5DUPH

Influenza a virus h5 hemagglutinin globular head in complex with antibody avfluigg03
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
227
structure length
208
Chain Sequence
EVQLLESGGGLVQPGGSLRVSCTNSGFTFSNYAMSWVRQAPGKGLEWVSAISGTYYADSVKGRFTISRDNSKNTMYLQMNSLRAEDTAVYYCVRDDSYDGGGHYGLHNWFDSWGQGTLVTVSSSTKGPSVFPLAPSALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Comprehensive analysis of antibody recognition in convalescent humans from highly pathogenic avian influenza H5N1 infection
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1/2005(h5n1))
molecule tags Immune system
total genus 34
structure length 208
sequence length 227
ec nomenclature
pdb deposition date 2015-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dupH01
1AP2A 1NGQL 4PJFB 1FL6B 1F4AA 3BQUA 1KCRL 1H8OA 4GXUM 2IG2L 1BIHA 2IMNA 3VRIB 5F9OL 5ESQA 2NW3B 3T0EA 4JKPL 1A02N 4MA7L 5DMYA 4WHDA 1LILA 1H3UA 4LNRB 4UOW0 3CVIH 4S1RH 4XPHL 1A3RL 5CGYD 3MXWL 2VDNL 4M4PA 4PRHB 1QSFD 1IFHH 4FQQB 2D3VA 4QXTB 4LCWD 2VLLA 4PTUB 5E2TH 5GGUB 4PBVC 3TN0A 4MNHB 4AJ0A 1MEXL 3UBXG 1WBYB 3FQXA 3QDGB 5DJXB 4ZOCA 4DUXA 3LB6C 1T1YB 4KJQC 3D2UB 3QEHB 5DLMH 3GMRB 4OD3H 5C0CD 4WFHD 2P43B 4HJ0D 2GSGA 2EDYA 3NN8A 3REWB 4H8WL 5LGKA 1KB5B 3ILQD 4TNWK 4PJ5B 4Z7NE 5ALBH 1X5KA 2EKJA 4L8BA 4NZTH 4QHNA 4DZ8B 5E7FA 2QADD 5ACLA 1IKNC 5L8LB 2RCSH 3ARSA 3TO2B 4K3EL 3KLSA 1TDQA 3TBTA 4G6FB 4N0YH 5ADOL 3BRDA 1XF2B 3MV11 4NO2A 1ZT1B 2Y5TB 3U4AA 1U8NB 3GSVB 1AR1D 4Z7WB 4Y89A 3S4SB 4DFIA 4YHOL 5IHUL 4J6RL 1C5CL 3ARRA 1AFVH 3MRGA 2VMFA 2Y9RT 5C09E 4TUJA 3BXNA 3QEQB 2H32A 2QSCL 4DW2L 4MQTB 4TOYH 1OB1B 4XPGL 1JWSB 3PWPA 3G08B 4LHUA 5FECA 5T1LB 3M07A 4YZFF 4NN7B 5IWLC 3ULUC 1FCGA 2YSSB 1RZ7L 3DETC 2VC2L 2M26A 5L88L 5BQ7A 2XTJC 4P2QD 3LQAH 3QCUH 4IIQB 2GEEA 2IEPA 4X5LA 4GG6A 5A2JH 4N0UB 3SDCD 1UJ3B 3DSNA 4HV8B 1IBGH 1JV5B 4JJ5B 1JHLH 3GI8H 3X14A 1FAIH 1TCRB 3CVHL 2XYCA 5JA9A 4U1SB 4ZSOA 2ICCA 4QRPB 1TTUA 4BK5A 4OFYA 4YLQT 2F5AL 4UZGA 5MP6L 4OGXH 4GFTB 4N5UA 4EUPH 1CXFA 3L1OL 2G75A 4UIMA 1Q72H 1XF4B 4XVSL 3KLDA 1B9ZA 4YXHL 3V0WH 3U82B 1Y18B 3L7FA 5BV7H 1FORL 5B8CA 1ZHLA 1ZVHA 3KAAA 4NQSA 1AE6H 3MTRA 3S96B 1TZIA 1QSVA 4AT6A 1HHGA 5DEGB 4PRID 5DRWA 4LLYB 4LOUC 3TNMB 1YNLH 4QHUB 4TSBH 2Q6WB 4OCWL 2EECA 3QUXB 4G6KL 3QP3A 2HLAA 4JLRB 4F7MB 2YD8A 1MLCA 4D9RD 3V0VA 2ITDB 3CDYA 5GRZA 4WI7A 2F5BL 3CNKA 1OM3H 4UILH 4GAGH 4JRWA 1CDUA 4FXKA 1GZQB 1RVFH 4OUUB 1SY6L 1TQBB 1UB6B 4Y5XA 1DZBA 1E27B 2ICES 1TVHB 3I84A 1G6RL 5IVXA 3JVGC 3DYMA 4AH2A 2A73A 2EDRA 2H41A 3KPOA 3DI2B 1FO0A 3H9HB 5I66A 4WWKB 3C5ZA 4BFGA 5AWNH 4NRYB 4N8VA 1BHGA 1ADQH 3P9LB 5E08H 3MLWL 1S78D 1F4WL 3GJFH 4NQEB 3SBWA 4ERSH 3KS0H 3TYFB 2C9AA 3H6JA 3QFJB 3HNTH 3TH2T 2I26N 1KPUB 2WWKO 5FKAA 1BM3H 4UINL 4LKCB 3MACH 3D39D 4RFOL 3W9DB 5J6HB 4PGCB 4I2XA 4J3UA 5ILTL 4GBXD 4JDZA 1LE5A 1MUJA 1ZA3B 5DK0B 3RWJA 2BFVL 3WSQL 3BH8B 3IDUA 3B9KD 2Z31D 5DJ6B 3OAYK 3TNNA 3IDXL 5CUSH 4LCCB 4R4BB 1I8KB 4V1DD 2VB5A 3VD9A 4U3HA 3H7BA 2JJVA 4M62H 4PV8B 2VABA 5GGSA 2AEIT 3BUYB 4WHYG 1A6VH 3T65B 5HHOB 2N56A 1QA9B 3LEXA 2Y7QA 4NQCB 1AD9A 3MRRB 3BMWA 3FO1A 2X2YA 5GGRY 1XR9A 2V17L 5ID0B 1N6UA 4AEHH 5CGTA 4JREC 1J8HB 5K9KB 5TQ0L 43CAA 4UTBH 3C6LC 5I1EH 3DO7A 2VAJA 2N7AA 1HH6A 2ZUUA 4WENB 3DV6A 1KN4H 5F7LB 1I4FA 3HE6A 4JFED 2F74B 4X8XA 2Q86B 3HRPA 3KJ4C 4QRTA 1HEZA 2XN9E 2NY0B 2HKHH 1Q9OB 4WIQA 3SDAC 1VADB 2VZ3A 5F7MC 1NCAH 5I8KL 4YQXL 2R29H 1ZWIB 4NC1E 5D7SL 4JY5H 5IMLA 1H3VA 5CKAA 3TC9A 3EDKA 3MRJB 2QSTA 5DGRA 1NCDH 1N2RB 1B0GA 1BZQK 4YDVB 5I73B 2OP4H 2R1XA 3DVGB 3IKKA 5IB3A 4M5ZH 3WFCL 1GPOH 4OV5B 1ACYH 3X3FL 1YMME 5IJKC 5IKCB 2UVEA 5L0QB 1QFWM 4NP4H 3GUTA 1QFUL 3CH1A 3OAZH 4OLUH 4Y4FD 2ICWB 2DKUA 1F58L 3X3GL 4GW4B 1IC1A 2PKDA 5GIRA 4R26H 3SGJA 2RHEA 1M7DA 4DOHE 1JPGA 1BBJA 1K4DB 2OSLA 2MNUA 1I1FA 3V5DA 2VUYA 2J7LA 1JNHA 5EZOL 2P45B 5HDQH 3GK8H 4BH8B 3Q6GL 3O3AB 4D8PB 2Y36L 5DFTA 5FO9B 1BEYL 1JGLL 4GW1A 1U9KA 3UTTA 2NLJA 2VQUA 3SE8H 4HWEH 3W0WB 3HUJF 2X6MA 3T08A 5GSRA 4TVSa 5KS9E 4PP1C 1T89A 2QQLH 4C54A 5GS1A 2KKQA 1HQ4A 5HPOA 1K2DA 4HXAL 5I1AA 5I1JL 4M48H 3EYSH 1AGCA 5JLZA 1L4IA 5DMIL 3A67H 3CX5K 4JFHD 1OTUD 5FK9B 5KVDL 3RVWD 4HWBH 1W72H 3SO5A 5D6CB 1BQLL 2FO1A 4F3FA 5JDJA 2VR5A 5EUOA 1MCJA 3QZWA 1RQ5A 2P24A 2JCCB 2VLKB 2YD4A 4HS3A 4X6CA 4KPHL 3JBG7 2VDLH 4NKOB 1CL7H 1D6EB 4ZUVA 5HHME 3GSUA 5C70A 2BNRA 2NCMA 2NY7H 2YA1A 1XGRB 4YHYC 3BP7A 3T0WA 4OLZL 1R3KB 4WNQB 4DN4L 1MJUH 4IMKA 1MJ8L 4HUNB 4IRZH 2XRAH 3RGHA 3SQBA 3T0ED 2CDEB 1NEUA 3SDDB 5I18L 5HHVL 1YPZF 1I7TB 1JNLL 2XWJB 4L9LA 35C8H 1YEDA 2WBJB 3LS4L 1JGVH 4L4TB 2D03L 4LHJB 4OD1L 3RKDC 4YHLL 1KPVB 3EYUL 5DJZB 3TN0D 4L3EB 2ZJSH 3HG1D 3GSQB 3PHOB 3VXUB 4HH9B 2PTTB 1RHHA 1QBLH 3MRHB 3SKUD 2DIBA 4I3GA 2MFNA 1OARL 4XXDA 4Y4KB 1S7VB 1U8JA 2R39A 5GZOD 3D85A 3PXJA 2E7BA 3MRLB 1OGTA 2MWCA 4LPWA 3OKMA 4Z0XA 4GKZB 4MNQE 3NACH 5C2UB 4APQB 2HTKC 3G5VA 5T1MB 4KUCD 5C0BE 3FB7A 3CJJA 1CQYA 4JFFB 3U30B 3PGFH 1NGXA 1EGJA 3ARGB 1JCKA 4P57A 1EEZB 4Y16B 4MJ5A 3SGKA 2DN7A 2J8UA 1BQHA 3L3OB 3SE4C 1E6OH 4K94L 1ORQB 1U8QA 3PL6A 4XCFL 4YBLC 4YNYA 3QUMB 1PYWB 1G9ML 2P7TB 5A1AA 1NL0L 2DI7A 4PBXA 2CK0L 3WFDH 3FHQA 5BV7B 2WUBL 5TDOB 3NVQA 3VFRB 3C09C 1OAKH 2QQNH 3PHQB 1K8DA 3P30L 5GRUL 3FL7A 1F6LL 1QTYT 1N6QH 3EO0A 4LPCA 3GMLA 4U6TA 2A74B 4DVBA 5D7LB 1MCOH 4LEXL 3G6DL 1Q9WA 1DUYB 3MJ6A 5IJVB 5ADPH 3QXDB 1G7IA 1MJJA 4P3CH 4CU6A 3EUUA 1RZIB 5EU4A 2BHYA 1MCCA 5LG1A 1DQQA 4KKBC 4YHZH 1UC6A 3PWPD 5ICXA 3RIFF 1T2JA 4LHUD 3TBSA 3U4EA 3VFUA 2I27N 2ICEB 1QLRB 3SO3B 1MFBL 3MOBL 1DLFL 3TZVC 3A6BH 2AW2A 2F54A 3IAGC 4MD0B 1ZOXA 1HSBB 4XPFL 5F89B 3IFPA 1TQCB 2JIXB 3LRSB 4YO0A 4EOWH 2AERT 4PTTA 1YN6A 5DMGD 5EUKA 2ZG3A 3EBAA 1WIPA 4ZAKC 3QHZL 5D2NB 4TRPH 1E4KA 4GW5A 5HPMA 1OGAE 4OFYD 3KJ6L 1X44A 1T1ZA 3WHXB 5J8OA 1T5XA 2APFA 5TE7H 2O5XL 2R2HB 3VXSB 2EE2A 4YFEA 5IVNA 5IQ9B 1D5BB 3JV4B 5CLWA 3MCKB 5IESH 3Q3GB 5KZCB 3BWUC 2NR6D 2AJYL 4U6VH 4Z77B 2BC4B 2YMXL 3HFML 4Z9KB 3DBXA 2ERJB 4KJWC 4MXVF 3V6ZA 4L4VB 1GOGA 1F5WA 4OSUL 1PD6A 5KSVA 4Y8AA 2BZDA 2YEZA 3N85L 5L2KB 4CU7A 5CBAB 1NGWB 1C16A 2KQMA 3Q1SL 2R4RL 1F90H 2SEBB 2LVEA 1KCRH 3MV9E 3HLAB 1C12A 3ULSB 3T1WA 5BW7A 4H1LA 4MD4B 1TVBB 4PJXB 1VKXB 2X4UB 2GJ6B 3C8HA 3O9WC 3QQ9D 1AGBB 4KKCD 3DMMB 1LK2B 4KI1A 3L3GB 1AHWC 2VDNH 3MXWH 3MX0A 4HBCH 3P73A 4KV5E 1TTFA 2FJGA 4HKXB 3DUSA 1R3LB 3MRNA 3DIFA 4JRYA 3ELAT 3NPSB 3ULUE 5DURB 4OLYL 4KRMB 3QO0A 1NAKL 1NC2A 2YPLB 3TIEA 1A4JB 1NDMA 3OB0H 3WL9B 4XAWL 3RL2A 5IBLC 2XTLA 1OSPL 1UXWA 3W39B 2O5ZH 2QTEA 5TDNB 1AXSA 4H8WH 5B39B 2PO6A 1FFNB 2XY2A 2UYLA 3FO2B 1B0RA 1OAQL 1XZ0A 3QNXB 5EU3B 2YPVL 4OIIL 2R2BA 3LN4B 3K74B 1HINH 5BVPL 1AJ7L 4PJ9C 3UAJD 2CLZB 3B6SA 2BSTB 2WP3T 3PGCA 2A6DA 4RGMB 4HQQL 3OR6B 3FCTA 3IDMA 4K3EH 1KULA 2XA3A 4YR6B 4BUGA 4BSWB 1H5BA 3HUJB 2GUOA 3DTXB 2A83B 4UUJA 4KJPC 4JM4L 4K3HA 4WJ5B 2QSVA 5E7BA 3QIUB 3IJSA 1T66C 2YR3A 5IHUH 4HUUB 4J6RH 4XP4L 3O8XC 4OKVB 2E6QA 3NIGF 4YPGB 3W82A 5F1OB 3U1SL 5DWUL 5HI5D 5LJYH 1MCLA 4NN6C 2RFXA 3QQ4B 4PRNB 1RZ7H 1IJ9A 3OJ2C 4Y4HC 5C08D 3DXAD 5DYOB 5I1HH 3RWGA 3HAEA 3GMMA 5EO1A 3JSSA 1V7NH 5T5FL 1MHHB 1VFUA 5JIPA 4BQ6A 4NN5B 5HVWA 1YEGL 4M3JA 1XH3A 4XNMB 5EOTA 3ZT5A 5ANME 3KLHD 1DUZA 1UKQA 1KB9J 5DHYB 1QBML 3EJYC 5EFIB 4G8EA 1NBYA 5FF6A 5BZWA 2F5AH 5MP6H 1XF3B 4D9QE 3OKNB 5K9JL 4XVSH 1YPZB 4IRSB 4O5LH 4X4XA 5TH2B 2VXSL 3F62A 4JFDE 3TPKA 1JK8A 1FGVL 5C07B 1FORH 4JKKA 5DC4B 1NMCC 4PR5A 3AMKA 4ODHL 1DJSA 3T2QA 2JB5L 1EO8H 4P2RE 5I9QC 1OF2B 1QNZH 4YHPB 1EERB 1RK1A 5IFHL 3G04A 4CVZB 2JJUA 4OZGF 1QOKA 3O3EA 4QKXB 1ZEAL 1M4KA 1HWGB 4MSWA 3CXDH 1T80A 4X5XB 3L5IA 1QO3A 1KJ3L 3P4OA 4HUXB 1GGBL 2V9QA 3O4LB 2F5BH 2HJKB 2X70B 3EW3B 1FH5H 1D9KA 2GAZB 1SY6H 4OZFB 4U6HB 2G5BB 3L3IB 5F7HA 1G6RH 1P7KA 3T4AB 1DQLL 1LP9A 4RBPK 4X7DC 2L4OA 2P42B 3VXRA 1JUFB 2OR9L 3MBEB 3S3SA 1QRNE 3KPSE 3P2TA 3MRBA 1RZKL 1NMAL 5H2BB 5HYSA 2CUMA 3V52L 3MR9A 1VCAA 3LKQB 4EI5C 2XKNA 5FHBH 1F4WH 5KSAC 4PJDB 5KW9H 1EIBA 1OP5H 4LSSL 3QUZD 4CVWA 2WMPA 1BLNA 4UINH 4XHJD 3SCMC 4NHUA 1N7ML 3BISA 5ILTH 4HMDA 3L3HA 3BZ4A 1KJ2A 1MRCL 4M7KH 4YGVB 2BFVH 1F45A 2OI9C 1ZXQA 5CKGA 2Y06H 3FB6B 3WSQH 2JJTA 5I74C 1TFHA 3BKCH 2P48B 3QNYA 3IDXH 4E41A 3ARFA 2V6HA 3AS2A 5JHLH 1IMHC 4EN3B 1AO7E 4XC3L 5D7JB 5E5RB 4P23A 3K2MC 1MREL 2ZKHL 2GCYA 3OGCB 2IAND 1RUKL 2Z4QA 3AREA 1U2HA 2PW1B 3RI5F 1N6VA 3G6AB 5SWZB 3VXPA 2YHGA 3BKYH 4M1CD 1N0LA 1ONQB 4QO1A 5TQ0H 4O2FA 4M61B 3TH3T 3PWVA 1DR9A 4Z76A 5DUBA 1IL1B 1T03H 2H6PB 1BFVH 4PPTA 5DFVC 4P99A 3D85D 4MXWL 4XZUA 2R69L 2W65A 4F8QA 1XCTA 5BS0A 5ITFA 1LO4L 3D48R 2P5WD 2DF3A 1GIGL 5L8KB 1RAMA 5EU6E 1P7HL 4B7LA 4K8RD 4Z6AT 4H5SB 4KFZC 4OLEA 2P47B 2CIKA 3CXHJ 5AAMA 1U6AL 4HCRL 1MI5D 3MJ9L 3QAZC 2YS4A 3U7AA 3SDYH 4YQXH 2FCBA 1I9IL 2H45A 4NO5A 4QXGH 3PL6D 5IP4A 5D7IB 5GJTH 3VWKA 1ZHBB 2HFEA 4KK9C 3G9VA 4GRWE 4ODSH 2F8XC 4JDVA 4NQDD 1FVDA 5AZ2H 3ZSSA 3LDBC 4NRZA 1PQZB 5FYKD 3V4PL 1DLHA 4R8WL 4NJAL 3OSKA 4AEIH 3U46B 1M71B 2VISB 4LIQE 4PGEB 1NFIB 2APTA 1BWWA 2H9GB 1F58H 4Y19A 3X3GH 3LEVL 5INDA 3UTSA 1NAMA 3CFBA 4ZTPH 4YHML 5JOFA 4I5BB 2OTUA 4HHAB 4NYLA 5F96L 5DK3A 4EBQL 1A7NL 2F54D 1B90A 4HH8A 1WC7A 3WN5C 1EAPA 2ESVE 2YD9A 4QXUL 3NABH 1FN4B 1QLEL 3Q6GH 4ZUWB 1LD9A 4JFOB 1JGLH 3GRWA 4PJ7E 3EO9L 4UDTA 1NBVL 2FO4A 5FO8B 3O6FB 3QIWA 4R96A 3RDTC 2BY3A 1JPFA 4X9HA 1TZHA 2RB8A 1AKJB 3EYVA 2FGWL 3HE7D 2YRPA 4Q2ZB 1U95A 4U1JA 3EO1B 5JHDD 3ULVL 4HXAH 2XA8H 5C9KA 5I1JH 1K6QL 5EOQL 2WZPD 5DMIH 5IB1B 3CSYB 4LSPL 4WI9A 5F7YC 4OQTL 1N5AB 1BX2A 3TBYA 3IXAA 2ZUSA 4X9IA 2F8VA 5FO7A 3NIFE 3PUCA 4LQFH 5DVLA 4JKLA 5F6HJ 3ARXA 5HD8D 3S9DB 1BQLH 2R0ZH 3GSOA 3SE9L 1CLCA 4RAUA 4Q9CA 1RIUH 4FHBD 1JF5A 1P1ZB 3IF1B 4QGYA 1JGEA 4DGIL 1QBAA 2BVOB 4KPHH 1DVFA 5D1ZA 4ZO6A 1U3HB 1J1XL 5DRZA 1UH2A 1U8NA 1UCTA 1G0YR 4YPJA 3S37X 1CF8L 2KBGA 3QG6A 3OG4B 4RIRB 4DN4H 1ULVA 2GT9B 3QEQA 3FQRA 1JBJA 1IKFL 4NDMA 4UAOB 3F5WA 5TQ2L 4EDXB 3IDNA 4RGNB 5I18H 1P2CB 2G9HB 2OR7A 5F9WB 3AXLA 1JNLH 3BX7C 1OAYL 3RY6C 5DJCB 2NY6C 1EZVY 4PJHA 5KN5A 2GIYA 2D03H 4OD1H 1WFTA 4NNXA 3HZMB 5K59F 3UTOA 1BZ9B 3GMNB 2EIEA 2F53E 3MA9L 3EYUH 1NUFA 4X6BB 2GJJA 1FZMA 1S5HB 4X6FB 3IDYC 3RIAK 3PGDA 1ACZA 3T2PA 4G9DB 2WUCH 4KROD 1OARH 3KPMB 3TM6A 4N1HB 4OQ1A 3HNSL 3CDFA 4F7TB 4OZGB 4K71C 3CVHB 1FNGB 4LIQL 4LMQE 1QQDA 1X4ZA 2XZQL 1BD2B 2P5EA 4PLOB 4DUWA 4M7ZC 3RPIB 3TVMD 3QYCA 4JM2B 2PR4L 4UOJA 3MRKA 3PWJB 4IDLA 4POUB 2JJWA 2X4SB 3TFKD 3EHBC 4S2SB 4K94H 3QPXL 1F3DH 4Q6IB 4P2OA 2VDPL 1A7OL 1FIEA 2CK0H 4X7FC 4EI6A 3CU1A 2WUBH 4JO3L 4PREA 2O93L 4U3CA 4XC1H 1UB5A 32C2B 2NXZB 3P30H 4DQOL 2R1WA 1S8DB 1CT8B 1DQJA 3H2WA 4J3OC 3EFDL 4CDGC 1EA9C 1JHTA 1KG0B 1WCQA 1NPUA 4I3RL 3G6DH 4UT7L 1PW3A 3RWIB 1V5JA 2B0SL 5H35B 1P4IL 3I3DA 3CZJA 4NBXB 3NZHL 1A1OB 3MOBH 1VB9A 2EDFA 3LMJH 2NY5C 3MLPA 4HUWA 4LRNL 5CGYC 1T4KA 1EUUA 3FONA 3S3PA 3JV0A 4FXGA 3IFOA 1M7IA 3OXRA 1T1XB 4LCIL 5CIPB 5ISZE 3C60D 2DTML 4P9MH 3QHZH 4RAVB 4X98B 1JN6B 2VZ1A 4D0CA 1MFEL 4HLJA 3CCHB 3PDGA 2FRGP 1BOGB 4PRDA 4ZXBA 2ZP0T 4U0QB 2DTSA 4XAKE 4FQ2L 5E1AB 4GLRH 3MLTA 1MY5A 4HJ0C 4JG1L 5IM7B 1Q94A 4G7VL 2O5XH 2AJXL 5HYQB 3ILQC 4WHTA 4M02A 2E9JA 2ENSA 2VYRE 1G7JB 1I8KA 2X1OA 4D3CL 1CZ8L 4G8FB 4QRSA 2QADC 2AJYH 3VE0A 1CU4H 3IFLL 5FYLH 1NJ9A 1WT5A 2PTUA 4XNXH 5C09B 3JV5A 3UCRA 2IADB 4I0CC 5DSCB 3VI3E 4GMTL 3P0VL 5HDOA 4Y5VA 2GTZB 4WUUE 5IMKB 5A16A 1AR1C 2X4NB 4JB9L 2R4RH 3QZWG 1D9KD 5JO5A 4AMKH 5HVFB 5IW6A 3IETA 2DWEB 4F37K 5I1IL 4GAJL 1HHHB 4G42B 5FB8B 4PJGE 1DEDA 2G5RA 1WTLA 4F2MB 5E5MA 2ZUWA 2A6IB 2GKIA 3LKPA 5CSZB 1AGDA 1X9QA 1GGTA 3LKSB 5IB4B 1I7RB 1BJMA 5MENE 1Z9MA 4OLYH 4JZJB 3SDCC 2ZUQC 5CILH 3DX7B 4UIKL 4QRUB 2OXHA 2DQIH 5DJ2B 1JRHH 3RBGA 3MYJB 1BIIB 4LLDA 2HFTA 2VWEE 3MNZA 5E4EB 4DAGL 3H3BC 2YUXA 1U8OB 5DZNA 4NJ9L 1E6JL 1QFWL 5DO2D 2YPVH 3T0DA 4PB0H 2AABL 2IPKA 1DFBL 1AJ7H 3NGBC 3BZFB 4E41D 2PETA 4ZPVB 4FQXB 4BQBA 2CXKA 4P23D 3JTTB 2NTSP 3BPNC 1YMHB 1IAII 3QULA 5SWSD 3FFDA 2EH8L 5IVZB 2HT2D 4W4OA 5B38B 5GS0D 4QHKI 5I17A 2HG5A 2N1KA 4JM4H 1NGZA 3PJSA 4NC2B 4XP4H 1A6ZB 2JJSA 1XEDA 1PSKL 5FKPB 4LP4A 3F6LA 3FO9B 5A2IH 2NX5E 5I1DA 4CGTA 3EFFA 4I18B 5DVNA 1IGTB 5DWUH 4IRJD 4Y1AA 1VFAB 4TPRH 3KYOB 2HAZA 4PS4L 5F3BA 1KCUL 1FZJA 5BRZA 3MOQA 4M7JL 1HYRC 4F9PA 3B5TA 1T3FB 2D4DA 2BSED 1ZT4A 1U58B 1X5GA 4JN2B 4UT9H 5BJTA 1W8OA 3CU7A 1LO2L 4QT5B 3D87B 4DEPB 4ZNEE 8CGTA 1YEGH 1S78C 2EIBA 3F6IA 4PBWD 4OV6F 3VXME 3WFBH 2VIRA 2IAMB 3VWKD 5EORL 5IR1B 3UXFA 5CMAA 5D4QA 3DSFL 2D7OA 5C0GB 1UZ8A 2Q87A 4GBXC 4G8IA 3ZYIA 5HVHB 4X4YB 5DDHA 2VXSH 4N0FB 3QA3B 3VFVA 3ZKXC 3HMWL 3B9KC 2Z31C 3HC0B 3L5HA 3EOAA 4ODHH 2Q7YA 2JB5H 1NFDE 4Y19D 4KKLD 3KPNB 2NY1B 1ZS8A 5IFHH 2V2XB 5GGQH 1ZHKA 3WE6A 2OCFD 2OL3L 5JW5A 3FQTB 2K3TA 5I8EB 3D3VA 4P2CG 2HVKA 4PRHD 4GRLA 1QSEE 2EKSB 2LU3A 4IM8A 4HXBL 2B1AH 5HYJE 4N9GB 4WTWA 1EJOL 2P8PB 5GHWL 3ARUA 5C0FB 2X4OB 1J86A 1UH4A 4Y8DC 3I3BA 3CFCH 4PGDB 1I8IA 2XN9B 2R56L 4Y4KA 3QDJA 5DD6B 2J8OA 4KTYA 4XXCC 3ETBF 1DQLH 5GQBA 4XBEL 5CWSA 2WM0A 5DF0A 3UO1L 3KVQA 1KTKE 4LF3B 3QI9B 4AENB 1NEZB 1IEBA 2B7DT 2CK2A 1A6AA 4RMWA 3LKRB 1CLZL 5JTWA 4KV5F 1NMAH 3GSRB 1SJVA 1ZLSH 3V52H 3O11A 4TVPD 2ADFL 43C9B 1YMMB 2DLGA 2H3NA 1HXMB 3NH7H 4EUPA 2XKSA 1U2CA 1YEKH 5JW4M 4KDWA 4LSSH 4L5FH 4RX4A 2I9LB 2Q8BL 3NTCL 4G6FD 3F7YA 4DGVL 1N7MH 1IAOA 2I9TB 3SDXF 2VITB 1CE6A 1DVFD 4P59H 5D1ZD 5IMOB 5L9DL 1INQB 1MRCH 2VZOA 2BNUB 4FZ8H 3RWEA 4DOHB 2WQ8A 3W9EA 4FMFA 5DC0A 4M00A 1YEJL 1IRAY 3MLXL 2OK0L 3QEQD 4YFLI 4Y4FC 3AY4C 3OKDB 4I0KA 1UA6L 4XC3H 2HYMA 3QJFB 1QLFB 4F33B 3M8OL 5T1LD 1TPXC 1IKNA 2Z8WC 1RUKH 3FQNA 4U6XA 3RWFA 4XH2B 3WDJA 3D25B 2GITB 1YEHL 3C5SB 2DJUA 2AEQL 1U8LB 5KS9B 5DR5L 3PWNB 2GJZA 1J0JA 7CGTA 1LO5A 1K5NA 1RUPL 2CPCA 1DQDL 4O2CA 2EH7L 2NZIA 5FGCE 4PGBB 3GMOB 2Z8VC 3QWRA 4ETQB 3FQUB 2GFBB 4O51A 5C0EB 4GG8B 2Z93A 4QRPD 1MHEA 1L0QA 2R69H 2E3VA 1ADQA 2F19L 4NCC1 3WHXA 1GIGH 3GJFA 1CFTB 2AEPH 1EK3A 4XPTL 4PJEA 5IWLA 3D6GA 1EFQA 2IBGA 3VWJA 2NTFA 5E8NA 1A3LL 1FFQA 5HHMB 1OTUC 2VDOL 3JWOC 4LASL 3FAWA 2FATL 1UT9A 1IC4H 3RVWC 2X42A 3OKYA 1UJTA 5E2WL 2H8PA 3WS6C 5DZLA 4Z8FL 4YIQB 4JO1H 1D3CA 3MLVL 3HPJB 3KXFA 5KSBE 3HAEG 2FGZA 5CHNB 3PNWA 1MCKA 3MRFA 4LSTH 4NO0A 1FRGL 3VFMB 4WV1B 3FOMB 3V4PH 5D5ME 1PFCA 3WIFA 2OXGA 3O2WL 1E28A 3WEXA 3WCYA 1KSRA 3BMVA 1VGKA 3LEVH 4I77H 4P4RB 1KPRB 1SVCP 4Y88A 3T0EC 4YHMH 5H8DA 4PRPE 4U1LA 4KMLB 4G9FA 5F96H 1A7NH 2A9NH 1KXQE 1NANI 1HH9B 2BRQA 2E27L 4ISVA 4QXUH 4KKAD 4MNQB 4Z7VE 5JW4R 3GO1L 3EO9H 3TN0C 3K4AA 4XBPA 2E5EA 5C0BB 4E5XB 2AKRB 1QR4A 3FN0H 1IC5H 2YPKB 4PRBA 5GZOC 2FGWH 2O5YL 4KH2A 3JVGA 3ULVH 1S7SB 3QNXA 3NCEB 2OZ4H 2VH5L 1HYSD 2C4FT 1AQDB 5F6IB 3IDIB 1XGUA 3IJHB 1KNOB 1AIFA 3TV3H 4IS6A 4MX7A 3OKOA 2VXTL 1H0DB 2XFXB 1MF2L 3R1GL 4YHNB 5KSUB 1XGPB 4L3CA 5HHOD 2P8LA 2VN4A 3SE9H 3TIDA 3MRIB 4NQCD 3ZZ1A 1C1EH 1PKQE 3BW9A 4YBHA 1F6AB 2GY7B 4OAWB 4RRPG 5HYSG 1J1XH 3JUYA 5F88A 4B7IA 5FM4A 4QYOB 2P44B 5C6TH 1CF8H 5I2IB 3B43A 1ITCA 3LCYA 1Q0XL 5L2JB 3ULVF 3GI9H 1A2YB 2MHAB 4TNWF 3P0YL 1YECL 3E8UH 5EPMA 1TXKA 3ARBB 5D1XB 3DX6B 3EGSA 2DB8A 1J8KA 3C5JA 3V4UL 1J05B 5C0RL 3KYNA 3MGTA 5DYOA 1A22B 1OGAB 2D7TH 2DQGL 2NY0D 1NLBL 3N0PB 4P3DA 2CLRB 1ZGLP 4PJAE 4HIIB 5AD0A 5E94B 1HHJB 5F7NC 1L0XA 2LAAA 5IQ7L 1ZK9A 4X4ME 5I1LA 1P53A 5DMGC 4LCWE 5DHYA 5CZVH 1KGCE 3MV8A 3C6LA 4DCQB 5EU5B 1EFXB 3HNSH 4OT1L 3HC4L 4Q9RH 1DBJL 1X4XA 4ONHA 4HWBA 1W72A 3I02A 4M8QA 5HHPA 4PIRF 3VRJB 5L7XH 5DEFA 1RFDL 1MFDL 3KYMB 1I1YA 4LLMA 5MEPB 2VZTA 4HIJB 1OW0A 5C0CE 4WFHE 4JRXE 3SDAA 4CVZA 4LPVA 3QPXH 1Y6NR 3GMQA 1G0XA 4RMVA 2BCKB 2VDPH 2NR6C 1B6DA 5JUEL 2FWOB 2WAHA 3S5LA 4WW2F 3FB8B 4PP2A 3MV9B 3CFDA 3JWDC 4GRWF 4JO3H 3LD8C 4OCNC 4X8JB 1HI6A 2DLEA 2A0LC 3BEWB 4JFXA 3ZKMD 4FABL 4DQOH 2ATKB 3STLB 2CRIA 1HKFA 4H0IA 2V7HA 1ODAA 1XGQA 3QG7L 5TJWK 3EFDH 5E2VL 1OP3H 3WFHB 3WBDA 5IJKA 4X9BA 1KIRB 4I3RH 1YY8A 3V8CA 3WXVH 4C56A 2ATPA 4TSAL 4LLVA 3DRTB 1MHPH 4YDJA 4Y5XC 2AJVH 3NZHH 4L29A 4DJMA 4LU5L 2K7QA 3LH2L 3C6SB 1JWUB 3GBLA 3QQ9C 1KELL 4KKCC 3DHMA 2VR9A 5BRZD 2DQJL 2WIMA 1IZKA 4G3YL 4LRNH 5CD5D 2DM2A 1BJ1J 5FUZL 4PJ7F 2Q3ZA 3GSXB 4LCIH 4OF7A 4P2QE 2X4PB 1FE8H 3UTQA 1CVSC 2BHZA 3NCCB 4DK3A 2FJHA 2FIKB 5JORB 4KRNA 1MFEH 2X9XA 3HS0B 3OX8B 3TH4T 4FQIL 4X7TB 3RVXD 1HE7A 4JPWH 1R24A 4JG1H 3DGCR 4JZNA 4QNPE 4ZYKB 3CLEL 5C3TA 5DD3H 1JWMB 3MV7A 1YEIL 4RFEA 3JWNC 4G8GA 3O6LL 1YY9D 4QHMA 3UAJC 3OAYH 3NIFF 4MJ6A 4D3CH 2VAAA 5ABDE 1RZFL 3B9VA 3SDDD 4BZYA 5CBEB 2NQCA 3IFLH 1QEWA 2EYRB 4NUJB 4HAFA 1CGYA 4WFEE 2JELH 3GJEB 3OF6A 1KEML 1WQVT 3O41B 4L4TD 2HFFB 4MDIA 1HN1A 4JFQB 4MCZB 1JL8A 1F4YH 1HDMA 1FZOB 4PRIE 4CNIB 4L3ED 3T3PF 1ZV5A 3OPZL 2V9TA 5IW3A 1OHQA 1F2XK 4LCYA 3VXUD 1RURL 4JB9H 4G80A 1J7VR 2R1YB 3T77A 4K3GA 4Y4KD 4YXKL 1A47A 3CX5J 3AB0C 3DOSA 3QDJD 3LIZL 5I1IH 1EXUB 3SY0A 1DL7L 4KUZL 2ENYA 1JPST 3KR3L 1FBIL 1OLZA 3MUHL 4GAJH 5ENWA 4D9RE 2HTLD 5I8CB 4TUOA 2VSDA 2W0FA 1AY1H 5ANMB 5HI5C 4APQD 5GRYA 2C3XA 3G5ZA 5IMMA 3ZE2F 3BHBA 3P4MA 3E3QC 5A2KH 3EYFB 5EBWB 5D70L 3S37L 3V4VL 4Y16D 4MDJB 3HNVH 2FZ3A 3TGXA 5FV1L 3MJ8B 2DLIA 4HS8L 4H20L 4DGYL 1NFKA 1G7QA 2C3GA 4JFDB 3UYOD 4I8DA 4H26A 4RX4D 1RK0A 4UIKH 2IJ0C 3F65A 4JO4L 1E4XI 4B50A 3KLHC 4M03A 4P2RB 3HZVA 3KPLB 4LRIC 2QL1A 3OJMB 3ZYOA 4NJ9H 2ED7A 1E6JH 4LAJH 4YEEA 5D7LD 4ONGL 3CC5B 5B38G 3BIAX 1IAIM 3D39E 3IGAA 2Y72A 2AABH 3L7EB 3O2VL 4U2ZA 3X11B 2VLJE 4NWTL 5JMRA 2W9EL 2HJLA 5I76A 1TJIL 3FB5B 4RMTA 1JZ7A 4X99B 1CBVH 2VQTA 3O45B 1R3IL 1BGXH 2PW2A 4ORGB 2EH8H 4JREB 4MAYA 4ZFFA 4FN0A 5L6YH 1X5FA 4Z95H 1V3MA 1CD1B 4V1DE 4OTXL 3FN3A 4NGHL 3DV4A 5E00A 2DL2A 3PABB 2JIXD 4CBPA 3MA7A 4AIZB 3QWRD 1QRNB 3KPSB 1UH3A 1PSKH 1KCLA 5GGVY 5D93C 1VSCA 5B21A 1NCCH 2FX9H 3LV3B 1CICA 5FYJL 3LZFL 3MRQB 5HGHB 3KJ4B 3SGDH 5BCAA 2VE6B 4WI4A 1CD9B 4R6UA 1I1AA 4Z7UF 3IXTA 3E1F1 1T89C 3M17B 1FFPB 4NZRH 2AJZA 4PS4H 1KCUH 3PQYA 4PJIF 5F7DA 4M7JH 3VXSD 1X6LA 3B8SA 4XB8A 3TZVA 3RZCA 3AS3A 3ZHKA 3VWJD 5FXCH 3WNPA 3KGRA 1IQWL 2NW2A 4JFEE 5KZCD 5IEHA 2BVYA 3BP4B 3C8KA 5TE4L 4HG4K 4LP5A 4NZUL 1T0MA 3QUZC 5EORH 2K7PA 4L4VD 5JOPD 4XHJC 1AO7B 1ZANL 3DSFH 4JY4B 2ZCHL 3D5OF 4NO0D 1X7QA 3NFNA 3V95A 5CAYB 4PJBA 1BP3B 3KLAA 2JB6A 5DJDA 3HMWH 1QFPA 4TUKH 1EEYB 1N59A 4MQ7B 1BFTA 1DBML 1VFOA 5ALCH 2ZCLH 2VL4A 1MLBB 1M05A 3R0MA 3RNKB 3T2OA 1S7XA 5C0AA 1LE9A 1U0QA 5ESVA 5IK3B 4G9FD 4HXBH 1MVUB 2Z92A 3H3PH 3BH9A 4F7CA 3GMNA 4TSCL 3VI3F 2HP4A 1KIUA 4X6BA 3FZUD 5DJAA 5DURD 4RMRA 4M1CC 1JZ8A 5EU6B 1EUTA 1EPFA 4OI8A 3SJVE 1A1MB 3AU1A 2VN7A 3L3KB 4AYFA 2DQCH 3O0RL 1MH5B 4HFUL 25C8L 4M7LT 3GBMH 3U48A 4XP5L 4WO4B 2R8SL 1KJMB 1GL4B 2BMKB 3BGFC 4MA8L 1II4E 5EO9B 3K4ZA 4XBEH 4PJGF 2AP2A 1GHFL 1U41A 4J3TA 4HIXH 1ERNA 4R0LC 3T09A 3HI1A 4FXLA 4GRWB 2XICA 1R5WA 4K8RC 1YDPA 3BSZL 1PZ5A 1AHWA 2JK5A 3T0BA 4XP6L 3IU3A 4JPKH 5LBSL 5EOCL 3BT2L 4Z7OE 1WUNT 2AJ3A 1BBDL 4PUBL 4YX2L 1ITBB 4H25A 3NTCH 5KANI 4JFHE 2XOTA 3PL6C 4DGVH 3G6JA 1WWAX 4BYHA 1YUHB 2VR4A 4GRMA 4YHYB 4NKDB 1RJYA 5BO1L 1ED3B 4ZFOA 4ELME 3KPRB 3QIUD 2J8HA 5IF0B 3MZTA 5F7WC 1FNEA 4OGYL 5F21B 2VXVH 3MLXH 3PP3K 2OK0H 3QBTB 2ESVB 1KCKA 1WCBA 4U3XA 5C92A 4OZHF 3QFDA 2QQKL 4G7YL 4JDTL 5DQJB 4PJ7B 3M8OH 5DQ9A 1DN2A 1Q9KA 2VL5A 1J0KA 1T04B 4K9EC 3E6FA 5E1HB 3ARDB 4EXPX 1X6NA 1YEHH 1NBZB 2AEQH 4IMLB 2A38A 5DR5H 3OR7B 1SY6A 5E4IA 3T0EE 1G6RA 5EBLB 3IVKB 3O3BB 1DQDH 4LLUA 4F58L 2DIJA 4MJIA 3UC0L 1PDKA 4RISL 1X4YA 2DL9A 4PYGA 1J1PH 3GKWL 4RAVA 3MV8D 4HIEB 3RWDB 4NKIH 3FO0L 4GXUN 2Q8AL 4JY6B 2F19H 2AV7B 3HE7C 1NSNH 3BKJL 2EIZB 5C0DA 1XF5B 4LBEA 4GKNB 4M6NH 4MB5A 5C07D 3S36X 4Y4HA 3FTGB 3MFGB 2DQDL 2ED8A 4PFEA 3V6OC 4RA0C 1FL5A 4WW1B 4C83B 5I15L 5F72S 2VDOH 4EQ2A 4P9HC 4RWHA 4XCYA 5F9JB 1IZJA 3C09B 5HD8C 1W8NA 4Z8FH 4OF0A 2L7UA 1L6ZA 3MLVH 2C1PB 3MUJA 4XNQA 5FAAA 4K8RH 2KZWA 3FMGL 1S7UB 3O4LD 4BSVB 4W6YB 1CR9L 1UYWL 3O2WH 3TO4A 5EC2A 2F53B 5FHAL 1NFDF 2IQAB 5E8EB 5DJ0B 5IG7B 4E42A 4FNLL 4OZIA 1WWWX 1IGCL 3MBED 3DROA 4DZBA 3STBA 2BX5A 4NHCL 3WO4B 5FYKH 3QCTH 2HN7B 3PWPE 4ZAKB 1NGYB 2B1HL 4A6YH 2PXYA 3GO1H 4QTHA 2FEDD 2YZ1A 4A2MA 5IHLB 2VZVA 5J06A 5EZJB 2A6JB 2XQBL 1U92B 4LFHD 4ODXB 3AC0A 3RU8L 1AD0B 4KROC 4MLSA 4DN3H 1C5BL 4GG6E 5C3LD 1B88A 1IAKB 1IM3B 4R9HA 4D0DB 1W0WA 2DQUL 1I3RA 1S9YB 1LEKA 3P11H 3P9MB 4ZSOE 2ED9A 5J13C 1IGJB 3BDYL 4G8GD 1N5YL 5LAXB 4EN3D 3TVMC 2X4TA 3UYPA 2VXTH 4F15B 4JG0L 4LSRH 3R1GH 3TFKC 1L7IL 5J1AB 3D0VB 1SBSL 2CGRL 5DZOA 2XWTB 5KSAA 1NMBH 5KOVC 5JNYA 2KL6A 4YDLC 2DMKA 5A2LH 1D7FA 1H5BC 2FYYB 5HGBA 3ROLA 1PEZA 1SYSB 3QHTC 4S1DD 3SCMA 1G9NC 4TYUA 5DVOA 2B4CC 4EUPG 2CKNA 4U4BA 1A6ZA 1BVKB 3TBVB 3WKML 1HXYB 4ALAL 1Q0XH 4P9HH 2AK4A 5E8PB 4X6DA 2J6EA 3BD3A 5TPWH 3O9WB 1CGUA 3OXSB 1I3GL 4JJHA 1CWVA 1JF1B 1EH9A 4X83A 1KB9K 1TIUA 3AS1A 5ISZB 3VFWA 1P4BL 1WWCA 1N3NB 1IM9B 3V4UH 1EMTL 4HK3N 3ZE0E 1U91B 4TQEL 4UQ3B 3TCLB 4ZDHB 3BAEH 1UXSA 2DQGH 2EDKA 1XIWB 2Q1EA 1NLBH 3F12A 4BZ1L 2Z91A 5IVXE 2JTDA 1JPSL 5GRJL 2Z35A 3VI4F 1MIML 1KT2A 1L7TL 3VH8A 5IQ7H 4ZS6D 5DEZA 3C60C 1T83C 1XGTA 1VA9A 5EO0B 2NXYB 5F3HA 4HKBB 1GGIH 4OT1H 1UACL 4Z5RA 3HC4H 4FS0A 2JLLA 3MNVB 3HZKB 3QDMA 1DBAL 1DBJH 4PJ9B 4ZUSB 4R7NB 1D5MA 3QUYA 4O9HL 2MTPA 1J9CT 4BUHA 3WS3A 3QB7C 1A5FL 1MFDH 1RFDH 1S5IL 1T1WA 1CQKA 1FZKB 4I2XE 4HJGA 5CEYB 5IHBA 3GEWB 2OBGA 3RL1A 4WUUB 2MQ3A 1KLGA 4BZ2L 4KK8D 4K3JH 2YD1A 4JPIB 5E03A 2XZZA 2D0GA 5INCA 5J11C 4MAYD 5KSBF 4UU9A 5GGRA 2CIIB 3GSNH 5HGAA 4FABH 4PJGB 3OKKA 2X1XR 4HFWB 4L8SC 1FFOB 5DTFA 2HWZL 3HZYA 1OSZB 5D5MF 5E2VH 2OL3B 4R90H 3U36B 1SJEA 2NNAA 5HY9B 3ESUF 4NN6B 2OM5A 3K3QA 2GK2A 1D9KC 5MENB 2OJEA 3P3YA 1T0PB 4TSAH 4FTVA 1AKJD 1CICD 5FOBA 2YD2A 4N1CA 5IBTH 1ZAGA 5LCVL 1I1AD 3DURA 3IS0X 4LU5H 5ACZA 2B4CH 4MWFB 3LKRA 1MCDA 5DJ8B 3PQYD 2D4FA 4HPOL 1CLYH 4G3YH 2CD0A 1UEMA 3RZCD 3EDFA 4Z7VF 4X80L 5KOMC 2I07A 5FUZH 3L9RB 4P46B 4M5YL 3THML 2YD3A 1CFSB 2Z8RA 3JTSB 5IFJA 1GAFH 3ZKND 3FT3B 4WVRA 1HHIB 1A21A 6FABL 1TCMA 4FQIH 3W5MA 3MLZH 1F3JB 5C9JB 2EICA 1CFNA 3P77B 1M7XA 3CLEH 3BPLC 2UZXB 1W0VB 4U1HA 5I9QB 4B41A 4X5WA 4NNPH 5T3XE 4M1DL 1T5WB 2JJTC 3TT3L 3O6LH 2AVGA 4MD5A 3CFJA 4YDKL 1RZFH 2Z8SA 5D9SB 4CVXA 4RGND 1NGPL 2BDNL 1T20A 4DVRL 4P23C 4WDIB 2B2XH 3HMXL 4RQQA 2MPAL 5C0AD 2NX5B 2LE9A 3AAZB 2HH0L 1G7PA 2GTWA 3FQWA 4OB5L 4XRCB 4ODWB 4OLVH 2HT2C 4OCRL 3IS1X 4UQ2A 3PDDA 1FO0L 5GS0C 3K2UH 4X0KB 3OPZH 3LHPL 3W5NA 3LEYH 4ETQA 5FA3A 2ZCKH 5HJ3A 1RURH 5C6PB 1DDHA 4WY7L 1GZPA 3CFKB 2V5YA 3T3ME 3FJTA 4D94A 1FP5A 4KUZH 1FBIH 1DN0B 3MRDA 5I30H 4IRJC 3MFFA 2BJMH 2YXMA 3UTTE 3U9PH 3VXMB 4JFPB 4EI5B 2AV1A 4HZAA 1ZT7B 3MUY1 2P1YA 4GAYB 4P3WA 3S37H 4HUVB 5D2LA 5AUMA 1JYNA 4HS8H 1P4LB 1H3PL 3CFEB 3MO1A 4G43B 4I0PA 2D7QA 3RBSA 3GIVA 3ECBB 5CJXC 1R5IA 3DX8B 4PY7A 1ZHNA 1FSKC 1NFDB 3VWKC 2OI9B 2ZOLB 3DVIA 2NXZD 2IPUK 3NBNA 2EO9A 1U8PA 2PN5A 1ORSA 4K7PX 4P5MA 3ZHLA 1LNUB 5FDWB 5BZDB 5EWIL 5HGDA 5EUOE 1QSEB 4KMTL 4UBDD 5DK2A 5HYJB 1LEIB 2DQTL 3BP6A 2IF7A 4X6CE 3ET9F 3QUML 3WIIL 1DANU 2W9EH 1RU9L 1AGEA 1JZ5A 4K2UL 2BNRE 4KKLC 5E6IB 5JPNB 1QPPA 2YA0A 1U8KB 2BVTA 4LLWB 5DHVH 1A1NA 2P8MA 3I6LE 4OTXH 2DD8L 1S7TA 3IJYA 5CCKL 2W1NA 5DXWA 3H0TB 3MUZ1 4UDUB 2D31B 3JV6B 2BVEA 3TBWA 2CKBA 3S5LG 1AC0A 2R4SH 4OFPA 1WBZB 4MYWB 1IGFL 3MNWB 5FYJH 1UKSA 5F8RC 3LZFH 3MODL 2G2RA 1S7WB 5J9PA 2J4WH 1EHAA 5GS0H 1MWAB 5T3XL 3U6RB 2BNQA 3QAZB 1XCQB 5F1IA 1VEMA 5C8JA 2ADGB 3V5HB 2Y5EA 1Q9LA 3FOLB 4DTGH 3UPAA 4P4KA 1QSFA 2P5WE 3NZ8B 4XMKH 3SE3A 3PWLA 3EDDA 5TE4H 1IAMA 5KG9B 3NAAH 5C09D 2IMMA 2R2EA 4I9WD 4M43L 4NZUH 3LDBB 2FNBA 2XWBA 2IBBA 2J8UE 2Y4SA 3MUGB 3H9SA 5BVJA 2C7UA 1DVFC 3BWAA 1A0QL 5D1ZC 4AIOA 4QNPF 3LY6A 5FYKU 5T33H 4NCDA 3QXAA 2DJ4A 4MA3B 1ZA6A 4GMSL 3MC0A 3CUPA 2C3VB 3QEUB 4CW1B 4NQDE 3RVVD 4AL8L 5FGCB 1DBMH 4KAQH 4HZLA 2CUHA 4ODUA 3WN5B 3BP5B 4QRQB 2NY4B 5F44A 2NY3D 5CEXA 4NN7C 3WIHL 3QRGL 4F57L 1F11B 1YQVL 3OBAA 3NCYS 2R23A 3BGMA 1HOCB 5IHZB 4YUEH 4TSCH 1HNGA 1PJ9A 3FRPA 3WO3B 3RDTB 4KJYB 2PXYD 3OMZA 4XBGB 2YKLL 4IBLT 1J0HA 4DKFH 2VXQL 4ZD3L 2F54E 3O0RH 3QNZA 4YHIB 4HFUH 2GK0A 1A14L 3MROB 2R8SH 3H9YA 4XCCL 1XGYL 1BZ7B 1D5IH 2AGJH 3RUGA 4Q6YA 5IIEA 1GHFH 1CN4A 4QTIL 1FC1A 5KSBB 1YN7B 4FQJL 4HIJA 3QEGL 1X5HA 1LO3H 4P5TA 4XP6H 2CDGA 4BKLB 4HX1B 3BKMH 4FQXD 1TTGA 4LLQA 3BT2H 2LABA 3OHXA 4FQHB 2ADJB 1ZKAA 1CGVA 2ADIA 1N0XL 3OTTA 4PUBH 5D5MB 4XP1H 4YX2H 1U8IB 1K8IB 1CK0L 1XT5A 5EZIH 4PG9B 3L5WB 5DQDL 1KB5H 3RIAF 3NCJH 4Y2DB 1O0VA 4HS6B 5FOJA 5BO1H 3QUKB 4U1IB 2ITCA 1F13A 1XMWA 4TVPH 4UTAL 4PRPB 4S1SL 4NSKB 3EOTL 4PV9B 4YH6A 1U3JA 4Z7VB 2OQJB 4JDTH 2QQKH 1I7ZB 1TQBC 2NY6B 2BOCB 1YJDC 1L6XA 1K4CB 1RJLB 1LGVA 5JW4Q 5GGVH 1MHCA 1HKLH 2YN3A 4D2NA 3SDXA 1U36A 5GJSL 3IDYB 5J89A 3LKOA 5BXFB 3ZT6A 3T8XB 3VFTA 4KKAC 5H37G 4F58H 1B2WL 2NY2B 3TESA 1EGJL 4RISH 2B5IC 1AR2A 1KJVA 1AQKL 3PWUB 5EG6C 3FO0H 4JRYE 2Q8AH 4JAMA 5DHXB 5GGTL 4ZYKA 4JVPA 3QUYD 3BKJH 1PKQB 1KYOK 2CMRL 3VCLA 2N7BA 1HYSC 2DQDH 3HPLA 1EO5A 2VDMH 4XCEA 2AJUL 5F9AC 2VDRH 1B4JH 3DGGB 5C6WH 1G7LA 2EDXA 2IFGA 3U9UA 1KLFA 3WNNA 1Y0LA 1CGXA 2X4RA 3QRFM 1OD7A 1YNKL 4HDIB 1JJUA 2HFFA 3OJDA 3PP4L 1LDPL 2WIIA 3VGDA 5IBUB 3OAUL 3D0LB 4W4NA 4A2LA 2X09A 5EIQA 2MKWA 2C1OA 4ZQKB 5HDLA 1CR9H 1UYWH 4O4YL 5EDXA 4FZEL 2XN9D 1IGIH 1NCBH 3QJHA 4LCUB 5FHAH 3MRMA 3NIDE 1HHKA 4PJAB 3RY4A 3B9KA 2Z31A 2V5MA 5E8DL 2RAMA 3QI9D 4ETYA 1IGCH 4LCWB 5L8JB 4NHCH 2FJFA 2VZSA 4KQ4H 1QSZA 3GJFK 1PY9A 3RX8A 4WCYH 2V2TA 5F1NB 1MAKA 2NY0C 1YMMD 4QY8B 1EVTC 3J7HA 3HR5A 3Q5TA 2GYSA 2AEWA 3WFEL 1KTDB 3OV6A 1Y6KR 3SPVB 5I19L 2XQBH 5C0CB 1DQTA 4JRXB 3RU8H 2QKIB 4U1GC 3W2DH 5I73C 4TULL 3NCYP 3WNLA 2BSSA 1CG9B 3LN5A 5CEZL 1SVZA 4JHWL 4NPYB 4LSDA 3WKNA 1JI2A 1T0NB 2DQUH 4WUKL 5D8JL 1IAIL 1EO7A 2ZOKA 3B9AA 4LEOA 3BDYH 1PZUB 1JGDB 1GGCL 4NRXA 4Z7OF 5CD3B 3TT1L 4J2XA 4JANB 2EDNA 1AI1H 4JG0H 1O7VA 1CFQA 1L7IH 2CGRH 12E8L 5IB2A 1ND0B 3PDOB 5EIIA 1P7QA 3FRUB 4U1MB 1A9EB 1DQML 2A6KB 2QHLA 3E6HA 4W4OC 1R5VB 5DJYA 1MFNA 5FA4A 3L3DB 5C0IB 3ZKMC 5JPMA 2I5YL 5HDBE 4HT1L 3WKMH 4ALAH 4MA1B 1ZGLM 2VLRA 4X7CC 3VXOB 5SX4I 1VERA 3F7VB 2XNAB 5EC1A 3TA3A 1I3GH 3RWCA 4E0RA 4CMMA 2VE6A 3MLYL 4Y4FA 4P2QB 1T22B 4OFIA 1S9XB 2MJWA 3KNBB 4KZDL 3F58L 3O4OB 5HHQB 4TQEH 1A4KA 2EYSB 2MOVA 2CLVA 2VLMD 2ZUQB 4BZ1H 4KTEL 1OLLA 5CD5C 1JPSH 1LP9E 3JXAA 3NA9L 5GRJH 5JDSB 1Z0NA 1MIMH 2VJXA 3CPLA 3VXRE 1L7TH 5TDPA 3ZTJH 4EDWH 4HIHB 3STZA 4LDLB 5E8OA 1I7UB 4I0PD 2ARJA 3REVB 4LK4A 2IH1B 2FHFA 1VDGA 3Q6FB 2OZ4A 1J0IA 1RJZB 3UJIL 3E0GA 4FQ1L 1ZSDA 2ZNXA 3I6GA 1DBAH 1G7MA 3D69A 1UVQB 3OAZK 3RVXC 3BPOC 3C9NB 2DQFB 4KXZI 2W60A 4DK6A 5DD5H 1A5FH 1S5IH 3LVEA 2A9ML 3BPNB 4ZMAT 3ZDYF 4PRIB 3U7YH 4JQIL 2A1WL 5I16A 1YY9C 4HKZA 1LEGB 2X7LA 4BZ2H 2E6PA 3QO1B 1DEEB 1WITA 5HI3D 2PYEA 3SDDC 1QR1B 5FYJU 2PCPA 1M6OB 4K7FA 3T0VA 1DE4A 4EVNA 4E41E 2Q76B 3X13A 1FNLA 5DMKA 4PJCA 3UTZA 3ROOA 2IPTH 1A7PH 1DSFL 3D18A 5K9OB 1K9TA 4HWUA 2XZCH 5C0BD 3S36L 5K33A 5D6DA 2YBRA 3KPQA 4N8CL 1E0OB 3EJZD 2CJUL 4R7DA 4XWOD 5FUCE 1D6VL 4Y4KC 4ZPTA 4LVHB 2DWDB 3LQAC 1FVEA 3UZEA 1RUAL 2HTLC 3U2SB 2W92A 2ID5A 4IHOA 3VFSB 3T1FA 4WW2A 2BNQD 4APQC 2IBZX 7FABL 4HPOH 3OB8A 5TGBA 3U30C 2CQVA 4LVEA 2VSCA 2XPGA 3QHFL 1FV1B 4X80H 4Y16C 5BS0E 4P4KD 4M5YH 3QWOB 2C26A 3DX9B 3N50A 2HKFL 4ZUUB 3CSBA 4XVUD 3D39B 2XZAL 4GBXB 4I48A 3UP1A 1KIPB 2VLJB 3VGAB 3HG1A 4J1UB 4GG6F 2EC8A 4F7EA 3T04D 5BV7C 4JFYA 3H9SD 1NDGB 3KPRA 1YNTA 1QKZL 1IEAB 3MRCB 2OTWB 1RZJL 5CP7A 4M1DH 4V1DB 4GXVL 3VA6A 3MRPA 3TT3H 3BIKB 1YQ2A 5DQJA 4XGZB 1JMZA 4YDKH 3M1BA 1NGPH 2CUIA 3N9GL 2VXUL 4DVRH 1S7RB 3ARBD 5D1XD 3SKMB 3DVNB 4HWNA 3HMXH 4G6JH 2MPAH 2FX7L 2V2WB 3B3IB 2H26A 4OB5H 2DYPA 5AYQA 1I8MA 2HJFA 4Y19E 3PE9A 3U0PA 3UTSE 3MJ7A 3VXNA 2H2PD 1ES0B 3VXTB 1TQCC 4OF3A 4R3SA 1GGUA 4WY7H 3T0AA 4K23L 4NOFA 2E7MA 1F3RB 4EXKA 5T3ZE 4AQ1B 5D2NC 3FHAA 4JFEB 3RTQB 2EDDA 4NNYA 3WHE1 2JCCF 3CDGA 2C4FU 3ZE0F 1Z9OA 3RIFK 2V7NB 4HAGA 4N0CD 1XFPA 5SWQA 3TCXA 3MCLL 4M7LH 1JNJA 4RA3A 4P5TD 3Q5YA 5C7XL 5D71H 3K7UA 3VWJC 5JW3L 3RVUD 4KDTC 2E7LC 1H3PH 5FCUH 4ODVL 1FL3A 2Z0BA 3MREA 4Q0XL 5CJOL 2I60L 4YAQB 2JKXA 1KN2H 4MB3A 2ERJC 3FT4B 8FABB 1UWGL 3IDJB 4U0RC 5JXAL 1RUMH 3ZLQC 5ACMA 4U7KA 1BVLA 1UKTA 2DQTH 2HVJB 3QUMH 1AGFB 3SKOB 3WIIH 3NPZB 4WI8A 5CJQL 3MLUL 1RU9H 5MEOA 5E6YA 4ZFGL 3BZEB 2AXGB 1I9JH 2CRMA 4MZ3A 3SJVB 3HCVA 2RIKA 2AI0L 2ZSVB 3QEQE 1ZMYA 4DKEL 3BEVA 2AQ1A 3RHWF 1CS6A 2DD8H 4YC2B 1DTUA 5CCKH 2QLVB 3P4NB 3ZT7A 1IGML 3NPSC 3FZUC 2ZUYA 4HKJA 5DT1H 3MYZA 1S3KH 4YE4L 4PJHE 3ISWA 3OKEB 4JQXC 5F7KC 3GB7B 3VFOB 1IGFH 1QD0A 4JCMA 1MCFA 4K7PY 2FIRT 3I75B 3MODH 3IFNL 1FJ1B 4HGWA 5EB9A 2DQHL 1EV2E 3P9MA 4GUPA 4YJZL 2BVPA 4P5KA 3HN3A 5HHNA 3AMLA 4NQUA 3GSWA 3QXVA 3UMTA 4C57C 3NCMA 2CXGA 3V79C 2R15A 4ELMB 2L7JA 3BVNB 4RGMC 3TP4A 2EXWD 1SYVB 3KPPA 3HRZB 5GSVA 1SJHA 1Y6MR 1Z5LA 2P5EE 4M43H 4M6OL 2ZUXA 2UUDH 1FG2A 4ZUTA 1S9WB 1UM6L 2A77H 1NAML 1WFNA 4KQ3L 4QF1B 4UNUA 4HWZA 4OCSL 2FBJL 4Z7UA 1AP2B 3RX7A 4OFDA 1A0QH 5EU7C 4U7MA 5MERA 2UV3A 1IGYA 5E70A 4PJIA 4EIZC 3BQUB 1JF6A 5T3ZL 2EE9A 1C08B 2RQ8A 5ESQB 3T0EB 4AL8H 2W59A 3I9GL 3WUWA 3DPBA 2XI9A 1CVRA 1HIMH 2VLLB 3WIHH 4F57H 1YQVH 3E2HB 3EIFA 4J7RA 3TN0B 3LQMA 1H3TA 1WZLA 1BVZA 5IEKA 3FQXB 1RZ8A 3OB0K 4YWGL 1CGTA 4RMQA 2FR4A 3UPRA 4JFDD 4NN5C 4HK0A 2VXQH 2FB4L 2VDQL 4ZD3H 4NKMA 2BVQA 1TETL 4P2RD 4X6EA 2GSGB 3VJ6A 3NN8B 4XCCH 1XGYH 3QQ3A 2WINA 5IFAL 4CRPA 3MXVH 3GMPA 1J18A 5EBMA 3L3JB 2GW5A 4L8BB 2QQQA 4QHNB 2IQ9L 1D5XA 3QEGH 5AEAA 4H88H 3NOIA 5C08A 1OW0C 3BJLA 5BOZG 3DXAA 3TBTB 5FFLA 4F7PA 5AZEL 4HPYL 2BY1A 4NO2B 1CK0H 4PJXF 1G84A 3WXWL 1WAAA 4KVNL 1J1OL 5DQDH 1P7QD 1V3JA 4NZJA 5FDYA 3DVFA 4JZOA 5HVGB 2MCPH 4ONFL 5GS2D 4OM0H 1MIEL 3DWTA 4HFWA 2DS4A 4LRIA 3MRGB 4UTAH 3KPSD 5EUOF 1D5ZA 4S1SH 4TUJB 3BXNB 1RSFA 2H32B 3HC3L 3R0NA 2VLRD 1ZVSA 4OCLC 4CKVX 2C3HA 2IALA 3PWPB 2EDOA 3DUUA 4LHUB 1YEFH 3TA3D 5FECB 5ICZA 1I1CA 5E95B 4ZS7H 5BQ7B 2YRZA 4QOKB 3MMEA 3TJHD 4OLWL 4WFFE 3WLBA 3MBEC 3TPUA 1MRFL 4GG6B 2DQEL 4MNGA 4ODTH 1NLDH 4K7PL 4XI5D 4ZTOL 1JNNH 4OGAD 3X14B 1A6TA 4XVJL 5T5NG 4KK5D 2X4QA 1WBXA 4ZSOB 5D1QA 3ULVD 3B2VL 2FEDC 2ZSWA 3UYRL 5E56A 4OZHA 1RPQA 3HI5L 1AO7D 2G75B 4UIMB 3GHEL 5GGTH 3CMOL 1OQOA 1S7QA 1KLUA 3L7FB 1EBPA 2CMRH 4BFIA 5B8CB 1ZHLB 4OCYL 5E9DA 4NQSB 5IBUG 5SV4A 4KHXL 1JTTA 3UBXA 1TZIB 5H94A 4AT6B 2AJUH 1HHGB 3IRZA 3SKNA 5DRWB 1JZ2A 1CLOL 1Q8MA 1IT9L 4EN3C 15C8H 5IV2A 2CDFA 4NM8L 1NC4A 3LD8B 2PYED 1J0ZA 1JFQL 1YNKH 1YYLL 5CINL 2EDLA 2HLAB 5T1DL 1MCEA 3T0XA 1MLCB 2C5DC 1LDPH 4C4KO 3V0VB 3QUZA 3OAUH 4S1DC 4BSJA 1W2KT 5EU6D 1WJ3A 4HLZG 4FXKB 4O4YH 1RIHL 4Y5XB 3RA7H 2VUOA 1FQ9C 5D72L 1BREA 3U0WL 2BSRA 5IVXB 4WO4D 5ICYA 1VACA 2H1PH 3ZTNH 4AH2B 2A73B 2LAGB 4RSVA 3KPOB 3GFUA 5I66B 1FO0B 4UV7H 1OQXA 2XIDA 3C5ZB 4HG4J 4N8VB 3TYGH 3C87A 1E4XL 2IANA 4WU5A 1OP5K 3BOVA 4Y1AE 1CGSL 1FVCA 1IC7L 3CD4A 4HF5H 1GC1L 4LKXA 5CJBA 3KWWA 3K0WA 4PYHA 4OZFH 3WFEH 3GZKA 5DRNA 3QIBA 5FKAB 4BK4A 3EOBA 5BRZE 4I2XB 5I19H 5TFSL 5KBNC 4ZS6C 3VD4A 4JDZB 1LE5B 1CTOA 5DUMH 1MUJB 4TULH 4QRRA 1L0YA 4Z78A 3OWEA 2GSIA 3RWJB 4JHZA 4FP8L 2VKWA 5CEZH 5T1KA 4JHWH 4KC3B 3KPRD 4BH7A 5ITBL 4ACPA 2UY7A 2J3SA 1FIGL 4BQCA 3TNNB 5D8JH 1FPTH 2EZ0D 2B39A 2P5WA 4R0LA 4Z7QE 1UQSA 1XR8A 3H7BB 5D96B 2VABB 1TJGH 5GGSB 5LWYL 4YZFE 3TT1H 4FMKA 3LEXB 4OD2A 2Y7QB 1R3JA 3T2NL 1MI5A 3KYAA 1AD9B 4KK8C 3FO1B 12E8H 3ARDD 1XR9B 4QHLA 4RWYH 2DYPD 3N1MC 4XX1G 4DKAA 4MAYC 2DBJA 1DQMH 43CAB 1F8TL 1JPTH 1HILA 1A6PA 3GNMH 3QH3A 4NWUL 4XCNA 1ZLWH 3L95A 2AK1L 3DO7B 3D3VE 4NQDA 1HH6B 3DV6B 4NO3A 5D7KD 1N64L 3RWHA 3KDMA 2YK1H 2QBWA 3I6KA 4PJDF 1I4FB 3HE6B 3MLYH 4A6YA 3U7WH 1CICC 4K3DL 3ZDXF 3D9AL 3F58H 1I1AC 1HEZB 3QDJE 5DS8A 3TLRA 3RFZC 5DC9B 4R2GC 3X12A 5I1CL 5IMLB 4M93C 3MLRL 1QFHA 3RZCC 1VFBA 4PJ8A 3RGVA 1A7QL 3ARTA 5IT2H 1B0GB 4NBYB 5LQBH 2R1XB 4H8WC 5IB3B 3UJIH 4KI5C 3ZKNC 4PY8J 5BMFL 2UWEA 5I1KH 4D9LL 1KEGH 3ES6A 3GUTB 1CXEA 2BOBA 3CH1B 3VXQA 2KZ1B 3CZFA 5KVGH 1KTLA 5LXGL 3HE7A 4Y5YA 1T21A 2A9MH 5JHDA 2F53D 1JVKA 5GIRB 1CXKA 2YC1A 3W11D 2A1WH 4J8RA 1G7HA 3CVIL 3V6OA 1M7DB 4I3SL 1JPGB 2RBLA 1BBJB 1F00I 3Q5OA 1DBKL 4RGNC 2OSLB 1CFVL 1I1FB 4W68A 5JW4N 3V5DB 2LQRA 5JQHC 1JNHB 3LSOA 3LRGA 2XT1B 3CAFA 3VFGH 3H7LA 1JTOA 4GW1B 1DSFH 1LWRA 3UTTB 5I71B 2NLJB 1YYML 3EOYG 1TVDA 2WW8A 2X89D 2B8OT 1MCIA 5DVKA 5GSRB 4N8CH 3IDGA 4U6YA 1D6VH 5MEQA 3NIDF 3GGWA 5C0JA 5GS1B 4R97B 1VEPA 1NGQH 5D7IF 1HQ4B 3R06A 1K2DB 4LVNC 1H15A 5I1AB 4D0BA 2F8OA 5JLZB 1AGCB 2IG2H 1FYTA 3EYOA 2YD5A 5F9OH 5ID1A 7FABH 4UOW1 5ETUA 4JKPH 1BFOA 4MA7H 4QCIA 3LKNA 3QHFH 4EEEA 4XPHH 1S9KC 1MCBA 1A3RH 3BDXA 3BYTA 4NQVA 1KCSL 1S9VA 4H0GA 4N0YL 4F3FB 5EUOB 3QZWB 2HKFH 2P24B 3O3DA 4PJEE 4HS3B 4X6CB 1MEXH 1P69B 1PG7X 3V6FA 2XTJE 3RY5A 2EDQA 2WBWB 3BPCA 4ZUVB 3GSUB 2FSEA 2BNRB 3BP7B 1SMOA 3OKLA 4I4WA 1BAFL 3VG9C 5IROA 1QKZH 2DM3A 3H42L 1RZJH 3MGOA 3KXFE 4GXVH 4TOYL 3VD7A 5JOPE 5J12B 4UBDC 3PV6A 5EN2A 2QR0A 3GSNA 1UCBL 3T4YA 3N9GH 3TVMA 2IBZY 2IH3A 2VXUH 1YEDB 4L9LB 2FX7H 5DA4A 5AG9A 2VKXA 1XIWD 1IBGL 4XAKD 3V0AC 5ADOH 3GI8L 1RHHB 4AEEA 4YFLF 1CD0A 5DI8A 1KUMA 5HDBF 2D9QB 1QVOA 3BGFB 4XXDB 1U8JB 3NCBB 2VQ1A 1YC8A 4G9FE 3D85B 4OGXL 1OGTB 3VG0L 2W9LA 2NXYD 4YHOH 4Z0XB 1C5CH 3G5VB 4O2EA 4FFZL 3S34L 3FB7B 2QSCH 4DW2H 1NGXB 3K8KA 1NUNB 4P57B 4XPGH 4ZFZA 4MJ5B 1AE6L 2HLFD 1HQRA 2J8UB 1BQHB 4L9DA 3WNMA 1J0YA 2VC2H 4F9LA 1LP9F 5C7XH 5L88H 3HB3D 1U8QB 3PL6B 4WUUD 4YNYB 5JW3H 3CMGA 1YNLL 4HD9A 3EDEA 4ODVH 3S6CA 2DI9A 4Q0XH 5CJOH 4HUKB 3EZ8A 5ESAA 3ZKSD 3FT2A 4NT6A 3C60A 1K8DB 1T83A 3CVHH 1UWGH 1MY7A 3EO0B 5JXAH 3GMLB 1OM3L 4DVBB 4UILL 4MJ2A 1LQSR 2AXFA 1Q9WB 3AS0A 4GKSA 2BRRL 2NMSA 3RAJL 1G7IB 1MJJB 2EDBA 3L1OH 1OAZL 3WDIA 5EU4B 1DQQB 4S1QL 1K3IA 3QCVL 5EU7E 1NANH 3TO4C 5ICXB 4YXHH 3MLUH 3U4EB 3DARA 3TBSB 4ZFGH 5LGJA 4TNVK 3RVVC 3VFUB 1EHNA 1G9EA 3ILPA 4L3AA 4S0TD 1U8HA 4YGAB 4FFVD 4LGSB 2F54B 2AI0H 5J3HD 2NY3C 4IOIA 2O61A 3IFPB 2YA2A 4YO0B 4ERSL 4PTTB 4XNUL 1YN6B 4OCWH 5EUKB 4P46D 3ULUL 3K8MA 3RJDA 4G6KH 2PXYC 4JZJC 3MACL 4JM2F 4L8SA 1CDGA 3BO8A 5D1QD 3G5YA 4GW5B 5HPMB 4CADA 4XWGL 1UZ6F 2Q7NA 1MJ7L 1JE6A 2PF6A 5SX5H 1T1ZB 4L8DA 3V7MA 1SEBA 1T5XB 4M6AA 3QISA 3BN9D 5C86A 4U7SA 5CUSL 3MV8E 4OF8A 5CIPH 5E9DD 4M62L 5EZLA 3FFCA 1NKOA 3DBXB 5FV2A 4FQXC 5IB5A 3V6ZB 1NC4D 3MLWH 5KSVB 1U93A 1DCLA 4EJ1C 3G9AB 3N1PC 4AEHL 1UM6H 1I85C 1P6AB 2YEZB 4KQ3H 3BRGC 2FBJH 4UTBL 5IOPA 1C16B 5I1EL 1N8ZA 4RFOH 5J6GA 4JGUA 3DRQA 1C12B 4H1LB 1IQDA 5DHVA 1F97A 4U31A 4Z7NF 4I18C 1ETZA 1I3VA 3BI9X 1HSAA 4RZCA 1H8SA 3P73B 3OL2A 2FJGB 3DUSB 3MRNB 1NCAL 3DIFB 4JRYB 2R29L 3SN6N 4C56E 5DRXA 5SWSA 1KIQA 1C5DA 3QO0B 4I13B 1NC2B 1YZZA 4JKWA 1B0WA 3TIEB 1Z9LA 1NDMB 4KROB 2AXHA 3QIBD 3VFNA 2V17H 3RL2B 4M5ZL 3U0TA 1GPOL 1UXWB 2DMBA 1INDL 4QRRD 1AXSB 2PO6B 2UYLB 5J13B 1B0RB 5T1KD 4NP4L 1NCNA 1XZ0B 1FC2D 2R2BB 4U1NA 4OLUL 4L8CA 1RY7B 3IKCA 4IRJA 1QSED 3B6SB 1MVFA 3PGCB 4JKMA 4PRAA 3QUYC 4BELD 5HVHC 2X05A 3V5KA 2A6DB 2EDTA 3LQZA 3FCTB 4R26L 3IDMB 2B20A 3G5XA 1A9BA 4YDLB 4RNRA 1CCZA 5E6ID 5AZEH 1H5BB 4HPYH 4PD4J 2GUOB 3MV7E 3ALWA 5I8KH 3VFPA 3WXWH 4KVNH 4UUJB 3K8LA 5D7SH 4G8GE 3B5HA 4LHUG 5HDQL 5CJXA 4R4FL 1X5IA 1MIEH 3IJSB 3JUZA 3PIQA 1A3QA 1FAKT 3SE8L 2R0WL 3WFCH 1RZGA 2PYFA 3WLWD 3X3FH 2QQLL 2RFXB 4POZD 4PJFA 1QFUH 1FL6A 4NC1C 5JXEA 3EYSL 3A67L 3VRIA 3QI9C 4FQCL 2NW3A 3RWGB 4OLWH 3HAEB 1P84K 3GMMB 1JYXA 1MRFH 5EO1B 5MI0C 2DQEH 5AAWA 4LNRA 2P46B 5JQ6L 4K7PH 4ZTOH 1W72L 4PRHA 1MFAL 4MZ2A 1XH3B 4FQQA 4QXTA 4XVJH 5EOTB 4PJ8D 1DUZB 3RGVD 1EHLL 4PTUA 3MQIA 5EZOH 3CK0L 5GGUA 1UADC 5A2FA 4MNHA 4PJHF 3B2VH 4G8EB 1WBYA 3QDGA 5FF6B 2Y36H 2VDLL 5BZWB 1BEYH 5DJXA 1LK3L 3S35X 5J57B 1MCHA 1T1YA 3GHEH 1C7SA 3D2UA 3QEHA 4X4XB 2MSPA 2VDKL 3GMRA 1JK8B 4V2CB 4K94C 5EIVA 2ZUVA 3REWA 4OCYH 1G9MC 1WEJL 1KB5A 2PTVA 1RK1B 4PJ5A 3G04B 4JVWA 4AM0B 4FFWD 1CLOH 4FQPA 1IT9H 1H3WM 3O3EB 35C8L 4DZ8A 4OKDA 4IOFD 2NY4D 1JGVL 3B3IA 4MSWB 1JFQH 5KVDH 1YYLH 5CINH 1I3UA 3TO2A 1QO3B 1M1SA 3P4OB 2ZJSL 2DAVA 3DLQR 1XF2A 5B4MD 1KTRL 1ZT1A 1WZ1L 3CLFL 1D9KB 2Y5TA 4N8VG 1OWWA 3GSVA 3SQOL 3ABZA 1RIHH 4J3XA 5D72H 4Z7WA 3S4SA 2DBLL 1P7KB 1LP9B 4OLZH 3VXRB 1MJ8H 3GIZL 2ICWJ 3MRBB 1FYTD 1OB1A 5HYSB 4NQTA 1JWSA 5GRVK 3MR9B 5F70A 3G08A 5T1LA 1DANT 1E4XH 1E6OL 2UY6A 5HHVH 3UTPE 2YSSA 4MAUL 2XKNB 1CGSH 1IC7H 3V6BR 1GC1H 3LS4H 4IIQA 1BLNB 1R3HB 3WUWG 3PQYE 4NHUB 4FOMA 4YHLH 4N0UA 4ENED 1UJ3A 4I0PC 5TFSH 4HV8A 1JV5A 2QQNL 2Y07L 4JJ5A 3L3HB 3BZ4B 1KJ2B 1TCRA 4Y2DD 3BPLB 1N6QL 2NPLX 4U1SA 3V8OA 4QRPA 4KI5E 5ADPL 2J5LC 3QNYB 2PNDA 4E41B 3ARFB 1XF4A 4YHZL 4P23B 2X5PA 1Y18A 2GCYB 5MHSD 1DP0A 3T2NH 4PJBE 5HI3C 3S96A 2Z4QB 3AREB 2N4IA 5DEGA 1TZGL 3VXPB 4LLYA 4XCFH 3TNMA 3IYLW 4QHUA 1G9MH 4TTDD 4EOWL 1F8TH 4O2FB 3PHSA 2Q6WA 3PWVB 1NL0H 5FGSA 2LV4A 4Z76B 5DUBB 3QUXA 2NY2D 4KRPB 5C0AE 2D7MA 4JLRA 4F7MA 5GRUH 2ITDA 1N64H 4XZUB 2W65B 5FGRA 1XCTB 2AXJA 3AUVA 3EJZC 4XWOC 5ITFB 5BS0B 4L4JA 4X7EC 4PGJA 4LEXH 3ZE1E 2LFGA 1GZQA 4OUUA 1UB6A 3WMSA 1E27A 4OBRA 1TVHA 3D9AH 2CIKB 3OGOE 3K81A 5IESL 2OLDA 3H9HA 4U6VL 4WWKA 1MFBH 1DLFH 4NO5B 3U83A 4P4KC 4NRYA 3VWKB 4MMZC 3P9LA 3SE3C 4XPFH 2HFEB 5C0ND 4XVUC 4JDVB 4NQEA 3BD4A 1FVDB 3TYFA 3QFJA 1KPUA 4NRZB 4LKCA 2ZWLT 4D9LH 1DLHB 1F90L 3MJGX 4PGCA 3W9DA 5J6HA 3VGFA 4XVTL 5KS9F 2R9HD 1Q1JL 1ZA3A 2YUVA 3G6JE 4XPBL 1C08A 5DK0A 3KJ6H 5LXGH 4Y19B 4RGOL 5INDB 3UTSB 1NAMB 3BH8A 3GDBA 3CFBB 2P49B 1QBBA 4I3SH 5DJ6A 5JOFB 1DBKH 2OTUB 4HBCL 1CFVH 4LCCA 4R4BA 4NYLB 1KGCD 3ARBC 5D1XC 4PV8A 1WC7B 1EAPB 1K85A 4QLRA 2YMXH 3BUYA 3HFMH 3T65A 5HHOA 1Z0MA 1QA9A 1LD9B 3P0GB 3Q2CA 1SJXA 4NQCA 4UDTB 3MRRA 2FO4B 2WSKA 4MS8D 3GBNL 1YYMH 3DJ9A 4OSUH 4Q9QL 3QIWB 4R96B 2H2PC 5ID0A 4ESKA 3ARYA 1J8HA 1N4XL 5K9KA 1KYOJ 1JPFB 1TZHB 3N85H 4JFZL 4JRXD 3EYVB 5DMJB 2O5ZL 2E9IA 3Q1SH 1U95B 2OTPA 4U1JB 4F8TA 3SOBL 3O6ML 4MJIE 3L3JA 1HINL 1TNNA 5I8OL 1BX2B 3TBYB 3IXAB 2F74A 5FO7B 3RX5A 3TEUA 4N0CC 1GJIA 3WFZA 2Q86A 4P5TC 3FFCD 5EBGA 1J12A 1KCSH 3GSOB 1Q9OA 4RAUB 1VADA 3RVUC 1O5DT 1MCRA 1G1YA 1ZWIA 1JGEB 4IJ3C 1DVFB 5D1ZB 5DRZB 1NAKH 3SEPA 1LVEA 2HFGL 1CXHA 3MRJA 4LSUL 3U79A 1N2RA 4YDVA 3QG6B 2MQ0A 4XAWH 3DVGA 1BAFH 1JZ6A 4CMHB 1OSPH 1U8MB 4I9WE 3FQRB 4JCLA 3DNKA 4OV5A 4NDMB 3H42H 3F5WB 4Z7QF 2QV2A 4XTRD 5IKCA 3IDNB 3KS0J 1OAQH 3VMPA 4OIIH 1UCBH 5BVPH 2EE6A 3AXLB 2ICWA 4QOKA 4PJHB 5I1HL 5KN5B 3KG5A 4GW4A 4HQQH 4NNXB 1L9NA 3HHRB 1V7NL 1K4DA 5FYJD 1FZMB 4XNZC 3PGDB 3S8WA 2MKLC 4OZIE 3N1GC 4BH8A 1BQHG 3O3AA 4D8PA 5FO9A 5K93A 1T6VN 3VG0H 1RZKC 3W0WA 3EYQD 4O5LL 4FFZH 2EDWA 3S34H 1QQDB 4WFED 2P5EB 3U1SH 4B5EA 1EO8L 1QNZL 3MRKB 4ZFOL 4IEFB 5IW1B 3C2AL 4P2OB 2DIAA 3F7QA 5FK9A 3KYKL 3CXDL 5IVOA 4EI6B 5T5FH 2EXWC 4PREB 4MHHI 1I75A 5D6CA 4FQLL 1J5OL 1UB5B 1A8JH 1OP3K 5HYIA 2R1WB 1DQJB 1CGWA 2JCCA 2VLKA 5DVMA 1QBMH 1JHTB 3PXHA 4DWHA 1FH5L 4NKOA 2BRRH 1JGUL 1BJ8A 3HMXA 3RAJH 4JPVL 1D6EA 1OAZH 5J0BA 5K9JH 1XGRA 4S1QH 1QZ1A 3QCVH 3WD5L 4J4PD 4WNQA 1R3KA 1FGVH 5JXED 3ORJA 2AK4E 4HUWB 4X6DE 4N90E 1T4KB 3AROA 2CDEA 1PX3A 3SDDA 3UDWA 3FONB 2QJDA 4FXGB 3IFOB 1I7TA 1M7IB 3OXRB 5FHBL 2XWJA 5KW9L 2B5IB 2WBJA 4XNUH 4H0HB 1ZEAH 2EDEA 4EIGB 4L4TA 3ULUH 4HW6A 4JEGB 1KPVA 4XP9L 5DJZA 1KJ3H 4L3EA 4D0CB 4HC1L 2VLJD 1GGBH 4XWGH 3QDGD 1VFMA 3GSQA 3PHOA 4PRDB 1MJ7H 4HH9A 2PTTA 4ZXBB 4M7KL 3VXUA 3MRHA 2I24N 4RFNC 3MLTB 4IOSD 1Q94B 1S7VA 2Y06L 3D2UD 1UWEL 3MRLA 4WHTB 3C2SA 3BKCL 4YBQD 5IUSA 5JHLL 4WTZA 4GKZA 3ESVF 4APQA 5T1MA 1P6FA 4QRSB 2OR9H 4PJ5D 5F97E 3VE0B 1MCWW 3QDME 4JFFA 1NJ9B 1RZKH 4BQ9A 4K55A 3ARGA 2H2SD 1EEZA 3LPFA 4Y16A 1T7WA 2CRZA 4PJEF 3ULUF 4H1LG 3L3OA 5I6XB 3ZMRA 3O3UN 2M2DA 1RULL 5K59E 1ORQA 3BKYL 3QUMA 1PYWA 2P7TA 4Y5VB 5A16B 1BECA 4RCAA 5TDOA 3VFRA 1T03L 4ZOBA 5JO5B 5IW6B 1BFVL 3IETB 3PHQA 2VRAA 2A74A 4CVUA 5D7LA 3RTQD 2FBOJ 4MJ4A 1DUYA 5IJVA 3UJJL 4MHHG 5E5MB 3TA3C 3QXDA 1PG7L 5AG8A 1RZIA 4OFKA 3LKPB 1OP9A 1AGDB 1MREH 2ZKHH 5FM5O 3SDYL 4KRLB 1TNMA 3TJHC 2ICEA 1QLRA 4FTVE 4QXGL 2X40A 4XI5C 5GJTL 4MD0A 4OGAC 4U1GB 4PY8I 1ZLVH 1HSBA 3QDAA 5F89A 4KK5C 4ODSL 2JIXA 3LRSA 3ULVC 4LLDB 1INDH 3MNZB 1NUDA 5AZ2L 4LNVA 4WWID 4Z18A 3H3KA 5D2NA 4AEIL 4MXWH 2IPKB 4AIXA 2DM4A 3ARPA 1LO4H 1MAML 1PLGL 1FNSL 2R2HA 1T7VA 4ZTPL 3VXSA 4XMPL 4N1EA 5IQ9A 1D5BA 1QPXA 3JV4A 3QULB 3FFDB 3SJVD 2J6EL 1U6AH 3MCKA 1WFOA 4HCRH 3MJ9H 4KDTA 2KDGA 1FGNL 3Q3GA 4JO2L 2E7LA 1I9IH 3BN3B 2HG5B 5I17B 4Z77A 2BC4A 3NABL 1V3KA 1NGZB 3PJSB 4R4FH 1A6WL 1KFAL 2DDQL 3SGEI 1V05A 3N06B 5DFWH 4QHKJ 4L4VA 1E4WL 3ALPA 3QUXD 2R0WH 4OI9A 4X7SL 1OTSD 5I1DB 5IGXL 3EFFB 3WIHA 5L2KA 5D6DC 1NGWA 4Y1AB 4R8WH 4NJAH 4WO4C 2SEBA 4CJ1A 2XA8L 3ALXA 3I3EA 5F3BB 1FZJB 5BRZB 3HLAA 3ULSA 5GS2H 4MD4A 1TVBA 4PJXA 1VKXA 2X4UA 1GOHA 2GJ6A 4FQCH 1ZT4B 4WW2C 1MCPL 1EZVX 1AGBA 5BJTB 2DI8A 3DMMA 1LK2A 5JQ6H 1P5VA 3L3GA 4LQFL 4HEPG 4WWKD 1VPOL 1MFAH 2R0ZL 4EBQH 2VIRB 3I50L 1EHLH 4HKXA 4W70A 1R3LA 1RIUL 3CK0H 5CMAB 5GS3A 1QLEH 4GS7C 1MWAL 2VLME 1UZ8B 3BPOB 1LK3H 1OTTD 4NQED 2WWMD 1NBVH 5D2LE 2YPLA 1CDHA 4JQXA 1A4JA 3QFJD 4G8IB 4OJFL 3WL9A 1RI8A 5DDHB 2VDKH 5I1GL 3VFVB 1J11A 1FFRA 4QGTA 1K3ZA 3W39A 3BQUD 5TDNA 3EOAB 2Q7YB 5B39A 1FFNA 3OZ9L 1WEJH 3FO2A 2EZ0C 1ZS8B 5EU3A 1K6QH 1ZHKB 5EOQH 3WE6B 3LN4A 3RPKA 5JW5B 4O58L 1JP5A 4LSPH 3VGGA 2CLZA 3D3VB 2BSTA 2HVKB 4OQTH 5FYLE 4GRLB 5JMOC 3OR6A 2R0LL 3H8NA 3ARDC 4YR6A 4BSWA 3HUJA 3DTXA 1WZ1H 2A83A 2K1MA 3CLFH 2WUCL 4DGIH 5E99L 1I8IB 3QDJB 4WJ5A 3SQOH