5DUPH

Influenza a virus h5 hemagglutinin globular head in complex with antibody avfluigg03
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
227
structure length
208
Chain Sequence
b'EVQLLESGGGLVQPGGSLRVSCTNSGFTFSNYAMSWVRQAPGKGLEWVSAISGTYYADSVKGRFTISRDNSKNTMYLQMNSLRAEDTAVYYCVRDDSYDGGGHYGLHNWFDSWGQGTLVTVSSSTKGPSVFPLAPSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Comprehensive analysis of antibody recognition in convalescent humans from highly pathogenic avian influenza H5N1 infection
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1/2005(h5n1))
molecule tags Immune system
total genus 34
structure length 208
sequence length 227
ec nomenclature
pdb deposition date 2015-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH01
1QSFA 4GW4A 3KYNB 4WU7B 5DJ8A 3A0OA 2UV3A 4L8SA 4JB9L 1BZ9A 1VGKB 1YEKH 2OI9B 2VXVL 4FABL 3VXOA 1HXYB 1QBAA 6CGTA 2W9DH 3DTXB 3O6FB 4YGAB 4PPTA 5J6GB 1H3PL 4XVSH 3KR3H 3VFPA 4M00A 1UEMA 4MA7H 4WUUE 1OQOA 3ARGA 4M5YL 4RMSA 3VH8A 2G5BB 2RCSL 2IBZY 5IUSA 3UTTB 1UADC 1ERNA 3ARTA 4G8IB 1YC8A 4RFEA 5JMOC 3FQTB 1RY7B 3O4OC 4W4OC 2D7OA 3U46A 5FHBL 1EMTL 1N0XL 4HQQL 4YDKH 2F74A 2VXQL 3NCYP 2FL5B 4M1CD 1KV3A 1JGDB 1P84K 1WFUA 1IGJB 5C07E 3GSRB 1QKZL 1TZGH 1YUHB 5GJTL 4XVTH 5B3JE 5IHLB 5T5NG 5HYJE 1Z9LA 3P77B 2GAZB 4FQQA 1BVKA 3UBXI 4GXVH 4WU7A 3QDJB 3IAQA 3FN0L 2X1OA 4EQ3A 5FDWB 4QRTA 4BSWB 5E2UH 1HXYA 4C57C 2IWGA 1P4IH 4AJ0A 3O6FA 1T6WA 3CXHJ 1YEKL 3BD4A 4V1DE 4HCRA 3E6FB 4YC2B 2W9DL 4TSAH 2LTQC 1MCNA 2V7HB 3NCJH 2IMMA 2G5BA 5D2NC 3KPRE 4NQVA 5IR1B 2GYSA 4MA7L 5DI8B 2P7TB 2QBWA 3EOBA 1RUQH 3BX7C 3TV3H 4FQJL 1GZQB 1INDL 2I27N 3U9UA 1JWUB 4TRPL 5FYLD 3ZKMC 1IGJA 3SN6N 3GSRA 1PD6A 1YEJL 4PB0L 1YUHA 4LLVB 4YDKL 3QHZH 3WD5L 1AGDB 4TOYH 1BIIB 3O0RH 3P77A 1RFDH 3G9AB 1TZGL 2GAZA 1A1OB 2VAAA 4XVTL 3DXAD 1T7XA 5E6ID 2R2HB 2VDQH 1EUUA 3DHJA 5F7WC 1G84A 3VXUA 4HWZB 5FDWA 4BSWA 4GXVL 1NMCB 4KH2A 3MLPA 2X4UA 5E2UL 4LEXL 5I76A 1I8KB 1ZHNB 1DDHA 5ESVB 3E6FA 5IMMB 4MMZC 3QEQA 4HZLB 2Y4SA 3MRJB 5IR1A 3K2UL 4KROD 4M62H 4PGBB 4B5EA 3NCJL 3DXAB 3CZJA 5E6IB 1T1XA 1KB5H 1JWUA 3TM6A 2I9LB 1QBMH 1RUQL 3H9YA 3TV3L 2BHUA 4U3XA 2DL2A 3HMXL 4LLVA 3SE3C 1AGDA 3KPQB 5BVJB 2FWOB 3VFWB 4G43A 5CMAB 3QHZL 4XMPL 1EHLL 1YEHH 4Y4KC 1N4XL 4X7FC 4TOYL 1BD2B 4H1LB 1HQRB 1RFDL 2MNUA 3QG7H 4HWZA 1Q38A 4R97C 1CU4H 2D0GA 4NBYB 4Y16C 2VQTA 2H3NB 4BKLB 1LD9B 3IJHA 3IFLL 3NA4A 3UC0H 4IHOB 4OZHA 2XRAL 5FM4A 1ZHNA 5E2JA 3CU7A 2WIIB 5ANME 3V4VH 3M07A 4XBGA 4LGSB 3MRJA 4PUBL 2JLLA 2RGSA 1UWEH 3DXAA 3ZT6A 1JN6A 1FVEB 3PABB 3PWPA 3V6ZB 2VN7A 4M62L 1WQVT 1A3LH 5FGBC 4U0RB 4PJXF 2VDNL 5I8OH 1KB5L 3QWRD 4HFUH 4U1GB 4LPXA 1S7SB 2BOBA 2FWOA 3VFWA 2FSEB 2KZ1B 2WUBL 5CMAA 5BQ7B 5EU5A 2EE3A 3TZVC 1P4LA 2JJSC 2VQUA 2DYPA 3MLVL 1U8IB 1QLFB 2VDMH 2CIIA 5H37H 3W2DH 1YEHL 5BS0E 3TJEL 4BKLA 4C83B 3QXWA 4JDZA 4IHOA 4GAYA 4O4YH 1G7MB 3MRCB 4CVXB 1FYTD 3AS0A 3UC0L 3BYTA 3GJFK 1DP0A 3OQ3B 5DJYB 1Q0XH 4Z6AT 3UZVB 4R90L 3VFTB 4MX7B 3V4VL 3D0VA 1HKLH 4G42B 5EBWB 1FDLH 1FVEA 3HLAB 5KS9A 1ADQL 2YUWA 4J4PC 2Z91B 1NC2D 1UWEL 1VFAB 2MPAH 1T66D 4FQHB 1XF1A 5C0RH 3QP3A 2DMKA 2H9GB 2N7BA 4YNYA 5J1SC 1LP9B 1BBDH 2CKBB 4GBXD 5BQ7A 5B3JF 4TTDC 4HFUL 2K1MA 1OAYH 4FZEL 4LKCA 1XGRB 3U0TB 4KKLD 4LLQA 2NPLX 3GIZH 2X4TA 4DN4H 4BZYA 4KVCH 5I75B 4ZTOH 1U8LA 5CHNA 3TO4D 3HR5A 4MQTB 4UQ3B 1ZT7B 5TF0A 3I75B 3MROB 1D9KD 1ZT1B 1M71B 3IDNB 1G7MA 3CSGA 4R96B 4CVXA 4K8RD 3QWRA 1FAIH 4JM4H 2C3HA 2C1OA 3KAAA 2Q3ZA 5JIKA 4GBXB 4Z7UA 4EBQH 3P9LB 1E28A 4G42A 5CAYB 1G7LA 1Q0XL 1GOGA 3ORJA 1TQCB 4YFLF 4R3SB 4FQHA 5A40E 1TDQA 2AABH 1FDLL 1PYWA 2NZ9C 5DD6A 2X4SB 3ULSB 1ZWIB 1XGYH 2H9GA 3TO4B 5C9KA 5C09E 5EZLA 2P48B 1D9KB 5CLWA 5KSAD 2CKBA 5INCA 1NLDH 5KAQF 1FYTA 4LRIC 3WUWB 1X5YA 1GYAA 1L0YA 1TCRB 2AI0H 3DSFH 1S9KC 3U0TA 2PW2B 4FMKA 1DL7H 1IT9H 3RNKB 1OAYL 3W0WD 5TDNA 2WBJB 2YD7A 4UQ3A 3GIZL 1NC2A 4JQVC 5GZND 1HQ4A 1NH6A 1A14H 4ZTOL 1FLRH 3OGCB 4R96A 1V7NH 1WICA 4Q9RH 2R69L 43C9A 5DC0A 1KB9J 2A1WH 3SO3B 4GBXA 5EDXA 5CJBA 3QEUA 1FAIL 4JM4L 3RY6A 4P5KB 1EFXD 3LPWA 3S3JA 3VWJB 4KRMB 1GPOH 4R3SA 3UTPE 2X4SA 3KLSA 4XWOC 3NCMA 5DZLA 5EORH 5I71C 4BFIA 5D7JC 5IP4A 3L6FA 4R2GC 2DJ4A 2AABL 4GG8A 1UZ8B 3CSBA 4KTDH 7FABH 4OI8A 5LGHL 3WNKA 3WUWA 3FN3A 1TCRA 5I1LB 3TYGL 4MGXA 3HZKB 3K4AA 1RHHB 4YHPA 2PW2A 3F7VA 3WLBB 2JELH 3DSFL 4JDTH 1I9IH 5SWSE 4DTGH 4FXGA 1SJEB 3BOVA 3OHXA 3QZWG 1DL7L 4POYA 5GRVL 2E8YA 4RAVB 4KY1H 3MODH 4WW2C 4J3TA 3BEVA 5FA4B 4CAGA 1A14L 1C7TA 5KSAA 3PV6B 4ZUWA 2FBJH 3T0XA 2AXGB 3BKCH 3ZO0A 4RRPA 5GSVB 2MJWA 3VMPA 4P5KA 1NEZG 3GJFH 2EIEA 3W0WA 5DMIH 3UTTE 3JV5A 2VH5H 1X5HA 2AEIT 3KPOB 3WN5C 4NC0B 2OR7A 3IVKA 4ZUSB 5EORL 4F3FA 5EOTA 3CPLB 4UOW0 1N6UA 5EC1B 3FT2A 5I1LA 3U79A 2X5PA 1D5ZB 3HZKA 3SPVB 3QQ9D 4JN1L 1T20A 4KTDL 7FABL 4R8WH 4PJGA 1FSKC 3UX9B 5F7LB 2KQNA 3ARWA 3IYLW 4N0UB 4O51B 3ZYJA 1SJEA 1EFXA 2XACC 5I73C 3QDJE 4JDTL 1CXKA 2D2OA 5HI5D 1I9IL 1OCWH 3QUMB 4DTGL 2CK0H 5FA4A 3RIFK 1A2YA 4AIZA 3QPXH 4G6AD 2G2RA 4LCCA 2Z8WC 3PV6A 3MODL 2AXGA 5GSVA 1XCQA 2VLKD 4RWYL 2FBJL 3LKRB 5TE6H 3BKCL 3D69B 3FQRB 1JHKL 1MLCA 5CLTA 1U95B 3SDCD 2GT9A 2J6EH 5HHOA 4WFGD 1FFNA 1EIBA 5DMIL 2EZ0C 1CD1A 4OCWL 3S88L 1EEZA 2CLZA 5MEQB 5EC1A 1NQBA 4PJ9A 1JE6A 1MHCB 1D5ZA 1NUDA 2FX8H 3VFOB 4G5ZH 3VXMD 1LEKB 2EDQA 3PGCA 4WTWA 3FQXB 3LS4L 5J4MA 2BNRD 4N0UA 4OF8A 5HDBF 1DANU 1K3ZA 2VLKB 4HS3B 4ZFOB 3HRPA 3HNTH 3R1GH 3Q5TA 4HGWB 1SHMA 3G6JA 3QPQC 1XF3A 2NY1C 4BQ8A 2GHWB 4YHYC 3B5HA 1GVIA 2NNAA 2BNUB 1VFOA 3VXMB 5CZKA 4HJGA 3D69A 2BNRB 1NBYB 2EC9U 3FQRA 4PJEB 5HJ3B 5TE6L 3T77A 4XNMB 2AJXH 5J6HA 1NKRA 2J6EL 3LKOA 4XHJC 2VABA 3U36B 1HHHB 3QIBD 1LEKA 1ZSDB 3MJ9L 3QNZB 1RVFL 3FQXA 5IB5B 1IAKB 4G5ZL 4UNTA 3RWFA 2VIRB 2VLKA 1QLRA 4PGZA 1BD2E 1X5IA 1LO0H 1OVZA 3H3BC 1RZ8A 4WNQA 4P99A 3RVXD 4DUVA 4OKVB 2I60H 3SDCA 1AD0A 4I18A 1YY8B 1JZ5A 3R1GL 5C0DA 2X44D 2NY6C 4HX1A 1U8QB 4LARH 5L0QB 3IXAB 2H32A 3VFMB 3QIBB 1KIQB 2W60B 2HFFB 5F3HA 3BP7B 4POUB 2VXTL 3ZMRA 1NBYA 5EUKB 4PJEA 1X5FA 1DFBH 4WFFE 3OL2A 5D2LE 1IQDA 4K2UH 5E24E 4XNMA 1J10A 1QRKA 1IC5H 4FN0A 2X05A 4IRZH 3EAKA 4XBEH 1LK3H 3UJTH 3OAYH 3X13B 2DIJA 2ADIA 4OUOA 3WHXB 3U36A 1HHHA 2AJXL 5IB4B 4X80H 4YHMH 3QNZA 5IW6B 1AC0A 5TH2A 1Q1JL 1TVBA 4MJIE 3B3IA 3D48R 3D6GA 3U7WH 4HG4K 2GKIA 4PJAA 3IETB 1DZBA 4KI5C 2OBGA 3DUSB 3EOAB 5ILTL 3C60C 4WHYH 3QXUA 1JMXA 1LO0L 3N1MC 3QNXB 1EAPB 2I60L 5FKAB 1YN7B 3VXPB 1SEQL 3PE9A 2A9MH 3IFNL 4DJMA 1XF5B 2B4CL 2P42B 3TIEB 4Y4FC 5GS0L 3IXAA 2X89D 4JE4B 4JQXC 4RNRB 5F9OH 3WSQH 4XP4H 5IM7B 1XEDA 3C9NB 4LARL 3BW9B 3OB0K 4UNUA 3TEUA 1QFUL 4LU5L 2X42A 3F5WA 1ZVYA 2NX5D 2GSGB 2P4AB 2DQUL 3WIHA 3DVNA 3QUYB 4NQCD 5B8CC 1DFBL 5E70A 4F7MB 3ROLA 2HJLA 4K2UL 4EN3D 4A6YA 3S37L 1LP9E 1ZLWK 1I85A 3MNZA 4XMLL 1Q9LB 1LK3L 4CNIB 3UJTL 4CW1B 3CXDH 5I18H 4X80L 4YHML 3LQAH 3HI1B 5EZOH 1RJCA 4PV8B 1QBLL 4MS8C 3DUSA 1KPUB 5EWIL 4XTRD 2NX5B 3HC0B 3QRFM 2C7UA 3U7WL 3QNXA 2QSVA 5JIHA 5K9JH 2GCYA 5ESAB 4AEIL 2W0KA 5FKAA 1YN7A 3OKKB 3OXRA 4BFGA 3UEZA 1NMBL 4HC1H 5J11B 4LVHB 2NXYC 4MCYA 3MUJA 5I2IA 4ETYA 3BKJL 4EN3B 1R5VA 2JCCA 1KTDB 4FTVA 1CICB 4KKNA 4AY0A 2A9ML 1JMZA 2NY3D 1LEGA 2YXMA 3DRTB 5IEKB 3QUZC 3BW9A 3GRWH 1P7KB 2Q20A 2ICCA 2XOTA 2GSGA 3TBYB 5C0ND 3WSQL 1U8HB 5GSRB 4FFVD 3CJJA 4ENED 1AP2A 2J12B 4F7MA 3CMOH 3VXQB 3MLRH 1NBVH 5ID0B 3X3GL 3QEHA 4CW1A 2EE6A 2F58H 4FFZH 1YNLH 3CZFA 2X89A 3SCMD 4IIQC 5FUOL 4PV8A 3GHEH 1WZLA 4L29A 4JY5H 1KPUA 5HGHB 3CXDL 2NX5A 4FP8H 4NJAH 1KB9K 1CBVH 4R4FL 5E4EC 3V6OE 1BQHB 4NYLB 1RJZB 2DLGA 3PL6D 4LLYB 1N5YH 2V17H 3HI5H 4NQCA 3MRKA 2W1NA 2QHLA 4G9FD 3ZTJH 5IMKB 3SEPA 1YNKL 5C6TL 3UAJC 2FB4L 2APFA 4UNVA 3GMLA 3PP4H 3PWVB 1KTDA 1U93A 3DI2B 1FL6B 4HC1L 4HUXB 5DUBB 2WW8A 1P7KA 2VQ1A 4J12A 2ZOKB 3SCMB 5ADOL 5BVPH 4N5EC 3TBYA 3OJDA 3NABH 3OR6B 5I9QC 1JGEB 4X7CC 1WC7B 2ZUQC 1ZMYA 3PL6B 2GFBB 2HP4A 1A6TB 4OZ4B 2F5BH 2EH7H 3KJ4C 3QEGH 3CMOL 2YPLB 2IGFL 3MLRL 2CJUL 3B43A 4HCRH 2MWCA 4MQ7A 4KK5C 3TGXA 1ZGLM 1WFNA 4DAGH 1A9BA 2HYMA 1YNLL 5F72S 5HGHA 4KK8D 3NCCB 1TETL 1HHGB 4O5LL 3LS5L 1BQHA 1V8HA 2GUOA 4LLYA 3TYFB 4QY8B 5IMKA 4OT1H 1J1OL 1CDBA 1YA5A 4OSUH 4Y5VB 3BDYL 4JKMA 1N5YL 5DYOB 4EIZC 4ONGH 3W82A 2C3GA 4F58H 3Q3GA 1LHZA 3PP4L 4P57A 3SCMA 3LKNB 2F5AL 3FFDB 5ID1A 1PG7H 2X4QB 2K7QA 1JGEA 3BGMA 5BVPL 1S9VB 1OAKH 5MP6L 1A6VH 1PG7W 5D2LF 5E94B 4B50A 3OB0H 4QTHB 3QXTA 2EXYD 3D85D 4G6JL 4G9FA 4MA1C 4OZ4A 4CU8A 3CGTA 3NCYS 1WTLA 3HFML 1ORQA 1PG7X 3AS2A 5HI4C 5GZOC 4FQIH 5FYJU 4XPGL 3D39D 1JGUH 1I8IB 1W8OA 2ICWB 2JTDA 4XX1G 5E9DD 4OLXH 1XGTB 3VG9C 5T3XE 1A9EB 5KSUA 4HGKC 1MPAH 2I07A 3O6KL 4PYHA 1UFUA 3D85B 4OT1L 1A7QL 4PJHE 3ROOA 5F97E 5IF0A 4OSUL 5FOBB 2CR6A 1QNZH 8FABB 2VISA 5AEAA 2YD1A 3LKNA 4GG6A 2H2SC 3GSNL 4MNGA 2BSRB 2OMNA 4RZCB 2X4QA 3D39B 4FS0A 2QQKL 2R0WH 1NUGA 4KV5E 2VITA 5E9DB 1PG7L 5T33H 5JUEL 5DO2D 4HJJH 5FYLH 1A6VL 1EERB 2HT4C 5E8DL 5FYJE 2PXYC 1LP9F 4JEGB 5J06A 1RK0B 4W68A 3NZHH 4ZODA 2CDGB 2ICWA 4LDEB 3OSKA 1T3FB 1A9EA 2Z31C 1JGUL 3S3PA 1CTOA 2AV1B 1KCVH 4OLXL 2QKIB 3NAAH 4NGHL 2P45B 3RZCB 1MPAL 5HDQL 3B2VL 2H1PH 2R4RL 1RUAH 3T2QA 4ZD3H 8FABA 5CP7A 3TVMC 3MLSH 3MREA 1A5FL 1CZ8L 2HG5A 2BSRA 2R0LH 5D1ZC 2DI7A 4H1LH 3D39A 4M7ZC 3ARVA 3QCVH 2PO6D 5A2FA 1IGFL 2R0WL 4J3WA 5DEZA 5DWUL 4ZUUB 3MX0A 2CR3A 2J5LB 3DMMD 4MD0B 1DQLL 4N0CC 5T33L 4ERSH 3T8XA 4M43H 4QT5B 2DBLL 2DQJH 5EU6D 2J1KA 2VR9A 2DM2A 4ZXBB 4P4RB 4X9BA 1Q94A 2CDGA 4BYHA 1SEBB 1GGTA 1HEZA 4P2CG 3O11B 4NZUL 4FQCH 3VWKC 5F9JA 4HT1H 2AV1A 4KAQH 4C4KO 4LCYB 1NGYB 2PO6B 4U1LB 1NFIA 3IDUA 2HAZA 3NFPB 5C0AE 2EO9A 3DMMB 4X8JB 1U41A 3NAAL 5I74C 3BUTA 4K23L 1CE6A 4LF3A 3FKUS 2H1PL 4F7EB 4LEOA 1EHAA 1RUAL 2CMRH 3MLSL 5F1SA 3GKWL 3OF6D 3RZWA 1C7SA 5C6WH 3W9EA 1I9RL 5K59E 3LN4A 5ACMA 2OTWA 1ZTXL 4Y2DB 4ZUUA 3QB7C 4NO3B 4MD0A 4QKXB 4X4ME 5INDB 2DI9A 3PHSA 3VFRB 4QT5A 3FRPA 3MFFB 2X1PA 1HSAA 4ERSL 1JWMB 4MXQC 2ZOLA 2DQJL 3AM8C 3O11A 1UZ6E 2DLIA 3D3VD 5GRJH 1UM6L 4HIHB 3MO1B 1TJIH 3LOWA 2PO6A 3WLWC 4HT1L 2OZ4H 2QV2A 5C7XL 1FN4B 4O02H 1OP3K 1T83C 4WHCA 5SWZD 5IHZA 2PTTA 3CLFL 4PBXA 1FFOA 2CKBH 3MV8B 3DMMA 4X8JA 5CJQL 3TN0D 4Z7OE 2RBLA 1MCLA 4HULB 4ZUTA 3K1DA 5EU6A 3T0DA 3OV6A 5BRZD 3UPAA 1PGRB 5JA9A 3E8UL 3KNBB 3U1SL 5I1EH 4O9HL 2CMRL 3ZT7A 3EOTL 2QQNH 2AEPH 1AKJD 4OZFA 5L6YL 3NCEB 4O2EB 3BPLC 5E6YA 3BE1H 4GRLC 4ODWA 4MLIA 3S36H 3SO5A 3VFRA 2FATL 4M6OH 2O5YH 2C3WA 3TN0B 1XIWD 1JWMA 1XZ0A 4OGXH 1PBYA 4OFDA 5BRZB 4JFOB 1S7VA 3NZ8A 4G9DB 3ARSA 5I8EA 4NQDD 4N90E 4NWTH 4H0GA 1H3UA 1AKJB 3VG0H 1FIGH 1K3IA 1KEMH 2FBOJ 1UH2A 1MFNA 2FLBT 4PJHF 5FM5M 2OZ4L 2DD8H 4K94H 4NKOA 3EZJB 5DSCB 2QR0A 1B90A 1XIWB 3WFHB 1AFVL 4F9LA 5H94A 1IFHH 1B4JH 3D3VA 4X6DA 1UA6H 3LQAC 4KV5F 5LGJB 4O2EA 1E4KA 5I1EL 3IDXH 4MXVE 4NQDB 2FJGA 2AEPL 2NXZB 3BQUA 5E1AB 1NCCL 2DBJA 3O2VL 5SWZA 3VXRA 2XZQH 1UKQA 1CWVA 4APQD 5CP3A 3TN0A 4PJCE 2W9EL 2NTFB 1S8DB 5FK9A 3M17A 4M6OL 3WS3B 2VZVA 2ED8A 4OZIB 2ICES 2MKLC 2H41A 4LSTH 1UJ3C 2OJEB 4QHLB 3WO4B 1KPRB 2EYTA 1ZHBB 1FFPB 5GQBA 4RGOH 4PJ8D 1UXWB 4L8SC 3QFJE 2FECL 2B2XL 4TNVF 5IKCA 3VG0L 1KIPA 3QZWB 4EVNB 3EFDH 3PNWA 4APQB 5C0BA 1MF2L 4K7FA 1XIWA 3PHQB 3WFHA 2DD8L 4K94L 1AGFB 3WDHA 5DGQA 2Y36L 5IVXA 4M03A 3ARGC 3LQZB 4GT7A 4EEEA 4H8WL 2XA3A 1B4JL 3MTRA 5JLZA 3ZTNL 1OTSD 4JFYA 3IDXL 5EOQH 5F7FA 3NGBB 4PJ8B 3DVGB 3HB3D 3C87A 2YPLE 3C09C 4BQCA 1OTUD 3H0TB 5IVOA 1S8DA 3WFZA 2Q8AH 3WS3A 1EEQA 2FGWL 2KDGA 4WO4B 5IIEA 3GI8H 3JWDL 5KSBE 4WWKC 2AGJH 2OJEA 4QHLA 3CFBB 3W11D 2D3VA 1KPRA 2A6DB 3L3IB 2A6KB 2VJXA 1ZANH 1FFPA 2DF3A 4GAFB 5DGRA 2FGZA 1A1NB 5KANG 4PRPA 1URLA 3ARFD 4L8DA 3RY5A 5DK0B 4L8BB 3V52H 4JFPB 2OI9C 1AH1A 4WFHE 3EJYC 4OCLC 3ESVF 4D0DB 3O6FC 1OP3H 1A3RH 1RZIA 1B0GB 3FO2B 5T3XH 3ZYOA 3I6KB 3UZQA 4FFYL 3QUMH 1WCQA 1YEEH 1OHQA 2B39A 5K59F 2JE8A 1F8TL 3DX8A 1KLFA 2DM3A 4PJ8A 4JKPH 2UYLB 3DVGA 5FF6A 1ZLVH 3ARFB 1IGCH 1MHPH 3H0TA 4Z5RA 4PJDE 4Y4HB 4GUPA 1BOGB 1KLUB 4QRRD 3IDMB 2CLRA 1UZ6F 1QR1B 2Q8AL 5J9PA 1MRFL 5E5UB 3L3IA 1T6VN 1FV1A 2A6KA 4WI6A 2PETA 5EIQA 2DL9A 3NFNB 1KSRA 2HWZL 1KIUA 2JB6B 2AGJL 4HFWB 2A73B 4Q0XH 5FYJH 4L8BA 4MB5A 4XNXL 1U91B 1SBBA 2WIMA 4L4JA 4HUWA 5I30H 3HUJE 4U6XB 3WEXB 4U1JB 3V52L 5F44A 4M1CC 1B0GA 1B2WL 2YUZA 3GMPB 4MAUH 4ORZC 2IMNA 2DIBA 1X9QA 4QRRB 4HLZH 1A3RL 3I6KA 3NTCH 4I0KA 5L9DH 3NMEA 2O5ZH 3L3JA 5T3XL 3QUML 3FONB 1CG9A 2UYLA 3VFUB 1UENA 4NQTA 1BZ7A 3ILQC 3TCXA 4JKPL 3B9DA 3BH8B 3IDMA 1MHPL 1QR1A 4JG1H 3BEWA 1AJ7H 2QJDA 3HI6H 2C4FU 5EC2A 1CVRA 3H3PH 5IG7A 2YPKB 3P30L 3DI3B 3QQ4B 4RISH 5C71A 1NMCC 2RJMA 5FYJL 2WM0A 4Q0XL 3WEXA 4HWEH 5D93B 1OD9A 4LQFL 1A6ZB 2CIKB 2IBGA 4NDMA 1Y0LB 5I30L 3T2OA 4ONOA 4QRRA 1I75A 5EU3B 1KC5L 4MAUL 1QVOA 5B4MD 5D7IA 3VD5A 3BKMH 3RTQA 2IAMD 5E6IC 4ZFOL 12E8L 3EKCA 3NTCL 4YFDB 2ZUYA 4MXVF 3STLA 4LNVA 1W0WB 2O5ZL 5FO9B 1W72A 2LFGA 1NCDH 2CUHA 4RMRA 4TULH 5IB1B 3JUYA 4M6NH 3VI3E 1MH5B 4F8QA 4I4WB 4F15B 4JG1L 3WIHH 1TJHL 1AJ7L 4AQOA 3HI6L 4OB5H 3BPOB 5ALBH 2IAMB 1FNLA 5EUOA 3H3PL 1I1YA 2ORBL 1M6OB 1NGQH 4D3CH 1UCBH 1DQDH 3MOBH 5GHWH 4NT6A 4HS8H 1I7UB 3MYJA 4KZDL 4WGWB 3PQYA 3BUYA 2X9XA 1C8PA 4KQ3H 5SX4I 1X5GA 3DUUB 5K9OB 1T0NB 2K3TA 3H9SB 3BYYA 1S9WB 1C16B 4N8CL 5EU3A 3RKDD 1QFPA 2VKWA 4XZUB 5CCKH 1GIGL 2IALA 3F12A 3BSZH 4CVZB 1DBAL 1FYHB 1AC6A 1RIVL 1W0WA 1HXMA 3BKML 3N9GH 4HH9A 4U0RC 3BZEB 1QA9A 3LHPL 5IB1A 4KXZH 1SVCP 1K5NA 4U1GC 3MJ7A 2JJVA 4WV1A 4U49A 3BP4B 4XH2B 4TTGA 4M6NL 4JQIH 2XN9E 5FB8B 4JKWA 4DUWA 5T5NF 5HVFB 4U1IA 3GMMA 3MMEB 3UTSD 3MV8E 5D7SH 1I7UA 2Y06H 3C5JB 2ERJB 4H5SA 1A21A 5K9OA 1T0NA 5T5FH 3T0EE 5IVZB 2KL6A 1LO3H 1HHKB 3KYMB 3UJIH 3GMQB 5B3NA 1Q8MA 4CVZA 3TBTB 4ODVL 3MNVA 4XPBH 4JM2F 4Q9BA 1KCUH 5E5MB 4OLZL 1GH7A 2VLJE 3BSZL 3FO1B 1QYGL 1VFUA 2OTUB 2QQLL 1HWHB 3N9GL 1S7UB 4PJDF 3BP4A 3ARZA 1FG2B 2DKUA 2OM5A 3THMH 1K2DB 2OK0H 2P24B 5JOFA 2O93L 5BRZE 3GO1H 2EICA 2PTVA 3CFJB 3C6SA 5FB8A 5I75C 1KJ2B 5F89B 4DFIA 4Z77B 5L2JB 5L2KE 4LAQH 1OSPH 1T66C 3SDYH 3FFCE 4UIKH 4G80A 5CIPB 1PZ5B 3X12B 4OCMC 4CMMA 3HUJF 3WNOA 2FO4A 5F8QC 1R24A 5LCVH 5DZOA 2IEPA 1IGTB 3RPIA 4CJ1A 3Q6FA 5EBMB 1WBXA 4NPYA 3TH4T 1HHKA 4GBXC 4YBQD 5T5FL 1BOYA 3SDXB 5JXAH 2R29L 3RY6C 4D9RE 3F7PC 1I7ZB 3B6SB 1NKOA 2E7CA 4GQ9L 4KKLC 5FCSH 5MENA 1TQCC 2DJUA 1QSFE 3JTTA 4S1SH 4YXHH 2Z4QB 1J0HA 3TO4C 2LVEA 1KCUL 2NY5H 4TVPD 4YHNB 3UTSA 2ATKB 1D9KC 1FG2A 3SGKA 5BV7L 2P24A 4ZS6C 4K94C 3EDEA 2R2EA 3L3DB 4R0LA 4OZIE 4DGIH 3VGBA 3CFJA 1MHHB 2GY7B 4RQQA 3F58L 2EDEA 5FO8A 1KJ2A 3HC4L 4QWWD 2BHZA 2WBJC 3GO1L 4PG2A 4Z76B 1E6OL 2DIAA 1AE6H 5DK2B 1FBIL 1MAMH 4M7KH 1CQYA 5CIPA 3O2DL 4PREB 5L88L 1NUFA 4NQEA 1G7QA 1OSPL 3KPPB 3OJ2C 3EJJX 3SDYL 5ABDE 4UIKL 3SO3C 1Q9KB 3E3QC 1IC1A 3O4LD 4ELMA 4LP4A 4PG9A 3B6SA 4URTB 5IBTL 3VWJC 5JXAL 3MJ8B 3U4AA 1IEAB 5GZNC 3ZHKA 4YHNA 4PY8J 1JGLL 4XRCA 3EIFA 4DN3H 4YXHL 2W0PA 2ZUWA 2BSSB 1DBMH 3GSUB 4OQTL 2JB5L 4P23D 3ZDZE 3U7AA 3VI3F 3WIIH 3L3DA 2IPTH 2P44B 3MRDA 1MHHA 3O4LB 1NGWA 1N6VA 1OT2A 1DEEA 3MLXH 5I19H 4NO2B 4HK0B 1GAFL 1MFCH 3KYAA 3LRSA 4PS4H 5DK2A 3RA7L 4UOJA 1EV2E 5CFHA 2AQ2A 3ULUE 4PP2B 1RU9L 5CINH 1HYSC 2XI9A 2A6IB 3KPPA 4M7KL 1MI5E 4JG0L 3ALPA 5KVGH 1KCRH 3MOAL 4P23B 1IQWL 3QH3A 4X5XB 1TLKA 2XWJA 4UOW1 5ICZA 2YBRB 4LHJB 2Z8SA 4B41A 3MRRB 3RI5F 1BWWA 3FCTA 4OCRH 5KANI 3VXUE 1XGPB 4ZFZB 4PJIB 3GSUA 1BFTA 3OKOB 1KOAA 2P5EB 5F7YC 4YDVA 1N5AB 3HPJA 3VCLB 5KSVA 1FZOA 5ELIA 4L4TA 7CGTA 3MRGB 2ZNXA 1GGUA 3QEQE 5D8JL 4F7PB 1MJ7H 2HKHH 3O4LA 3WIIL 1ZK9A 5HHPA 2VSCA 3BJ91 5EB9A 2P47B 4H88L 3SGEH 3QAZB 2A6IA 4D94A 5TDOB 1BQLH 1BJMA 2HN7B 4YFEA 3KLHD 4XCEA 2XZAL 3JVGC 3F7YB 2WQ8A 1AI1L 4P23A 2G60H 5CJXC 2ZSWA 3ULVD 2R4SH 2YD5A 1KG0B 4YGVB 3QQ9C 2IANB 1KNOB 4D8PB 1X7QA 3WKMH 5TQ2H 1IM9B 4QRSB 1MVUA 4N0FB 3AGVA 1MFAH 5DEGA 1A4KB 3V5KB 1RPQA 3OKLB 1OTTC 4LPCA 2NY0D 3MRHB 3HAEG 5HI5C 2ICWI 4M1DH 3ALXA 3OKOA 2A0LD 1RQ5A 2NR6D 4OZHE 3REWB 4G6AC 2WSKA 3I85A 4UT7H 3MCLH 2AVGA 4NHUA 4OCSH 3QA3B 4WFEE 2SEBB 5AUMB 1HN1A 1V3LA 1MJ7L 1MFDH 5LQBH 2HKHL 3FQUB 1X4YA 3PWPE 1G7HB 2EYSB 4YAQB 3V6FB 3FB8A 2VLLB 4XHQA 4NNYB 1E4WL 3G6DH 2HN7A 1EZVX 1PSKL 1I1CA 3F7YA 1XR8A 3HG1E 1O0VA 4GMTH 2EKJA 1BQLL 2VE6B 4MSWB 1KG0A 4YGVA 5J57B 4X7SL 5C9JA 3CK0L 4ORGB 2GJZA 2HT2D 4JO3H 4R26H 2R4SL 4FOMA 3Q48A 4JO1H 4AEHH 3OKLA 4Z7VB 5A16B 3WKML 3MRHA 5J12B 1J05B 1MFAL 1A7BA 4PJ7B 2Q86B 4KRPB 1DUYB 4XT1C 2YZ1A 5JO5A 1BIHA 1UACL 3L3KA 4OZIF 1JUFB 2SEBA 2Q76B 3MCLL 2V2XB 1HHIA 1T1WB 2EIDA 4AMKH 2OSLB 4YO0A 3FQUA 3HN3A 1C12A 2FD6L 2CRZA 3HE6D 1KJMA 2VLLA 3ZDXE 5LQBL 1AQDA 2IQ9H 4YHOL 3ZE0E 1NAKH 5DD5H 1TITA 3S5LG 4CDHA 3G6DL 5L0QC 4MSWA 3H9SE 1BGXH 4GH7B 3QIBC 2XNAA 4I48B 4GMTL 3IRZA 1RJYB 3TBWA 2N7AA 2YWYA 5A16A 4R26L 1T21A 3IDIB 1M7DB 2IQAA 1CGXA 3RVXC 2BXZA 3HE6B 4JO1L 1EHNA 3BP6A 5AWNH 3GSXB 1DUYA 5DVMA 1YEFL 3TC9A 4RGNE 1JPTH 1EUTA 1B0WA 3ZDZF 1YEDB 1JUFA 4Z7UE 1T1WA 4GO6B 2J8OA 3GSOB 4MD4B 1E4JA 3LN5B 4JHAH 4JR9H 4AMKL 3ULUF 2DQCH 1MNUL 5C0GA 2WP3T 3V8OA 5EPMA 3V4UH 5CEZD 5TE7H 2IQ9L 3B83A 3ZDYF 5I8CB 2DM4A 5DD5L 4QYOB 1HINH 1MHEB 2YEZA 5EN2A 1Y6MR 5F93C 4ZPVB 2CUIA 3EYUL 1MQKH 1QACA 4ODXB 1XT5A 5GGRY 1NFDA 5JPMB 3QUYC 4W4OA 4XNYH 1FO0B 2KBGA 2QSCH 5DURD 3TNMA 1JHLH 2HMID 4XBPA 3GSXA 3KPSD 1YEDA 1RAMA 2OMBA 4AT6B 5AWNL 2BERA 2VMFA 3N1PC 4BH7B 1FIEA 1DN0B 1JPTL 3VXTA 1FL3B 4YPJA 5B39G 5M95B 3WL9B 1AXTH 1NLBH 4X6FB 5I15H 2RFXA 4OTXH 5D9SA 1H5BB 4Q6IB 1OLZA 3MRBA 3CFEB 3TPUA 43CAB 4X5WB 5J11C 4LVHC 3ARYA 4ETQA 3S96A 4EN3C 4KKCC 1CICC 2GIYA 3KPSB 3MBXH 4OFKA 5J7CC 5TE7L 5E8EB 2PNDA 3QDGD 5C6PB 1DE4B 5D2NA 3CDGB 1N2RB 1IL1A 5JOEA 4MLSA 4M61B 5DVOA 4XCCL 4XTRC 4LNRB 4YDIH 4Y16D 5I1AA 1MQKL 3MXWH 3B9VA 1X5AA 4JPKH 4ODUB 4LSQH 4JN2B 4LSRL 4AT6A 4BH7A 3L5WA 2P5WB 1CDUA 4B0MM 5F1IA 3CUPB 1LE9A 3UROR 1FL3A 2VRAA 3T1FB 3QDGB 5C0NC 4HF5H 1MREH 3EO1B 1H5BA 4FFVC 4P49A 4ENEC 3ARDB 4X5WA 2EYRB 2NY5C 3KPSA 4QXTB 1UYWL 1LE5A 3MC0A 2IC2A 1FRGH 3BPNB 1XF4B 1KCLA 3SCMC 3CDGA 5IMOA 4A2LA 1N2RA 1BJ8A 5FV2A 1IGYB 4TSBL 4EDXA 3ULUH 4XPTH 1C5DA 1I9JH 4LNRA 3SKOA 5IESH 5E95B 3MUGB 1KTLA 3PL6C 1TJGL 3UMTA 3SE3A 3MXWL 2NW3B 4FRWA 3CVHB 2HTLD 4LSQL 4FQ2L 3L3GB 1F6AB 1PX3A 4RFNB 1F11A 3QDGA 1IAOA 3DX7B 4NZTH 3N85L 3F6IA 4J4PD 1XF2B 3RNQB 5BJTA 1WVZA 3BZ4B 2YRZA 4HPYH 2DS4A 1IMHC 1TFHA 5HHOE 4G8EB 3ZDXF 2P49B 4Y16A 4DOHB 4XX1E 4Y5VC 2A9NH 5EOCJ 4YXLL 4WEBL 3TBVB 2EYRA 1PQZB 5C70A 1RZKH 4I9WD 4J7RA 1U8KB 3ARBD 4PRNA 1V5JA 4NIKB 3BDXA 1HNGA 3RIAF 1CF8H 1N6QL 2Z93B 5KBNC 4AM0B 3SKNA 4AYFA 4PJIE 3ULUL 1AGEB 3G5XB 1HDMA 1I9JL 3G6JE 1H8NA 2VWEE 5IESL 2P5EE 1L7IH 2EIZB 4P59H 2C3VA 4DGYH 3FO9B 5EU4B 4L1DA 3RVTC 4PTTB 1FC1A 2XWBB 4Z7UF 3RWGB 3TZVA 1IARB 25C8L 3ARBB 4PFEA 1MELA 1RUPH 2B1AH 3BZ4A 5T1LB 1J0JA 2XQYG 4NZTL 4XXCC 4ZFFA 3QXAA 5H8DA 1QFWI 1WIOA 4HMDA 1TENA 3VRLF 1JTTA 2EXYC 3UZEA 1IAII 1IC4L 4OD3H 3FB6B 2X4PA 3LN9A 4LK4A 1FFRA 1PKQE 1U8KA 3IS1X 1D6VL 3K4DA 3KXFD 4KPHH 3JUZA 1RZKL 3V5HA 2EE9A 2J3SA 4TPRH 2IANE 3DROA 1IEBA 4DGVH 1KLGB 4AM0A 4J4PA 3IU4L 3Q0HA 1MWAB 4KJPC 1F02I 3MGAA 4M1GL 4MA3B 3QIUB 2ADFH 4OBRA 1ITCA 5AZ2L 3FAXA 2DICA 1HSBB 3OXSA 3G6AB 4P59L 4UUJA 4DGYL 3ARBA 3DV6B 3KXFB 4YWGH 1JWSA 3HE7D 3ULVE 5A2IH 1K8IA 3PHOA 4BZ2H 3DSNA 5DJ2A 5DTFB 1OF2B 4CDGC 4YJZL 1IRAY 1JNHB 5D7JD 4BZ1L 2ZUTA 1RUPL 4R2GD 4ZNEE 1S7WB 3DWTA 3QXVA 4NQSB 3RZCC 2CSPA 3CNKA 2QQQA 5GISL 1DLHB 2A74B 3MA9H 1U6AH 1ZA3A 3V0WL 1F4AA 2DQEH 1FE8L 3MR9B 3SDXF 3T3ME 2DN7A 4DUXA 5GGRB 3BHBB 4HUVB 1RZFL 4KPHL 3HE7B 5ALCH 3VFGH 1CDCA 1TZHB 1MWAA 3LH2H 4PJ5D 3LKQB 1FGNL 4DGVL 1MIML 4FQLH 4AIXA 1S7XB 3I3DA 5CD3B 1W0VA 4MA3A 4PJ7E 2J5LC 1D3CA 2YMXH 4NO0B 2J7LA 5DFVD 1CE1H 3BRFA 2V6HA 1HSBA 4ZXBC 4AL8L 2ADFL 2VDRL 1U58B 3KXFA 4TUKH 3QDMD 1LO2L 5DTFA 4Y8AA 1ZHLA 1R3KB 4YWGL 5C0IA 1JHTB 5D7LD 3OBAA 1YMHA 1P6AB 4JQVA 4PTUA 1HI6A 1Z5LA 4KJQD 2YA1A 4PJ5B 1BJ1J 5EO1B 1S7WA 2PO6C 5FUZH 5FKPA 2EDTA 3DMMC 4NRXB 1MUJB 2AW2A 2BRQA 1MCOH 3U4BL 3BGFB 1BPVA 3MR9A 4NKMA 3A6CH 2AJ3A 3MA9L 2YR3A 4LVNB 3BHBA 3QDMB 3HE7A 1T2JA 3ZYIA 1IE5A 5CJ5A 4RGMB 3HNSL 1EGJL 2XYCA 2CRYA 1S7XA 4JANB 2Q8BL 4Y2DC 3WHE0 1NCBH 2X4RB 2XFXA 5D7JA 3LH2L 1RK1B 4C55A 4FQLL 2E6PA 3PDOA 1ZT4A 4XCFH 4FTVE 3WFDH 3SE4C 2V9RA 4JREB 3FO0L 2AK4D 4QEGA 3SKJL 2GK0A 5FDYA 1BFVH 1R3KA 3ZKXB 4GAJH 3W81A 3RVUD 1RSFA 4OIIH 2DQHH 5K9KB 5F96L 4G6FD 2HVJB 2IADA 1A7NH 1DBBL 4K55A 5GGSY 4MVBD 1ES0B 5IQ9B 4HV8A 3SJVB 1FG9C 1R3JB 4X7TB 3HCVA 3DX6B 3T0AA 5D5MB 1QBBA 1KXVC 3QDMA 1MCOL 1KJ2H 3VRJB 2HH0H 3U83A 4MD5B 4JGJA 3O45B 4LASH 3T4AA 4OLVL 5KVFL 1OWRM 5CUSH 5D7LA 2MCPL 5CIPH 3WN5A 4PJIF 3MV11 2OR9L 4G6FB 3EYSH 3G6JF 3HTLX 4QRPD 2FEDC 4KUCF 1N7ML 1NCBL 4UINL 1EEYA 1RIUH 5IHUH 5A2LH 1D5XA 1UH3A 3TN0C 4MAYB 4FQ1H 4AENA 3HHRB 3BWAB 4JCLA 4QHKI 4XCFL 5LG1A 3WFDL 5MEPA 3KVQA 1JZ2A 4HJ0C 1CGTA 1BFVL 1XMWA 4GAJL 2HVJA 4NZRL 2DQHL 2NY7H 5IQ9A 3QSKB 2XTJE 4EOWH 1A7NL 4LSPH 1R3JA 2I9TA 3TIDA 1UWGH 4E0RB 2H6PA 1WWWX 3L1OH 5ECJE 4ELKB 2X7LA 3R0NA 4XNQB 1XIWC 2ARJB 2X40A 1WWCA 2AK4A 4YIQB 2D7QA 2ZCLH 2CPCA 3MGOB 1GZPA 2HH0L 1UQSB 1IGML 2AJZB 4LSUH 2NXZC 1T0PB 4TVPH 4HW6A 5CUSL 2A2QT 3T2NL 1WEJL 3L5HA 4MJ6A 2VLMD 3WS6C 2YK1H 4O00A 1JPST 4P4KD 4U4BA 4WU5B 5HPOA 4JJHA 5C08A 3JWOL 2DWDB 1RIUL 2P5WE 1JRHL 3LKSB 3ULVF 4FQ1L 3BIKA 2HRPL 1KBGH 4XMKH 3WO4C 4NFCA 5CBEB 3WE6A 2NYYC 1VERA 1TQBB 1U3JA 4DW2H 4QRPA 3DO7B 4ZQKB 3HMXA 1P4BL 4JRYD 2N4IA 2E7MA 4E0RA 1ZXQA 2NY7L 3SGJC 4APQC 1QR4A 1K8DA 4NNPL 2YKLH 4XNQA 4I0PB 4EOWL 4P4KB 4LSPL 3T3MF 1UWGL 4YIQA 4I8DA 5I66B 5JW4Q 1KGCD 4U1KB 4Z78A 3M8OL 3F6LA 1BBJA 1E4XL 2GJ6D 4KQ4H 2FX7H 5CEXB 3VRIB 1H0DA 2ZCLL 5TPWL 5C3LD 4NSKB 1M4KA 2MHAB 3WFCH 3K7UA 2UZIL 1CFNB 1NAMB 2BVQA 3IDGB 4PJ7F 3NGBC 5HHQB 4CMHB 4PJ8C 4LSUL 3CDYA 1EXUB 4JRYB 4RBPH 4WO4C 2YK1L 5GS2D 3MRQB 3SOBH 5CS7A 3IXTA 3B9KD 3FTGB 4L9LB 2W59A 3WFEH 5ISZA 2HFEB 2GJ6B 4OJFL 1KBGL 3ULUC 1AXSA 1OB1B 4DOHE 4OZGE 2BNQE 3PWJA 4ZMAT 3DO7A 1R3LB 4ZQKA 4BFEA 1KB5A 4YLQT 1CFTB 5DEFB 2R1YA 3IGAB 5C0EB 1BF8A 3RWIA 4DW2L 3HB3C 3B2UC 3O6MH 5I1DA 4HPOH 1OTUC 4O2FB 5I66A 4U1KA 2V7NA 4MS8D 4M5ZL 4CN1A 4QOKA 2YKLL 1JK8B 1JZ8A 3UP1A 1AY1L 1EJOH 4QF1A 5FAAA 3CFDA 3B9KB 3GBMH 2MHAA 4KQ4L 1CFNA 3GJEB 3IDGA 5HHQA 4RIRA 4DQOL 1JF1B 1PW3A 3ARFC 3WFCL 2YD8A 5D7KE 4Y4HC 3L5IA 3QUZD 5JQ6H 2R1XA 3WDIA 1RZKC 1ZVSB 4KHTL 1CIDA 3MRQA 4JHWH 4K71B 4MB3A 1NDGB 5GIRA 3HKFA 4YHZH 4PRBB 3FTGA 4PRIE 4L9LA 1ADQA 1CIUA 1L6XA 1WZMA 2GJ6A 3SOBL 3C60A 2ZUSA 4BH8A 3K46A 1K4DA 4B7IA 5MHSD 2YC1B 1QPXA 3WFEL 5ITBL 3QG6B 3IGAA 4UILH 5FGRA 5CD5D 4ZOBA 3LIZH 4F57H 3RQ3A 5C8JB 3FT3B 3ULVH 4LCWD 4N9GB 4PBVC 3K8KA 4I13B 3SDAB 3BKYH 1JK8A 1KELL 3VD3A 3O6ML 5IEHB 4PR5B 3AFLA 4HPOL 5GJSH 3QCUL 5DJCB 1RI8A 2CLVB 2D7TL 5DDHB 1J0IA 1FL5A 5ITFB 4JPWH 4X8XA 5B8CA 5IQ7L 2LAAA 1EJOL 3UAJD 4P2RD 1P7QD 3NBNA 4HKBB 2UWEB 1JNNH 1TTFA 4FNLL 1NGZB 4RFOH 5DQDH 4N5ED 3P4MB 1CFBA 1UM4L 1NDGA 5F7DB 5JQ6L 3WUZA 1KYOK 4P2QA 4U1SB 5DVNA 5E1HB 4XPHH 3MRPA 5J3HD 1CN4A 4XAWH 3GB7B 1SJHB 2NY4D 1T7ZA 4HKZB 4P2RB 2D31B 5D93C 1A7RH 4KK5D 4D2NA 1G9ML 3QUZA 4KMTH 1CLYH 4F57L 5ACZA 5BZDA 3L3OA 1IC7H 4HMCA 4RAUB 5DJCA 2XA8H 3ULVL 4MJ5A 3S5LB 1F3RB 1U8PB 1UB5A 2VKXA 3D1MC 3INUL 5GJSL 3U7YL 1N64L 4QXUH 3CFIC 4YDJB 2ZJSH 4OAWB 1CLZH 2PYEE 3V8CA 4NC1E 4MDIB 4JFHE 2R39A 4PJXB 1T22A 2G75B 2NY4B 2PF6A 4F37K 2HVKB 5HDLA 1JNNL 4GKNA 4IIQA 3RVVC 3V4PH 4WUUD 4LCWA 2DTSA 3BAEH 3EBAA 5DRWB 2CH8A 4F15C 5D6CB 4NQUA 3BPOC 5EOCH 5GGSA 4L4VA 4MB4A 5B4MC 4PJ5E 2IAMC 2LE9A 3A6OA 3GB7A 3RFZC 1SJHA 2IFGA 2VDPH 2MQCA 3KPNB 4HKZA 4XPHL 4P2RA 1P7QA 2D31A 4XAWL 5C07D 3L3HB 2FEEI 5FOJA 2AJUL 4W6WB 1BX2B 4F7TB 1QPPA 4NJ9H 5HYJD 5H2BA 1XGUA 3WO3B 1A7RL 4BK4A 1E6JH 1RULH 3N1QC 5JORB 4W6YB 4KMTL 4PIRF 1IC7L 3EZ8A 5JMRA 5M7QA 4HIJB 1X5XA 3I2CH 2DLEA 1MCCA 2X4OB 5A1AA 2O61B 3UBXG 2R56L 2ICEB 5DMJB 1IVLA 4NZDA 2WZPD 3VGEA 4MDIA 4QXUL 4PJXA 3S35L 1FNFA 4ZAKD 1G7IB 1T4KA 4V1DD 2HVKA 3OJVC 5HY9B 1CLZL 2BY1A 3T4YA 2P46B 2NLJB 3D5OF 5HYJB 5DRWA 2IH3A 4QCIB 3KPRD 4E41A 1F6LL 4X6DE 3IDJB 3GI9H 3RKDC 4XNUH 5D6CA 1FO0H 4M02A 2Y7QB 4P2YA 5D4QA 3RBSA 2YD9A 5DQ9B 3RWCB 5TF1H 4OZGF 1ROWA 3CLEH 5CEZH 3VXRE 3L3HA 3LV3B 3SJVE 4YE4L 2VDPL 2ERJC 4ZAKB 4O58H 2BSTA 4V1DB 2IBBA 3W9DA 1FNEB 1R5WB 5D5ME 2P8LB 1ACYH 2B0SL 3L95B 3IJYB 4WUUA 4Q9QH 1KJVA 4NJ9L 4ZSOE 1U8OB 2Z31D 5DHVB 3I6GA 1INEL 3KPRB 1E6JL 1RULL 4E9LA 4K3DH 5I1KH 3OTTA 1IBGH 3QNYB 2ICEA 5C0CA 3UTQB 5HHNB 1P2CA 1JTOA 1NCUA 1G7IA 1I8LA 4LVEA 3O41B 2P8MA 5DHYB 1Z6JT 3B5TA 5F88B 5C07A 3SKUD 3SGKC 5C0BE 3RWJA 4GS7B 2VXUH 1J9CT 1DLFH 1YMME 5HYEA 5FV1L 3AY4A 1ED3B 5IVXE 4L3EE 2C5DC 5J8OA 1FH5H 3P0VH 4WW1B 1SYVA 1FO0L 3VW3H 1WCBA 4KKBD 1JVKA 3D9AH 1RZGA 3DBXB 5IFAH 4V1DA 1YECH 4OFYD 3EYVB 4YDLB 1R5WA 3ARUA 2P8LA 3MCKB 3L95A 4HK3N 2ZUVA 3N06B 4O58L 4TVSa 4R7NB 1T2XA 4K07A 2ARWA 3MRMA 4NUJB 4Q9QL 2E9BA 1HH9B 1ORSB 4P9HH 3UTQA 4JFEA 4PRPE 2G9HA 4PGEB 3KJ6H 5DHYA 4LP5A 4WTZA 5C0JB 4I3RH 4FQXD 4ALAL 3P0YH 4PBWD 4QHMB 1FJ1B 1B4RA 4NKIH 2HTKD 2H2PC 1QHPA 5ENWB 1MRDH 2B1HH 4YBQC 1JNJA 3NPSB 1BJ1H 2Z31A 5DJXB 1QG3A 1DLFL 2DKSA 5HGDB 3UXFA 2D0HA 3EGSB 1FH5L 3PWLB 5DFWH 2J6EA 3CC5A 4MHHI 5GS0D 3CVHH 3DBXA 4UT9H 3TVMA 3EYFB 3EYVA 3R06B 1PLGH 4KMQA 3MJ9A 5IFJA 2C1PB 4MXQD 3TBSB 4XC1L 4FQXB 5D1ZA 5ANMB 4NCC2 1YECL 4QNPE 4OV5A 5FGCE 1A0QH 3RBGA 5DUPH 1CT8B 1UH4A 4Y1AA 3GSQB 4QWWC 2EDRA 1ONQB 2A83B 3WNLA 5GS1B 2YRLA 1R5IB 4ONHB 4C56B 4XC3H 2FIKA 5C0JA 2ED7A 1GGYA 5EBGA 2CD0A 4MXWL 3VFNB 1G7PB 4MDJA 3KJ6L 5EO9B 4OFYA 2HLFD 5ENWA 3GKZA 3C5ZB 3HNVH 3P0YL 5BOPA 3H2WA 1YZZA 3O8XD 2P1YA 5KOMC 3EGSA 5T1DL 1WZ1H 3RL2B 1CGSH 2AXFA 1LO4L 5KN5B 3GMNB 1HIML 3S4SA 3UPCA 4WI2A 2ZUUA 5DJAB 2G5RA 1UEYA 4MA8L 5ANMA 4R7DB 3CVHL 1VESA 3CDFA 1T04B 5E8PB 4P23C 4RDQG 1UVQA 3PWUB 4HWBH 4LFHG 3KPMA 1U9KA 3O8XB 3DGGB 1ONQA 5GS1A 3KLAA 2WUCL 5TGBA 3WXVH 5DUPL 1F3JB 2VWEC 3A67H 4HUMB 3O2WL 4QHUB 1G7PA 4KDTA 5EO9A 3G5ZA 4GLRH 4Z8FH 3AM8A 2QHRL 1VEOA 5H37G 2ADJB 3BIAX 3N1FC 4OGZA 1MWAH 1JZ7A 3ZL4H 5BS0A 1OP9A 1A6UL 3DETC 5F3BB 1AHWB 1T83A 2OJZL 4NUGH 3GMNA 1NANH 3QAZC 2BHYA 5C09D 3RWDB 4HMEA 3HZYB 3S8WA 4PJFE 1RJLB 1CGSL 3LD8B 2E8ZA 1GOHA 4XP6H 5E8PA 3OKMA 1U0QA 4OLEA 5D5MF 3WXWH 1NBZB 3VFVA 4M8QA 3BO8A 3JSSA 3C2AH 3VGDA 1JPGB 1A1MB 1JPFB 2CDFB 4XGZB 2AEQH 1ZGLA 5E8NA 4HWBL 4OUUB 2R0KH 4GRLA 3QUKA 4GFTB 4NFBA 5LWYL 2VSDA 3U9PL 2UWEE 2XQBH 2XWTB 4UDUA 3WXVL 3PQYE 2I26N 4K3GA 1QRNA 4NO5A 3A67L 4JHZA 2V2WB 1FZMA 3CCHA 3KHQA 2FR4B 3NIDF 3ULVC 3D0LB 1ZE3C 5HVWA 1RUMH 4Z8FL 2E7HA 5SV4A 2X4NB 2ITCB 3UTPD 5F3BA 1AHWA 2FRGP 2VXVH 4F9PC 5L8JB 3ZL4L 1B9ZA 3STBA 4KC3B 3WJJA 2EH8L 1HOCA 2HJFA 2GTWB 3RJQB 2A0LC 3UPRB 2IFFH 2NR6C 2BRRH 3W5MA 1BQSA 3RRQA 1BP3B 4TNWF 2ZCHL 1JPFA 2CDFA 4XGZA 5SWSD 2J88H 3LDBB 4JZOB 2R8SH 2Q7YA 5FHBH 4OUUA 1EMTH 2FYYB 3C2AL 1FZJB 2JF1A 1N0XH 4HQQH 5J12C 5LAXB 2VXQH 4LRNL 4PD4K 1PY4A 2XWTA 5C09A 2H8PA 4KRPC 4HC1A 3GUTB 2CXKA 2V2WA 2XQBL 1ZS8A 4X6EB 1I3RB 3MV01 2IPKB 3D0LA 1MRCL 2F53E 1UJ3A 3UTTD 1NCTA 3FN0H 1A02N 2HT2C 5SWSB 5DD3H 2BVOB 3IDYB 3BGAA 4XXDB 2GTWA 1A22B 3UPRA 1YJDL 2XG4A 1NMAH 4KKAD 4DCQA 2BSED 3PG2A 4X9HA 2Q6WA 5HYSG 4WDIB 1IZJA 2IFFL 4HXBL 4QNPF 2BRRL 4IEFB 2VZ1A 4FQJH 1OY3B 3QDJD 1INDH 5F1NB 3OB8A 4K3EH 4UTBL 2J88L 4TRPH 5LAXA 3SBWC 1G1YA 3HE6C 2R8SL 1YEJH 1QD0A 2R23A 1OSZA 3IFPA 4PB0H 5L7XH 1JP5A 4XWGH 5IBLC 3WD5H 3HPLB 3GUTA 3T2PA 5DRNB 2IPKA 2YSSB 3GSNB 1Q9OA 4OD1H 4WWKA 3RP1A 5J89A 4BA8A 3ARXA 3GK8L 5MEOA 5DJZB 5MENE 1CL7H 1J8HE 3BJLA 3CDCA 3KYNA 4I77L 3MA7B 1VGKA 5DD3L 4R4ND 2ADGB 4NHCL 3ILQD 3NACH 4LEXH 4WJ5B 5IOPB 3IFOB 1P7HL 1MCEA 2BFVH 3KYOB 3DTXA 4HH8A 4LPVA 5J6GA 5E08L 3ME0A 2HT3D 2N1KA 4WDIA 1NMAL 3K2UH 2ZSVB 1KUMA 4BQ9A 3TLRA 5GRYA 2E6QA 2OL3L 5TFSL 1FZKB 4N8VG 3QDHA 3UTTA 4G8IA 3RGHA 5JR1H 3FQTA 4HDIB 5F7HA 3HMXH 2Z92B 4K3EL 1GRWA 2FL5A 1JGDA 4KJWD 3K80A 4NQEE 3D2UD 3P9MB 5DRNA 5L7XL 3ZKNC 5B22A 4XWGL 2A77H 3GSNA 4XMPH 1AIFB 1EHLH 2E9IA 4L1HA 1N4XH 4ELME 3PXJA 2IG2L 3MLUL 1ZA6B 1I1AD 4JDVB 4OD1L 3U0WH 3EO9H 3RPKA 3TESA 4JPVH 1TNNA 2ZNWA 3QDJA 1G6VK 4DKDC 4UT6H 3IFLH 4Y89A 3K1KC 1H5BC 1KULA 4Q6IC 4WJ5A 1CL7L 2XRAH 3IFOA 5SX5K 1CFQB 3KYOA 1QFHA 4PJFF 2HMIC 5T1KB 4I5BB 4ZUVB 4YK4B 3NACL 4PUBH 5D1XD 3D2UB 5DJ6B 3SE8L 2BFVL 2DB8A 2V7HA 1FC2D 1FVCB 2DLFL 2VUYA 1BD2D 3SGDH 5EA0L 1H15B 5DI8A 1RD6A 1U3YA 2P7TA 1I1AB 2PUQT 1YY9D 1GZQA 2VDNH 1WFOA 2FLRT 5JR1L 2BOCB 2UWEF 2WUBH 2W65B 3PV7A 4H20L 1F58H 1QSEB 5GRVK 1WIUA 4S1QH 1DBKL 5DMKB 4HUNB 1BIIA 3MLVH 5D1XB 1DQJB 1SM3H 1A1OA 1F90L 2A77L 4HWUA 2P8PB 2YD4A 4ZOCA 2VB5A 2R2HA 5BCAA 3TJEH 4WFFD 5IGXH 1NAMH 4Q6YA 3U0WL 3EO9L 4JPVL 1CGYA 5L8KB 3ARDC 4JRXE 4Z7QE 4P9HC 1CFQA 1T89C 4UT6L 4XAKE 1KT2B 2YD6A 4I5BA 4ZUVA 1J1PH 1I8KA 4OF3A 4MJID 4NP4L 1DQQB 1AGBB 4R90H 5ESVA 4L4TE 5IMMA 4IOIB 3QT2A 3BPNC 4HZLA 1I8MB 1VFBB 1T7WA 4BSJA 1ADQH 4G8GB 1YN6B 1S7QB 4WI7A 1I1AA 2BVYA 1H8SA 2IH1B 2QSQA 3FT4B 4PGBA 1J0ZA 5E6IA 1HH6B 5D2LB 4E42B 4C56E 2I9LA 2BOCA 4ODHL 3UJJL 2YXFA 2DWEB 1JF5A 3KPQA 4FZEH 5BVJA 5D1XA 1OGTB 4MJIB 5GS2H 1F58L 1VA9A 2L7UA 4RFNC 2P8PA 4S1QL 4XPFH 1LWRA 1BD2A 4H1LA 1HQRA 2BK8A 1MLBB 1S9XB 1SM3L 1CDJA 4I2XE 1ND0B 5IGXL 3QI9D 2H3NA 3Q2CA 1LD9A 3QJFB 1NAML 2DLTA 1QQDB 3V0AC 5D72L 1D5BB 2WLZA 4OD2B 2X10A 5B38G 1AGBA 2WIIA 5F8RC 4IOIA 5TJWK 1F13A 1YC7A 1I8MA 1J1PL 2HTLC 1BQUA 3DLQR 3NCBB 2IH1A 4MMXC 1HH6A 1IAIL 3PABA 5D2LA 1P69B 3V6ZA 4OF6A 1XCTB 4GOSA 5DRXB 3VE0B 4EI6B 2J8HA 2F54B 3QI9B 5F1OB 4DVBB 1S7SA 2FSEA 4MJIA 3ARBC 5AG9A 3C2SA 3ET9F 1U8IA 4WHYG 1QLFA 5HPMB 3GZKA 1RURL 4XPFL 1LVEA 3ESUF 2E27L 4H25B 3QJFA 4C83A 4X9GA 2R69H 1D5BA 4OD2A 3QRGL 1AR1D 3MRCA 4LKXB 5KVMC 4ZS6D 2IPUK 3AC0A 5DJYA 5SX5H 3VFTA 4MX7A 5EBWA 2WBJD 3HLAA 2Z91A 3RHWF 2Y1VA 1VFAA 4U6HB 4K3JL 4JO4L 1YDPB 5LGHH 1W72L 3T3PE 2WK2A 2OZ4A 2GITB 1LP9A 3QIUC 4RMWA 4DVBA 3TYGH 4UQ2B 1HCFX 3IJSB 1P53A 2NW2B 4AIOA 3WBDA 3DRQB 1XGRA 4ELMF 3I6LE 3VWJD 3H3KA 1PY9A 3GFUA 1PVHA 1ZT7A 3V95A 1CXLA 1K9TA 2ZKHH 3I75A 3R8BB 3MROA 1ZT1A 3IDNA 1M71A 3EDKA 1DJSA 5TE4L 4LHUD 1AD9B 3BXNB 4LKXA 2FJHB 4J3UA 4M48L 1IAIM 3QIWD 4IOFD 4EUPG 1QSZA 2EDLA 3H7BB 2Y23A 2Y6SD 3P9LA 4QRQB 4FQPA 4RX4D 2L4OA 4KHXH 1CI5A 4KUZH 3HE7C 2MFNA 2OCFD 5D70H 1OPGH 4HKJB 5DJDB 1I3GH 4Y5YB 1YDPA 3ULSA 3VI4E 1BHGA 1ZWIA 3TO4A 1HYSD 1MAKA 1OGAE 3F7QA 1D9KA 4UQ2A 4LHUB 3T65B 4JN1H 4KDVA 3VH8G 1FORL 2EXWC 4Z18A 2N56A 3P9WB 3HRZB 3QIWB 3TNNB 1GGCL 1EVTC 5IMLB 4LDLB 1OAQH 3G5YB 3RNKA 3ZTJG 5F6HJ 2WBJA 4L3CB 2YD3A 4NM8H 5J0BA 1L4IA 5GS3A 4H26B 4Z7QF 1AD9A 3BXNA 5LJYH 3OGCA 2QADD 3FJTA 2ZKHL 3WHE1 1DANT 1VEPA 5DFVC 3BGFC 4RWYH 1EH9A 4JJ5B 4LVNC 4DZBB 1MCRA 3B5GA 1JHKH 1CGVA 3MV7E 4PY7B 5T3XD 3VWJA 4RGMC 3OAYK 4Y88A 4KHXL 3CU1A 5EIIB 4JZJB 4Y5YA 2OX5A 4KUZL 4F80A 4UB0H 4OCWH 3S88H 5D70L 5DQJB 4KJQC 1OPGL 1I3GL 1UZ8A 3T65A 1KFAL 2QADB 5HVHB 2HA1A 5HTSA 3LS4H 2EC9T 3TNNA 1LDSA 1N0LA 1RHHA 4JREC 3LRGA 2DQIL 5DHVH 5GGTL 3WLBA 5IHBA 2GEEA 4RX4A 5D2NE 1D5IL 1VEMA 1CFSB 1GC1H 4L3CA 4CVUA 3CXHK 5IW1B 1L0QA 1OAQL 1OTTD 1U3ZA 4NQXB 3DV4B 4MNHB 4RAVA 4H26A 4NM8L 5FYJD 5LXGL 4WWID 1PDKA 4UDTB 1VKXB 1MIEL 3NA9L 4PJHB 3V7AE 1CXEA 3G5VB 3VGAB 5BMFL 5FYKE 2AXHA 5FGSA 2V2TB 5ICYB 2ZZUT 3AUVA 4DK6A 2VNCA 3RX8A 5EIIA 2E6JA 3RVUC 3KPOA 3IAGC 3IAPA 3VGGA 2JIXD 2JJUA 4ZUSA 4UB0L 3RWHB 1GHFL 2XIDA 3QISA 4O2CB 3CPLA 3MJ9H 1RVFH 2ZUXA 4MVBC 4ZPTB 4MAYC 3SPVA 4LSVH 1YQVH 1DR9A 4O51A 5IW1A 3U0PB 4R4BB 4MNHA 2M26A 4X6CB 1CDIA 3MRIB 1GC1L 3QUMA 2OP4L 2C26A 5E03A 3X14B 5KW9H 1WUNT 4PJHA 5EBLB 1H3XA 2JIXB 2W9LA 1BVLB 3JVGA 5ADPL 3GBNH 3LSOB 1LEIB 4TSCH 4NRZB 1KTRL 5CJXA 4PRAB 2VXTH 5CZVL 3UO1H 5TQ0L 1QLEL 4OQ1A 3TT1L 5BZWB 3LKRA 5ICYA 4ZYKB 3NPZB 1U95A 5T1MB 2VL4A 2YPVH 3MSPA 5DS8B 5C0AD 4O2CA 3T3PF 5MEQA 3G04B 1T5XB 5CKGA 1U92B 1Q1JH 1MHCA 4ZPTA 4GXUN 3VFOA 1QSEE 3OPZL 5K9QI 1BLNB 4BSVB 3VXSB 5ILTH 4LSVL 3UYPA 3C8KB 5C2BH 2M8XA 1DVFD 4R4BA 1YQVL 4KTEH 5SWQB 4HS3A 4ZFOA 3MCG1 1SEQH 3M1BB 3X14A 3IFNH 4HGWA 4LFHD 4N0YL 2B4CH 5MERB 1TQBC 5GS0H 1B6UA 1BVLA 1MCSA 5C0AB 1XH3B 1LEIA 3WYRA 5KW9L 3ZE2E 2BNUA 1QFUH 1QSVA 4I0PC 1OAZH 4LU5H 4P4KC 3VXMA 4CU7A 3GBNL 5BZWA 5E00B 4TSCL 4G8GE 2DQUH 2YD2A 2BNRA 4KZEL 3UO1L 5HJ3A 5E4IA 5I1JL 1DVFB 4N68A 4LIQE 5BW7A 1SJXA 3VI4F 3S37H 4YHKH 4XMLH 2ATPB 3G04A 1U92A 4CMHC 2YPVL 3QFDB 3IKCB 3BP5B 3MLWH 4UU9B 3CVIL 2BVPB 5GRUL 3SDDD 1ZSDA 2DMCA 3QO1B 1QBLH 5IB5A 4PB9H 1IAKA 5EWIH 3S37X 1V3KA 2VIRA 3C8KA 1CDHA 2D4FA 4U2ZA 3D25B 4AEIH 3QUYD 4L9LC 4OKVA 4U1NB 3M1BA 5C2BL 1NMBH 4DK3A 4KTEL 4P0DA 4XP5H 3BKJH 1JCKA 1Y18B 1YY8A 5C0AA 4DEPB 1U8QA 4OCYH 1G6RB 3VFMA 3QIBA 4Q9CA 1KIQA 2W60A 4YPGB 2HFFA 3SDDB 5E00A 1UT9A 3FQWB 3BP7A 3KPLB 4B53A 4LPYA 5EUKA 1OAZL 2J2ZA 4N90D 1GOFA 4GW5B 2W38A 3O81A 5C0FB 1VACB 3B9KC 3CD4A 3OG6B 1T1YB 4D0CB 4X4MA 3X3GH 2F54E 4TN9A 1EZVY 3X13A 4KKCD 3BP5A 3H9ZA 3WHXA 5IB4A 4YHKL 1CICD 5JW4R 2J8UB 5IW6A 5FUOH 5EO0B 1WK0A 3MLWL 2VLRE 5FEBA 4K71C 3ZLQC 3MJGX 4U1MB 4R4FH 3GNMH 3IETA 1IM3B 3D25A 4UAOB 3EOAA 4PB9L 1TZIB 4U1NA 3H8NA 4HK3J 1YNKH 1CGWA 5C6TH 1EAPA 2FB4H 1Y18A 4P3CL 1KXQE 3VXPA 4HHAB 1XF5A 4QTIH 3TIEA 3AAZB 4XP5L 4KK9D 3T04D 1DSFH 4RNRA 3PGDB 5BV7B 5ADOH 2NQCA 4YPGA 4FG6D 3JXAA 3RL1B 5IM7A 3KPLA 3C9NA 1G0DA 3SDAC 4OCYL 5FFLA 1MY7A 4KJYB 1N59B 5B21A 1JYWA 1VACA 4P46D 3QUYA 3O9WD 4IDJH 4D0CA 3K0WA 5DF0A 3GSWB 3QFJD 2IGFH 1J1XL 2CJUH 1Q9LA 5I16B 2IF7A 4CNIA 5DA4A 4HIEB 5CWSB 4YBHA 1Z9SA 5CD5C 2BP3A 4PJCB 3ZE1E 5E2WH 3EHBD 1TETH 3HI1A 4U1MA 4O5LH 3LS5H 3ZHLA 5JW5B 1J8KA 4XI5D 2ESVB 1TZIA 4GRMB 3HC0A 1I4FB 1J1OH 5LVEA 3MOQA 1FPTH 1P9MC 3GNML 2DQDL 5ESAA 5KG9B 1I7TB 3VA6A 3BDYH 4P46B 3OX8B 3WUWG 3OKKA 3O9WB 3U6RB 3AAZA 2YPLD 3QFJB 3UYOD 4EN3A 5GRWA 3TH2T 3PGDA 3WFBH 1CICA 4JVWA 1NDMB 3RL1A 5IEKA 3DRTA 2F5AH 4QTIL 4HKXB 3RJDA 3BN3B 1DSFL 3D18B 4KJYA 4YR6B 1N59A 1Q9WB 1WJ3A 5MP6H 1U8HA 3NFSH 5GSRA 3DYOA 3LQMA 3TFKD 3UTZB 4G6JH 1BEYL 2FEEL 5HYSB 3TA3B 3VXQA 3HFMH 4OCXL 4FA8A 2CDEB 5J3HC 3O2DA 4WFHD 5ID0A 4UV4L 4IDJL 4LGRB 4RRPG 3HZMB 1LDPL 2NY4C 4XPGH 2ED9A 1H3WM 4P5TD 1S5IL 1F3DJ 1MCKA 4M7JL 4GMSH 3MRFB 1L0XA 4NWUL 5E2WL 5KSBB 5IBUG 4E5XB 4PJBB 5E99H 4JM2D 4NYLA 1RJZA 1I7TA 3O6KH 3OX8A 1TPXB 1A7QH 1H3TA 3O9WA 3U6RA 1ZKAA 1FPTL 1GGBL 4ZTPH 4OLUL 3QFJA 1MVFA 4OQTA 3PWVA 3GSNH 1FL6A 2KQMA 4HUXA 5DUBA 3RVTD 3ZE2F 5JZ7D 2PYFB 4P5MB 1ZEAH 2ZOKA 4P5TB 4YR6A 1Q9WA 1S5HB 2QQKH 3WFBL 2F15A 3OR6A 5D1QD 3UTZA 5JUEH 1WC7A 1P84J 3NFSL 4JM2B 1A6WL 2V5SA 3GJFB 4TYUA 5E8DH 3PL6A 2GFBA 2NY2B 1A6TA 4P2OB 3D87B 2XV6B 1WF5A 3UYRL 4N8VB 2YPLA 1I8LC 1H3GA 5ICXB 3WV0A 5CSBA 4PJDB 4QHNB 5GGUB 5IB3B 4OF5A 3MRFA 4D9QE 5CKAA 2XPGB 1EEUA 1W8NA 1ACZA 4U3CA 4YEFA 4Y19B 1HHGA 4GMSL 3AY4C 4I3SL 4KJPD 3TYFA 5D1QB 4QY8A 4CKVX 2DQFB 3O6LH 4NGHH 5E99L 5HDQH 3B2VH 5HI3D 2R4RH 4Y5VA 2ENYA 2R0ZH 1A5FH 5DYOA 1S7RB 1CZ8H 3HUJB 4Y0GA 4ZTPL 1NJ9B 2PYFA 4ZAKC 4P5MA 4JFQB 5C08E 2EKSB 1S5HA 4U1HB 2KUTA 1S3KL 3FFDA 1LO5B 1ZEAL 1S9VA 1IGFH 3S6CA 5E94A 1EO5A 1CD0A 2VDOH 2BMKB 3LEVH 1GC1C 4JM2A 4QTHA 5DWUH 1DQLH 3TWCL 1ZAGA 4MNQB 3RZCD 3DURB 2DBLH 3MLZL 2Z8RA 1W2KT 3EJZD 3J7HA 4PJDA 1SVZA 1VADB 3M45A 3QO0B 4NZUH 4GS7C 5FYKL 4P3WA 4U6YB 1I8IA 4TQEH 1YQ2A 5DUMH 1XGTA 4Q58C 2OQJB 4X6CE 1N8ZB 4XXCA 3MXVL 3CH1B 5JHLH 1JZ6A 1CLOL 4PRHE 2ILLA 3D85A 3O6LL 1S7RA 4K23H 3HUJA 4ODBD 3JTSB 5FOBA 5FM8A 1EAJA 4ZXBD 4JFQA 3BMVA 3CX5J 4YDLC 2R0ZL 1NL0L 3GKWH 2CO7B 3O3EB 1M1SA 1OD7A 3UDWA 1S78D 4RZCA 1LO5A 1I9RH 4K7PL 4RWHA 1ZTXH 3K3QA 5E9DA 5ISZE 3MLTB 3NVQA 4G7VH 5HHME 3MACL 2FJFB 2VDOL 3I02B 3LEVL 1F5WA 3TCLB 4KKBC 3MNWB 1BFOB 1RK0A 1CXFA 3ZE1F 3BPCB 2BJML 4MQXD 2P43B 1UM6H 4LHQB 3FOLB 3VXSE 4L8CB 1FP5A 1INQB 4QOKE 4HSQA 3NPSC 5E2VL 1T3FA 4LIQH 1HHJB 3W39B 1N8ZA 5C7XH 4P3DB 4TQEL 2APBA 1J86A 4Y2DD 1X44A 3CH1A 5CJOL 5DUML 5JHDE 3CLFH 2YHGA 4XCYB 5CJQH 3RDTB 2QKIA 1FFQA 32C2B 2I24N 3RZCA 5E7FA 5JHLL 1B0RB 4WI8A 5IROC 5CGYC 4OI9A 4F8TA 3E8UH 1O7VA 4FQXC 3U1SH 4O9HH 3EOTH 4KTYA 2HTKC 2XN9D 2EEBA 3C08L 5L6YH 4KI5E 4Q97A 5B38B 2AJSH 5AD0B 2Z8VC 4JZNB 4DZ8B 1T5WB 2FATH 3O3AB 4U7KA 5GS1C 4J3XA 3MV8D 4WW2F 4G7VL 3ECBB 4PGCB 4UBDC 2B4CC 4TUOB 3MNWA 1BFOA 5GS0C 3T0ED 3T0WA 4ZXBA 2RQ8A 4KDTC 4P4RA 1SEBA 3C5ZC 4XPAL 3TO2B 4PLNC 2WBKA 1OARL 2VTFA 2XN9B 3HS0B 4LCYA 2GSIB 1NGYA 4LIQL 2VLJD 4U1LA 3GMOB 2FEDD 1T03H 3NN8B 2PTUA 3AROA 1B0RA 3NFPA 1JPSH 4C54A 3CH8A 4EXKA 4IDLA 1AFVH 4F7EA 5HYQB 4JLRB 2RHEA 4IRJD 3T0EB 2FZ3B 2KPNA 4X9IA 5JOPE 3R4DA 2HLFC 1WBZB 1QHOA 4AEFA 4HJ0D 5AD0A 4JFFB 4JZNA 1T5WA 3O8XC 1ZLVK 1NCCH 3P11L 4Y2DA 3O2VH 2AJSL 4P2QE 5L2KD 5TDPB 4NO3A 4EDWL 3FFCD 3OAZH 4Z7WB 3LKPB 2VLJB 5H35B 5INDA 2LU7A 3ECBA 2W9EH 1WT5C 4TUOA 2J8UE 3MFFA 4YX2L 1F4WL 2DMBA 3SE4A 1VDGA 3OMZA 4HS6B 1G1CA 1R3HB 4IRJB 4D9RD 2R1WB 4HIHA 2XN9A 3JV0A 3MO1A 3OF6A 3MV9B 3VD9A 2EDBA 1QSFD 2L7JA 4XCNB 2NXZD 2B2XH 1JBJA 1FN4A 3NN8A 1AHWC 4V2CB 5L2KB 5ESQB 3MV8A 3FFCB 1GXEA 1MF2H 2HFGH 3WJJC 3PP3H 1T03L 1QUNA 3LD8C 4JLRA 3QYCA 4CBPA 4HIIB 1JPSL 2Y36H 5DRZB 1JI1A 4CADB 1K85A 1SMAA 2NZIA 1MJ8H 3NH7H 1WBZA 5J13C 3KNBA 5DC4B 4H8WH 4TNVK 5CSZB 4EUPB 3ZTNH 1BECA 2VZUA 4YXKH 2NYYD 4L4VE 1QSFB 4GW4B 1JFQL 5DJ8B 4BFBD 3KLDA 1BZ9B 4Q74A 2FGWH 4HS6A 3PGFL 3JWDH 3BD5A 1MCPL 4IRJA 1OAXL 5BRZA 3VFPB 4JFOA 1C1EH 2ESVE 4CN4A 3OAUH 4G9DA 4M6ML 3VH8B 3I50H 4XCNA 4J23A 4X6CF 1AKJA 3QWOB 4RFEB 2MQ3A 4I3GA 5ESQA 3U46B 3U4EB 3HC3L 3FFCA 5D6DC 3EYOB 4Z7NE 3WJLA 4HIIA 5DSCA 5DRZA 4WO4D 4RSVA 2HFGL 1BQHG 4OLYL 4FFYH 5CSZA 4E41E 4NKDB 1T2QH 1MJ8L 3LDBC 3NH7L 5LGJA 1F8TH 5CILH 4QXGH 3ULUD 4NQDA 1K6QL 1EVUA 5E1AA 1GCFA 4QRTB 1NEZB 1UKSA 1KN2H 4OLWL 4YXKL 5C3TA 1MI5D 1MY5A 3WS6A 3B2UD 2NTFA 3RKPA 4YBLB 4V2BA 5DHXB 1UM5L 1MRFH 2Y25A 4KGLA 4OZIA 3PJSB 4LCUB 4PJBE 2HWZH 4GAGL 4NQVB 3VXUD 1CK0L 1C1EL 2DTMH 3QWOA 3OAUL 3EOBB 4XNXH 3IDYC 3JBG7 1ZHBA 2X1WL 5C0CE 3U4EA 1UXWA 5DR5H 3I50L 3U9UB 3EYOA 1B2WH 3QZWA 4Y4HD 2VDLH 4EVNA 4YUEL 2C4FT 3SGJA 3F65A 4APQA 1MI5B 5E2TL 3PHQA 1RZ7H 3QEQD 1EO8L 1AGFA 5JIIA 1Z0MA 2RB8A 4NKDA 4KI5F 4XVJL 3LQZA 1WZKA 2VAAB 1VPOL 1NCWH 1T2QL 1YEIL 4Z0BH 3VXUB 2JJTC 4RDQF 4NRYB 5CILL 1KTKE 4QXGL 1NEZA 2EEDA 2GQHA 3S98A 1VGEH 2WQRA 4KGJA 2X4UB 1KN2L 5I76B 4KKAC 2EO1A 4WO4A 1DDHB 3PJSA 4I0CC 4LCUA 3QEQB 4Y19E 4XVSL 3CFBA 3KR3L 3P30H 3C6LD 2A6DA 2CRIA 4KMLB 5FUCE 3WDJA 3BI9X 5HD8C 1A1NA 4JFEE 1T1XB 1T1ZB 5DK0A 2DTML 4JFPA 4LQFH 4Z7OF 5DR5L 4D0DA 1MI5A 2DAVA 3BN9C 3QBTB 4X4YB 4KFZC 3FO2A 1KC5H 2DI8A 2VDLL 4YC2C 4WFED 4G43B 2JK5B 1JNLH 1RZ7L 12E8H 1JI2A 4WUKH 2NTSP 3C6LB 3PWPD 4Y5XB 4NRYA 1M7IB 2YRPA 4MNQE 2ZCKH 2WWMD 1NCWL 3ARFA 4Z0BL 4R4NC 3IJHB 3TP4A 4ZO8A 3HG1D 2J8UF 4Y4HA 4OZHB 3W5NA 1BOGA 1YPZE 1KLUA 1VGEL 1CFVH 1P4IL 3RUGE 2HT3C 1LMKA 1TJHH 2DYPD 2ZWLT 4XBGB 4OGYH 4ZNCD 4TSAL 3CX5K 2BCKB 3V2AR 3NFNA 4KK6C 1JN6B 2JB6A 4Y1AE 4HFWA 2A73A 2ORBH 1T1ZA 4L3AA 3PWPB 4LLUB 1U91A 4KZDH 3LAFA 5F6IB 1NPUA 4U6XA 4U1JA 4YK4C 5CZXD 4N8CH 4X4YA 4KJWC 3HG1B 3RVVD 2BOBB 2FCBA 3GMPA 1CDGA 1GIGH 2JK5A 5EU5B 1DBAH 1P4LB 2DYPB 1PZUB 3O0RL 1AO7E 1RIVH 3C6LA 4LOUC 1I1AC 4NCDA 4Y5XA 1M7IA 2CIIB 1JNLL 4KROB 4ODTH 3FONA 2VDQL 3TF7C 3LHPH 3VFUA 3V9FA 4WUKL 1F3DH 2WV3A 1FNHA 4JDZB 4J3VA 4GAYB 4NN7B 2ZCKL 1J0KA 3BH8A 3H9SD 4PJCF 2FDBP 4LBEB 4S0SD 1IAMA 4ZG1A 3VU2A 5D1XC 3BIBX 2MTPA 1CFVL 2BCKA 1FNAA 4PGJA 3D0VB 3OGOE 4MYWB 3AS3A 2YPKA 5KS9B 3QQ4A 4LLUA 4OGYL 3FRPG 3QQNA 4N1EA 1YY9C 2VYRE 3EYQD 4Z7NF 4YNYB 1ZLUK 1A6ZA 1QBML 2CIKA 3HG1A 4RGND 1Y0LA 4KDWA 1EJ6A 2V9TA 4LKCB 4ODVH 5JXED 4LLQB 4OLZH 3OG4B 2X4TB 4ZO7A 1JIBA 1QYGH 1U8LB 5CHNB 3CSPA 2QQLH 3HR5B 5A43C 5FO9A 3QG7L 6FABH 5JNYB 1G6RH 4ODTL 4HG4J 1CU4L 3BRGC 4LBEA 1TXKA 4HUKB 4RGNB 1MH5A 2OTPA 4OZFG 2C1OB 4I4WA 4Z7UB 5KSBF 1E28B 4PJBF 1EGJA 1G7LB 2W92A 5E0QA 2COQA 1VFMA 2IAMA 3QR2A 2BY3A 1PYWB 5DD6B 1Y6KR 1M6OA 4MJ4A 1P6FA 4OGAC 5EZLB 1A3LL 1ETZB 3DUUA 1QRNE 3H9SA 5INCB 5I8OL 2R29H 1S9WA 1FYTB 1C16A 4GQ9H 4DKFH 4XZUA 5HDBE 4JFFE 4JO2H 2YZ8A 5TDNB 4QLRA 2WP3O 4CRPA 2VDML 1NC2B 1HQ4B 4Z7WE 3W2DL 5IJVB 3BZEA 5JNYA 3QI9C 4JFDE 5BV7H 6FABL 4O4YL 43C9B 1G6RL 4HGMA 4WTXA 1NSNH 3ARQA 3F58H 4XH2A 5EH1A 3HC4H 3QEUB 3V79C 1E6OH 3MV9E 5JXEA 1FBIH 4KXZI 3EFFB 1HKLL 4NNXB 3QHTC 3O2DH 3MMEA 5L88H 4BFIB 4KU1A 1WAAE 4OCNC 3F8UB 3L6FB 1F4HA 2MPAL 1UGNA 3C5JA 1MCDA 4GG8B 1ETZA 5C0RL 2WINB 2H2PD 5IVZA 3KYMA 5F7MC 5HGAB 1BBDL 4YHPB 3F7VB 5IBTH 3GMQA 2UVFA 3TBTA 4X98B 4YHLH 5IJKC 5EULV 2BZDA 5E5MA 4DKFL 4FXGB 3OHXB 2DRUA 1JGLH 4DN4L 4KVCL 3FO1A 5IJVA 3EDJA 4JO2L 4OQTH 2JB5H 2OTUA 1S7UA 3BEVB 1MJJB 1AR1C 4LSSH 5KSAB 1K2DA 1YPZF 4ZUWB 5E5RB 3RUGF 3ARPA 1GAFH 3FAWA 1NSNL 3RA7H 1D6EB 2V5TA 4EBQL 1EO7A 2E9JA 1RU9H 5F89A 3EFFA 4H8WC 5GGVH 3W0WB 5T3ZD 4NNXA 2WLYA 4XVUC 3V6OC 4Z77A 5L2JA 3K8LA 5IBUB 3X12A 1PZ5A 4JG0H 3IVKB 4F3FB 5EOTB 1XGYL 3MBED 1S7TB 2WINA 3MOAH 1IGTA 1IQWH 1X5JA 3FT2B 5EBMA 1FVDB 1PAMA 1JYNA 5HGAA 1U2CA 1T20B 3SDXA 3JWDC 1JF6A 1NLDL 3LMJH 4PJGB 1ZLUH 2AI0L 5E56A 1I7ZA 4X98A 1MJUH 3U30B 5HHOD 1IT9L 1EFXB 4IS6B 2Z4QA 4Y5YC 3PWNB 4Q2ZB 4YHLL 1NUNB 2ATKA 1MJJA 1A2YB 4PJ9D 4AIZB 4CL7A 2G2RB 4X4ZA 4LCCB 3RI5K 1FLRL 2FIRT 5D8JH 3MBEB 1V7NL 4Q9RL 2RIKA 3QIWC 4IOFC 3MUZ1 1N26A 2A1WL 4LSSL 1XCQB 2Y6SC 1D6EA 4H88H 4GJTB 4Z76A 5AYQA 1X5ZA 1MLCB 3AU1B 2GT9B 5HHOB 1GPOL 5F7EH 1FFNB 4KUCD 5GGVL 2XZAH 2P5ED 4PREA 1CD1B 1S7TA 1AI1H 1EEZB 2CLZB 2UY7A 3L9RB 2X09A 4PJ9B 3LPFA 1FVDA 1Q9KA 1OT1A 3RGVD 3RWEB 1F4YH 2EDOA 4LPWA<