3NBNA 5TE7L 2BSRA 2L4OA 1JV5A 3QCUH 3NTCH 4OLZL 3JV4B 4PJIA 3RTQA 1A02N 2AXHA 1OAKH 4H1LG 5HGDB 4YEFA 1UH2A 4AG4H 1A5FL 4W4OC 1QR1B 5JA8B 3BT2H 4I0PA 4MXQC 4XCFL 2OJEB 5EO0A 4JFZL 4R8WH 3QUMA 4ELKA 5EO1B 4UOW0 3RY4A 3QUXA 3B9AA 4N5EC 4G8GA 3LN5A 4EVNA 3HNVL 4PLKD 4ODHL 3EFDH 2D7TH 1JF6A 3QCVL 2YD2A 1BQLH 1C12B 5MENE 2BSSA 2MJWA 1MFBL 1QFUL 2GEEA 3LEVL 3ZHDA 4M7ZB 2EDOA 3HUJE 5IJVA 3AUVA 5I2IA 4G9DB 1FV1B 2X70A 2V17L 4PJ5E 2R0ZL 3X17A 1GGBH 1T0NA 3HFML 1KOAA 2JJSC 4MQTB 2ATPA 5JR1H 4YDLB 4JGUA 1L7IL 2DQHL 3CH8A 2BNRB 4P9HL 3KR3L 3AVEA 3CDFA 2C7UA 5ESAA 5EU6A 3Q0HA 1DP0A 2BFVL 1IL1B 5DVNA 3BKML 1QACA 5I8KL 4M93B 3IXAB 3C60C 4S2SB 2B2XH 4DKEL 1NGZA 3GK8L 4NNYA 4H0HB 1AO7D 2F58L 5C0DA 4PV8A 1W0VA 3TNNB 2EIDA 5GRWA 2PTTA 1S7WA 3L95B 4M5YL 1FVCB 1I75A 1YQVH 2YMXL 3B2UD 4Y5VB 1CU4L 3MBED 4JR9L 4NFBA 1R3KB 1SJHB 4QWWD 2B20A 1A6AA 4JHWL 3RX8A 2Z8VC 5HPOA 1KCKA 4ZTOH 2X4UA 4CW1B 1IAIM 4JY4A 5BO1L 3V4UH 5B38G 1WCBA 3NIDF 5C0BB 2HT4D 4JCLA 1G0YR 3BIKB 5D6DC 4UQ2B 3QNXA 1GZQB 3L9RB 1J1OH 1H3UA 3WDHA 4YDJA 3B8SA 3M17A 1PG7H 2IQ9H 4R4BB 3BEWA 3PHQB 3W9EA 2NZIA 3IGAA 1TPXB 2HTKD 2P5ED 4PJ9D 1BZ7B 3HAEH 1RIUL 3JVGA 3U9UA 4N68A 1A3QA 1L6XA 1KV3A 2ARJQ 2Y06L 3BUTA 4YDVA 3QQ3B 2J8UE 5DDHA 4TTDC 2BNRD 5BS0D 5AUMB 5DJDB 3TIDA 1F02I 4D9RE 3LPFA 1INQA 5EWIL 1LK3L 5D70L 2X7LB 2D0HA 3JWOH 5CIPA 3WHE0 4BK5A 4M7KL 2E6PA 3B9EA 1YY9D 4CNIB 4UAOC 3GMOB 3BHBB 5AUMA 4JY5L 43CAB 2OI9B 2OK0H 5LAXA 1T22A 4R97B 4KGLA 1CG9A 1YNLH 4FQPA 4X83A 4Q2ZB 1VKXA 3X11A 5CZKA 2ZCHL 4G8FA 3IDNB 4GQ9L 4PY7A 2QHRL 1CDHA 3CNKA 1KPUA 5SWZA 4EOWH 4KQ3H 5SX4I 2RJMA 4ZPTA 5AZ2L 3ZHLA 3TO4A 3ARGD 3GSNH 3SDAC 1JGUL 4UAOB 4O4YH 4GKZA 5CLWA 4CDHA 3MRHA 3F58H 3IU3B 2IC2A 1KPUB 1GGUA 3D87B 4OIAA 4XVSH 1IC7H 1A9EA 4LEXL 2ICES 3MGOB 1MJJA 2E3VA 4WI2A 4WTWA 3RU8L 4U6VH 3LN9A 1TZGH 2VJXA 4J23A 3GMOA 5E4EC 4Q0XL 4XP1L 4LCWE 3SDAB 2N7BA 1A6UH 4H0IA 5IV2B 5AYQA 1T89C 4TVPE 1B4JL 1NMBL 4LARL 3SDYL 4HT1L 4PB9L 1EFXA 4RNRB 3TN0D 4K7PY 2P5EB 4PJ9B 4XXCA 2I27N 4TSAH 4OZHE 4Y16C 5LGHH 4JRXA 3E3QE 1AO7B 1MCWW 4HPOH 3K0WA 2IQAB 3U4BH 4XNXL 5B3JF 1U8OA 1ZT1B 4GW4A 3E8UH 1RZKL 5E8NB 3CZFA 2J6EH 5DHYA 4OT1H 3EYVB 4MD0B 2VIRA 4KI5C 4L4JA 4Z7WB 4NN7B 4DEPC 5IMOA 4LSQL 3I3DA 2H9GA 3PE9A 2DJSA 2XQBH 1MFDH 4RGNC 3C9NB 5J6HB 1U9KA 3ARBD 3T1WA 4MLIA 1E4WH 5I1AA 1W72B 1UGNA 3ZKNC 5CMAA 2Z9TA 4OQ1A 1OTUC 4JFQA 3BOVA 5DYOB 2EDNA 4U1MA 1MJ8H 1DQML 1FJ1A 1B0GB 5TDPB 1L4IA 3WE6A 3V8OA 4R8WL 1D5MB 4DK3A 3GHEH 4QRPE 5DRWA 2XN9A 1CIDA 5DZLA 4Z7VF 4ZQKA 1MQ8A 4XXDA 1E4JA 2CRIA 1S5HB 1AR1C 1AP2A 1I8KA 1CLOH 3PG2A 4X6EB 3VWJB 3O4OB 4OZFG 3IJYA 1C8PA 1JWMB 1BZ7A 1IAIL 3DVNA 2RAMA 2ZKHH 2F9BT 5F7DB 2FJGB 3G5YA 3RWEB 1YNKH 5D1XD 4K3DL 2DQDL 3ZT6A 4PV8B 2HT4C 3ULUE 5IB2A 3CK0H 1CTNA 3FB5B 3FO0L 4JQVA 3JWOC 4AEHH 1NL0H 2O5YL 5FUZH 3QO1B 3IJSA 1B2WL 3LEYH 4FHBD 5K93A 5I8OH 3SDDB 4LP4A 1G9EA 5AWNH 1P4LA 1BQHG 4NBXB 3RWEA 1F97A 2PO6D 4OFDA 3VJ6A 3KPNB 1FVDA 3WD5L 4NKDA 2H26B 3D2UA 1QHPA 3GMRA 4MXQD 4X5WB 4ZSOE 5FOBA 3VFNA 4MB3A 2XTJE 3WFZA 4TULL 4GMSL 4PRDB 4NP4L 4XXDB 1FZOB 3JVGC 4WTXA 2B2XL 5EPMA 3O6LL 3RL1A 2CD0A 1EO8H 4HKJB 3CVIH 3D1MC 1J0HA 1RK1A 2NY1B 4AY0A 4L5FL 4RFEA 4JFYA 3RL2B 5FKPB 2O93L 3U79A 2RBLA 1I9RL 1FFNA 1I1AC 2BNQD 2ENYA 5FDWB 1RZFL 3JXAA 1QFOA 1ZHNA 3ALWA 3WIFA 5A2KH 2Z31C 2X70B 1RZIA 5ENWB 4ZFFB 4MJ6A 1VFUA 2BVQA 5TDNA 1I85A 2A38A 2VB5A 3EYFB 1CXEA 2P5EE 4WW2A 1GIGL 4I2XA 3HFMH 5C0AD 1D6EA 5ECJE 3QDJA 2NY1C 5L88L 2BVQB 5BS0A 1Q9KB 4NKDB 2Q8AH 5IW6B 1NBYA 1E4KA 1KB5L 2FJFA 2YEZB 3A6CH 3CU7A 3OTTA 4UUJB 1YN7A 1I4FA 4GS7C 5IJVB 1J1PL 3A6OA 1F45A 3GSXA 2VKXA 2R4RL 2VXSH 4DN4H 5EC2B 4RAUA 1K2DB 2EE6A 3GSWA 1X5HA 5GISH 4KJYA 1KIRA 4M9PA 4P2OC 4Z7VB 1KENL 2MFNA 3BH8A 4F3FB 4F37F 3CFKB 4D0CA 4C4KT 2C3GA 3RUGF 3BPCA 4NM8H 2O5XL 1ED3B 1CS6A 2IBBA 1CXIA 1U8QA 3I02A 4X4YA 3BGFC 1S7TB 5F7UA 1DE4A 3MXWL 4JFFE 3FOMB 4J1UA 1YNLL 4WFHD 4P23B 4AIZB 1G7IB 4QRPD 2DQGL 5HSFA 4JY5H 5MEPA 3WSQL 4LCCA 1Y6NR 5TDPA 3VGFA 3CCHA 3PWVB 1ZHKB 3WHXA 5HJ3B 2G9HB 4HLJA 4APQB 4JO2H 5CWSA 2C9AA 2A74B 1DBAH 2QHLA 4H1LH 5DMIH 3OKOB 3V0WH 1X7QA 4KHXH 3KLAB 4UILH 5IK3B 3HG1B 2XN9B 5I30L 1KJVA 3G6DH 1OTUD 1EFXB 1OP3K 1SBBA 2ITDA 2AEPL 3FO1B 3FKUS 4TTDD 1XCTA 4W6XB 5EOCL 1KTLB 1IAOA 5EWIH 3E2HC 4FQXA 4H5SB 4AEIH 1LE9B 1OQXA 5IQ7H 1CR9L 3THML 4J7RA 5T1DH 1U8HA 1TMCB 4D9LL 1BQSA 3JWDL 4Z7NF 1OAUH 3UPRA 4JDVB 3H9YA 2LQRA 4PIRF 2NY0D 1RUPL 2PW1A 1N8ZB 3LS4L 5E7BA 3VFUB 2DS4A 1K5NB 3AY4C 5C08D 4G6FD 2FO1A 3BPOC 5EBMA 5HGDA 2WIMA 1F58H 3CFIC 3E8UL 3QDJD 1M7DA 5GRUH 2HAZA 1P53A 4JFXB 3QFJB 1EGJA 4X6DF 1AD0B 4YHPA 1IEAA 4PJXB 4N1HB 2GJ6B 4H0GA 4N8VB 5IVZA 1Z6JT 3LMJH 2IPTH 3FCTA 3MCKA 2R4SL 1MCLA 4MDIB 5LAXB 5J57B 4JGMA 4I18A 2XYCA 3RKDC 3BQUB 4GW4B 4G80A 2VLKB 4XPTH 1KB9K 2WIIB 1JNNL 2YKLL 1T03L 4XNMB 1TZGL 2X4PA 3LAFA 2C1OB 4P4RA 4PGZA 3UPRB 4U1JA 1IZKA 2R4RH 2VXSL 3MSPA 4KI5F 4P59H 3VXSD 2QV2A 4K9EC 4KMTL 2A83B 4JO3H 5KSBF 1CBVH 3AU1A 4HH8A 3GRWA 2X4OB 4HV8A 4XNMA 4YDIH 1Q94B 3SGJC 3O4LE 4LU5L 1RV6X 4NT6B 2V2TB 3UO1H 1IC5H 5EC1B 5C9KA 4TUOA 4FQQA 4X99A 2EIZA 4KMQA 1NGPH 1G6VK 4HX1B 2J5LB 2CIKA 2IANA 2XZZA 3BAEL 3KAAA 3ALPA 4XMLH 3B8YA 4F7CB 5KTEL 1GZPA 3IFNH 1EVUA 4XC3H 2B1AH 3NPZB 4FABH 2VDQH 1JF1A 3EYUL 4S1DC 2Y06H 3VXRA 5L2KB 4HS8H 3W9DB 4LVOB 5HYJD 4KKCC 3LSOA 1RJYA 1HINH 2RIKA 5DD0H 5JZ7C 1S3KL 3HE6A 5D70H 5F1OB 1SJHA 3EZ8A 2VLME 2DB8A 3IVKB 3SE4A 3IFOA 5I15H 4KH2A 2APXA 2JJSA 1DSFL 3TA3A 1XZ0A 1J86A 1NSNL 4OF8A 2XXCB 4ODSL 3EO9L 4ZDHB 4QRUA 3H6JA 3OJDB 4LCUA 1EO8L 3C60A 5JW4M 2FECL 5HGAA 5HPMB 2P8LA 5K59E 1UM6L 3HG1A 5KW9L 1ETZA 9CGTA 4OCWH 4FMFA 4M1GL 4BH7A 4LKCA 5JW3H 4JQXA 4L29B 5GRVL 3NCJH 4HIHA 4KY1L 5EIQA 3MO1B 1MQKH 3QXDA 1A3RH 1J11A 4X6FB 4LHUG 3VFOB 1KLGB 3D0LA 5C0BE 2BY2A 5DJCA 3ROOB 3KLDA 3WFHB 5FA4A 1LMKA 3W82A 1CN4A 3L1OL 2R29L 3P3YA 3VFPB 2VZUA 5IROA 5IEKA 1I8MA 2AVGA 1JWSB 3PP3H 2GHWB 3V6OC 4QXWA 1B6DA 5CGYC 1RQ5A 4MNHB 3VA2C 4X4MA 3IDGB 3PGFL 1NMCC 1T3FB 2CKBH 5MI0C 1UKTA 2Z31D 1PYWB 4Y1AB 5JNYB 2QQLH 4DKAA 4RAUB 2OL3B 4TN9A 2DMCA 4BFBD 1X5AA 3JUYA 3NH7H 1RURH 3M1BB 4X9GA 3C2AH 5HGBB 1A7OL 3RBGA 2G60L 4RA0C 3A6CL 3PWPB 4TNWK 4U33A 1FFPB 5DUBB 5E99L 2OZ4A 3WS6C 4NCDA 3QNZB 5DJYB 3TH4T 5HDLA 3FT3A 1LEKA 4X80L 1EV2E 4J1UB 1UCBL 5CZXD 1YZZA 5EA0H 4XMLL 1OWRM 3IKCB 3PDDA 3JV6A 5J12C 3MXVH 5DJAB 5JOPD 2UWEA 1C7TA 4Y19B 5IVXE 4I2XB 3HPLA 1NGQL 1D5ZA 2ADIB 5LBSH 3P77A 2PNDA 4K8RD 1NCAL 5DVMA 4L8BA 1MWAA 5ESQB 1B4RA 1BF2A 1T7WA 2OJEA 4YFLI 5EO0B 1PYWA 4GT7A 2OXHA 2LVCA 3S3PA 4NDMA 1S9VA 5IG7A 3T1FA 1D5ZB 3P2TA 1Z2KA 4R2GC 3WFCL 4K2UL 1I9JL 5J12B 1YN7B 1D5IL 1OY3B 2G75B 5JOFB 2VO5A 3MRFA 1BJMA 4LHQB 4TVPD 1ORSB 3I2CL 1JHKL 3AREB 4OLVH 3PL6A 3MRQA 2F54E 4H20L 4WFED 1DUZA 1QVOB 1KLUB 5EBLA 3QHZL 5L8KB 1UM6H 5E6YA 5KW9H 3HE7C 5FYLE 5EORH 5J56B 4PUBL 1VSCA 1ZKAA 1JYXA 4G3YL 4PJ8D 4ZODA 2W9EH 2Q7YA 1I8LA 2ZCKH 1F58L 2ADGB 5JW4Q 4O2CA 2XZCH 1NJ9B 2MOVA 4YIQA 2ESVD 4E5XA 2DLTA 1RJLA 4KROC 3QHTC 4P2RA 5D7KD 3TT3H 4YHLL 1NCUA 1D7FA 2EDTA 4HAFA 4JO4L 4HUUB 1AE6L 2XPGB 5D1QB 3EBAA 3L3HB 1OGAD 2ZWLT 5IGXL 1QBLH 2GTWA 1KN2L 2F5AH 2DQFB 1WUNT 2H2PC 2HJFA 5F3HB 1G7JA 1GGIL 1Z5LB 3QXDB 5CMAB 3GB7B 5CKAA 3HE6B 1WFNA 1DBBL 5HHQB 2HT2C 4RMWA 4MA7L 4X6DB 2FWOA 2XFXA 4YFLF 3MV7A 4X6BA 4ELMA 2OQJB 2VDPH 4D0DB 1T04B 1F6AB 1HZHH 2ZUQC 1NGYA 1HYSD 1IQWH 1MHEB 2HTLD 5FGCB 4BQCA 1NUFA 1YYLH 1TZIA 4MJID 4XH2B 1MF2L 1JHTA 3BDYL 5JNYA 5KTEH 4L8SB 3OKDA 1P4IH 4NO3A 3U36A 3EDDA 1T3FA 3OAYH 2B1HH 1DQDH 3PJSB 3ULSB 2EXWD 5DA0B 1FFOA 2ERJB 2XTLA 4YC2C 5CCKL 4JPVL 3VG0L 4M43L 3SDDC 2FSEA 5MEQB 1HH6A 3U9PH 2WQRA 5ALBH 1XF3B 2I9TA 1VCAA 5TQ2L 1J8HE 3WFCH 3EYSL 4DGVH 3TJHD 4HKXA 3GRWL 1NH6A 1X3DA 2FB4L 4LK4A 2ATKA 1DANT 3MRIB 3QYCA 1EEUA 4XAKD 1NDGB 3O6ML 1UFUA 2PW2B 5FGBC 1H15A 2DQHH 1D5IH 5INDB 4EQ3A 4DAGL 1KXVC 4R6UA 5CJOL 4I3SH 1GGBL 4F7CA 1KG0B 2DYPA 5LQBL 4PR5B 5IFAL 3QI9B 3QCTL 2J6EA 1YC8A 1V7NL 1M6OA 4WRLA 5HYEA 2FYYA 5TF1H 5I8KH 1A4KA 4HUWA 1EO7A 5CLTA 2HKHL 3MV8A 3BGFB 5HD8C 6FABH 5HYQA 1W72L 3GMQB 3QUXC 4PJFB 2DRUA 5CJXA 1KJMA 5IJKC 3WJLA 3D9AH 4DZ8A 4UT9L 4AENA 1JPSH 4FQJH 4GRWE 5KOMC 3S98A 1JYWA 3D48R 3PNWB 4U1JB 3VW3H 1A1OB 4WW2C 2HG5B 1NKOA 2CIIA 2CQVA 4XTRD 4QRQB 4RA3A 1U8KB 3NA9L 4CU6A 5HYIA 2HRLA 3S5LB 4MAYA 3UTTD 4HPYL 4WI9A 2VLJB