5DUPH

Influenza a virus h5 hemagglutinin globular head in complex with antibody avfluigg03
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
227
structure length
208
Chain Sequence
EVQLLESGGGLVQPGGSLRVSCTNSGFTFSNYAMSWVRQAPGKGLEWVSAISGTYYADSVKGRFTISRDNSKNTMYLQMNSLRAEDTAVYYCVRDDSYDGGGHYGLHNWFDSWGQGTLVTVSSSTKGPSVFPLAPSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive analysis of antibody recognition in convalescent humans from highly pathogenic avian influenza H5N1 infection
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1/2005(h5n1))
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 34
structure length 208
sequence length 227
ec nomenclature
pdb deposition date 2015-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH01
1HHKA 4AK1A 1QSFD 3A6OA 5E00B 2IBZX 1KB9J 5EOCJ 1J0HA 1MJUL 5L6YL 4GBXA 3WXWH 5BS0A 4WIQA 4XHJC 2A1WH 1VHPA 3U2SB 3MLXH 4KHTH 4XPFL 3RGVB 4HGWB 4OCWH 5DR5H 2VIRA 1GC1L 2X44D 2Q6WB 4MX7A 2WBJB 2EH7H 3D2UA 2FX9H 4ONFH 5D93B 3G6JA 4PJDB 2Z31A 5GJSH 1NMBH 1CGSH 1IAKB 4M1DH 3UX9B 3BGMB 2JCCB 3JVGC 4HMDA 1X7QB 1M7DA 1V3KA 3INUL 4I0PB 4UQ3A 5TDPA 4HUVB 2P49B 3GSRB 1HYSD 5EO1B 3VGEA 2PO6C 5IB2A 4K3HA 2BFVL 3IDMA 3NMEA 4OF6A 1RZ7L 4LLQA 4YDJB 4PRAB 4F9LA 3UZVB 4DGIL 2HJKA 1B4JL 4MNGA 1P5VA 3CSPA 3IT8D 2F8OA 2R0LL 2BVOA 1J0JA 4WHTA 1JPTH 5IBLC 5IR1B 4LLMB 2B2XH 5IOPA 3O4LE 2B2XL 3QG6A 2O61B 3DI2B 3MBEA 1KCRH 1WFUA 2X9WA 1F4YL 3LQMA 2CKBB 3BHBB 3TBSB 5DMGC 4J12A 5IFHH 4HKXA 4M1CC 1XCQA 5T1LD 1CFSA 1MRFL 2VL5A 4DGYH 5B3JF 5DEZA 3MOBL 4ISVB 1U93B 4QT5A 4JG1H 3PWJB 3QDJE 4JFZL 4X6EA 2Z92B 4XNQA 1NC2D 2V5TA 1SYVA 2DM3A 2DL2A 5ADOH 3RVWC 1KCVH 3QNZB 3BKYL 3OAZK 2IFGA 4PREA 1HXYB 2VSDA 4QWWD 3MCKA 1F4XH 2UZYB 1ETZA 4MLSA 3LD8C 4QRRD 3VW3H 1F4XL 5K33A 5D6DC 5D2NE 1A3LH 1MF2H 2AJYL 2CSPA 3EJYC 3ZDYE 3DARA 1IC1A 4LMQE 1CGXA 4HULB 1RZFL 2OR9H 3DSNA 3W0WA 2ZSWA 5IB5B 4ORGB 1WAAF 2EDBA 4MA1B 3MRDB 1HYSC 2E9BA 2GY7B 4MA3B 1CXFA 3SCMA 3H7BB 5DYOA 1XGTA 4DTGH 2DWDA 1FYHB 5E2VH 1RIHH 2OCFD 5CD3B 4PJDE 1G6RA 1FZJA 1AGFB 1IGIL 1G7HA 1UZ8A 5IHZA 5GS3A 3LV3B 1A4KB 5KVEL 4PGCA 1P69B 2XTJB 1UT9A 3GNML 3SKMB 3AY4A 4BSWA 1U8MB 2JIXA 3OQ3B 2BNQA 43CAB 2O5XL 4HGMA 3SE3A 4ONGH 1I1AA 4PJEF 3REVA 1NAMA 5A2KH 2FYYB 3HRZB 3PQYD 1OWRM 5FXCH 1L0XA 5JLZA 1AC0A 2R56L 3DX8B 2EKSA 4OZHE 4PY8I 5JMOC 1VFUA 3QDGE 2Q8BL 3MJ8A 1MREL 2ESVE 4QHKJ 7FABL 2YD6A 3QNYB 1YECH 3CK0H 4FQ2L 3GM0A 3GHEH 3KPOB 3KYOB 3T4AB 5AG8A 3QNXA 2BJMH 3MCLH 4L8BB 5MEOA 4JFEA 3RVWD 4I18B 5ITFA 3L6FA 4NFBA 3WUZA 3KYKL 3VDCA 5TE6H 1WFNA 4X9GA 3HNVL 3HMXH 4W68A 4P46D 3T04D 4MQSB 5IMMB 2R0KL 1OSPH 3RWFB 4GW5A 3EFFB 5FOJA 1I8LC 2F54A 2VZOA 4PRPB 2BVQA 3C09B 1AGBA 5DC4B 2R0ZH 1I4FA 1QSFE 4WW2A 1C16B 4HC1A 2YSSA 2E3VA 5DDHA 2IJ0C 3NPZB 1HDMB 5IKCB 1RZJL 3BH9B 1IM9B 4GRLB 1OVZA 2BRQA 2DLTA 2W0FB 4K7FB 5IBUG 1ND0A 3HI5L 4RMQA 12E8L 1XGPA 4ZNCD 4R4BA 5JW4Q 2EE2A 1AC6A 3SKNA 4PJGE 1S7XB 4XWGH 3SDAB 1WSST 3NCFB 4C54A 2ADGB 3MFFB 4KY1L 2FX9L 2CXKA 3D39A 4NQSB 4NDMB 1JRHI 3UBXI 1Z5LA 4CMHB 1WIOA 4U1GB 4XNYH 1TTFA 1XGYH 3BUTA 4UU9A 5FDYA 3QI9D 1N3NB 1VGKB 3LN9A 4ZTPH 5IVZA 4PJAB 3TO4C 1IM3B 1VEMA 4XNZB 5BV7L 4JFFA 4P5KB 4LU5L 3L6FB 1I7UA 1HSAB 4OUUB 5CSZB 4HIEB 3IKCA 4LEXL 4PJ7F 2DIJA 2A6JB 2NY5C 4XPFH 4P46C 4YPGB 4FMKA 4PRPA 3A6BH 3C5SA 2M8XA 5T1DL 3NH7H 1JPGB 1T04B 3BKJH 4MMXC 2IAMD 3BE1H 1AKJA 2OLDA 4XNQB 5FHBL 2PW2A 4MJID 1I3GL 1P6FA 4RIRA 4NQED 1CTOA 3INUH 4G8IA 5JW3H 3DRTA 2FD6L 1M7IB 5IVXF 2GITA 1FHGA 3EOTL 1R24B 4TTDC 1OGTA 5HDBF 2G5RA 1OT1A 1CGVA 3SN6N 4U1IA 3AM8A 1VKXB 1RURL 2XZAH 4PJFE 2DF3A 3KNBA 3PNWB 5DGQA 1ZA3B 2D7OA 2MQCA 3WFHB 1VFOA 5ADOL 5H37G 2W9EH 3UZEA 1B0RA 1I1AC 2DWDB 5KSUB 4YHYB 3RBGA 2Z31C 4E42A 2VABA 1OSZB 4D9LH 2J4WH 5DJ8A 2BC4A 2J4WL 2GJ6E 2VZSA 5C0RL 2W1NA 3ALXA 3E8UH 1TLKA 1CDBA 4V1DE 1A9EB 4LQ1A 1FNSH 1U3HA 4NO0D 2IALA 3QI9C 2AKRA 4MB3A 3ARDC 4Q58C 1YN7A 5IBTH 5HDLA 1M6OA 1AXIB 3V4VL 1M71A 2DJUA 5JIPA 5GRWA 1EAPA 4V1DB 2ZPKH 4WHCA 3T2NL 4LHUB 4K9EH 3LKQA 4HLZH 1FPTH 5FYJU 1CLYL 4CRPA 2LU7A 4LVHB 3V6OE 2QQNL 3NPSC 5HYSA 1OAXH 4LCCA 1G1YA 1PEWA 4OZHB 2CIKA 3LN4B 4K9EC 1N4XL 3X12A 4PBXA 1NKRA 2AABL 3TBYA 2H26B 3RIFK 3I84A 3LEVL 3GSOA 4Y4KC 4Q9BA 3X3GH 5M95B 1D6EA 2J7LA 1JWUA 2E9WA 5H8DA 3P0VL 4WW2C 2ENSA 4XXDA 3GMRA 4JO3H 3D18B 1SBBA 2HN7A 4MD4A 5EUOB 4LLVA 4KPHH 4N68A 1G0YR 3V0AC 2X09A 4WHTB 3JSSA 1VESA 4YDIH 3AS1A 1DANU 1X5GA 2UWEB 4OTXL 2OX5A 1B6UA 5FKPA 4HPYH 1TPXC 3SGEI 1MAKA 5ALCL 3ARPA 1RUKH 3ZYIA 1YYML 1BZQK 2A38A 3OF6D 2Z31D 2DAVA 3IFLL 4HS3A 4G6ML 3FT3A 3OR6B 1QFUH 4EUPG 1F3JA 3QEUB 2CLVB 4Z76B 3WFDL 1QFUL 3P9LB 2X4UA 4DAGL 1H3GA 3MV8A 4KZEH 1IC4L 2G75B 4HUXA 2YS4A 3ARDD 2WNGA 1Q1JL 1AQDA 4P4RB 3ZHDA 1L6XA 2CMRH 3PWNB 3V5DA 5DTFB 1GHFL 2HFFB 4F7MA 5JXAL 1BIIB 4UZGA 3S88H 3GK8L 1FV1A 4RQQB 5JXAH 1Y18A 4L4TB 1T03L 4ELMF 4OZGE 5E5RB 1I9IL 1H3TA 4PJIF 3T8XB 3BP6A 4WY7H 4ODVH 3BVNB 3DYOA 4NM4L 1Q9KA 4PB9H 4JRWA 1WBYA 2WLZA 4JFOA 2CIIA 4NFCA 5BVPH 1AI1H 1Q9WA 2JB6A 4Y4FC 1JNJA 5FCSH 5BVPL 4UT7L 1J1XL 3EYVB 5FB8B 2CKBH 3GO1L 5T1LA 4KK9D 5FGBC 1U58B 1QOKA 3T3MF 3MNZB 4N5ED 3LQAH 5KVGH 4XRCA 3T77B 2BNRB 2OI9C 3CPLB 2FZ3B 2XNAA 1T1YA 4H5SB 3I9GL 4QRPB 1T7WA 2R1XA 4NHCH 4F15B 4R2GD 4G42B 3EYUH 4KK6D 3MMEA 2A6IA 5DK0B 3QCTL 1DQLH 5E8DL 2VDMH 4P3CH 1NCCL 2C1OB 3DYMA 4HEME 5LCVH 5JQHC 3MQIA 2Y36L 4HQQH 4I3SL 1Y0LB 2Q76A 3RUGA 4EI5D 2OK0L 3W0WD 5F9WB 5ISZD 3FQXB 2N56A 4N0YL 3C2AL 1CXLA 3WFBH 1JGEB 1L7IL 4WO4A 1XGYL 3IDMB 4H88L 3RY5A 4AEIL 3QFJA 2BY0A 2CLZB 4NZRL 3OKLB 3U9PH 4LOUD 5ADPH 5BW7A 1TDQA 4YHNB 3TGXA 4NN5B 1AR1C 3WO4C 5C0CB 4Y2DB 5DGRA 1RURH 1F13A 2ZUXA 2FECI 3CPLA 5IK3B 4KI5C 1S7QA 1X5ZA 1UM4L 3ZDYF 1JRHH 2AXGA 1A6VH 1OAQH 3B9KB 1M1SA 2AXFB 1FP5A 3QXDB 4KMLB 4LSVH 2YXMA 4IOIA 4M7ZB 1P1ZA 4TSCH 5GRUH 1LO3H 4PJBF 1X5AA 4J8RA 4NN5C 3WO4B 4EN3D 2GIYA 4U6YA 4R4FH 4N5EC 3NBNA 2AKRB 3GMMA 5CUSH 2R1YA 1AGDB 5E8EB 4B5EA 1UQSA 4GW4B 3BPNB 3WL9B 1P7QA 3AREB 4NBYB 3HE6C 3KPNA 2R2CA 5C6TH 3M45A 3WIFB 3RJDA 3ARWA 1TZIA 3O6KH 4GH7B 3KYMB 3WBDA 2MNUA 2R2EB 3WN5C 1VENA 4YNYB 3ARBB 2XWJA 4NQCE 5IWLC 4IBLT 3L5WA 3HR6A 1PG7W 4FFZL 3MBXH 4M1GH 2F8XC 3EDJA 4U2YA 5EUOF 4N9OB 4Z76A 1FVEA 4OFIA 5T33H 1MPAH 1U91A 4KC3B 5IQ9A 4DZ8A 1GZPA 4Z77B 4R90L 2VITA 1JTOA 4IRJB 2G60L 4GKZB 5D2LB 1HINH 3HLAA 4PRHD 3TEUA 1SBSL 4YHZL 1M7IA 4ZO8A 4ENEC 1ZMYA 4DQOL 3QDMA 2AV7A 4F33B 3MGTB 4EQ3A 5CBEB 3QEQA 5DF0A 1MJJB 1AGCA 1BGXH 3PHOA 5DQDH 4P9MH 2C4FT 5DHVB 1GSMA 2OL3H 2GSGA 2P5WD 2IH3B 4FTVB 4G7VH 4JFOB 4L1DA 1FO0H 1SEQL 1FL5A 1CVRA 2AJVH 4TSAL 2I26N 1LO0L 4KKNA 1T0MA 4H1LA 4YXHL 3TIEB 1MCPL 1A0QL 4KHXL 5KS9A 4PJFB 2YHGA 5DMGD 1KSRA 1MHHB 4FZ8H 1YQ2A 3QJFA 4G43A 4TUOA 5D5MA 3KPPA 2V9TA 5H94B 3QI9A 5BZWB 2DBJA 2L7JA 1GZQB 3DO7B 1Q9LA 4QNPF 1AQDB 1R0AH 2QBWA 3V0VB 1EO7A 4QXUH 3HE6D 1LD9A 4OIIH 3C9NA 5LAXB 3MXVH 1QKZL 3MFFA 2ICEA 4IMLB 4QRSA 5TGBB 2J6EH 2ICES 5CJQL 4K94L 5E8NB 2YZ8A 4HXAH 4JZNA 3KXFB 3O3UN 2Y6SD 4TN9A 3IVKB 1AKJD 4LNRA 2YPLA 1JHTB 1XGRA 5CIPA 1PLGL 4NWTH 5KSAB 3PQYE 5F9OH 1CIDA 2FBOJ 3KGRA 3HZMB 5GGSB 1YZZA 3GSVB 3ECBA 4LCIH 2JE8A 1F4AA 4LPWA 5I75B 2O5YH 3LRHA 5DA4A 5B39G 3GIVA 2QSQA 3QZWB 4WRLA 4ENED 1MAML 5KVGL 1NGPL 2FEDD 1NGWA 4XXCA 4JFPB 5KAQG 5T5FH 1GOGA 1L0YA 2IH1A 3TCLB 2PYEA 1TCMA 4PJ7B 3ALWA 5A3IC 4MXQD 1JP5A 5DRWB 1CS6A 4QHMA 2BVYA 1FJ1A 4KV5E 5FHAL 1INEL 3QFDB 3VFUB 3KAAA 3DVGA 2VC2L 4G80A 3BZ4A 3TJEH 3UAJD 5I1DB 2OS7A 3BWAA 3OHXB 3QEGH 2EDYA 5ESQB 4L8DA 3C5SB 1EHLH 2DLEA 4P5TC 32C2A 5E2TL 3V7AG 3C2AH 1UJ3B 1MCIA 1J1OL 3BGFB 3BKMH 1R5IB 1EVTC 1XF2B 1KLFA 3VWKB 4HFUH 2BOCA 3QA3B 1CL7I 4NSKA 1XT5A 3ZDZF 4NGHL 1S5HB 3D0LB 4WWKB 5EU7C 1LEKA 1NKOA 3GSQA 3P4LA 5E7BA 4ZDHA 5FM5M 1R6VA 2BNQB 5LCVL 3ECBB 3C8KA 2PW1B 1TTGA 4K71B 4OZIF 4ERSL 5J8OA 1CZ8H 4AENA 1RJCA 3PGDA 5F1IA 3TBTB 2VZTA 1LO3L 1NBQA 4U6HB 3PGCA 4S10A 3BZFB 4K2UL 5C8JA 3RWIA 5MEND 3O4LD 3HI6L 1P5UA 4A6YB 1A22B 1U8PA 3GMOB 4M9OA 5FYKH 5ESQA 1NANH 4M6AA 1YMMA 3DX7A 4ZYKA 1J87A 1QZ1A 1WZ1H 5I1EL 4CAGA 3EO0B 3REWA 3RGHA 3O2DL 4OGAC 3ULUC 5D7LE 3OTTA 2AJ3A 4PR5B 5C0IB 3IJYB 4MQ7A 5K9OB 1CFVH 5DRXA 3QBTB 4NN6B 4R8WL 3V4PL 4ZTOH 3VGAC 4YR6B 3WHE1 1NDMB 4JHBA 1FC2D 4JY4A 4TULL 32C2B 2I60L 3UP1A 2IH1B 1D5BA 4QHNA 4UDUA 3EGSA 4KQ3H 4XP1H 4ODWA 4YBLC 5IF0A 5I76A 5LBSH 5IFAL 1IGFL 2DI7A 2P5WB 4FZEL 1DBJH 4P5TD 1IGFH 4Y5XC 3QFDA 4NNPL 3VFUA 3W81A 2VZ3A 3TO4D 4NNPH 3UZQA 4WVRA 3C8DA 4C59B 4U1JA 4OFYA 1LK3L 2ZOLA 3O2WH 3NN8B 4K7PL 3CFKA 5I1IH 3SE9L 2F5BH 2OTWB 1OB1A 4G8FA 5D4QA 3RWCB 3V0WL 3A0OA 3EYFA 4CADA 2GI7A 3S3JA 5EZOL 2RBLA 5L9DH 4JO2H 1OHQA 3WFZA 4C58B 1MCOH 4L8CA 3KJ6H 3RU8H 1A1MA 2HTKC 3KYMA 4LGPB 4OF0A 1ZLWK 4LLQB 2VUYA 4FZ8L 2MFNA 3O0RL 4QRSB 1VGEL 3KR3H 4CVXA 3GHBL 5E9DA 4NQDB 5JW4N 1ULVA 5LG1A 3OJ2C 5J11B 4KTDL 4HMCA 2X1XR 4EIZC 1HI6B 5F44A 4LRIC 3MLUH 3C5JB 4OGAD 1P7QB 3ULUD 1IAMA 3WN5A 4KH2A 3S37X 4ZFFA 3ZO0A 4JZJB 2WBJA 3MXVL 1JCKA 4PJGB 2ZCLH 3PWVA 1CXHA 4YK4C 2HT3D 2IADB 4JDZA 4UNTA 5CJQH 2X4RB 4NT6B 3RZCB 3B8SA 4IOSD 1P53A 1MI5D 3G5VB 3K4DA 2NW2B 2DWEA 5D1QA 4QYOA 3MACL 4L3EE 2R0WL 3I6GA 1QNZL 4Z7UA 5ISZA 3UROR 3G08B 1CU4H 4IOIB 1N0LA 2SEBB 4I18A 2P45B 5ITFB 1NCBH 3CH1B 2W9DH 3HNSL 5TPWH 1TENA 3S4SG 3OAZH 4JREC 3V5HB 2IFFL 2MTPA 3QNZA 1IVLA 5DT1L 1IGCL 3IFNH 1I85A 3CCHB 2H8PB 1X5JA 4ZS6C 3NACH 1G7JB 3PL6B 4ZFOL 1A6UH 4H0GA 4F37K 4Y89A 5FM4A 5KVMC 1V05A 4X99B 4XVUD 2BZDA 1GGBL 4JN1H 4RAUA 1F6AA 4X7SH 4EBQL 1A1OB 3WEXA 5IQ9B 4PJXB 4U0RB 3FRPA 2A6KB 3CXDL 4KDVA 2RFXB 1QRNE 3KLHD 4IRJA 2C3VB 3V95A 1ADQH 1UWXK 2AAVA 3QIUB 4KMTH 4ZUSA 1C5DA 1FCGA 1UKQA 3GM8A 2HTKD 4Q6IC 3HE6B 1MEXH 3EYQD 3L5XH 3CFDB 2R1WB 4H8WH 4I4WB 5A2LH 1UZ8B 3RY6A 3DI3B 1VADB 4XBPB 4PJ5B 1J12A 3UTQA 1LP9A 4JCLA 4P2RA 5DSCA 4PJHE 4PRIB 3P4NA 4ZQKB 1XGQB 2MCPH 4JO4H 5C07E 4DUXA 1NFIB 4GKSB 4OKVA 4JM4H 5AAMA 3A6CH 5IB2B 4GRWH 2FHBA 3EDFA 2Q1EA 4UV7L 1TNMA 2H32B 3T0EE 5DVLA 1R3KA 4HIJB 4LVHC 1K8DA 4FOMA 4MXWL 5EU3B 2XA8L 3MJ9H 4L4VE 4B0MM 2X9YA 1BM3L 1EHXA 1ADQA 3T8XA 3OKNB 5I1HH 1ZGLA 4QOKA 3QH3B 4RBPK 2OXHA 3QEGL 2KPNA 4BH7B 3WUWG 1E6JH 4JRYA 1QLEH 3NGBB 5MERB 3MV9D 1Q9KB 1BECA 5FECA 3N1FC 1Z9LA 2AERT 3HI6H 4N1EA 5EIVA 3S36X 5IK3A 5GS2H 1BBJB 1EEZA 3OJVC 5C09A 3RL1A 3IDXH 2RFXA 2NY1B 4XC3H 1U41A 2XIDA 3PXJA 4XBGB 5EU4A 3ZE1E 3S5LG 2FJHB 1T7XA 3G04B 5LVEA 5HYJE 3WEXB 1JMXA 2H6PB 3K8MA 3OKOB 1BWMA 1V8HA 4X6DE 2X42A 3NCYP 2G5BB 1H3UA 4Y4FD 4XWGL 4XCCH 3OKMA 1ZLUH 3WLWC 4NZDA 1IAIH 3MRNB 5CJXC 2DQGH 2N7AA 3VXSD 4X7TA 5FYJD 2QSTA 4WFHD 5EBMA 4HC1H 4X9FA 5I8EB 1T83C 4G8GB 3GSNL 5HHVL 2UZIL 3CSBA 4FQQB 2X4QB 3DURB 3GBLA 2FSEB 1WFOA 3U7YH 2ZG3A 5F93C 3KYNB 1G7PB 4D8PB 4TUKL 3GRWL 2O93L 4KTYA 5BRZA 4K7PH 4K3JH 1R5VA 2BFVH 4NT6A 2DM7A 4Q9QL 2DI9A 4K3JL 1J8HD 4XXDB 2G2RB 3OG4B 5MERA 4L3AA 2APBA 4LKXA 4ZPVA 1X5XA 4BQ9A 3IAPA 4YZFE 2H1PH 1ZGLB 1E4WL 3C5JA 1G7LB 3TWCL 1MCOL 1KUMA 3N9GH 4G9FE 5IGXL 1IEAA 2H2PC 5KSBF 1RZKC 3H3PH 1DBMH 15C8H 2VLRB 3RZCA 4U49A 3OB8A 4ZODA 1YEHL 4MHHI 1H8OA 3HRPA 4M6ML 4PJIB 4Y1AA 4QHLA 4W81A 1WCBA 3I75B 1FH5L 4HS8H 5GGQH 3WN5B 4DKDC 3TC9A 1II4E 3RIFF 4F15C 4HS8L 3RAJH 1AHWB 5EH1A 1J7VR 3QQ3A 1N59B 1UJTA 4U1SA 4XI5D 3V52L 5ICZB 1FL3A 3UTPD 1OAKH 3H42H 3JV0A 4M43L 1A6AA 1KCVL 4P4KC 3VCLB 5E03A 4UOJA 3IU4L 5GRJL 4PGJA 2R0WH 4D9LL 3TNNB 3ULSA 4P49A 1KIRA 3LEXA 2KUTA 4MA8L 5ACMA 2HVJB 4KKLC 5EZJA 3V5HA 3FFCB 1PJ9A 2C26A 4QEGA 4LDEB 4S1QL 4XPHL 1ZA6A 2AGJL 2F53D 1U6AL 3VXUD 2AJUH 4F80A 2F15A 4RGMB 1A2YA 1LILA 3AC0A 1VKXA 5C0JA 4OZFH 4L4VD 2IGFL 3VGBA 3DUUA 3QHTC 4YQXL 3VXRA 2F19L 1A47A 3RIAK 3MRLB 5K9OA 4PRID 3UBXA 5J3HC 4GQ9H 5FF6A 4Z7VA 5F7EL 5LKNA 4OLYL 3HZVA 4AL8L 2EEBA 3CZFA 2HJLA 1KYOK 1YN7B 1I7TB 1MWAH 1WZLA 1K4DB 4ZSOB 5IB1B 1F6FB 1FZKA 3QIWA 5ENWA 4F8QA 3MRIB 2J2ZA 4NQDA 1OLLA 3K74B 1JYWA 2FLBT 1KBGL 4Y16D 4ALAH 4PP1C 5CEYA 4JPWH 4ODHH 4KPHL 4RMTA 5AZEH 5C0GB 4NJ9L 5IVZB 2LTQC 3BZEB 2Q86A 4XI5C 1JF1B 1WISA 3OKDA 4CVXB 5AYUL 2NXZC 4HUUA 5F7HA 3FCTB 4U33A 2R2BB 1BZ7A 4U6XB 5SWZA 4GXVL 4P46A 4WCYH 1ZHBA 1P2CA 3CVIL 3D39B 4KXZH 2V2TB 2W0PA 3HMXL 3JWDH 2NYYC 3VFTB 3HC3L 1HHJB 4YHIB 4DAGH 4Y19B 2DD8L 4LHUG 1O7SA 2X7LA 1JTPA 1FBIH 5DEFB 5B8CA 2DQEH 1AJ7L 4W6XB 2DQEL 4BZYA 3WJJC 4XMPH 1R24A 4L3ED 2MJWA 1V3JA 2DQHH 2VMFA 1MJ8L 5GS0D 2EZ0C 5JXEA 2EDFA 5F70A 3VXRE 4M03A 2AV1A 4E0RA 1ZVHA 3MLRH 1RQ5A 1T03H 4YEFA 1I7TA 5TDOB 3L5IA 3WSQL 3P9MA 1ZLVH 3VJ6A 4IRJC 5AZ2H 1CXKA 2CKNA 4XX1E 4RNRB 5IEKA 1YJDH 3V7AE 4LVNB 2CXGA 1A7QH 3MLXL 1BFVH 5DMIL 1YJDL 4PLNC 4ZNEA 2P47B 2XT1B 2HTLC 3DX7B 1WCQA 3G9VA 4M93B 1E6OH 4M8QB 4HC1L 4XPGL 5GGVH 1QLFB 3NAAH 1AXTH 4OV5B 4XMLL 1V7MH 4JFPA 3WIHL 2Q87A 1KIQA 5D2NB 3AGVA 4Z7OF 5D1ZA 2XA3A 2NY4D 2VLME 4FQXA 2XY2A 4MAYB 4N0UB 1EGJA 1UYWL 3QYCA 5B8CB 5FOBB 5KSBE 2RGSA 1F6LL 1SJEB 4ZTPL 3FFDB 2X6MA 3MC0A 4DK3A 1N2RB 2HRPL 4JZNB 2VXUH 1LO5A 1P84J 4B53A 3QUMB 3VFTA 1MI5A 2VDML 1YEFH 1E28B 3MA9L 2YPLB 1BJ8A 3I3BA 4XCCL 1KB5L 3TT3H 4X4ME 4LKCA 2IAMA 5FGSA 1S7WB 3HI1B 3H9SD 1NLDH 1BFOA 1A3RH 1N59A 1KENL 5F72S 2R9HC 1KF9B 1A3RL 4Y4KA 4F2MB 2V7NA 2ATPA 1I3GH 1E0OB 3BAEH 3D3VA 1IQDA 1A7PH 4RISH 4B7IA 3ROLB 1NMAH 4K7FA 4KK5C 3D87B 4P9HC 4MLIA 2EZ0D 2CO6B 3KPPB 3OPZL 2XWTB 1YPZA 2IH3A 4FTVA 1CK0H 2AQ2A 4HG4J 4XNXH 4ETQA 2CK0H 1R5WA 4IRJD 2B20A 2M26A 2ZG1A 4FQHB 3L95A 3OXSB 5DQJB 5T1KD 5EULV 1FZKB 3SJVE 3OKYA 1GRWA 3ZE1F 1KCRL 2XG5A 5GHWH 1T83A 1JZ8A 1CN4A 5DJ2A 3S36H 3P9MB 1LHZA 2AXJA 4XVJL 2AJYH 5K9JH 4P2RD 5L0QC 4BELD 4KRLB 3B9EA 5CUSL 5L2KE 3KHOA 4PYGA 3DURA 2L0DA 1FNSL 2AGJH 2ICWI 3C60B 2VZUA 5I74C 4C56A 1TXKA 4L8BA 2FL5B 1KPVA 4MQXC 5DMYA 4N8CL 2A74A 4YO0A 3Q48A 1CLOL 1J18A 4HZAA 5TDNA 4ORZC 2ITDA 4QOKD 3SKUD 1EFQA 1VERA 3RWDB 1QTYT 4FQIH 4XP4H 4HS6A 2VDLH 3HZYA 1P84K 3WV0A 1CD1A 4DKEH 1N4XH 5MI0C 3C5ZA 1FL3B 2R9HD 1KJVB 2FWOB 4G6FD 3LPWA 4YDJA 5EFIA 4MSWB 4R7NB 1IEBB 3FCTA 1CD9B 3L3DA 2PYFA 4Y7MA 4YC2C 4U6YB 3MUJA 2EH8H 3IJHB 2XWJB 4QOKE 3O11B 1JMZA 2C3HA 3TJHC 5GS0L 1I3VA 1KCSH 4RWHA 1O0VA 2JK5B 1RZKL 2EE3A 5JNYA 1S78C 4E5XA 2VDNH 4JRYB 2EDWA 3KPQA 4Z7OE 3NA9H 3MRGA 1T5XA 2LVCA 2XZZA 5CINL 3FFCD 2A0LC 1RU9L 3BIKA 1A7NH 5C07A 1PBYA 1EK3A 1ETZB 2GHWB 3LHPH 4XCFL 1F45A 4OM0L 3VXSA 2DQTH 4P2RE 1MCFA 1LP9E 1MWAL 2DQTL 4DJMA 5C0ND 3IU3B 4ZUUB 4DEPB 2W07A 4J6RL 1SYVB 5HVHB 4LFHG 2VOTA 2YEZA 3CDGB 3D85A 3DVNA 4PRNB 1H9VA 3DVFA 1AE6H 4KZEL 3RVXD 3QFJB 1QRNA 5D8JL 4FXGA 4BFGA 2X4QA 3H9HA 3ARFB 2EEAA 2X4TA 4XMPL 3LRSA 4GW1A 1J8HA 1NFDB 4HEPG 3U0TA 1LVEA 5AUMA 1J1PL 4UTBL 1MLBB 4J3UA 2KBGA 3B5GA 3KPRB 3CVIH 2D7PA 1DN2A 1PG7X 4P2OA 3T0WA 4LAQL 3RVUC 4M6NL 2E6QA 4G6JL 1T20A 3UO1H 1KELH 1HSBA 3ZL4L 4PJ8D 3RL1B 3BGMA 4UILH 5C0CD 1IAKA 4O58H 1AXTL 5CWSB 4ZS6D 2A6DB 5I8OH 1I1YA 1MY7A 2R0ZL 4PLJD 5HDOA 5IMKA 1TQCB 1VFMA 1QO3B 4FHBD 2H6PA 3N85L 2VO5A 4XVUC 4APQC 3F5WA 2I5YH 4QY8A 5GISL 1HZHH 4WV1B 2EXYC 4NQEB 4AIZB 3U2SA 1MIML 1I7ZA 1KG0A 1QFWH 3B9KA 4XT1C 3T08A 3MNVA 3KLHC 2A0LD 4HF5H 5DD3L 3D2UB 4R6UA 2G9HA 5I66A 1N64H 2DWEB 1DR9A 4H25B 4XVTL 2XTJD 5T1LB 1NFDF 1UFUA 2WWMD 3NGBC 2B5IB 2JCCF 3MYZA 4LP5A 4ZMAT 5C0NC 5BS0B 3X11A 1Y18B 3NFPA 2JJWA 4L4TA 1EEYB 2W60B 1WFTA 1VFBB 2G75A 1N6UA 4MGXA 4BSVB 5GGVL 3L3KB 3BQUC 1FVCB 4RGMC 4M1DL 3WKML 2X4NA 5TQ0L 3FMGH 1FV1B 5ALBL 2QHLA 3SE8H 1WTGT 4GRWE 3VRIA 2CR6A 5CWSA 1IEBA 2WMPA 5DUBA 2X4UB 5IIEB 3ZDXF 2HFGH 1RUAH 4PRIA 1HEZB 4HS6B 4X6DF 3TT3L 2QSVA 3TCXA 1K5NB 3L7FA 3W11C 3MJ9A 1A6ZA 2R1XB 5ICYB 3BKJL 4P2QD 3TP4A 2VTFA 4EN3A 3FOLB 4G8FB 3PL6C 4UTAH 2CDEA 2YD4A 4XRCB 3P4MA 3OAUL 3L3HA 1H15B 3GBNL 3QHFH 4EDWL 4EDXB 4XVJH 1BP3B 2LQRA 4RISL 3LKRA 4RGNE 4MD4B 3EOTH 4PLJC 5FYKL 4FQXC 4MHHG 2QJDA 4HFWB 4IDJH 3CXHJ 1OL0A 2ADFL 2O5ZL 5FA3B 1TVBB 5HJ3B 4Z0XA 4JFZH 1GXEA 4LF3A 4PRIE 5BCAA 3LS4H 4UIKL 3Q0HA 5D7LA 1AH1A 3O9WD 3IU3A 5IB3A 4TULH 3BKYH 1I8MA 1PZ5A 2ERJC 4OCSL 4G6KL 3BEWA 3N50A 3OGCA 4JY6B 1XZ0B 4W6YB 4ETQB 4LHUA 3VW3L 4I9WE 3U1SL 3GIZH 1BFTA 1S7RA 2MHAB 4UINH 1F5WA 1NEZB 1I9EA 1VEOA 4Y4HB 3UPRB 3KPLA 4OIAA 4R26L 5J1TC 2HFTA 1KLGB 1PFCA 4L4TE 1HQRB 3QIWC 3OKKA 1YN6B 4PJXF 3T1WA 2ZUUA 2NY6B 1G1CA 4Z18A 3U4EA 5EORL 5C0FB 3HB3D 5D1XA 3DETC 5F7UA 1GIGH 5T3XH 2F5AL 3SDXA 5T5NF 3BMWA 1KEML 4XP4L 2C9AA 4X98A 4UV4H 1FFOB 1JGLH 4P23B 1NJ9B 3PL6D 1BQLL 3Q1SH 3MLWH 1OB1B 2P43B 4XC1L 5D1ZD 4LK4A 3HS0B 1YY9C 3KDMB 3ZHLA 5FM8A 3V5KA 4O9HL 4I5BB 5GS0H 4JFYA 4WNQB 4JO3L 4DOHE 1R5IA 2V2XA 5DC9B 1KIQB 4G9FD 3DRTB 4J3WA 3UBXG 3MTRA 3T0VA 3QIBD 1MHPH 2R4SL 1JWSA 2CMRL 5DQJA 5L2JB 4P23C 4J7RA 1HQ4A 2LAAA 5JXEC 3TNMA 4M00A 1NCWH 2PYEE 1J8HE 3LHPL 1R3IH 3LKQB 4XCFH 5I9QB 4P99A 3VG0L 4BUGA 5C1MB 4OQTL 5IROA 4G8EB 1VDGA 2EXWD 2C1PB 2CJUL 1MNUL 2XN9B 3HNVH 2IPTH 2PCPB 4FQ1L 4KKLD 4UIMA 3DROA 3UPAA 4G6JH 3VGDA 3SEPA 1R3HA 3O8XD 3RWIB 4XPAH 3LPFA 3VXMD 4WEMB 4HIEA 1ACZA 1CG9A 1K2DB 4UU9B 1KLUA 3GMOA 1GGCH 5EU5B 4UBDC 4JDTH 5EA0H 2IAMB 4LCUA 5GISH 4Z7VF 4BKLB 3HB3C 5TH2B 5F1IB 4FNLL 1EXUA 2VZVA 3UTOA 4U3CA 3FO1A 4TSBL 4ZAKC 4XWOD 3MRJA 4BZ2H 4EZMA 4J1UB 2QQLH 4M61B 5SWZB 1NCCH 3PGCB 4PLKC 1INEH 4Q9CA 2NXYD 1QQDA 4RGNC 2QKIB 5IG7B 4X6BA 5FYJE 1CQYA 1UKSA 4IRSC 4Y5XA 4HV8A 3ZKMD 4Y16C 4CUCA 4PB0H 5JW4R 3W9EB 4XP6H 5KS9E 3GUTA 3WS6C 4P57A 4GXUN 5ESAB 1YA5A 3OKEB 3QUMA 5TQ0H 5BV7C 4OLVH 1HYRC 3IDIA 3NCJH 3DECA 1LEIB 2DKUA 5JA8B 5JR1L 1FYTE 1I9RH 4GXUM 5KVDH 3EFFA 5C3LD 2ZOKA 3DROB 4MXWH 4U05A 2B0SH 3P11L 5IMMA 4C56E 1F3RB 3QNXB 1P9MC 3DSFL 5DK3A 5E6ZA 3TCLA 1A6VL 1WV7T 2AQ3A 4A2MA 4A2LA 5JA9A 3EDKA 3VXOB 4H20H 5IMLB 2DLFL 4DN4H 2KQNA 3MV9E 3BT2H 4FQHA 2R8SH 4Y88A 4OCRH 4N0YH 4V1DD 1C5CL 3O9WB 3VD5A 3CFCL 3K80A 2B1AL 4KJQC 3WKMH 4OF3A 5HGGS 2XWTA 2MKLC 1G6VK 2IBBA 1WWWX 4L29A 3DGGA 1DBAL 3LKPA 3RVTC 2HWZH 3SDAA 3GUTB 3SDYH 3W9EA 4J1UA 2Z35B 3KWWA 5C07D 1SJHB 1XGPB 1DLHB 1QFWM 1T2XA 3PDGA 4JFYB 3PGDB 3TBTA 4S0SD 4LVEA 2HKHL 3T0EB 2ZUYA 1OAQL 4JKPL 4GRLA 4JKPH 2DJSA 2FGWL 4OT1L 3WNMA 3NFSH 4Q6YA 4Y5YB 3VXTB 5HY9B 1KT2B 4M7ZC 5HHOB 1A02N 4GAJH 3QHFL 4J3SA 3VI3E 4GAJL 2NY4C 1QRND 3MRJB 1WIUA 4IRZH 1BLNB 2DDQH 3GMQA 4HKBA 3TPUB 1FZJB 2XICA 1EO8L 3OB0H 4A6YH 5D1ZB 5E2WL 4HD9A 4OQTA 2N1KA 3Q5TA 4MA3A 4G8EA 5EORH 3SCMB 2VJXA 5AG9A 3CDCA 1KLUB 2DMBA 3RWGA 5CEZL 1A3QA 1C12A 2ZKHL 4K9EL 3P0GB 5GGRY 2XWBA 2J8UB 4DKAA 4AEFA 3HZVB 3MGTA 3IS0X 1JIBA 1CFTA 4TSAH 1FGVL 2F8VA 1MHHA 2IBZY 1YEIL 2JJTA 4YFLF 1T3FB 5C0CA 4NQUA 4HUMB 5D70H 3KXFD 3DX8A 4PJ7E 3GI9H 3NABH 4I1NB 3P30L 4N9GB 4NQCB 2W0KA 3TO2A 1QP1A 1WITA 2Y1VA 2FSEA 4JHAH 2V9QA 4HSQA 3RDTD 4JPVH 4AYFA 4JM2B 5DJXB 2YPKB 5FO7A 3WD5L 4IS6B 4ZXBC 2VITB 1NGYB 3QUKA 1AFVH 3K8KA 3OV6A 1N8ZA 2LU4A 1NAKL 4O2EB 4YDIL 3EW3B 5KN5B 4KV5F 4NO2B 4UB0H 4ELME 3IU4H 4OLUH 4PJ5D 2CJUH 4KHXH 3GBML 1Z0NA 2WIMA 3BWUC 5EOCH 5HGAB 5J12C 2VXVL 4QTIH 4XAKE 1TZIB 4JG0H 3IXAB 1RULL 3VFOB 1IGJA 2IANA 4OKDA 3TN0B 3QQ3B 3L5WB 3KPLB 4LLWA 2VXTH 4YUEL 4M62L 2AJUL 1XGTB 5FM5O 3B9DA 4R3SA 3BRDA 5LQBH 4JY6A 1FRGH 3RPIB 3J7HA 5EU7E 3FONB 4OIIL 1AHWA 1UH4A 3U4EB 1WBZB 3OJDA 3W0WB 4ODSL 4HWUA 3UPRA 2XQYK 2W60A 1Q94B 2VR5A 3B9VA 4ZS7H 1R3IL 2YXFA 2OP4L 1QSVA 2OM5A 4P2QA 3O6FC 4YXLL 2VDQH 1MNUH 2YD8A 1I1RA 3HUJA 2VLRA 1OARL 4JFQB 3QJHB 2DQIH 3G6JB 3QDGD 1ITBB 1MFCH 4JRXB 1W0YT 1WZMA 5IB4A 2XPGA 4NOFA 1MJJA 3L9RA 2MQ3A 4OZFA 3Q6GL 5C0DB 3BDBA 4EUPA 2VLJE 2OXGA 1KJ3L 4G8GA 4DKFH 1SM3H 2A2QT 5ILTL 4LLDB 5JO5A 1PKOA 5E00A 1ZEAH 4HKJB 5HHQB 4ESKA 2X1QA 3IDGB 1DE4B 2Y06H 2FX7L 5MENB 5SX4I 5D7LD 4YHNA 1Z3GH 1MVUB 3FQTA 3FT3B 4LRNL 1T66D 4M9PA 1Z3GL 2IF7A 1FNGB 3P4MB 4JQVA 2Q76B 4CBPA 5L0QB 1FAIH 3MO1A 3MOAL 4JFDD 4YWGL 2QQLL 4NN7C 2HVKB 1W8NA 4YHLH 2GTZB 5MENE 3MSPA 3FO0H 5ACZB 4KKBC 1I8IB 3DO3A 4LSRH 2VQ1B 1YMHB 2FDBP 4PY8J 1MCEA 2C3GA 4I0CC 2XXMB 1G7JA 1DEDA 1X7QA 1J1OH 1DLFH 4EI6B 1RHHB 2X4TB 1S5IL 4G5ZL 3DMMC 1JZ5A 4POZD 1MJ8H 4NZRH 4IRSB 3AFLA 4OIBA 1PSKL 3ES6B 3BVNA 2D7TL 1K3IA 3RGVA 4Y8DC 4EOWH 4LAJH 3SQBA 3V6FB 5I16B 3H9HB 4YFLI 4TVPD 1S9XB 3IDGA 1OTSD 1YNTB 1NSNH 3P11H 2PO6D 1LDPL 1G6RH 4DCQA 3PV6A 3QPXH 5C08B 5DTFA 1U0QA 4ZTOL 3OWEA 4Y1AE 4WEBL 5F88A 4OT1H 1NANI 1D7FA 1GC1H 1K8DB 3HNTH 4LDOB 3RFZC 5IBLD 1MHCA 2R39A 4ONFL 1ACYH 3RI5F 3EBAA 4JVUA 3BP4A 1RFDL 1E4JA 1PQZB 1U8LB 4GKSA 2DQJL 4GG6F 5I17A 3MRBA 3BEVB 4P59L 1R3KB 3RI5K 5DFWH 1A9EA 5GSVB 5BRZD 2CLZA 2PYFB 4WU5A 5L7XH 4M1CD 1S9VA 5E2WH 4NO2A 4QY8B 3U83A 2COQA 1JVKA 5GJTL 3FQXA 2EDRA 4P2RB 5D1XC 4EKXA 2C5DC 3E2HC 4GT7A 4NO3B 5DJDA 3U79A 5CEZH 2BCKA 1Y0LA 2I60H 4AM0A 3F62A 5ACZA 4R7NA 1LQSR 1RJZA 4Y19E 4YXKH 3ULVH 5FO7B 5IVOA 3IRPX 3B3IB 2QR0B 4PRBB 4YO0B 4O2EA 3DTXB 1GGIL 5F9DC 3BD3A 4NM8H 2VH5L 5EOQH 2FO1A 1NC4A 3VH8B 3RZCD 5HYEA 2GJZA 1MCWM 4NM8L 5EOQL 3ZKQD 1I8KB 5JW3L 3BRFA 2DDQL 2HN7B 5EUOA 1TNNA 3DMMD 5CCKL 2AW2A 1AD9B 2AK1L 4NQVB 3WIIL 2E8ZA 4X6DA 4RIRB 1FH5H 5F7FA 4ZAKB 5DWUL 2P5WE 2VAJA 4EUPB 4PP2B 2BSED 4MJ6A 1ZLSH 1OTSC 1Z9SA 3ZZ1A 1NAKH 2ZKHH 1QRNB 2GAZB 5EZOH 4PTUB 3CFEA 3JXAA 2GT9A 5C09E 5C3TA 4PJBA 4JO2L 2ZUTA 1UEYA 5J13B 3HE7D 1BBDH 2GTWA 5IROC 1XAUA 3ZE2F 4ODTL 2HKFL 3VI4E 3BJLA 2AJ3B 4PR5A 2WIIB 4H26A 2NW3A 1ZE3C 5B8CC 1RK0B 1V7NH 4LLWB 3QHZH 3IJSB 3WDHA 3PWNA 3V5DB 2VXTL 3NOIA 3UDWC 3FN0L 1NGZA 3IFNL 1YYLL 3SQOH 4WDIB 5HY9A 1BREA 2QSCL 5DJAB 1M71B 1R0AL 5D5MF 3M1BB 1T1XB 4TQEL 4NQCD 1BIHA 3VMPA 1BLNA 3GMQB 2QQNH 3SKNB 2CDGA 3DRQA 3D3VB 3ZKXC 1F42A 3CFKB 2P48B 2NNAA 5EFIB 1OSZA 4UT9L 4D3CH 3KNBB 3PNWA 5IBUB 5A2IH 2V2WA 1A1OA 4U1GC 3BH9A 4UOW0 2GFBA 3B6SB 2A74B 1CICB 5DT1H 4LSQL 4Y16A 1SM3L 3W9DA 4XPBH 1KOAA 5A40E 2QADD 4JM2A 3FRPG 5DJXA 3SDXF 5IESL 2XKNB 2DQDH 2Q8BH 2D03H 1X5LA 2FH8A 1JNNL 1NCTA 3CX5J 5CJOL 3EOYG 4M3KB 3F65A 5D93C 4OM1H 4PJEA 5DRNB 2NY0C 5DJ2B 3EIFA 4WJ5B 2RHEA 1CLZL 3MRHA 4WI9A 1XGUA 2ESVA 4OZHA 3VMNA 1J10A 2KKQA 5FUZL 1G9NH 1E4XH 3OKEA 4XVSL 3SY0B 4GKOA 4P5KA 5C0IA 1LEIA 5I15L 2DD8H 5D9SB 5I19L 5D7SH 3LQAC 2ATPB 3QIBC 1OGAD 4J2XA 4Z7UE 5ISZE 1XIWB 1DVFA 3OX8A 2ICWA 3SGDI 2FX7H 5JXED 4FQ2H 4U1MA 1S7WA 5C7XH 4LCYA 3C8KB 5LJYH 5HHNA 5JZ7C 5C7XL 1N3NA 2EXWC 4JAMB 4XP5H 3DV6A 2J5LB 1D6VL 3EFDL 1F8TL 3GSQB 5TE6L 5J57B 5J6GA 2A77L 1DZBA 5CZKA 2J12B 5E8NA 1CDCA 4WEBH 3W0WE 4WW2B 4Z9KB 2FBJL 3EYOB 2LV4A 1U95A 4QKXB 5GRVL 3U7WH 2AS5M 4HH9B 4TRPH 3NAAL 4WFED 2HYMA 5GGVY 3ZMRA 3UTZB 2BSSB 5CLWA 5GSRA 2CGRL 2D7TH 5F9AC 4N8VG 3ILPB 2NW3B 4DK6A 4F7PB 1XCTA 2IQAA 5GRZA 5K9KA 2NY0D 2HA1A 4PLKD 5TE4H 2VXUL 1R3LB 5JDSB 5IF0B 4P5MB 4NZTL 4F9PC 1IJ9A 3LKNB 1B9ZA 4GBXD 3RWJB 4IRSD 4PJCB 3EYSL 1NDMA 5J7CC 4YXKL 2IAND 4Q9RL 3HNTL 3LQZA 4GRWF 3VJ6B 1UEMA 2E7MA 5HYJB 3QUML 3GSNH 4QT5B 2PO6B 1TJIL 5F8QC 3QDMB 1I7RA 4HIXH 2WZPD 3PIQB 2APFA 4OFDA 2YN3A 4PY7A 1NMAL 1YNKH 5IW3A 1Q0XH 5I1IL 3T0EC 5DEFA 4XZUB 2N7BA 4QRTA 4CVZB 3OPZH 4N90D 3QQ9C 1OAKL 1S3KH 3UPCA 2QL1A 3N06B 3A6BL 4EI5B 1AIFA 3ULVL 3FZUD 3N1PC 4KJQD 5IVXA 1DN0B 2VDKH 1NJ9A 5TF1H 4HJGB 4BFIA 2E6JA 1T1WA 3ZT6A 3DO7A 3LDBC 1FO0B 1ZOXA 5HPMA 4R4FL 2JIXB 3FQUA 2YN5A 3GSRA 5HHMB 3KLDA 3MRCA 1AGDA 1PDKA 4BK4A 4G43B 1NGZB 4LEOA 4PJ9C 1IAOA 4PD4J 5IB1A 4FFYH 4RFOL 1UA6H 1RZJC 2ICEB 3NIGF 4IMLA 1RIUH 4ZFOA 1BVZA 3UTTE 3QSKB 3SGJC 1MHCB 4OZ4B 1AHWC 3PWUB 5LGKA 4JFDA 1UWGH 5CEYB 5F88B 1U8IB 4M43H 3D6GA 1NC2A 3MRLA 3A67L 1G7LA 3VGHA 3BEWB 2D31A 2AXFA 4OLXL 4H1LB 1AR2A 3L1OH 4MCZB 1GC1C 1JPST 5CHNB 1K8IA 1TQBC 3O6FA 3QUXD 4OAWB 3U48A 4LQFL 4FQIL 1X9QA 3QJFB 4ODTH 1K4DA 1Y6NR 4RFNC 3SO3B 2AJSH 3B8YA 3TYGL 4PJEB 1BD2A 1I8KA 4ZUWB 1W72A 4PIRF 4S1QH 3PWPB 2D0GA 1MFEL 4ZPVB 3RWEA 2DMKA 2AV7B 2XY1A 4APQA 5I1CH 2CUHA 5E2VL 5L88H 4Z0XB 1XR8B 3GIVB 3B9KC 1OAUH 3QRGH 3FFCA 1YMHA 1JNNH 3SGEH 1CFSB 2V9RA 1F02I 3NA9L 1F4HA 4KJWC 1CF8L 5MP6H 4HPYL 1ROWA 2FEEL 2AJVL 2HT2C 3FTGB 3BOVA 2PKDA 2GW5A 5J1AB 4HJ0C 3HAEH 1A1NA 5GGTA 4DZ8B 2Z8RA 3O3BB 3SDDB 1G9NL 4LARH 1MEXL 3L5XL 3AB0C 4QRPD 2R4RH 5FO9A 5ICZA 1YEDB 1KXVC 5D1XB 5KSVB 3OKKB 5BZDA 1REIA 4O9HH 3MRKA 2VYRE 4YHML 3AS3A 4JKLA 4XP9L 2YPLE 4ZXBD 5F3BB 1MREH 1QYGH 4Z95L 2P8MA 1OW0A 4HXBH 3H6JA 3I2CL 3O3AB 5IB5A 5C09B 5AYUH 3V6OC 4GOSA 4LCWE 4BSVA 2CIIB 1LP9F 4NKIL 3UJIH 1X4XA 1A14H 4KUCF 5HHXL 1N0XL 1FN4A 1PQZA 1U8LA 4HK0A 4R2GC 1F8TH 1P4IH 1YYMH 5BJTA 1I9IH 1TETH 1T0MB 1BM3H 1QACA 1ERNA 1HN1A 4CW1A 5I66B 5SWSD 2MSPA 1BFVL 4D8PA 2NY0B 1DEEB 3BESR 3HZKB 5E8OB 1AGCB 1KELL 4HDIA 4GBXB 1JJUA 2BVUA 1O5DT 1FZMB 2CKBL 3GO1H 1V7ML 3CD4A 1ZV5A 4MCYA 2GK2A 1I9JL 5BZDB 3B9KD 3ARZA 3MLTB 1XGQA 1N5AB 3QDAA 4XCYB 3AROA 5CEZD 3QEQE 4YJZL 3R4DA 3L3HB 2B4CL 3ULUE 2HRPH 4JFHE 3V6BR 4NKOB 3F7VA 5D6CA 4EN3B 1ITCA 1CCZA 4MDIA 3JV5A 3GSWA 5IM7A 2Z8VC 2XYCA 1NBYB 4H0HB 4LLMA 4KDTA 4HJ0D 3PV7A 2VR9A 3ULVC 1VB9A 5DR5L 4XH2B 4NO3A 5DJDB 1FDLH 1G7QA 4MD5B 4HKJA 4MAUH 5JO5B 1HNFA 4OD3L 3MRMB 2C3VA 2A73B 4IHOA 3QUMH 4M5ZH 5C0AA 4OD3H 1XF5A 2LVEA 1S9VB 3FB8B 1J0YA 3H7LA 2XPGB 4OGXH 2ITCB 43C9B 3TA3B 5F7NC 4GW4A 4ZUUA 4M4PA 1LGVA 2P42B 3GJEA 1MWAB 4UQ3B 1FNLA 4NQCA 3TO2B 3SDCA 1DUYB 3HG1B 3BP6B 3WS3A 1Q0XL 4K8RD 2YWYA 1F3DH 3KVQA 3TYFA 2HFGL 5JORB 4Q9QH 4NRYB 4J8RB 3O6FB 2UWEF 4PG9A 3CVHH 1J05A 3CU1A 2J6EA 1ZGLP 1J9CT 2DLIA 2DLGA 3I02B 4PD4K 1AGEB 2IMNA 1T7YA 2Y36H 1A5FL 3F8UB 1P7KA 4LGRB 1PZUB 1JNLH 1KENH 2KDGA 4D0CA 3O6LH 3PUCA 4QOKB 3ZLQC 1BVLA 2ZSVA 3X17A 3VD9A 4I3RL 1I8LA 4MJIA 4EVNB 3GBNH 4O51B 4NQEA 3E1F1 1OTUD 4KVNL 4HJJL 4QXTA 1WBXA 4J4PC 5ESVA 2Y5EA 4L3EB 1RIUL 5CZXD 3ABZA 3F7YA 2OJEB 4XMKL 4Z5RB 1CFVL 1PX4A 2IPUK 1ZKAA 5IVNA 1P4LB 5CEXB 2MOVA 4F9PA 5KN5A 5HGAA 5C70A 1W0WA 1G7QB 5FYLD 3SHSA 4Q74A 5JQ6L 4JRXE 4ETYA 3ULUF 4FFZH 1M05B 25C8L 4G6KH 3CVHB 2GSIB 1KJVA 2FWOA 2GJJA 2XOTA 4KJPD 5I75C 2VLJB 3X14A 5I74B 3BW9B 4R90H 3PWPA 2EICA 1HH6A 3RUGE 2V5MA 4POYA 4GW1B 3NIDF 5JW4M 4L3CB 5SX5H 3ZDXE 4JVWA 1UACL 2VLKB 3JTTA 2A9MH 3WUWA 4QRRE 1DQJA 1KNOA 2W59A 4DQOH 4MAYD 3K0WA 5D1XD 1T22A 1KXQE 3ARXA 4GKNB 4XCNA 1LE9A 4U1JB 3TN0D 4TVPE 4F7CA 3VGFA 2NX5B 4BFEA 1BEYH 1KEMH 4RRPG 4G7VL 4PGZA 3P0YL 1FGNL 4RFEA 1FL6A 4OLYH 2F58H 2QQKH 4PRDB 1INQA 2AJSL 4LLUB 3WJLC 2HLAA 5H2BB 1ZHLA 3MFGB 3ARQA 1A0QH 2I24N 3RVVC 4RGOL 3LSOA 4PJHF 3FO2A 4LARL 3HKFA 4KGLA 4KTDH 4HX1A 1WWCA 4I0KA 3MREA 4MZ3A 5GS2D 5IW6A 2P8MB 4NN6C 1HH9B 1IGYA 4FG6D 1ORQA 2J3SA 4OZGA 4RCAA 2XRAH 4NQSA 4AMKL 4JRXD 5E5MB 3T0BA 3GMLB 3MNWA 3QUZC 5FYLE 2VL4A 4E9LA 4X5WA 5F6HI 1QQDB 1EBAA 1DQMH 5EZLA 4ZUTB 1P9MA 1CI5A 1QLRB 2VAAA 3CDFA 2PTTA 1A8JH 4L8CB 3FQUB 4MXQC 5FYJL 1JHLH 5C2BL 5INDB 2HH0L 1CFNA 3ARTA 1JHLL 1KPVB 1GGYA 1YUHA 3MV8E 4FQ1H 4RZCA 4JB9L 5JUEL 3ZL4H 3VXMA 1QLFA 5HVHC 3UAJC 1YEEH 4HLJA 1BVKA 2EIBA 3N1QC 5EC2A 1PD6A 4M5YL 1AGBB 2NY2D 5I1KH 4Y2OA 3ARDA 3WO3B 3D0LA 1T0NB 4E41D 3WNLA 4U3HA 5EA0L 5FOBA 1GGBH 5AAWA 4Z0BH 4PY7B 5EIIA 3LMJL 1BD2B 4ZS7L 1N0XH 2GK0A 3GSXA 1M4KA 5IMLA 4LIQL 4S2SA 1NGQL 2AK4D 4GRLC 1K6QH 1TVHB 4UDUB 5HGBA 12E8H 3MRHB 4NCC1 4YPGA 2Y07L 4MCZA 3PJSB 2X5PA 2DS4A 1IAII 4NO5B 4UT7H 3QPQD 5D7KD 3T4AA 4LCIL 5EUKA 4MAUL 4Q2ZB 3IJYA 2NLJB 2WUCL 4TOYH 1B2WL 4PJXE 4M5ZL 2XKNA 1EHLL 4UQ2B 4PV8A 5IUSA 1OW0C 4JZJC 4QXGH 2EKSB 2X1WL 4J4PA 4XNYL 5DRWA 3ZKND 4ZYKB 4FG6C 3V6OA 5JLZB 1IAOB 4KI5E 1TMCB 5DHYB 3A6CL 1MIMH 4M61A 4UAOC 2NR6C 4WHYH 4WFGE 3ZE0F 1KJ2H 1NAMB 1S7TA 4UT6L 1JI2A 4JFHD 3MLVL 1OLZA 5HHOA 1NMCC 1LO5B 3OKDB 5FHAH 3AXLA 2BVEA 4GS7B 4LSUL 4JN2B 2VRAA 3UCRA 1DANT 1ES0A 4PRHE 4QF1B 4WUUB 1A6PA 4KU1A 4JREB 1XFPA 2PTVA 3TO4B 3BPCA 5T1DH 1OCWH 4KRPD 4K3GA 1JNLL 5KBNC 5C6WH 4XB7A 3KPSE 3E6FB 1O7VA 4OCYL 1OP5K 2HMIC 1DLFL 4BJLA 5FGCB 3VA2C 4H88H 3KXFE 3BKML 3M8OL 4X7FC 3ARGA 1G0XA 3CU7A 3UC0L 4WEUD 4KVNH 2MQ0A 3UC0H 1PSKH 3QFJD 3AU1A 2VXQL 4RX4A 4JAMA 5BVJA 1PKQE 5AWNH 1PG7H 1S5HA 5CD5C 4GAYB 2Q8AL 2FX8L 4OZIA 4PJFA 2CH8A 5MHSE 3CVHL 3LS4L 2R23B 3RWFA 1AQKH 3K2UL 5J89A 4GRLD 1F00I 5DVOA 2WM0A 4TPRH 3NCEB 1S8DB 2X70B 5JQ6H 1FVDA 1IL1A 3L5HA 3LSOB 3LKNA 4NO5A 4DZBA 2CLRB 4PP2A 4CU7A 1KN4L 2GK0B 4I5BA 1J0IA 3V8CA 4RAVB 3U1SH 1VFAB 2NY5L 2DTSA 5C0RH 4I13B 3I6LD 4QRPE 2FB4L 4JR9L 5KSAC 3SPVB 2VERN 1U9KA 5I1EH 2A9ML 2FJFA 2EECA 2NR6D 3PP4L 2FR4B 3ARGB 3PDOA 4JPIB 3IRZA 3O2DA 1EV2E 3DXAA 3V4VH 3QQ4A 4F7EB 4GBXC 1CLOH 1FAKT 4DFHA 4NUJB 5EC1A 1G0DA 2ATKA 5DQ9A 3VI3F 4YIQB 1BEYL 1XF3B 2H3NB 4LL9A 4HCRA 4QRUA 3S34H 5B21A 3LEXB 5JPNA 1FGNH 1JPFB 3PABA 3KXFA 3C8HA 1GGIH 3T2PA 3AAZA 2EC8A 2EDHA 2IG2L 3MLWL 2ZSWB 1SVZA 15C8L 1JHTA 1HINL 1XGRB 3W2DH 4DVRL 1NSNL 1QHPA 2J5LC 2VAAB 4I77L 5C0GA 5ENWB 4G7YL 1WBXB 2EH8L 1IEAB 1T21B 4PRHA 1XZ0A 3P0VH 4FXKB 3T2OA 3T0DA 2BP3A 2FATL 2JTDA 2WWKO 4F9LC 3WD5H 3ISWA 3QQ9D 1KTDB 3CFJB 5JMRA 2R1YB 3J8F7 3VWKC 3FN3A 2BSTA 2OL3L 1DBBL 1T7ZA 4OJFH 2FJGB 1QSFA 2PCPA 1J05B 2D0HA 4OM0H 1TVBA 2YD2A 2MHAA 3FB5A 4N8VB 4QGYA 5FA3A 3Q1SL 1YEJL 5HPOA 2JKXA 3OGCB 4QCIB 4PJ9D 5BMFL 1PEZA 1FFPB 3L3OA 3QUYA 2ZZUT 3D2UD 1HH6B 3MLPA 1OP9A 2PXYC 5IB3B 1EGJL 1JUFB 3EYQC 2NXYB 4KK9C 3UYRL 1L7TH 4AEHH 1A2YB 3SE4C 2EDQA 1L7TL 4ZOEA 3JTTB 3WUWB 4M62H 4D2NA 2XRAL 5F8RC 3IF1A 2D7MA 3FQNB 1ZXQA 3HLAB 4EIGB 3NACL 5KTEL 1AO7E 2I9LB 4KKAD 2KL6A 4YGVB 4Z0BL 1GHFH 1J0KA 4HPOL 4WW1A 4HXAL 1A6AB 1N6QH 4UTBH 4LPTA 3QUXC 3GK8H 4HKXB 3ARBD 3OMZA 4OZFG 3CNKA 1MAJA 3R8QA 5JHDD 4AZ8A 5IWLA 5ETUA 3KPRA 4V2CB 3V4UL 3TH3T 3BSZH 4X98B 3B4NA 4O02H 3BUYA 1GZPB 4OI9A 3RUGB 3JWOC 3VXME 4PGCB 3GJFA 4NNYB 4OD1L 1NCBL 1MCHA 3WE6B 1YEKL 2OQJA 3PDDA 3LH2L 3RHWK 5EO1A 2YRPA 4LPUA 4Z7QF 5DJAA 3LQAL 4WDIA 4K8RH 5AZEL 3CMOL 2A9NL 4KJWD 1OD7A 2Y06L 4U7KA 3FAXA 1T1YB 2IEPA 2HT2D 2PYED 4PJDA 2ICWJ 3NFPB 3RTQA 1S7QB 3GMMB 2FECL 2GEEA 5I17B 1S7UA 3QCTH 1DDHA 1FVCA 2IQ9L 1BAFH 3FHAA 4KROB 4NYLA 5FYKE 3BIKB 4GO6B 1CE6A 3G5ZB 5DSCB 1CL7H 4I48A 2EDLA 1RD6A 1PKQB 4BQBA 1KJ2B 3IAGC 1FBIL 3WLWD 3B2UD 4UUJB 3CFCH 2XXCB 2RR3A 2H45A 3B2VH 3SO3C 4OLWH 4RSVA 1U93A 4B50A 2RJMA 4NRYA 1I1YB 4WI8A 1MJ7L 4HMEA 3MV8B 3TH2T 2OQJB 4LSTH 2IANB 3TN0A 5EBWB 2WBKA 3RJQB 3F7PC 2B0SL 1A7BA 3MLVH 1RUAL 1TJGH 2ADJA 2P24A 4WI5A 3WDJA 4R0LA 3EFDH 3DV4B 4OLZL 2QR0A 4KMQA 3LD8B 1D5XA 4EI6A 5BQ7B 3VI4F 2ED8A 4H20L 4HGKC 4RA0C 5EWIH 1K5NA 2ZUSA 3L7FB 2GJ6D 3P40A 2FBJH 1BBJA 1E6OL 1U3YA 3HAEG 2AEWA 5HHQA 2BVTA 1FIGL 3JWOL 3PP3H 3S9DB 4PRAA 4PGBB 1W72H 5HHVH 1IGMH 5EPMA 3O4LA 2UZIH 5E6IB 4WTWA 4Z7WE 4JRXA 5KJRH 4MNGE 4DVBA 5EG6C 2NW2A 5D1QB 5T3ZL 5C9JA 5D7IB 2UV3A 5L7XL 1WT5C 4P3DB 5TJWK 2FZ3A 4X5XB 4C4KO 4TPRL 2Q3ZA 3LN5B 2D0FA 1FG2B 3VGGA 3EYSH 1G7IA 4PG2C 1YY8B 1TZHA 2VR4A 4M1GL 4QCIA 1B6DA 1NLDL 2DLHA 2EH7L 4NQEE 5E8OA 1QVOA 5TF0A 1KCKA 1CFQB 4H25A 4MJIE 4P4KD 4X4XA 3RTQB 1YEIH 1IKFH 5ID1A 3IJHA 1H5BB 4LCCB 3G6JE 4HHAA 2G60H 1C08A 3P9LA 3SE4A 4MSWA 1T21A 4PRHB 3S96B 4F37F 1A64A 3MRGB 5BS0E 1CD1B 4TUKH 5DZOA 5E2UL 4OFYD 3MOBH 4PBVC 2WW8A 4XNXL 4PGEB 3FTGA 2CK0L 4XHQA 4NWUH 2K3TA 5F1KC 2WWKT 2F5AH 4IEFB 3BH8B 3WDIA 2BSRA 1N26A 5E1HB 3S34L 5BO1L 2Y6SC 1I3UA 4XNMB 3IF1B 3QQNA 4ELKB 2V5RA 1ZA3A 5J3HD 3S36L 1W0VB 3SE3C 2VXVH 2Z35A 5IMOA 3P30H 1GGTA 3KR3L 2HKFH 1U8JB 4LP4A 1DBML 1DUZA 4NJAL 1RZGB 4R97B 1LNUB 4D9QD 1MLCB 3VFWA 2AEPL 2K9UA 4CVWA 2N4IA 5E5UB 3SPVA 4AEHL 4KAQL 1D5BB 2FEDC 3ME0A 4NOBA 4QHNB 3DVIA 1A7RL 2FR4A 5B4MC 5IHUL 1MCKA 1T7VA 3TBWB 3K1DA 5IHUH 5IW1A 4ZSOE 5DUML 3LVEA 2C4XA 3X13B 1ZT7A 3SO5A 4KJPC 1UADC 3EJJX 4NZUH 5F7EH 4HK3J 3MXWH 1OQXA 1LE5A 1JZ6A 1X5FA 2YC1A 1INDL 4PRPD 4OB5L 3MBEC 4HKZB 5D2NC 1BQHA 4JFDB 7CGTA 4OZ4A 2NYYD 3VMOA 2IFFH 3U30C 4MAYC 2D31B 2R56H 5J12B 4WUKH 4CDGC 4G6AD 3I6KB 1X5HA 3TN0C 3HPJA 5IESH 3ZTNL 4JPWL 4ODHL 4ODSH 4YFDB 3ILPA 2PXYB 3CUPA 4KQ4L 2Z4QA 3GHEL 4X6FB 1HIMH 4MD0A 4R0LC 1KULA 3IKKA 4K3EL 1ZTXH 5DD5L 4Q6IB 4ZDHB 1T1WB 1MFAH 3CXDH 3CZJA 2BDNH 1QUNA 1A1NB 4CN6A 3HZYB 1WJ3A 4O02L 1D9KA 1BAFL 1MFCL 2ATKB 5DQ9B 2WSKA 2LU3A 1X5KA 3O2VH 2OZ4H 2OTUA 2F74A 5HHME 4MNQB 1NPUA 3IDNB 2R4RL 4NKDB 5AD0A 4WWKA 3TFKD 1HKFA 1OGAA 4PJCF 4DKFL 5DHYA 1XF4A 3Q6FA 5DJ6B 3VXQB 3F7RA 5E2TH 1OAYL 5KZCD 2CUIA 3OZ9H 1QA9B 2ADIA 2A9NH 3O45A 5C0BB 4HT1H 4AQOA 1U3HD 4OSUH 1SJEA 5CILH 3NCJL 3ZSTA 2BY2A 4EOWL 3S6CA 4N0FA 5FYLL 4ZO6A 2NY3C 2MMXA 3FFCE 3MLRL 1OGTB 2HJLB 3CZFB 1HSAA 2EC9U 1DQQB 5J9PA 3VFSB 4KTEL 5K9KB 3HI5H 4G8IB 3AMKA 3NIFF 1H0DB 3QPXL 3Q3GB 5A43C 4JY4B 5EOTB 4Z7WB 1UM5H 5IW1B 1AKJB 3BPOB 3H9ZA 4WW2F 3BT2L 4M6OH 3VXOA 3BQUB 3HG1D 2R8SL 3C6LB 4XBEH 1ZLUK 2VDOL 1NBZA 4O58L 5DVNA 5DC0A 3ARDB 3S98A 2J8HA 4XPGH 3QXTA 5MEPA 5B22A 3BZFA 3IDNA 5AD0B 2XN9E 3QZWA 4H8WC 1BVKB 1ZWIA 3PF2A 4K55A 3SGJA 8FABA 3MJ7A 1OQOA 5ANMB 1KB5B 5CGTA 5IP4A 4JFDE 4L1HA 1TJGL 1UZ6E 4DGVL 1Q8MA 2YPVH 3QDJD 4YH6A 3TNNA 3O45B 5JHLH 1NGXA 1EFXD 1AP2A 2B4CC 4LEXH 3QXVA 3QPQC 1UWEL 2DM4A 5HTSA 4MNQA 5CJ8A 8CGTA 3QULB 1MFDL 3QUYD 5GZND 4PGEA 1UB6B 1DVFB 3OX8B 3TFKC 4FN0A 4BSJA 3ZKNC 2XV6B 3MRRB 4FZEH 3V79C 5IVXE 2X4SA 2H41A 4LGSB 4J3XA 4X83A 1PYWB 3TIDB 5CJBA 1T5WA 1U3HC 1C5BH 1ZS8B 1EO8H 2MWCA 5MEPB 4ACPA 2PETA 1FE8L 3EDDA 3QDHA 2XFXB 1U2HA 3X13A 1B3JA 2XZAL 4NHUA 1CK0L 4M7JL 4PRDA 2ICWB 1D3CA 1LE5B 1ZK9A 3QEQB 2BVQB 4Z7WA 5EOTA 4R96B 1QSZA 3OSKA 4Z7NE 1BBDL 3MLSL 1JHKL 3PHOB 1SEBB 1IC7L 4LMQI 4LLUA 1RUPL 4NUGH 4XCNB 1LE9B 5FV1L 5TF1L 1X5IA 5D70L 1BQSA 4PTTB 3KYNA 3T3ME 1ZT7B 1XCTB 2E5EA 3U0PB 3GSVA 3QHZL 3HTLX 3H9SE 5F89B 3O4LB 1LO4L 2F74B 4AIOA 4PJ5E 1WT5A 2HVJA 2VZ1A 3RTQD 3TJHD 1MFBL 3CAFA 1XF4B 2PTTB 3NFNB 3GB7A 4IOFC 4GG6E 1HK6A 1K3ZA 1JN6A 4NC2B 3TF7C 2W9EL 5BO1H 2BCKB 2Z9TA 3M1BA 2Z91A 2VLMD 3WXVH 3I85A 4HWBA 4S1DD 3MXWL 1QNZH 5ANME 1SY6A 3B3IA 5F6IC 5I1JH 4O2FB 1WUNT 4X5WB 1IC5L 3DJ9A 1IC5H 4HHAB 5E70A 2AEPH 3BZEA 4Z7UF 1RK1A 4BKLA 1RZFH 4HUVA 1T2QH 2DQUH 3V0VA 4C4KT 4KAQH 4WO4D 4XPBL 3B5TA 1AXSA 3V9FA 5IFJB 3GJFH 4U1SB 4YE4H 1RJYB 2WP3T 1CG9B 3L5JA 5CSBA 1HCVA 1WCBB 1JF5A 2VDNL 4B41A 1CLYH 1IKNC 4OTXH 3VXRD 4MB4A 3QXDA 2OP4H 2R2HB 4EVNA 3DX9A 4YXLH 1JZ7A 5DZLA 5LWYH 4RGOH 3SGKA 4BZ1L 2VQUA 4MVBC 4W4NA 5JIHA 5J1SC 2GUOB 4GKNA 2WAHA 5F7DA 4X6EB 1RZGA 1NUGA 2GJZB 4PJBB 5D7SL 5DI8B 5C0JB 3FJTA 1KCSL 3KPRE 3OZ9L 2ITCA 4XBPA 4X7TB 3MBEB 5EPMB 2R4SH 2P5ED 4Y2DA 5H37H 3MCLL 3V5KB 4DVBB 4X6DB 4MZ2A 4BUHA 1T20B 5DK0A 1P7QD 3AB0B 4M7LT 1MCSA 3OKOA 1UKTA 2EXYD 3VG0H 1W0VA 1GPOL 2Q3AA 1FVEB 5FYJH 2G5BA 4U6TA 2VXSL 2A73A 1D5ZA 3K8LA 3STZA 4S1DC 3CGTA 4LAQH 2LE9A 2PXYD 3IGAA 4M6NH 3T77A 4OCNC 3MRNA 3KHQA 2GYSA 2BVPB 1QLEL 1D5MB 3O81A 1EFXB 1UJ3C 5E95B 3BP4B 2VDOH 3GMNB 1BFSA 1MQ8A 4JPKL 1NCDL 4ODXB 4WO4C 2DTML 3QISA 5J0BA 1OPGL 4YGAB 2X89A 3ILQC 2Q6WA 3GRWA 4RMSA 2DYPB 1J1PH 3VFRB 3RNQA 2ARWA 5FEBA 3QDMD 3V8OA 4LLYB 3HZKA 2EYTA 2YPVL 3U9UA 1J11A 5KZCB 2XN9D 3FT4B 4D0CB 4D9RD 1D9KC 1V3MA 3DX9B 1X6LA 4HDIB 3WXWL 1QFWI 5C0BD 1JFQH 2OBGA 4P4RA 5C08A 3VXUE 3IB4A 5I18L 4M6OL 4NC1E 3QAZB 1WBYB 4RMRA 1XMWA 2HFFA 4F7MB 2OYPA 2G2RA 5B3JE 1CTNA 4JFQA 1ONQB 3NTCL 1IT9L 2I9TB 2AJZA 3FOMA 4QXGL 2YKLH 2NZIA 3EUUA 2NZ9D 1FNAA 2CGRH 2YKLL 1KPRA 1HWHB 2BXZA 3ARED 1UYWH 3P73A 1AD9A 4NQVA 1UWXH 5I30H 3IDYC 1YEDA 4OKVB 4FQXD 4GMTH 5CP3A 1T6WA 3GSNB 5DVMA 5HI4C 4JO1L 3DUSA 3HE6A 3DTXA 4P3CL 2ADJB 1MVUA 4YDKL 3MUGB 4Y5YC 1IZJA 2C1OA 4WWID 3N0PB 5EUOE 1MCQA 3NFNA 4NKOA 3DIFB 3QDJB 4NBXB 1CGSL 1DSFL 1KACB 3TT1L 2GTZA 3LPGA 3ZT7A 3AUVA 3MLTA 4PV9A 3ROOB 2W65B 3MR9B 3D3VD 1KJ2A 1HHGB 5DRZB 1XIWD 4DN3H 3VD7A 1WGOA 3NIGE 3QUYB 5HYSB 4JG1L 2FJGA 3KJ4C 4OZIE 3MUZ1 4M7JH 4FTVD 2R15A 1UWGL 2JB6B 3X12B 1D9KD 1EEYA 2YA2A 4E5XB 3CDGA 5HVFB 2VDPL 3TH4T 3GSOB 5GHWL 1UZ6F 1T3FA 2IADA 1U8HA 1NCAH 5IJKA 4P48A 4F8TA 3JUZA 3BPLC 4YAQB 3HFMH 5F3BA 4QO1A 1RIVL 3KPSA 3HFML 4QYOB 5DXWA 4JR9H 3JV4B 1WIPA 2ORBL 5CKAA 3QXUA 2OR9L 3VFOA 4RFOH 2ORBH 2V5SA 4WI3A 3AREC 1KJMA 3ZYJA 2DICA 2EDNA 3OR6A 4FXLA 3C5ZB 1U6AH 1YY9D 1YC8A 2DKMA 3RKPA 4PP1D 1Q94A 5HHOE 2CPCA 4G9DB 4N8CH 2VKWA 1MCBA 5J4MA 1VCAA 2YZ1A 3W5NA 1ORSA 3RRQA 3S37L 4HUNB 4L4VB 4UIKH 5HI4D 1MHEB 4HKBB 3MGAA 3CFBB 3S5LA 4HS3B 4QRUB 3S7GA 4GQ9L 4LQFH 1NGXB 1A6TA 3T1FA 1FGVH 1EDQA 4WI7A 3EYFB 4CADB 4PJXA 4WV1C 5IVXB 1SJHA 3GIZL 4UINL 1ZGLM 4WHYG 3L3IB 5DURB 1B0RB 2EE6A 1UCTA 1YQVL 4PTTA 5E6IC 1CBVH 4YHZH 5SWSB 5MENA 4Y0GA 4PV8B 3RWCA 2PR4L 1F11B 4JGJA 4JPIA 4TVPL 4M8QA 1YMMD 2E6PA 3BIAX 4ZUWA 3D85B 3TVMB 3CX5K 3VU2A 4ONOA 4S11A 1C12B 5KS9F 1OD9A 1RUKL 4U0RC 3BZDA 1NC2B 1NCWL 4K71C 4OLUL 1GPOH 1W8OA 3BKCH 3QIUC 4OQTH 4PJAA 3S3SA 3QWOA 4YXHH 5DJZB 3H2WA 4L5FL 5CHNA 1JGLL 2AVGA 5I76B 3G5XA 4G8GE 2ARJQ 4FXKA 1NAML 1Z9MA 1WAAA 4JFXB 5E4EB 1JGVL 2EDEA 1FLTX 5GRVK 3UJTL 4RGND 1JK8B 3ARGC 3QO1A 4OZHF 5I15H 4ONHA 5HPMB 4P5TA 5JOFA 2HG5A 5LQBL 3ZKMC 4E41A 1BFOB 2VLRE 1AXSB 4HXBL 4JPKH 5IFJA 1I9JH 4P2QE 3C60D 3TO4A 2Q7NA 5C9KA 1Q1JH 4IJ3C 3VXUB 2BJML 1L6ZA 1ZS8A 3PGFH 3L3DB 5GGRA 3IDJB 1MI5B 3KYKH 3VFVB 4O2FA 3MRFA 5BXFB 3D25A 4LIQH 5F71A 4Y5YA 1KB5A 3P4OB 5JOPE 2IPTL 4NBZB 3MBED 3AS2A 6CGTA 3SGKC 4CJ0A 1OSPL 1BF8A 2ARJB 2ADGA 2BOCB 3QA3A 4UMGA 1CQKA 1A7OH 5F7WC 1LD9B 1A7OL 2GITB 1DLHA 5EB9A 4OZGB 1HH9A 1IGYB 2WUCH 4JY5L 3LB6C 4RA3A 5E9DD 1X4ZA 1MVFA 3QI9B 3NCBB 5F89A 1JK8A 3FO2B 1Z0MA 4LIQE 2XTJE 4N0UA 1S8DA 2X70A 4QNPE 4Z7NF 5BV7H 2K1MA 3NZ8B 4NHCL 5HHOD 3STBA 4LVOC 5E1AA 5MEOB 4NKMA 2CLRA 3QDGB 4BQ6A 4QRRA 4U31A 4U1LB 1OAZL 1DQLL 2X2YA 4NQXB 2HFEB 1NGWB 2YD5A 2C4FU 5D1QD 4XNUH 3BE1L 1QA9A 2ADIB 5KVFL 4PJ7A 4DOHB 5C0CE 1DSFH 3TT1H 3ARGD 3JBG7 1DQJB 2FRGP 4AEIH 4PGDA 1FJ1B 3SCMD 4EUPH 4ZXBB 4DN3L 4N0FB 1I75A 2OR8A 3ROLA 2YA1A 3H3KA 4LU5H 5HGDB 2I07B 1LDPH 3VFVA 2BNQD 1G7HB 1U8OB 1KIUA 3VE0B 1AQKL 3K2UH 5I71C 2OMNA 5E7FA 4HV8B 4DN4L 5IKCA 4AEEA 1EAJA 2CD0A 4WTZG 1I4FB 4XP1L 1MCWW 4DEPC 2P1YA 5D6DA 4X0KA 4D0DB 4U7SA 1IGML 3P4OA 5K9JL 1MQKH 3Q5OA 4S0TD 1SMOA 4P59H 3MJ7B 1OP3K 1KCUL 1A4JB 2FB4H 3VXNB 3T4YB 5GXBB 5GZOD 1ODAA 4OF8A 2Y7QA 3DWTA 1JGDA 4OD2A 1JPSH 4HX1B 1QBBA 5DURD 3FT2A 5H94A 4NRXB 4JFED 3QWRD 3DXAD 4PREB 3O6KL 3WHXB 1S78D 5FF6B 1T0PB 1C1EL 5DFVC 5KS9B 1WF5A 3T2NH 1G7IB 1CLCA 2GTWB 3G5XB 5BOPA 3DUUB 3IFPA 1XF1A 5L2JA 4OLXH 1SVCP 1TZGL 1OAXL 3QIWB 1F11A 4NRZA 1LO2L 2YUVA 5DO2D 3TYFB 3GDBA 5D7IA 2RCSH 5GPRA 5C9JB 1QR1A 1HILB 1EHAA 4RMWA 4QHKI 3MV9A 1GL4B 4W6WB 3W2DL 5ID0B 5C0BE 3GHBH 5DA0B 3UXFA 1G9MC 4CJ1A 2GFBB 3B6SA 3WIIH 4F3FB 4D9RE 2ED7A 4PJCE 3FB8A 4U1KB 4RWYL 3RVXC 3AM8C 4TNVF 1X5YA 5FYKU 1I85C 3FQWB 2X1OA 4QTHA 1FZOA 4ISVA 1ZSDA 4LHJB 3O3DB 2BHYA 2CDGB 4PJ8B 5EU6D 4TVSa 3G6AB 5EZLB 1WK0A 2YD3A 2BK8A 4OCXL 3KLSA 3KPNB 1ZHNA 3P0YH 4H1LH 1I1CA 4RFNB 5IJKC 4OCXH 5DUPH 4LBEB 3MACH 4YNYA 3FOLA 1ZHBB 5J56B 4Y4FA 4P46B 3LEVH 4M48H 2UUDK 5L2KD 3H9YA 1YQVH 4Q6IA 1M7DB 4CU6A 3C87A 3UJTH 1BVLB 4JHWH 2FO4B 4JJ5B 1S7VB 3EDEA 3QUZB 3FN0H 3S4SA 1HCFX 4CU8A 3UTSD 2R2EA 1SJVA 5HVGB 1MHPL 3MLUL 1ZHLB 1KJMB 4IOFD 5D8JH 4KI5F 1H3PH 4JZOB 5CAYB 2X40A 3FB6B 2EDKA 3I3EA 2ZCKL 3ARSA 1Q9WB 1RUQH 2E7BA 3F12A 4LCWA 4LKXB 2YMXL 2GT9B 2P5EE 3S88L 5JHDA 4PTUA 1EJ6A 3KPRD 1NBVL 1S9WB 5C2BH 1T66C 1K6QL 3MROB 2VE6A 3EOBB 3IFLH 4HUKB 1EEQA 3QWQB 3T09A 5CBAA 5DHVA 3HC4H 4GLRH 1I3RB 1I7ZB 1U8HB 1DUYA 3QG7L 2PNDA 3FRUA 4KKBD 2F53B 1XF5B 1RZIB 4OFVA 3HR5B 3STLA 3FO9A 3BX7C 4M5YH 3PXHA 4WUKL 4WTXA 2Z8WC 3O8XA 3TA3A 43C9A 4JY5H 2D03L 5B39A 2NY6D 4L3CA 1FQ9C 2ILLA 2OSLB 4CDHA 5HI3D 2VNCA 1CXEA 3QO0B 2XKUA 4GKZA 1DBKH 4KK8D 2J8UE 4KRNA 3CIQA 4XH2A 5D2LE 1A21A 1NUDA 2NX5D 4PV9B 3ROOA 3U7AA 3RX5A 2A6KA 2RB8A 3CLEL 1EHNA 3VRIB 2UVFA 3KPSD 4WW1B 6FABL 3FO0L 3FAWA 4MJ4A 1OCWL 4I3SH 1BD2E 1KPRB 5F9JB 6FABH 4CNIB 1D5IH 5TDPB 1OF2A 4AT6A 2EO9A 5AYQA 4C57C 1HEZA 4FMFA 4NO0A 5EN2A 4C55A 4Q97A 3QCUL 4UAOB 2JCCA 1DJSA 2OL3B 3V6ZA 4OI7A 2EO1A 2JB5H 3WL9A 3GKWH 1T89A 2DQFB 4HT1L 2FHFA 2C3XA 1XH3A 5FUCC 1C7TA 5ALBH 3HR5A 1U8QB 3VFNB 5ADPL 3MRBB 4JM4L 2F53A 5CGYC 1J8HB 3DYPA 3SDXE 2FCBA 1AGEA 1RZ8A 5DJYB 1KJ2L 3G08A 4HUWB 4YFEA 3UTTA 1S9YB 4NC0B 4XGZB 1G6RL 2VE6B 5C92A 2WK2A 2VLKD 3FRUB 4JQXA 1WLHA 3BXNB 4ZQKA 2OK0H 1ZHKB 5ELIA 5KVFH 4OCYH 3DBXB 4FQLH 4K2UH 4XCEB 3L7EB 3O6LL 3U7WL 1L7IH 5JDJA 4FQLL 3OAUH 4J3OC 1S9WA 4OLEA 1R5VB 3ILQD 1FFNA 5F1SA 3QIWD 1K85A 5C0AB 3ZYZA 4KGJA 2DQJH 2E27H 4H1LG 3O3EA 3DHMA 4RQQA 4HJJH 5F9JA 3RZCC 3TVMC 4IDJL 1TCRA 2E7CA 3LKSA 5E4EC 4TNVK 1UH3A 2OL3A 3PE9A 1N7ML 4P2OB 3GRWH 4KK8C 4D94A 4JEGB 5CKGA 3P4NB 5TE4L 1A1MB 3S4SB 1A9BB 1MJUH 2GY5A 4LBEA 5L6YH 2VUOA 4YHKH 5I9QC 1AD0A 2BNRE 2FGWH 1T2JA 3WCYA 5SWZD 1IAIL 3S97C 5FUOH 4P4KA 5TDNB 2BVPA 3D18A 4MDIB 1JI1A 3TWCH 3GB7B 1ZSDB 3W39A 2RCSL 4KRMB 4IS6A 1K9TA 5D1ZC 2NY4B 4I0PD 2H2SC 3S35L 2EDJA 5JPMA 4A6YL 4YBHA 4YGVA 2AK1H 4L9LB 3M07A 4LASL 3QJHA 2CUMA 5F7DB 1C1EH 1RZIA 3SE9H 3BFOA 4DWHA 1KN2H 1UCBL 2HAZA 4PJGF 3CCHA 5D71H 1CGWA 1VFBA 2B8OT 3KPQB 1DBBH 1ZANL 1FO0L 1SEQH 2GUOA 2VLLA 4UV4L 1BOGA 3HG1E 4WWKC 4LPVA 3H3PL 4LCWB 3EO0A 4IMKA 1B90A 5CZVH 4MA7L 1QSFB 2BOBA 3OJDB 4ZOCA 2R2HA 5KAQF 3O8XC 1OY3B 2EDOA 3U0WL 5FO9B 3K2MC 3BGFC 4HBQA 4HJGA 3UYRH 3CX2A 4KJYB 3GGWA 2DBLL 3PWLA 4G9FB 5DLML 1VACB 1QO3A 5CP3H 5DWUH 5I0DA 1A7RH 3V52H 1VADA 3GMNA 5T3XE 3HPLB 5KSVA 3TPUA 1QKZH 5FDWB 4WU7B 4XB8A 4UB0L 3VFGL 4F7EA 3BP7A 1AIFB 4X4YB 4XWOC 4X0KB 2OTWA 1DFBL 1ZT1A 2Y9RT 1P6AB 1FZOB 4GQPH 5EDXA 3JWDC 4M48L 4BFIB 1QBLL 5E6YA 4ODBD 1QR4A 1A3LL 1MF2L 3RNKA 5HHNB 3BMVA 4MQTB 2H9GA 4LCYB 2J88L 2YK1H 1V7NL 5HHMD 5KSUA 4Y5VA 1QRKA 5CMAB 3QCVH 2YSSB 4JHWL 1YEKH 3BJ91 2H2SD 3RKDD 4RAVA 1T89C 1YEEL 4XPAL 1HHHB 4L8SB 1JN6B 1YEGH 1E4XI 1FRGL 4U1KA 4ODWB 4U1HA 4YDVB 5FFLA 2DQDL 3WJJA 4L8DB 4PJEE 2FJFB 2VWEE 1KIPB 1FC1A 4P5MA 1F97A 4L29B 5L8JB 1TPXB 3RWJA 4EBQH