5DVBA

Crystal structure of s. cerevisiae tsa2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
b'YFQGMVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVSPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tsa2p
publication title Structure of TSA2 reveals novel features of the active-site loop of peroxiredoxins.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 65
structure length 199
sequence length 199
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dvbA00
1DE2A 1PRXA 3C7MA 3ZITA 2YWOA 2H30A 5D96A 4ULXA 3LFLA 16GSA 6GSXA 5F05A 4ISDA 4MF6A 4MLYA 2C0GA 1SU9A 1EOHA 3KP8A 1JHBA 2REMA 3DRNA 2Z9SA 3DVXA 4QQ7A 1G7OA 3IOSA 4EXJA 5D9WA 4K7NA 1X9MB 1XZOA 4J2FA 4K0GA 1SL0B 1PD21 3F9UA 1ERUA 4F0CA 5KN3A 1DE1A 3G7YA 4TW5A 2YANA 1GL8A 2AUVA 1TTZA 1YEXA 4PNGA 1PSQA 4RI7A 2VOCA 5HQPA 4YAPA 4IELA 4CHSA 2JADA 4OMVA 2DMLA 3F4SA 4I97A 1HNBA 5B8AA 4DSSA 1EP7A 3TRQA 1SKRB 3F63A 3E9JB 5ECPB 5CRGA 4KW6A 4AJ8A 1OAZA 3O76A 5IMFA 1OE7A 3IE3A 3VI5A 2K8VA 3UVTA 4L0UA 4NHWA 1U88A 1UA5A 1BEDA 5DCHA 1LU4A 1SL1B 5IOWA 3VWXA 1WWJA 4MABA 3LXTA 1QQ2A 5ECKB 3OR5A 2E2MA 5KEJA 3EE2A 3FR6A 2GSRA 3GYKA 3ERWA 4WF4A 5J9BA 2VD1A 3WT2A 1ZGNA 4HUAA 3I9V2 4MJEA 2PVQA 3Q6OA 1KEBA 3HZ8A 2M46A 2V32A 2CQ9A 1XVWA 3M8NA 2AYTA 2V1MA 2X8CA 3IPZA 3TOTA 1XCCA 1URMA 4ZIJA 4FYCA 2L5LA 1X5EA 1XWKA 4GTUA 3TUEA 2FLSA 2H0GA 2LV3A 3IHQA 1SD8A 1SYRA 5L71A 4E8EA 4CW9A 4BVYA 4O32A 2HZEA 4O92A 1TXXA 3GKKA 4RQRA 1DBYA 5G1LA 4K7OA 5FWGA 5KN0A 3RDWA 2ON7A 3ZMKA 2K8SA 5JCGA 1X9WB 3TGZA 3APOA 2GS3A 3D6IA 4GWRA 2IFQA 2H1GA 4XS1A 4HOJA 2O89A 3F8UA 4G19A 3ED3A 2VLVA 4EUYA 2JZSA 3TJKA 4KDYA 1GSSA 1A24A 3BD2A 1TU7A 2HE3A 3GUSA 4OO4A 4ZB6A 1ERVA 2RUFA 4TOPA 1K0MA 2L59A 3GFKA 2GGTA 3FEUA 3GL5A 2HT9A 2CVDA 5HR1A 3E0UA 4POLA 3QOUA 8GSSA 2VIMA 2QGVA 3D22A 3FKFA 1O6JA 1YJ6A 3ZLPA 5IM9A 2DBCA 3KXOA 1AQWA 1BYEA 3DGQA 1A2LA 3L4NA 2XPDA 2OACA 1PN9A 4FIWA 2B1KA 3S9FA 5H5RA 1FO5A 3FZAA 3IC4A 5G30A 5DALB 2AHEA 1OVNA 1M9AA 2VL2A 3TOUA 2JACA 3WGEA 1ERTA 4YAVA 4TR0A 3ZIVA 1PKZA 3GX8A 3SWLA 1DSBA 2IMDA 3UARA 4KSOA 2ZUPA 1EEMA 3GKNA 1GSDA 4KGIA 2GSSA 3DIEA 2HLSA 4EF0A 1VGLA 4ZL7A 5EY6A 4N30A 5A4WA 1S3AA 5CRWA 2HZFA 3TKRA 4X0XA 3QMXA 4TKYA 4BA7A 4POBA 1K3YA 1B9YC 3CSIA 1SKSB 1GSFA 5A5KA 1SJZA 1A2JA 2CA8A 3TKSA 2A2RA 1UC7A 2JSYA 5J5NA 2KP1A 1UN2A 3F3QA 5CRDA 4MK3A 2B5EA 4RQXA 1V2AA 2AV4A 3HKRA 5CRHA 3I69A 3KMOA 4JR6A 4V2LA 1GNEA 2LRCA 4ML1A 3W8SA 2KOKA 4KAEA 3VWUA 3RHCA 5DAKA 1AXDA 5IIZA 2IIYA 2BMXA 1OC9B 1PL1A 3FZ9A 1ZYEA 2QSIA 2NVLA 2FWEA 3P8WA 1A0RP 2X8HA 2GSQA 3VWVA 7GSSA 3KTLA 1NW2A 2HRNA 3K8NA 1PX6A 3TJFA 4IP1A 2I3YA 4I2TA 2YZUA 1MDIA 4WBRD 1HD2A 4K9ZA 3VK9A 3DD3A 4HS1A 3F4RA 1Z9HA 3TRPA 1K3OA 4EC0A 4J57E 1W89A 4OFMA 4KUNA 3EINA 3P7XA 3APSA 3N5OA 1X5DA 4EE0A 1ZL9A 2H8LA 2VCXA 2DSAA 6GSVA 3MDKA 2G2QA 2RIIA 1QGVA 3RPNA 2CAIA 3V1WA 4GQCA 2WGRA 4V1Ap 3L78A 1GTUA 2C4JA 1T7PB 2BJXA 4EDZA 1V58A 2P31A 4NHZA 4O7HA 2YPMA 3IDVA 4KA0A 1KTEA 3ZIJA 2PPTA 3CBUA 5DCGA 3LXZA 4JU5A 2PVOC 2LKUA 4GSTA 5DVBA 5B8BA 1QUWA 4XRDA 3HXSA 5IPHA 5IMAA 2MYGA 3C8EA 4KH7A 2I9HA 5ECOB 2DIZA 2VCTA 1FG4A 1EGOA 1TKDB 2PWJA 1ON4A 5B7CA 1EV9A 1TRUA 5IQYA 5IPGA 1JLWA 5G2ZA 3IA1A 6GSYA 2HSHA 5KN1A 1ERWA 4OCEA 1JLVA 2H0IA 5JWQB 1H4OA 2H71A 2C3TA 3LORA 3M3MA 4F9ZA 2JU5A 4TVEA 4D73A 1K0AA 3G7JA 1J9BA 1V57A 2VM1A 4ZBDA 3US3A 1TU8A 3FZ4A 4KNDA 3F3RA 5DQYA 1K0OA 4PGTA 1PL2A 3UAPA 4XHMA 4IS0A 4AGSA 3EWLA 5ABRA 2QKEA 2A4VA 3EMPA 1EOGA 4MJCA 4TXOB 5C04A 2MZCA 3UJ1A 2TRCP 2XC2A 3GTUB 4ZL9A 1R7HA 5B6MA 4WEYA 4ZILA 1AIUA 1Z5YE 6GSTA 1C72A 5B6NA 4L8EA 1O81A 2G0FA 1NHYA 4PURA 3CTGA 1WP0A 5G5EA 3KTBA 4HJMA 3IAS2 5JWOB 20GSA 5F8BA 1U3AA 2J23A 3DYRA 2MMNA 1QXHA 3D4TA 2IMKA 1XW6A 1USBA 2IMEA 2P5RA 4F03A 4GSSA 4YH2A 3IBHA 3GMFA 1OE8A 4ECBA 3KMNA 4FO5A 4MF7A 2H70A 4HI7A 4V2NA 1VF4A 1PA3A 1WMJA 1EGRA 4LL4B 4PUAA 4CDOA 5ID2B 3HVSA 1JFUA 3ZTLA 1IYHA 2B3SA 3KJYA 3GL3A 1B4PA 2GDRA 1PMTA 4PQHA 4ZBBA 4MP4A 1SJIA 2PUKC 1ML6A 2V2GA 3Q19A 4IP6A 1GTIA 1YKCA 2CT6A 3GV1A 2L4CA 3C1RA 3VFIA 2XPEA 3F6FA 4YQVA 3AY8A 1GTAA 2FNOA 4NMUA 5G5FA 1YF1A 1JZWA 2H01A 3RBTA 3P2AA 2YNXA 3QAGA 3JCML 1B9XC 3M1GA 4MPFA 2M72A 2M80A 3WGDA 2HI7A 2LNTA 4MJAA 1TDIA 1MD4A 4POKA 5HR3A 5F06A 3VPQA 2CV4A 1XIYA 3FHKA 3UL3A 3WGXA 3MWHA 4RI6A 5CNWA 1WPIA 4HZ4A 4XTSA 3GRXA 2LQQA 2DJ2A 1N2AA 2C3QA 4O5RA 3GNJA 1U3IA 1G6YA 6GSWA 3HHVA 3H4KA 5H5QA 4KX4A 2JL4A 3WT1A 3CTFA 4IW9A 3APQA 1R5PA 4N0ZA 3D4MA 1MDJA 3HJMA 1ZCPA 10GSA 5ECRB 4YQUA 4DEJA 4RUVA 3LYPA 2R3XA 3DVWA 2O87A 4G10A 1M2AA 5JCUA 3TDGA 2C0FA 1SK1A 1RK4A 4PUFC 2ZCTA 2H1BA 3RHBA 2FCHA 3BBYA 1K0DA 1RW1A 4ZL8A 9GSSA 3LWAA 3L9UA 2IMIA 4DSRA 1SL2B 4P3YB 1FAAA 2GZPA 3KEBA 1TRVA 5JCWA 2B7KA 4MCUA 2OE1A 2TRXA 2R37A 1SYXA 1XWGA 4JE1A 1GULA 2WCIA 5LD0A 1YQ1A 1YF0A 3D5JA 3ME7A 1TK5B 2FHEA 1GNWA 1TI3A 4PXOA 1SD9A 1FHEA 1S3CA 2IWTA 3CRUA 1NM3A 4F2IA 3EC3A 4XCSA 2KP2A 5ECIB 2R4VA 1XOAA 1AC1A 22GSA 1VF3A 1YEPA 5AGYA 4LMVA 2OE0A 2E0QA 2VCVA 5F07A 3KGKA 2FD3A 1ILOA 4HJ2A 2YJ7A 4IQ1A 2TIRA 3R2QA 1GUHA 3A2VA 5DBQA 1X0RA 3EVIA 1GP1A 1TK8B 1XOBA 14GSA 1HYUA 2R5GA 2B1LA 1SK0A 2VAFA 3KM6A 2BTOT 6GSUA 4HEA2 3HY2A 3IK9A 4HQZA 2LQOA 2E7PA 1EZKA 4IBPA 5F0GA 2V6OA 3BCIA 3N9JA 3HVVA 2KUCA 3CRTA 5CO3A 1OKTA 4ECIA 2C0EA 3MSZA 1K0CA 2HFDA 2F8FA 1PKWA 3TCOA 2VLTA 1K0BA 2GZZA 3FW2A 3IAM2 3GH9A 1M99A 2OBKA 2KLXA 2P5QA 11GSA 4TR1B 4EVMA 2DJJA 2CAQA 4IVFA 1K3LA 1M9BA 13GSA 4K2DA 4K6XA 3HJPA 3ZFLA 4DSQA 2X64A 3LSZA 3FYGA 5IMVA 4Z7XA 5ECSA 4NV2A 2MBTA 4X43A 2B5YA 2P0GA 1WRYA 3ISOA 4GSNA 3I6AA 3LEFA 3VPTA 3QAWA 2DLXA 2VD0A 2OKAA 3KZQA 1BX9A 3KP9A 3IK7A 2L57A 4K1FA 4F0BA 5DJMA 3EMXA 1PGTA 2QC7A 3TRXA 2LNSA 3UIWA 2N5BA 4QL7A 4IJIA 1XWCA 1OC8A 2FY6A 5GAND 3UEMA 3D0ZA 1AQVA 1TP9A 1KBNA 5HR2A 5ECLB 4GRFA 2H74A 4NV5A 1GSQA 2D2ZA 2HXKA 4LL1B 3DKSA 1O85A 2GT6A 4V1Ag 5HFKA 3H1NA 4ZXGA 2ES7A 4GF0A 2X8GA 2FA4A 3GHAA 3E3EA 2FWFA 2H1DA 4AF2A 3H79A 2FWHA 5KN2A 1I5GA 2GQLA 3HZ4A 5D93A 1Y25A 2GQMA 1Q98A 4JR4A 1GH2A 2VCZA 2PN8A 3ZREA 3PR8A 4DSSB 3UOMA 4KDXA 1B8XA 5LNKe 3ZMLA 4KB3A 2H73A 2C0DA 1Z6NA 4PQIA 1VF1A 2FWGA 2DJ3A 3DMLA 1NHOA 2FA8A 4MPGA 1F3AA 3GURA 1GLQA 5HFGA 2XBIA 2XBQA 2K6VA 2H1AA 4EKZA 2E2GA 2I81A 3TKPA 1M7TA 3QD9A 4F82A 3VI7A 2L4QA 2DIYA 5DQSA 4MF5A 2HRFA 3A3TA 3IR4A 2O85A 4WKWA 2IMFA 3TB2A 2GLRA 2XHFA 2J9HA 1XXUA 4WR4A 3M9JA 5ELAA 3ERFA 4ECCA 2C3NA 4L0WA 5G1KA 3QCPA 2YZHA 4TRXA 5GSTA 1XWBA 2LJAA 2VL2C 5E59A 2RLIA 1A2MA 3GN3A 1GRXA 1I9DA 2OE3A 3ZL5A 2YP6A 3WYWA 2RM5A 2N5FA 3M9KA 1QFNA 3QFBC 1OC9A 3KH7A 3ZFBA 1V9WA 4ECJA 3GH6A 5AN1A 1DUGA 4N11A 2HZEB 4DVCA 1HNCA 2H76A 3KH9A 1KNGA 1HNAA 6GSSA 5D9XA 1B48A 1TI1A 3I43A 3Q74A 3CXGA 4I5QA 2YJHA 3KCMA 3HVXA 4HQSA 2IFQB 4XS4A 1A8YA 1GTBA 1E2YA 2LS5A 4GXZA 1RQMA 1SKWB 3GX0A 2FUG2 3TKSE 2RUEA 3BOAA 3CYNA 2WJUA 3TKSC 5FHIA 1T3BA 4JRRA 4WF5A 2ZNMA 2WS2A 3F4TA 1ZZYA 4PX1A 1O73A 2JZTA 1OKDA 3TJJA 5G31A 4H86A 3UMAA 2MBSA 4Q5RA 3DEXA 3W8JA 5CAXA 2NTOA 1XW9A 1QMVA 2L6DA 1T1VA 5ECMB 3MNGA 1F9MA 2YWIA 4KCAA 4OWYA 3Q18A 1IYIA 5CP1A 4GQFA 4KCEA 3EURA 4WXTA 4YQMA 2GQKA 3LYKA 2MMOA 1FB0A 4NXIA 5IOXA 2PGTA 2C1YA 1ZMAA 3PGTA 3HJOA 3EU3A 5HR0A 5DJLA 1HQOA 5HFIA 4X1UA 1BG5A 3H8QA 3F6DA 4MJBA 4ID0A 2L6CA 4LA1A 1YDKA 1M2BA 4OO5A 2YV9A 3PINA 2B5XA 3HCZA 2WDUA 4NWYA 4Q5NA 5CYYA 4HDEA 4XIHA 3BCKA 3VWWA 3SBCA 1TOFA 1B4QA 3GIXA 3IV4A 2H66A 5ECNB 2IPAA 5ELGA 2MMZA 1TK0B 4L5LA 5EPFA 3WD6A 1V40A 2PU9C 3FY7A 2V41A 2O7KA 3RPPA 3L0HA 2A2SA 5J4UA 2OBIA 2H19A 5AIXA 1R5AA 3IXRA 2YWMA 3EU4A 4BWQA 3J7Yk 2VL9A 5GSSA 1YY7A 12GSA 1EWXA 1XFLA 2H6YA 2DC5A 3F0IA 3IRAA 4JZQA 3U6VA 5DAKB 1O8WA 2VCQA 2JSZA 2GTUA 1G7EA 1BQ7A 1Z6MA 1R26A 4TXOA 3H93A 1SJ6A 1W4VA 4HZ2A 2AJQB 1THOA 3GTUA 3LG6A 3L9SA 4KDUA 1MDKA 1TW9A 3PH9A 1F37A 2IJYA 3J7Yb 2YN1A 4IN0A 3O3TA 2DJ1A 4OFTA 4E8HA 1VRSD 1X9SB 4ILFA 4NAXA 3FR3A 1O8XA 4NPBA 4LLRA 2F3MA 4LMWA 1FB6A 2CX4A 2AAWA 3LQ7A 5ENUA 2L5OA 3NIVA 4I8BA 3HDCA 1XW5A 1O7UA 4MH2A 1N8JA 1U87A 2H72A 2YCDA 1GUKA 2PMTA 2K18A 1GLPA 1ST9A 2EC4A 3GKXA 1LBKA 3C71A 4JBBA 4MMMA 3NZNA 2OA7A 3UVHA 5GZZB 2EIQA 5IO2A 2VM2A 2GZYA 1A23A 1J0FA 1GSEA 1ACVA 4BPYA 5ID2A 4ACSA 2HYXA 2GVPA 2YOIA 3A5WA 5COHA 3HYPA 1X5CA 4IHUA 2IL3A 2WFCA 3A2XA 1EEJA 3DWVA 1BAYA 4OD7A 2FGXA 1F3BA 1G6WA 3BJ5A 1T8EB 5FT3A 2EIOA 3M0FA 5EVOA 1MD3A 1U6TA 4KSMA 4XS6A 1CQGA 1GWCA 2B6MA 3ME8A 2PERA 4OFNA 4OCFA 2GSTA 1VF2A 1OYJA 3RAZA 3VURA 1NSWA 5JWRB 1FOVA 2ON5A 4AJ7A 2I4AA 1GUMA 2R6KA 4BWSA 3QAVA 4TR3A 2F9SA 1LJRA 3EYTA 5J9CA 4MZBA 4ZB8A 5DDLA 4D73B 5D9VA 2PBJA 1K0NA 5CREA 2B7JA 4G9HA 3GSSA 4BVXA 5IO0A 1PQNA 5INYA 3ZZXA 5ECQB 3LJRA 5H5SA 4K7IA 2NPBA 1WJKA 4N10A 4Q5QA 3G7IA 3L9VA 2H6ZA 4POMA 2R2JA 1A0FA 2X99A 3G9BA 1OC3A 4HU7A 2WZ9A 5AISA 2HSYA 2LUSA 3TKQA 1Z3EA 4GCIA 1J08A 1M2DA 1S3DA 2NBSA 1Z7PA 3CMIA 5E4WA 4MA9A 1M0UA 4EO3A 4N0VA 3FK8A 3KD0A 3QPMA 4KE3A 3U5RE 4ZBAA 4FH8A 2DJ0A 3QFAC 5D8IA 4XRAA 1XWAA 4I6XA 2F8AA 3KIJA 2LJRA 1JZRA 1JZDA 3FZ5A 3NOFA 1YZXA 1Q4JA 1YKAA 2IN3A 1UVZA 4XS4B 4L5OA 2VLUA 1T00A 4WBJA 2DMMA 4IQAA 2LJKA 2NDOA 1F2EA 1MEKA 2F51A 3MAKA 3ZVJA 2YWNA 4ML6A 2V6KA 1ZYQB 4ZB9A 5J3RA 4AJ6A 3UBLA 4IGJA 2H75A 3W6GA 1A8LA 2LRNA 5IMDA 2OJLA 1TJDA 1WIKA 4EDYA 2LRTA 1QK8A 4EL1A 1FW1A 3TJBA 4JEDA 1ABAA 1TRWA 1SENA 1V98A 1BJXA 1SK2A 5DALA 3P90A 3GA4A 5IMZA 5D73A 2JZRA 4K8MA 2AB6A 4TXVA 5J41A 5EL8A 3QDNA 2CX3A 1T4ZA 2WRTA 2RM6A 4IKHA 1EV4A 3CSJA 4I2UA 4MH3A 1R4WA 4HU9A 2CVKA 3HA9A 4WETA 2HNLA 1G0TA 2OADA 1GSYA 4Q5FA 1PX7A 1GSUA 2K9FA 5A4VA 1AQXA 3C1SA 5AIVA 2LEGA 3C73A 1XPVA 2WULA 2LTKA 1AAZA 1E6BA 2H0HA 1MTCA 1WOUA 4TN8A 4K0NA 5D9TA 19GSA 3GKMA 4FYBA 3VLNA 4IJ3A 5GAPD 4WR5A 2VL3A 2YV7A 18GSA 2H6XA 1AUCA 1TRSA 2VO4A 3UBKA 4PQ1A 2WB9A 1XBSA 5IMCA 3GSTA 2C8UA 2ALBA 4BL7A 2DJKA 4PNFA 5A4UA 4J56E 5C00A 3A2WA 1CQHA 4TR4A 3ZRDA 1JZOA 1FVKA 4MZWA 1WE0A 3FRCA 1FVJA 3HD5A 2EIRA 5ECHB 2I1UA 4G2EA 4MZCA 1EP8A 1XVQA 2KHPA 3QR6A 3TJGA 4QL9A 4V2MA 4TR1A 1T4YA 3O6TA 4FYUA 4MDCA 3ZYWA 1THXA 2CVBA 1AW9A 2C80A 3ZVJD 2CZ2A 3FR9A 2CZ3A 1Y6EA 2O8VB 1H75A 3D21A 2LSTA 3CSHA 3DXBA 2MMAA 3LGCA 1F6MC 2VUPA 2VCWA 5LCZA 2N5AA 3ERGA 4GLTA 1Z7RA 1ZOFA 17GSA 2GT5A
chains in the Genus database with same CATH superfamily
1DE2A 1PRXA 3C7MA 3ZITA 2YWOA 2H30A 4Z2TA 5D96A 4USSA 4ULXA 3LFLA 16GSA 6GSXA 5F05A 4ISDA 4MF6A 4MLYA 2C0GA 1SU9A 1EOHA 3KP8A 1JHBA 2REMA 3DRNA 2Z9SA 3DVXA 4G0IA 4QQ7A 1G7OA 3IOSA 4EXJA 5D9WA 4K7NA 1X9MB 1XZOA 4J2FA 4K0GA 1SL0B 1PD21 3F9UA 1ERUA 4F0CA 5KN3A 1DE1A 3G7YA 4TW5A 2YANA 1GL8A 2AUVA 1TTZA 1YEXA 4PNGA 1PSQA 4RI7A 2VOCA 5HQPA 4YAPA 4IELA 4CHSA 2JADA 4OMVA 2DMLA 3F4SA 4I97A 1HNBA 5B8AA 4DSSA 1EP7A 3TRQA 1SKRB 3F63A 3E9JB 5ECPB 4YKGA 5CRGA 4KW6A 4AJ8A 1OAZA 3O76A 5IMFA 1OE7A 3IE3A 3VI5A 2K8VA 3UVTA 4L0UA 4NHWA 1U88A 1UA5A 1BEDA 5DCHA 1LU4A 1SL1B 5IOWA 3VWXA 1WWJA 4MABA 3LXTA 1QQ2A 5ECKB 3OR5A 2E2MA 5KEJA 3EE2A 3FR6A 2GSRA 3GYKA 3ERWA 4WF4A 5J9BA 2VD1A 3WT2A 1ZGNA 4HUAA 3I9V2 4MJEA 2PVQA 3Q6OA 1KEBA 3HZ8A 2M46A 2V32A 2CQ9A 1XVWA 3M8NA 2AYTA 2V1MA 2X8CA 3IPZA 3TOTA 1XCCA 1URMA 4ZIJA 4FYCA 2L5LA 1X5EA 1XWKA 4GTUA 3TUEA 2FLSA 2H0GA 2LV3A 3IHQA 1SD8A 1SYRA 5L71A 4E8EA 4CW9A 4BVYA 3IHGA 4O32A 2HZEA 4O92A 1TXXA 3GKKA 4RQRA 1DBYA 5G1LA 4K7OA 4YKFA 5FWGA 5KN0A 3RDWA 2ON7A 3ZMKA 2K8SA 5JCGA 1X9WB 3TGZA 3APOA 2GS3A 3D6IA 4GWRA 2IFQA 2H1GA 3CQFA 4HOJA 4XS1A 2O89A 3F8UA 2HRKA 4G19A 3ED3A 2VLVA 4EUYA 2JZSA 3TJKA 4K5RA 4KDYA 1GSSA 1A24A 3BD2A 1TU7A 2HE3A 3GUSA 4OO4A 4ZB6A 1ERVA 2RUFA 4TOPA 1K0MA 2L59A 3GFKA 2GGTA 3FEUA 3GL5A 2HT9A 2CVDA 5HR1A 3E0UA 4POLA 3QOUA 8GSSA 2VIMA 2QGVA 3D22A 3FKFA 1O6JA 1YJ6A 3ZLPA 5IM9A 2DBCA 3KXOA 1AQWA 1BYEA 3DGQA 1A2LA 3L4NA 2XPDA 2OACA 1PN9A 4FIWA 2B1KA 3S9FA 5H5RA 1FO5A 3FZAA 1PN0A 3IC4A 5G30A 5DALB 2AHEA 1OVNA 1M9AA 2VL2A 3TOUA 2JACA 3WGEA 1ERTA 4YAVA 4TR0A 3ZIVA 1PKZA 2HRAA 3GX8A 3SWLA 1DSBA 2IMDA 3UARA 4KSOA 2ZUPA 1EEMA 3GKNA 1GSDA 4KGIA 2GSSA 3DIEA 2HLSA 4EF0A 1VGLA 4ZL7A 5EY6A 4N30A 5A4WA 4MNNA 1S3AA 5CRWA 2HZFA 3TKRA 4X0XA 3QMXA 4TKYA 4BA7A 4POBA 1K3YA 1B9YC 3CSIA 1SKSB 1GSFA 5A5KA 1SJZA 1A2JA 2CA8A 3TKSA 2A2RA 1UC7A 2JSYA 5J5NA 2KP1A 1UN2A 3F3QA 5CRDA 4MK3A 2B5EA 4RQXA 1V2AA 2AV4A 3HKRA 5CRHA 3I69A 3KMOA 4JR6A 4V2LA 1GNEA 2LRCA 4ML1A 3W8SA 2KOKA 4KAEA 3VWUA 3RHCA 5DAKA 1AXDA 5IIZA 2IIYA 2BMXA 1OC9B 1PL1A 3FZ9A 1ZYEA 2QSIA 2NVLA 2FWEA 3P8WA 1A0RP 2X8HA 2GSQA 3VWVA 7GSSA 3KTLA 1NW2A 2HRNA 3K8NA 1PX6A 3TJFA 4IP1A 2I3YA 4I2TA 2YZUA 1MDIA 4WBRD 1HD2A 4K9ZA 3VK9A 3DD3A 4HS1A 3F4RA 1Z9HA 3TRPA 1K3OA 4EC0A 4J57E 1W89A 4OFMA 4KUNA 3EINA 3P7XA 3APSA 3N5OA 1X5DA 4EE0A 1ZL9A 2H8LA 2VCXA 2DSAA 6GSVA 3MDKA 2G2QA 2RIIA 1QGVA 3RPNA 2CAIA 3V1WA 4GQCA 2WGRA 4V1Ap 3L78A 1GTUA 2C4JA 1T7PB 2BJXA 4EDZA 1V58A 2P31A 4NHZA 4O7HA 2QA1A 2YPMA 3IDVA 4KA0A 1KTEA 3ZIJA 2PPTA 3CBUA 5DCGA 3LXZA 4JU5A 2PVOC 2LKUA 4GSTA 5DVBA 5B8BA 1QUWA 4XRDA 3HXSA 5IPHA 5IMAA 2MYGA 3C8EA 4KH7A 2I9HA 5ECOB 2DIZA 2VCTA 1FG4A 1EGOA 1TKDB 2PWJA 1ON4A 5B7CA 1EV9A 2R0CA 1TRUA 5IQYA 5IPGA 1JLWA 5G2ZA 3IA1A 6GSYA 2HSHA 5KN1A 1ERWA 4OCEA 1JLVA 2H0IA 5JWQB 1H4OA 2H71A 2C3TA 3LORA 3M3MA 4F9ZA 2JU5A 4TVEA 4D73A 1K0AA 3G7JA 1J9BA 1V57A 2VM1A 4ZBDA 3US3A 1TU8A 3FZ4A 4KNDA 3F3RA 5DQYA 2X49A 1K0OA 4PGTA 1PL2A 3UAPA 4XHMA 4IS0A 4AGSA 3EWLA 5ABRA 2QKEA 2A4VA 3EMPA 1EOGA 4MJCA 4TXOB 5C04A 2MZCA 3UJ1A 2TRCP 2XC2A 3GTUB 4ZL9A 4BVYB 1R7HA 5B6MA 4WEYA 3A5IA 4ZILA 1AIUA 1Z5YE 4EIPA 4CY8A 6GSTA 1C72A 5B6NA 4L8EA 1O81A 4G0KA 3PPUA 2G0FA 1NHYA 4PURA 3CTGA 1WP0A 5G5EA 3KTBA 4HJMA 3IAS2 5JWOB 20GSA 5F8BA 1U3AA 2J23A 3DYRA 2MMNA 1QXHA 3D4TA 2IMKA 1XW6A 1USBA 2IMEA 2P5RA 4F03A 4GSSA 4YH2A 3IBHA 3GMFA 1OE8A 4ECBA 3KMNA 4FO5A 4MF7A 4V2NA 2H70A 4HI7A 1VF4A 1PA3A 1WMJA 1EGRA 4LL4B 4PUAA 4KF9A 4CDOA 5ID2B 3HVSA 1JFUA 3ZTLA 1IYHA 2B3SA 1ZYNA 3KJYA 3GL3A 1B4PA 2GDRA 1PMTA 4PQHA 4ZBBA 4MP4A 1SJIA 2PUKC 1ML6A 2V2GA 3Q19A 4IP6A 1GTIA 1YKCA 2CT6A 3GV1A 4BIKA 2L4CA 3C1RA 3VFIA 2XPEA 3F6FA 4YQVA 3AY8A 1GTAA 2FNOA 4NMUA 5G5FA 1YF1A 1JZWA 1XG8A 2H01A 3RBTA 3P2AA 2YNXA 3QAGA 3JCML 4A5PA 1B9XC 3M1GA 4MPFA 2M72A 2M80A 3WGDA 2HI7A 2LNTA 4MJAA 1TDIA 1MD4A 4POKA 5HR3A 5F06A 3VPQA 2CV4A 1XIYA 3FHKA 3UL3A 3WGXA 3MWHA 4BVXB 4RI6A 5CNWA 1WPIA 4HZ4A 4XTSA 3GRXA 2LQQA 2DJ2A 1N2AA 2C3QA 4O5RA 3GNJA 2DKIA 1U3IA 1G6YA 6GSWA 3HHVA 3H4KA 5H5QA 4KX4A 2JL4A 3WT1A 3CTFA 4IW9A 3APQA 1R5PA 4N0ZA 3D4MA 1MDJA 3HJMA 1ZCPA 2A2PA 10GSA 5ECRB 4YQUA 4DEJA 3FMWA 4RUVA 3LYPA 2R3XA 3DVWA 2O87A 4G10A 1M2AA 4K2XA 5JCUA 3TDGA 2C0FA 1SK1A 1RK4A 4PUFC 2ZCTA 2H1BA 3RHBA 2FCHA 3BBYA 1K0DA 1RW1A 4ZL8A 9GSSA 3LWAA 3L9UA 2IMIA 4DSRA 1SL2B 4P3YB 1FAAA 2GZPA 3KEBA 1TRVA 5JCWA 2B7KA 4MCUA 2OE1A 2TRXA 2R37A 1SYXA 1XWGA 4JE1A 1GULA 2WCIA 5LD0A 1YQ1A 1YF0A 3D5JA 3ME7A 1TK5B 2FHEA 1GNWA 1TI3A 4PXOA 1SD9A 1FHEA 1S3CA 2IWTA 3CRUA 1NM3A 4F2IA 3EC3A 4XCSA 2KP2A 5ECIB 2R4VA 1XOAA 1AC1A 22GSA 1VF3A 4CY6A 1YEPA 5AGYA 4LMVA 2OE0A 2E0QA 2VCVA 5F07A 3KGKA 2FD3A 1ILOA 4HJ2A 2YJ7A 4IQ1A 2TIRA 4X4JA 3R2QA 1GUHA 3A2VA 5DBQA 1X0RA 3EVIA 1GP1A 2DKHA 1TK8B 1XOBA 14GSA 1HYUA 2R5GA 2B1LA 1SK0A 2VAFA 3KM6A 2BTOT 6GSUA 4HEA2 3HY2A 1PFOA 3IK9A 4HQZA 2LQOA 2E7PA 1EZKA 4IBPA 5KOWA 5F0GA 2V6OA 3BCIA 3N9JA 3HVVA 2KUCA 3CRTA 5CO3A 1OKTA 4ECIA 2C0EA 2X4AA 3MSZA 1K0CA 2HFDA 2F8FA 1PKWA 3TCOA 2VLTA 4BL7B 1K0BA 2GZZA 3FW2A 3IAM2 3GH9A 1M99A 2OBKA 2KLXA 2P5QA 11GSA 4TR1B 4EVMA 2DJJA 2R0GA 2CAQA 4IVFA 1K3LA 1M9BA 13GSA 4K2DA 4K6XA 3HJPA 3ZFLA 4DSQA 2X64A 3LSZA 3FYGA 5IMVA 4Z7XA 5ECSA 4NV2A 4PTSA 2MBTA 4X43A 2B5YA 2P0GA 1WRYA 3ISOA 4GSNA 3I6AA 3LEFA 3VPTA 3QAWA 2DLXA 2VD0A 2OKAA 3MIXA 3KZQA 1BX9A 3KP9A 3IK7A 2L57A 4K1FA 4F0BA 5DJMA 3EMXA 1PGTA 2QC7A 3TRXA 2LNSA 3UIWA 2N5BA 4QL7A 4IJIA 1XWCA 1OC8A 2FY6A 5GAND 3UEMA 3D0ZA 1AQVA 1TP9A 1KBNA 5HR2A 5ECLB 4GRFA 2H74A 4NV5A 4K5SA 1GSQA 2D2ZA 2HXKA 4LL1B 3DKSA 1O85A 2GT6A 4V1Ag 5HFKA 3H1NA 4ZXGA 2ES7A 4GF0A 2X8GA 3R3EA 2FA4A 3GHAA 3E3EA 2FWFA 2H1DA 4AF2A 3H79A 2FWHA 5KN2A 1I5GA 2GQLA 3HZ4A 5D93A 1Y25A 2GQMA 1Q98A 4JR4A 1GH2A 2VCZA 2PN8A 3ZREA 3PR8A 4DSSB 3UOMA 4KDXA 1B8XA 5LNKe 3ZMLA 3LW9A 4KB3A 2H73A 2C0DA 1Z6NA 4PQIA 1VF1A 2FWGA 2DJ3A 3DMLA 1NHOA 2FA8A 4MPGA 1F3AA 3GURA 1GLQA 5HFGA 2XBIA 2XBQA 3IC8A 2K6VA 2H1AA 4EKZA 2E2GA 2I81A 3TKPA 1M7TA 3QD9A 4F82A 3VI7A 2L4QA 2DIYA 5DQSA 2A4HA 4MF5A 2HRFA 3A3TA 3IR4A 2O85A 4WKWA 2IMFA 3TB2A 2GLRA 2XHFA 2J9HA 1XXUA 4WR4A 3M9JA 5ELAA 3ERFA 4ECCA 2C3NA 4L0WA 5G1KA 3QCPA 2YZHA 4TRXA 5GSTA 1XWBA 2LJAA 2VL2C 5E59A 2RLIA 1A2MA 3GN3A 1GRXA 1I9DA 2OE3A 3ZL5A 2YP6A 3WYWA 2RM5A 2N5FA 3M9KA 1QFNA 3QFBC 1OC9A 3KH7A 3ZFBA 1V9WA 4ECJA 4FQUA 3GH6A 5AN1A 1DUGA 4N11A 2HZEB 1FOHA 4DVCA 4HSCX 1HNCA 2H76A 3KH9A 1KNGA 1HNAA 1ZYPA 6GSSA 5D9XA 1B48A 1TI1A 3I43A 3Q74A 3CXGA 4I5QA 2YJHA 3KCMA 3HVXA 4HQSA 4Z2UA 2IFQB 4XS4A 1A8YA 1GTBA 1E2YA 2LS5A 4GXZA 1RQMA 1SKWB 3GX0A 2FUG2 3TKSE 2RUEA 3BOAA 3CYNA 2WJUA 3TKSC 1S3RA 5FHIA 1T3BA 4JRRA 4WF5A 2ZNMA 2WS2A 3F4TA 1ZZYA 4PX1A 1O73A 2JZTA 1OKDA 3TJJA 5G31A 4H86A 3UMAA 2MBSA 4Q5RA 3DEXA 3W8JA 5CAXA 2NTOA 1XW9A 1QMVA 2L6DA 1T1VA 5ECMB 3MNGA 1F9MA 2YWIA 4KCAA 4OWYA 3Q18A 1IYIA 5CP1A 4GQFA 2UZ8A 4KCEA 3EURA 4WXTA 4YQMA 2GQKA 3LYKA 2MMOA 1FB0A 4NXIA 5IOXA 2PGTA 5BRTA 2C1YA 1ZMAA 3PGTA 3HJOA 3EU3A 5HR0A 5DJLA 1HQOA 5HFIA 4X1UA 1BG5A 3H8QA 3F6DA 4MJBA 4ID0A 2L6CA 4LA1A 1YDKA 1M2BA 4OO5A 2YV9A 3PINA 2B5XA 3HCZA 2WDUA 4NWYA 4Q5NA 5CYYA 5BMUA 4HDEA 4XIHA 3EPTA 3BCKA 3VWWA 4ICYA 3SBCA 1TOFA 1B4QA 3GIXA 3IV4A 2H66A 5ECNB 2IPAA 5ELGA 2MMZA 1TK0B 4L5LA 5EPFA 3WD6A 1V40A 2PU9C 3FY7A 2V41A 2O7KA 3RPPA 3L0HA 2A2SA 5J4UA 2OBIA 2H19A 5AIXA 1R5AA 3IXRA 2YWMA 3EU4A 4BWQA 3J7Yk 2VL9A 5GSSA 1YY7A 1M3IA 12GSA 1EWXA 1XFLA 2H6YA 2DC5A 3F0IA 3IRAA 4JZQA 3U6VA 5DAKB 1O8WA 2VCQA 2JSZA 2GTUA 1G7EA 1BQ7A 1Z6MA 1R26A 4TXOA 3H93A 1SJ6A 1W4VA 4HZ2A 2AJQB 1THOA 3GTUA 3LG6A 3L9SA 4KDUA 1MDKA 1TW9A 3PH9A 1F37A 5KOXA 2IJYA 3J7Yb 2YN1A 4IN0A 3O3TA 2DJ1A 4OFTA 4E8HA 1VRSD 1X9SB 4ILFA 4NAXA 3FR3A 1O8XA 4NPBA 4LLRA 2F3MA 4LMWA 1FB6A 2CX4A 2AAWA 3LQ7A 5ENUA 2L5OA 3NIVA 4I8BA 3HDCA 1XW5A 1O7UA 4MH2A 1N8JA 1U87A 2H72A 2YCDA 1GUKA 2PMTA 2K18A 1GLPA 1ST9A 2EC4A 3GKXA 1LBKA 3C71A 4JBBA 4MMMA 4EIQA 3NZNA 2OA7A 3UVHA 5GZZB 2EIQA 5IO2A 2VM2A 2GZYA 1A23A 1J0FA 1GSEA 1ACVA 4BPYA 5ID2A 4ACSA 2HYXA 2GVPA 2YOIA 3A5WA 5COHA 3HYPA 1X5CA 4IHUA 2IL3A 2WFCA 3A2XA 1EEJA 3DWVA 1BAYA 4OD7A 2FGXA 1F3BA 1G6WA 3BJ5A 1T8EB 5FT3A 2EIOA 3M0FA 5EVOA 1MD3A 1U6TA 4KSMA 4XS6A 1CQGA 1GWCA 2B6MA 3ME8A 2PERA 2R0PA 4OFNA 1M3JA 4OCFA 2GSTA 1VF2A 1OYJA 3RAZA 3VURA 1NSWA 5JWRB 1FOVA 2ON5A 2QA2A 4AJ7A 2I4AA 1GUMA 2R6KA 4BWSA 3MYDA 3QAVA 4TR3A 2F9SA 1LJRA 3EYTA 2HSMA 5J9CA 4MZBA 4ZB8A 5DDLA 4D73B 5D9VA 2PBJA 1K0NA 5CREA 2B7JA 4G9HA 3GSSA 4BVXA 5IO0A 1PQNA 5INYA 3ZZXA 5ECQB 3LJRA 5H5SA 4K7IA 2NPBA 1WJKA 4N10A 4Q5QA 3G7IA 3L9VA 2H6ZA 4POMA 2R2JA 1A0FA 2X99A 3G9BA 1OC3A 4HU7A 2WZ9A 5AISA 2HSYA 2LUSA 3TKQA 1Z3EA 4GCIA 4O5UA 1J08A 1M2DA 1S3DA 2NBSA 1Z7PA 3CMIA 5E4WA 4MA9A 1M0UA 4EO3A 4N0VA 3FK8A 3KD0A 3QPMA 4KE3A 3U5RE 4ZBAA 4FH8A 3HVNA 2DJ0A 3QFAC 5D8IA 4XRAA 1XWAA 4I6XA 4G0LA 2F8AA 3KIJA 2LJRA 1JZRA 1JZDA 3FZ5A 3NOFA 1YZXA 1Q4JA 1YKAA 2IN3A 1UVZA 4XS4B 4Z2RA 4L5OA 2VLUA 1T00A 4WBJA 2DMMA 4IQAA 2LJKA 2NDOA 1F2EA 1MEKA 2F51A 3MAKA 3ZVJA 2YWNA 4ML6A 2V6KA 1ZYQB 4ZB9A 5J3RA 4AJ6A 3UBLA 4IGJA 2H75A 3W6GA 1A8LA 2LRNA 5IMDA 2OJLA 1TJDA 1WIKA 4EDYA 2LRTA 1QK8A 4EL1A 1FW1A 3TJBA 4JEDA 1ABAA 1TRWA 1SENA 1V98A 1BJXA 1SK2A 5DALA 3P90A 3GA4A 5IMZA 5D73A 2JZRA 4K8MA 2AB6A 4TXVA 5J41A 5EL8A 3QDNA 2CX3A 1T4ZA 2WRTA 2RM6A 4IKHA 1EV4A 3CSJA 4I2UA 4MH3A 1R4WA 4HU9A 2CVKA 3HA9A 4WETA 2HNLA 1G0TA 2OADA 1GSYA 4Q5FA 1PX7A 1GSUA 2K9FA 5A4VA 1AQXA 3C1SA 5AIVA 2LEGA 3C73A 1XPVA 2WULA 2LTKA 1AAZA 1E6BA 2H0HA 1MTCA 1WOUA 4TN8A 4K0NA 5D9TA 19GSA 3GKMA 4FYBA 3VLNA 4IJ3A 5GAPD 4WR5A 2VL3A 2YV7A 18GSA 2H6XA 1AUCA 1TRSA 2VO4A 3UBKA 4PQ1A 2WB9A 1XBSA 5IMCA 3GSTA 2C8UA 2ALBA 4BL7A 2DJKA 4PNFA 5A4UA 4J56E 5C00A 3A2WA 1CQHA 4TR4A 3ZRDA 1JZOA 1FVKA 4MZWA 1WE0A 3FRCA 1FVJA 3HD5A 2EIRA 5ECHB 2I1UA 4G2EA 4MZCA 1EP8A 1XVQA 2KHPA 3QR6A 3TJGA 4QL9A 4V2MA 4TR1A 1T4YA 3O6TA 4FYUA 4MDCA 4O5QA 3ZYWA 1THXA 2CVBA 1AW9A 2C80A 3ZVJD 2CZ2A 3FR9A 2CZ3A 1Y6EA 2O8VB 1H75A 3D21A 2LSTA 3CSHA 3DXBA 2MMAA 3LGCA 1F6MC 2VUPA 2VCWA 5LCZA 2N5AA 3ERGA 4GLTA 1Z7RA 1ZOFA 17GSA 2GT5A
chains in the Genus database with same CATH topology
1DE2A 1PRXA 3C7MA 3ZITA 2YWOA 2H30A 4Z2TA 5D96A 4USSA 4ULXA 3LFLA 16GSA 6GSXA 5F05A 4ISDA 4MF6A 4MLYA 2C0GA 1SU9A 1EOHA 3KP8A 1JHBA 2REMA 3DRNA 2Z9SA 3DVXA 4G0IA 4QQ7A 1G7OA 3IOSA 4EXJA 5D9WA 4K7NA 1X9MB 1XZOA 4J2FA 4K0GA 1SL0B 1PD21 3F9UA 1ERUA 4F0CA 5KN3A 1DE1A 3G7YA 4TW5A 2YANA 1GL8A 2AUVA 1TTZA 1YEXA 4PNGA 1PSQA 4RI7A 2VOCA 5HQPA 4YAPA 4IELA 4CHSA 2JADA 4OMVA 2DMLA 3F4SA 4I97A 1HNBA 5B8AA 4DSSA 1EP7A 3TRQA 1SKRB 3F63A 3E9JB 5ECPB 4YKGA 5CRGA 4KW6A 4AJ8A 1OAZA 3O76A 5IMFA 1OE7A 3IE3A 3VI5A 2K8VA 3UVTA 4L0UA 4NHWA 1U88A 1UA5A 1BEDA 5DCHA 1LU4A 1SL1B 5IOWA 3VWXA 1WWJA 4MABA 3LXTA 1QQ2A 5ECKB 3OR5A 2E2MA 5KEJA 3EE2A 3FR6A 2GSRA 3GYKA 3ERWA 4WF4A 5J9BA 2VD1A 3WT2A 1ZGNA 4HUAA 3I9V2 4MJEA 2PVQA 3Q6OA 1KEBA 3HZ8A 2M46A 2V32A 2CQ9A 1XVWA 3M8NA 2AYTA 2V1MA 2X8CA 3IPZA 3TOTA 1XCCA 1URMA 4ZIJA 4FYCA 2L5LA 1X5EA 1XWKA 4GTUA 3TUEA 2FLSA 2H0GA 2LV3A 3IHQA 1SD8A 1SYRA 5L71A 4E8EA 4CW9A 4BVYA 3IHGA 4O32A 2HZEA 4O92A 1TXXA 3GKKA 4RQRA 1DBYA 5G1LA 4K7OA 4YKFA 5FWGA 5KN0A 3RDWA 2ON7A 3ZMKA 2K8SA 5JCGA 1X9WB 3TGZA 3APOA 2GS3A 3D6IA 4GWRA 2IFQA 2H1GA 4XS1A 4HOJA 2O89A 3F8UA 2HRKA 4G19A 3ED3A 2VLVA 4EUYA 2JZSA 3TJKA 4K5RA 4KDYA 1GSSA 1A24A 3BD2A 1TU7A 2HE3A 3GUSA 4OO4A 4ZB6A 1ERVA 2RUFA 4TOPA 1K0MA 2L59A 3GFKA 2GGTA 3FEUA 3GL5A 2HT9A 2CVDA 5HR1A 3E0UA 4POLA 3QOUA 8GSSA 2VIMA 2QGVA 3D22A 3FKFA 1O6JA 1YJ6A 3ZLPA 5IM9A 2DBCA 3KXOA 1AQWA 1BYEA 3DGQA 1A2LA 3L4NA 2XPDA 2OACA 1PN9A 4FIWA 2B1KA 3S9FA 5H5RA 1FO5A 3FZAA 1PN0A 3IC4A 5G30A 5DALB 2AHEA 1OVNA 1M9AA 2VL2A 3TOUA 2JACA 3WGEA 1ERTA 4YAVA 4TR0A 3ZIVA 1PKZA 2HRAA 3GX8A 3SWLA 1DSBA 2IMDA 3UARA 4KSOA 2ZUPA 1EEMA 3GKNA 1GSDA 4KGIA 2GSSA 3DIEA 2HLSA 4EF0A 1VGLA 4ZL7A 5EY6A 4N30A 5A4WA 4MNNA 1S3AA 5CRWA 2HZFA 3TKRA 4X0XA 3QMXA 4TKYA 4BA7A 4POBA 1K3YA 1B9YC 3CSIA 1SKSB 1GSFA 5A5KA 1SJZA 1A2JA 2CA8A 3TKSA 2A2RA 1UC7A 2JSYA 5J5NA 2KP1A 1UN2A 3F3QA 5CRDA 4MK3A 2B5EA 4RQXA 1V2AA 2AV4A 3HKRA 5CRHA 3I69A 3KMOA 4JR6A 4V2LA 1GNEA 2LRCA 4ML1A 3W8SA 2KOKA 4KAEA 3VWUA 3RHCA 5DAKA 1AXDA 5IIZA 2IIYA 2BMXA 1OC9B 1PL1A 3FZ9A 1ZYEA 2QSIA 2NVLA 2FWEA 3P8WA 1A0RP 2X8HA 2GSQA 3VWVA 7GSSA 3KTLA 1NW2A 2HRNA 3K8NA 1PX6A 3TJFA 4IP1A 2I3YA 4I2TA 2YZUA 1MDIA 4WBRD 1HD2A 4K9ZA 3VK9A 3DD3A 4HS1A 3F4RA 1Z9HA 3TRPA 1K3OA 4EC0A 4J57E 1W89A 4OFMA 4KUNA 3EINA 3P7XA 3APSA 3N5OA 1X5DA 4EE0A 1ZL9A 2H8LA 2VCXA 2DSAA 6GSVA 3MDKA 2G2QA 2RIIA 1QGVA 3RPNA 2CAIA 3V1WA 4GQCA 2WGRA 4V1Ap 3L78A 1GTUA 2C4JA 1T7PB 2BJXA 4EDZA 1V58A 2P31A 4NHZA 4O7HA 2QA1A 2YPMA 3IDVA 4KA0A 1KTEA 3ZIJA 2PPTA 3CBUA 5DCGA 3LXZA 4JU5A 2PVOC 2LKUA 4GSTA 5DVBA 5B8BA 1QUWA 4XRDA 3HXSA 5IPHA 5IMAA 2MYGA 3C8EA 4KH7A 2I9HA 5ECOB 2DIZA 2VCTA 1FG4A 1EGOA 1TKDB 2PWJA 1ON4A 5B7CA 1EV9A 2R0CA 1TRUA 5IQYA 5IPGA 1JLWA 5G2ZA 3IA1A 6GSYA 2HSHA 5KN1A 1ERWA 4OCEA 1JLVA 2H0IA 5JWQB 1H4OA 2H71A 2C3TA 3LORA 3M3MA 4F9ZA 2JU5A 4TVEA 4D73A 1K0AA 3G7JA 1J9BA 1V57A 2VM1A 4ZBDA 3US3A 1TU8A 3FZ4A 4KNDA 3F3RA 5DQYA 2X49A 1K0OA 4PGTA 1PL2A 3UAPA 4XHMA 4IS0A 4AGSA 3EWLA 5ABRA 2QKEA 2A4VA 3EMPA 1EOGA 4MJCA 4TXOB 5C04A 2MZCA 3UJ1A 2TRCP 2XC2A 3GTUB 4ZL9A 4BVYB 1R7HA 5B6MA 4WEYA 3A5IA 4ZILA 1AIUA 1Z5YE 4EIPA 4CY8A 6GSTA 1C72A 5B6NA 4L8EA 1O81A 4G0KA 3PPUA 2G0FA 1NHYA 4PURA 3CTGA 1WP0A 5G5EA 3KTBA 4HJMA 3IAS2 5JWOB 20GSA 5F8BA 1U3AA 2J23A 3DYRA 2MMNA 1QXHA 3D4TA 2IMKA 1XW6A 1USBA 2IMEA 2P5RA 4F03A 4GSSA 4YH2A 3IBHA 3GMFA 1OE8A 4ECBA 3KMNA 4FO5A 4MF7A 4V2NA 2H70A 4HI7A 1VF4A 1PA3A 1WMJA 1EGRA 4LL4B 4PUAA 4KF9A 4CDOA 5ID2B 3HVSA 1JFUA 3ZTLA 1IYHA 2B3SA 1ZYNA 3KJYA 3GL3A 1B4PA 2GDRA 1PMTA 4PQHA 4ZBBA 4MP4A 1SJIA 2PUKC 1ML6A 2V2GA 3Q19A 4IP6A 1GTIA 1YKCA 2CT6A 3GV1A 2L4CA 3C1RA 3VFIA 2XPEA 3F6FA 4YQVA 3AY8A 1GTAA 2FNOA 4NMUA 5G5FA 1YF1A 1JZWA 2H01A 3RBTA 3P2AA 2YNXA 3QAGA 3JCML 4A5PA 1B9XC 3M1GA 4MPFA 2M72A 2M80A 3WGDA 2HI7A 2LNTA 4MJAA 1TDIA 1MD4A 4POKA 5HR3A 5F06A 3VPQA 2CV4A 1XIYA 3FHKA 3UL3A 3WGXA 3MWHA 4BVXB 4RI6A 5CNWA 1WPIA 4HZ4A 4XTSA 3GRXA 2LQQA 2DJ2A 1N2AA 2C3QA 4O5RA 3GNJA 2DKIA 1U3IA 1G6YA 6GSWA 3HHVA 3H4KA 5H5QA 4KX4A 2JL4A 3WT1A 3CTFA 4IW9A 3APQA 1R5PA 4N0ZA 3D4MA 1MDJA 3HJMA 1ZCPA 2A2PA 10GSA 5ECRB 4YQUA 4DEJA 3FMWA 4RUVA 3LYPA 2R3XA 3DVWA 2O87A 4G10A 1M2AA 4K2XA 5JCUA 3TDGA 2C0FA 1SK1A 1RK4A 4PUFC 2ZCTA 2H1BA 3RHBA 2FCHA 3BBYA 1K0DA 1RW1A 4ZL8A 9GSSA 3LWAA 3L9UA 2IMIA 4DSRA 1SL2B 4P3YB 1FAAA 2GZPA 3KEBA 1TRVA 5JCWA 2B7KA 4MCUA 2OE1A 2TRXA 2R37A 1SYXA 1XWGA 4JE1A 1GULA 2WCIA 5LD0A 1YQ1A 1YF0A 3D5JA 3ME7A 1TK5B 2FHEA 1GNWA 1TI3A 4PXOA 1SD9A 1FHEA 1S3CA 2IWTA 3CRUA 1NM3A 4F2IA 3EC3A 4XCSA 2KP2A 5ECIB 2R4VA 1XOAA 1AC1A 22GSA 1VF3A 4CY6A 1YEPA 5AGYA 4LMVA 2OE0A 2E0QA 2VCVA 5F07A 3KGKA 2FD3A 1ILOA 4HJ2A 2YJ7A 4IQ1A 2TIRA 4X4JA 3R2QA 1GUHA 3A2VA 5DBQA 1X0RA 3EVIA 1GP1A 2DKHA 1TK8B 1XOBA 14GSA 1HYUA 2R5GA 2B1LA 1SK0A 2VAFA 3KM6A 2BTOT 6GSUA 4HEA2 3HY2A 3IK9A 4HQZA 2LQOA 2E7PA 1EZKA 4IBPA 5KOWA 5F0GA 2V6OA 3BCIA 3N9JA 3HVVA 2KUCA 3CRTA 5CO3A 1OKTA 4ECIA 2C0EA 2X4AA 3MSZA 1K0CA 2HFDA 2F8FA 1PKWA 3TCOA 2VLTA 4BL7B 1K0BA 2GZZA 3FW2A 3IAM2 3GH9A 1M99A 2OBKA 2KLXA 2P5QA 11GSA 4TR1B 4EVMA 2DJJA 2R0GA 2CAQA 4IVFA 1K3LA 1M9BA 13GSA 4K2DA 4K6XA 3HJPA 3ZFLA 4DSQA 2X64A 3LSZA 3FYGA 5IMVA 4Z7XA 5ECSA 4NV2A 4PTSA 2MBTA 4X43A 2B5YA 2P0GA 1WRYA 3ISOA 4GSNA 3I6AA 3LEFA 3VPTA 3QAWA 2DLXA 2VD0A 2OKAA 3MIXA 3KZQA 1BX9A 3KP9A 3IK7A 2L57A 4K1FA 4F0BA 5DJMA 3EMXA 1PGTA 2QC7A 3TRXA 2LNSA 3UIWA 2N5BA 4QL7A 4IJIA 1XWCA 1OC8A 2FY6A 5GAND 3UEMA 3D0ZA 1AQVA 1TP9A 1KBNA 5HR2A 5ECLB 4GRFA 2H74A 4NV5A 4K5SA 1GSQA 2D2ZA 2HXKA 4LL1B 3DKSA 1O85A 2GT6A 4V1Ag 5HFKA 3H1NA 4ZXGA 2ES7A 4GF0A 2X8GA 3R3EA 2FA4A 3GHAA 3E3EA 2FWFA 2H1DA 4AF2A 3H79A 2FWHA 5KN2A 1I5GA 2GQLA 3HZ4A 5D93A 1Y25A 2GQMA 1Q98A 4JR4A 1GH2A 2VCZA 2PN8A 3ZREA 3PR8A 4DSSB 3UOMA 4KDXA 1B8XA 5LNKe 3ZMLA 3LW9A 4KB3A 2H73A 2C0DA 1Z6NA 4PQIA 1VF1A 2FWGA 2DJ3A 3DMLA 1NHOA 2FA8A 4MPGA 1F3AA 3GURA 1GLQA 5HFGA 2XBIA 2XBQA 3IC8A 2K6VA 2H1AA 4EKZA 2E2GA 2I81A 3TKPA 1M7TA 3QD9A 4F82A 3VI7A 2L4QA 2DIYA 5DQSA 2A4HA 4MF5A 2HRFA 3A3TA 3IR4A 2O85A 4WKWA 2IMFA 3TB2A 2GLRA 2XHFA 2J9HA 1XXUA 4WR4A 3M9JA 5ELAA 3ERFA 4ECCA 2C3NA 4L0WA 5G1KA 3QCPA 2YZHA 4TRXA 5GSTA 1XWBA 2LJAA 2VL2C 5E59A 2RLIA 1A2MA 3GN3A 1GRXA 1I9DA 2OE3A 3ZL5A 2YP6A 3WYWA 2RM5A 2N5FA 3M9KA 1QFNA 3QFBC 1OC9A 3KH7A 3ZFBA 1V9WA 4ECJA 4FQUA 3GH6A 5AN1A 1DUGA 4N11A 2HZEB 1FOHA 4DVCA 1HNCA 2H76A 3KH9A 1KNGA 1HNAA 1ZYPA 6GSSA 5D9XA 1B48A 1TI1A 3I43A 3Q74A 3CXGA 4I5QA 2YJHA 3KCMA 3HVXA 4HQSA 4Z2UA 2IFQB 4XS4A 1A8YA 1GTBA 1E2YA 2LS5A 4GXZA 1RQMA 1SKWB 3GX0A 2FUG2 3TKSE 2RUEA 3BOAA 3CYNA 2WJUA 3TKSC 5FHIA 1T3BA 4JRRA 4WF5A 2ZNMA 2WS2A 3F4TA 1ZZYA 4PX1A 1O73A 2JZTA 1OKDA 3TJJA 5G31A 4H86A 3UMAA 2MBSA 4Q5RA 3DEXA 3W8JA 5CAXA 2NTOA 1XW9A 1QMVA 2L6DA 1T1VA 5ECMB 3MNGA 1F9MA 2YWIA 4KCAA 4OWYA 3Q18A 1IYIA 5CP1A 4GQFA 2UZ8A 4KCEA 3EURA 4WXTA 4YQMA 2GQKA 3LYKA 2MMOA 1FB0A 4NXIA 5IOXA 2PGTA 5BRTA 2C1YA 1ZMAA 3PGTA 3HJOA 3EU3A 5HR0A 5DJLA 1HQOA 5HFIA 4X1UA 1BG5A 3H8QA 3F6DA 4MJBA 4ID0A 2L6CA 4LA1A 1YDKA 1M2BA 4OO5A 2YV9A 3PINA 2B5XA 3HCZA 2WDUA 4NWYA 4Q5NA 5CYYA 5BMUA 4HDEA 4XIHA 3EPTA 3BCKA 3VWWA 4ICYA 3SBCA 1TOFA 1B4QA 3GIXA 3IV4A 2H66A 5ECNB 2IPAA 5ELGA 2MMZA 1TK0B 4L5LA 5EPFA 3WD6A 1V40A 2PU9C 3FY7A 2V41A 2O7KA 3RPPA 3L0HA 2A2SA 5J4UA 2OBIA 2H19A 5AIXA 1R5AA 3IXRA 2YWMA 3EU4A 4BWQA 3J7Yk 2VL9A 5GSSA 1YY7A 12GSA 1EWXA 1XFLA 2H6YA 2DC5A 3F0IA 3IRAA 4JZQA 3U6VA 5DAKB 1O8WA 2VCQA 2JSZA 2GTUA 1G7EA 1BQ7A 1Z6MA 1R26A 4TXOA 3H93A 1SJ6A 1W4VA 4HZ2A 2AJQB 1THOA 3GTUA 3LG6A 3L9SA 4KDUA 1MDKA 1TW9A 3PH9A 1F37A 5KOXA 2IJYA 3J7Yb 2YN1A 4IN0A 3O3TA 2DJ1A 4OFTA 4E8HA 1VRSD 1X9SB 4ILFA 4NAXA 3FR3A 1O8XA 4NPBA 4LLRA 2F3MA 4LMWA 1FB6A 2CX4A 2AAWA 3LQ7A 5ENUA 2L5OA 3NIVA 4I8BA 3HDCA 1XW5A 1O7UA 4MH2A 1N8JA 1U87A 2H72A 2YCDA 1GUKA 2PMTA 2K18A 1GLPA 1ST9A 2EC4A 3GKXA 1LBKA 3C71A 4JBBA 4MMMA 4EIQA 3NZNA 2OA7A 3UVHA 5GZZB 2EIQA 5IO2A 2VM2A 2GZYA 1A23A 1J0FA 1GSEA 1ACVA 4BPYA 5ID2A 4ACSA 2HYXA 2GVPA 2YOIA 3A5WA 5COHA 3HYPA 1X5CA 4IHUA 2IL3A 2WFCA 3A2XA 1EEJA 3DWVA 1BAYA 4OD7A 2FGXA 1F3BA 1G6WA 3BJ5A 1T8EB 5FT3A 2EIOA 3M0FA 5EVOA 1MD3A 1U6TA 4KSMA 4XS6A 1CQGA 1GWCA 2B6MA 3ME8A 2PERA 2R0PA 4OFNA 4OCFA 2GSTA 1VF2A 1OYJA 3RAZA 3VURA 1NSWA 5JWRB 1FOVA 2ON5A 2QA2A 4AJ7A 2I4AA 1GUMA 2R6KA 4BWSA 3MYDA 3QAVA 4TR3A 2F9SA 1LJRA 3EYTA 2HSMA 5J9CA 4MZBA 4ZB8A 5DDLA 4D73B 5D9VA 2PBJA 1K0NA 5CREA 2B7JA 4G9HA 3GSSA 4BVXA 5IO0A 1PQNA 5INYA 3ZZXA 5ECQB 3LJRA 5H5SA 4K7IA 2NPBA 1WJKA 4N10A 4Q5QA 3G7IA 3L9VA 2H6ZA 4POMA 2R2JA 1A0FA 2X99A 3G9BA 1OC3A 4HU7A 2WZ9A 5AISA 2HSYA 2LUSA 3TKQA 1Z3EA 4GCIA 4O5UA 1J08A 1M2DA 1S3DA 2NBSA 1Z7PA 3CMIA 5E4WA 4MA9A 1M0UA 4EO3A 4N0VA 3FK8A 3KD0A 3QPMA 4KE3A 3U5RE 4ZBAA 4FH8A 2DJ0A 3QFAC 5D8IA 4XRAA 1XWAA 4I6XA 4G0LA 2F8AA 3KIJA 2LJRA 1JZRA 1JZDA 3FZ5A 3NOFA 1YZXA 1Q4JA 1YKAA 2IN3A 1UVZA 4XS4B 4Z2RA 4L5OA 2VLUA 1T00A 4WBJA 2DMMA 4IQAA 2LJKA 2NDOA 1F2EA 1MEKA 2F51A 3MAKA 3ZVJA 2YWNA 4ML6A 2V6KA 1ZYQB 4ZB9A 5J3RA 4AJ6A 3UBLA 4IGJA 2H75A 3W6GA 1A8LA 2LRNA 5IMDA 2OJLA 1TJDA 1WIKA 4EDYA 2LRTA 1QK8A 4EL1A 1FW1A 3TJBA 4JEDA 1ABAA 1TRWA 1SENA 1V98A 1BJXA 1SK2A 5DALA 3P90A 3GA4A 5IMZA 5D73A 2JZRA 4K8MA 2AB6A 4TXVA 5J41A 5EL8A 3QDNA 2CX3A 1T4ZA 2WRTA 2RM6A 4IKHA 1EV4A 3CSJA 4I2UA 4MH3A 1R4WA 4HU9A 2CVKA 3HA9A 4WETA 2HNLA 1G0TA 2OADA 1GSYA 4Q5FA 1PX7A 1GSUA 2K9FA 5A4VA 1AQXA 3C1SA 5AIVA 2LEGA 3C73A 1XPVA 2WULA 2LTKA 1AAZA 1E6BA 2H0HA 1MTCA 1WOUA 4TN8A 4K0NA 5D9TA 19GSA 3GKMA 4FYBA 3VLNA 4IJ3A 5GAPD 4WR5A 2VL3A 2YV7A 18GSA 2H6XA 1AUCA 1TRSA 2VO4A 3UBKA 4PQ1A 2WB9A 1XBSA 5IMCA 3GSTA 2C8UA 2ALBA 4BL7A 2DJKA 4PNFA 5A4UA 4J56E 5C00A 3A2WA 1CQHA 4TR4A 3ZRDA 1JZOA 1FVKA 4MZWA 1WE0A 3FRCA 1FVJA 3HD5A 2EIRA 5ECHB 2I1UA 4G2EA 4MZCA 1EP8A 1XVQA 2KHPA 3QR6A 3TJGA 4QL9A 4V2MA 4TR1A 1T4YA 3O6TA 4FYUA 4MDCA 4O5QA 3ZYWA 1THXA 2CVBA 1AW9A 2C80A 3ZVJD 2CZ2A 3FR9A 2CZ3A 1Y6EA 2O8VB 1H75A 3D21A 2LSTA 3CSHA 3DXBA 2MMAA 3LGCA 1F6MC 2VUPA 2VCWA 5LCZA 2N5AA 3ERGA 4GLTA 1Z7RA 1ZOFA 17GSA 2GT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE2 A;  1PRX A;  3C7M A;  3ZIT A;  2YWO A;  2H30 A;  5D96 A;  4ULX A;  3LFL A;  16GS A;  6GSX A;  5F05 A;  4ISD A;  4MF6 A;  4MLY A;  2C0G A;  1SU9 A;  1EOH A;  3KP8 A;  1JHB A;  2REM A;  3DRN A;  2Z9S A;  3DVX A;  4QQ7 A;  1G7O A;  3IOS A;  4EXJ A;  5D9W A;  4K7N A;  1X9M B;  1XZO A;  4J2F A;  4K0G A;  1SL0 B;  1PD2 1;  3F9U A;  1ERU A;  4F0C A;  5KN3 A;  1DE1 A;  3G7Y A;  4TW5 A;  2YAN A;  1GL8 A;  2AUV A;  1TTZ A;  1YEX A;  4PNG A;  1PSQ A;  4RI7 A;  2VOC A;  5HQP A;  4YAP A;  4IEL A;  4CHS A;  2JAD A;  4OMV A;  2DML A;  3F4S A;  4I97 A;  1HNB A;  5B8A A;  4DSS A;  1EP7 A;  3TRQ A;  1SKR B;  3F63 A;  3E9J B;  5ECP B;  5CRG A;  4KW6 A;  4AJ8 A;  1OAZ A;  3O76 A;  5IMF A;  1OE7 A;  3IE3 A;  3VI5 A;  2K8V A;  3UVT A;  4L0U A;  4NHW A;  1U88 A;  1UA5 A;  1BED A;  5DCH A;  1LU4 A;  1SL1 B;  5IOW A;  3VWX A;  1WWJ A;  4MAB A;  3LXT A;  1QQ2 A;  5ECK B;  3OR5 A;  2E2M A;  5KEJ A;  3EE2 A;  3FR6 A;  2GSR A;  3GYK A;  3ERW A;  4WF4 A;  5J9B A;  2VD1 A;  3WT2 A;  1ZGN A;  4HUA A;  3I9V 2;  4MJE A;  2PVQ A;  3Q6O A;  1KEB A;  3HZ8 A;  2M46 A;  2V32 A;  2CQ9 A;  1XVW A;  3M8N A;  2AYT A;  2V1M A;  2X8C A;  3IPZ A;  3TOT A;  1XCC A;  1URM A;  4ZIJ A;  4FYC A;  2L5L A;  1X5E A;  1XWK A;  4GTU A;  3TUE A;  2FLS A;  2H0G A;  2LV3 A;  3IHQ A;  1SD8 A;  1SYR A;  5L71 A;  4E8E A;  4CW9 A;  4BVY A;  4O32 A;  2HZE A;  4O92 A;  1TXX A;  3GKK A;  4RQR A;  1DBY A;  5G1L A;  4K7O A;  5FWG A;  5KN0 A;  3RDW A;  2ON7 A;  3ZMK A;  2K8S A;  5JCG A;  1X9W B;  3TGZ A;  3APO A;  2GS3 A;  3D6I A;  4GWR A;  2IFQ A;  2H1G A;  4XS1 A;  4HOJ A;  2O89 A;  3F8U A;  4G19 A;  3ED3 A;  2VLV A;  4EUY A;  2JZS A;  3TJK A;  4KDY A;  1GSS A;  1A24 A;  3BD2 A;  1TU7 A;  2HE3 A;  3GUS A;  4OO4 A;  4ZB6 A;  1ERV A;  2RUF A;  4TOP A;  1K0M A;  2L59 A;  3GFK A;  2GGT A;  3FEU A;  3GL5 A;  2HT9 A;  2CVD A;  5HR1 A;  3E0U A;  4POL A;  3QOU A;  8GSS A;  2VIM A;  2QGV A;  3D22 A;  3FKF A;  1O6J A;  1YJ6 A;  3ZLP A;  5IM9 A;  2DBC A;  3KXO A;  1AQW A;  1BYE A;  3DGQ A;  1A2L A;  3L4N A;  2XPD A;  2OAC A;  1PN9 A;  4FIW A;  2B1K A;  3S9F A;  5H5R A;  1FO5 A;  3FZA A;  3IC4 A;  5G30 A;  5DAL B;  2AHE A;  1OVN A;  1M9A A;  2VL2 A;  3TOU A;  2JAC A;  3WGE A;  1ERT A;  4YAV A;  4TR0 A;  3ZIV A;  1PKZ A;  3GX8 A;  3SWL A;  1DSB A;  2IMD A;  3UAR A;  4KSO A;  2ZUP A;  1EEM A;  3GKN A;  1GSD A;  4KGI A;  2GSS A;  3DIE A;  2HLS A;  4EF0 A;  1VGL A;  4ZL7 A;  5EY6 A;  4N30 A;  5A4W A;  1S3A A;  5CRW A;  2HZF A;  3TKR A;  4X0X A;  3QMX A;  4TKY A;  4BA7 A;  4POB A;  1K3Y A;  1B9Y C;  3CSI A;  1SKS B;  1GSF A;  5A5K A;  1SJZ A;  1A2J A;  2CA8 A;  3TKS A;  2A2R A;  1UC7 A;  2JSY A;  5J5N A;  2KP1 A;  1UN2 A;  3F3Q A;  5CRD A;  4MK3 A;  2B5E A;  4RQX A;  1V2A A;  2AV4 A;  3HKR A;  5CRH A;  3I69 A;  3KMO A;  4JR6 A;  4V2L A;  1GNE A;  2LRC A;  4ML1 A;  3W8S A;  2KOK A;  4KAE A;  3VWU A;  3RHC A;  5DAK A;  1AXD A;  5IIZ A;  2IIY A;  2BMX A;  1OC9 B;  1PL1 A;  3FZ9 A;  1ZYE A;  2QSI A;  2NVL A;  2FWE A;  3P8W A;  1A0R P;  2X8H A;  2GSQ A;  3VWV A;  7GSS A;  3KTL A;  1NW2 A;  2HRN A;  3K8N A;  1PX6 A;  3TJF A;  4IP1 A;  2I3Y A;  4I2T A;  2YZU A;  1MDI A;  4WBR D;  1HD2 A;  4K9Z A;  3VK9 A;  3DD3 A;  4HS1 A;  3F4R A;  1Z9H A;  3TRP A;  1K3O A;  4EC0 A;  4J57 E;  1W89 A;  4OFM A;  4KUN A;  3EIN A;  3P7X A;  3APS A;  3N5O A;  1X5D A;  4EE0 A;  1ZL9 A;  2H8L A;  2VCX A;  2DSA A;  6GSV A;  3MDK A;  2G2Q A;  2RII A;  1QGV A;  3RPN A;  2CAI A;  3V1W A;  4GQC A;  2WGR A;  4V1A p;  3L78 A;  1GTU A;  2C4J A;  1T7P B;  2BJX A;  4EDZ A;  1V58 A;  2P31 A;  4NHZ A;  4O7H A;  2YPM A;  3IDV A;  4KA0 A;  1KTE A;  3ZIJ A;  2PPT A;  3CBU A;  5DCG A;  3LXZ A;  4JU5 A;  2PVO C;  2LKU A;  4GST A;  5DVB A;  5B8B A;  1QUW A;  4XRD A;  3HXS A;  5IPH A;  5IMA A;  2MYG A;  3C8E A;  4KH7 A;  2I9H A;  5ECO B;  2DIZ A;  2VCT A;  1FG4 A;  1EGO A;  1TKD B;  2PWJ A;  1ON4 A;  5B7C A;  1EV9 A;  1TRU A;  5IQY A;  5IPG A;  1JLW A;  5G2Z A;  3IA1 A;  6GSY A;  2HSH A;  5KN1 A;  1ERW A;  4OCE A;  1JLV A;  2H0I A;  5JWQ B;  1H4O A;  2H71 A;  2C3T A;  3LOR A;  3M3M A;  4F9Z A;  2JU5 A;  4TVE A;  4D73 A;  1K0A A;  3G7J A;  1J9B A;  1V57 A;  2VM1 A;  4ZBD A;  3US3 A;  1TU8 A;  3FZ4 A;  4KND A;  3F3R A;  5DQY A;  1K0O A;  4PGT A;  1PL2 A;  3UAP A;  4XHM A;  4IS0 A;  4AGS A;  3EWL A;  5ABR A;  2QKE A;  2A4V A;  3EMP A;  1EOG A;  4MJC A;  4TXO B;  5C04 A;  2MZC A;  3UJ1 A;  2TRC P;  2XC2 A;  3GTU B;  4ZL9 A;  1R7H A;  5B6M A;  4WEY A;  4ZIL A;  1AIU A;  1Z5Y E;  6GST A;  1C72 A;  5B6N A;  4L8E A;  1O81 A;  2G0F A;  1NHY A;  4PUR A;  3CTG A;  1WP0 A;  5G5E A;  3KTB A;  4HJM A;  3IAS 2;  5JWO B;  20GS A;  5F8B A;  1U3A A;  2J23 A;  3DYR A;  2MMN A;  1QXH A;  3D4T A;  2IMK A;  1XW6 A;  1USB A;  2IME A;  2P5R A;  4F03 A;  4GSS A;  4YH2 A;  3IBH A;  3GMF A;  1OE8 A;  4ECB A;  3KMN A;  4FO5 A;  4MF7 A;  2H70 A;  4HI7 A;  4V2N A;  1VF4 A;  1PA3 A;  1WMJ A;  1EGR A;  4LL4 B;  4PUA A;  4CDO A;  5ID2 B;  3HVS A;  1JFU A;  3ZTL A;  1IYH A;  2B3S A;  3KJY A;  3GL3 A;  1B4P A;  2GDR A;  1PMT A;  4PQH A;  4ZBB A;  4MP4 A;  1SJI A;  2PUK C;  1ML6 A;  2V2G A;  3Q19 A;  4IP6 A;  1GTI A;  1YKC A;  2CT6 A;  3GV1 A;  2L4C A;  3C1R A;  3VFI A;  2XPE A;  3F6F A;  4YQV A;  3AY8 A;  1GTA A;  2FNO A;  4NMU A;  5G5F A;  1YF1 A;  1JZW A;  2H01 A;  3RBT A;  3P2A A;  2YNX A;  3QAG A;  3JCM L;  1B9X C;  3M1G A;  4MPF A;  2M72 A;  2M80 A;  3WGD A;  2HI7 A;  2LNT A;  4MJA A;  1TDI A;  1MD4 A;  4POK A;  5HR3 A;  5F06 A;  3VPQ A;  2CV4 A;  1XIY A;  3FHK A;  3UL3 A;  3WGX A;  3MWH A;  4RI6 A;  5CNW A;  1WPI A;  4HZ4 A;  4XTS A;  3GRX A;  2LQQ A;  2DJ2 A;  1N2A A;  2C3Q A;  4O5R A;  3GNJ A;  1U3I A;  1G6Y A;  6GSW A;  3HHV A;  3H4K A;  5H5Q A;  4KX4 A;  2JL4 A;  3WT1 A;  3CTF A;  4IW9 A;  3APQ A;  1R5P A;  4N0Z A;  3D4M A;  1MDJ A;  3HJM A;  1ZCP A;  10GS A;  5ECR B;  4YQU A;  4DEJ A;  4RUV A;  3LYP A;  2R3X A;  3DVW A;  2O87 A;  4G10 A;  1M2A A;  5JCU A;  3TDG A;  2C0F A;  1SK1 A;  1RK4 A;  4PUF C;  2ZCT A;  2H1B A;  3RHB A;  2FCH A;  3BBY A;  1K0D A;  1RW1 A;  4ZL8 A;  9GSS A;  3LWA A;  3L9U A;  2IMI A;  4DSR A;  1SL2 B;  4P3Y B;  1FAA A;  2GZP A;  3KEB A;  1TRV A;  5JCW A;  2B7K A;  4MCU A;  2OE1 A;  2TRX A;  2R37 A;  1SYX A;  1XWG A;  4JE1 A;  1GUL A;  2WCI A;  5LD0 A;  1YQ1 A;  1YF0 A;  3D5J A;  3ME7 A;  1TK5 B;  2FHE A;  1GNW A;  1TI3 A;  4PXO A;  1SD9 A;  1FHE A;  1S3C A;  2IWT A;  3CRU A;  1NM3 A;  4F2I A;  3EC3 A;  4XCS A;  2KP2 A;  5ECI B;  2R4V A;  1XOA A;  1AC1 A;  22GS A;  1VF3 A;  1YEP A;  5AGY A;  4LMV A;  2OE0 A;  2E0Q A;  2VCV A;  5F07 A;  3KGK A;  2FD3 A;  1ILO A;  4HJ2 A;  2YJ7 A;  4IQ1 A;  2TIR A;  3R2Q A;  1GUH A;  3A2V A;  5DBQ A;  1X0R A;  3EVI A;  1GP1 A;  1TK8 B;  1XOB A;  14GS A;  1HYU A;  2R5G A;  2B1L A;  1SK0 A;  2VAF A;  3KM6 A;  2BTO T;  6GSU A;  4HEA 2;  3HY2 A;  3IK9 A;  4HQZ A;  2LQO A;  2E7P A;  1EZK A;  4IBP A;  5F0G A;  2V6O A;  3BCI A;  3N9J A;  3HVV A;  2KUC A;  3CRT A;  5CO3 A;  1OKT A;  4ECI A;  2C0E A;  3MSZ A;  1K0C A;  2HFD A;  2F8F A;  1PKW A;  3TCO A;  2VLT A;  1K0B A;  2GZZ A;  3FW2 A;  3IAM 2;  3GH9 A;  1M99 A;  2OBK A;  2KLX A;  2P5Q A;  11GS A;  4TR1 B;  4EVM A;  2DJJ A;  2CAQ A;  4IVF A;  1K3L A;  1M9B A;  13GS A;  4K2D A;  4K6X A;  3HJP A;  3ZFL A;  4DSQ A;  2X64 A;  3LSZ A;  3FYG A;  5IMV A;  4Z7X A;  5ECS A;  4NV2 A;  2MBT A;  4X43 A;  2B5Y A;  2P0G A;  1WRY A;  3ISO A;  4GSN A;  3I6A A;  3LEF A;  3VPT A;  3QAW A;  2DLX A;  2VD0 A;  2OKA A;  3KZQ A;  1BX9 A;  3KP9 A;  3IK7 A;  2L57 A;  4K1F A;  4F0B A;  5DJM A;  3EMX A;  1PGT A;  2QC7 A;  3TRX A;  2LNS A;  3UIW A;  2N5B A;  4QL7 A;  4IJI A;  1XWC A;  1OC8 A;  2FY6 A;  5GAN D;  3UEM A;  3D0Z A;  1AQV A;  1TP9 A;  1KBN A;  5HR2 A;  5ECL B;  4GRF A;  2H74 A;  4NV5 A;  1GSQ A;  2D2Z A;  2HXK A;  4LL1 B;  3DKS A;  1O85 A;  2GT6 A;  4V1A g;  5HFK A;  3H1N A;  4ZXG A;  2ES7 A;  4GF0 A;  2X8G A;  2FA4 A;  3GHA A;  3E3E A;  2FWF A;  2H1D A;  4AF2 A;  3H79 A;  2FWH A;  5KN2 A;  1I5G A;  2GQL A;  3HZ4 A;  5D93 A;  1Y25 A;  2GQM A;  1Q98 A;  4JR4 A;  1GH2 A;  2VCZ A;  2PN8 A;  3ZRE A;  3PR8 A;  4DSS B;  3UOM A;  4KDX A;  1B8X A;  5LNK e;  3ZML A;  4KB3 A;  2H73 A;  2C0D A;  1Z6N A;  4PQI A;  1VF1 A;  2FWG A;  2DJ3 A;  3DML A;  1NHO A;  2FA8 A;  4MPG A;  1F3A A;  3GUR A;  1GLQ A;  5HFG A;  2XBI A;  2XBQ A;  2K6V A;  2H1A A;  4EKZ A;  2E2G A;  2I81 A;  3TKP A;  1M7T A;  3QD9 A;  4F82 A;  3VI7 A;  2L4Q A;  2DIY A;  5DQS A;  4MF5 A;  2HRF A;  3A3T A;  3IR4 A;  2O85 A;  4WKW A;  2IMF A;  3TB2 A;  2GLR A;  2XHF A;  2J9H A;  1XXU A;  4WR4 A;  3M9J A;  5ELA A;  3ERF A;  4ECC A;  2C3N A;  4L0W A;  5G1K A;  3QCP A;  2YZH A;  4TRX A;  5GST A;  1XWB A;  2LJA A;  2VL2 C;  5E59 A;  2RLI A;  1A2M A;  3GN3 A;  1GRX A;  1I9D A;  2OE3 A;  3ZL5 A;  2YP6 A;  3WYW A;  2RM5 A;  2N5F A;  3M9K A;  1QFN A;  3QFB C;  1OC9 A;  3KH7 A;  3ZFB A;  1V9W A;  4ECJ A;  3GH6 A;  5AN1 A;  1DUG A;  4N11 A;  2HZE B;  4DVC A;  1HNC A;  2H76 A;  3KH9 A;  1KNG A;  1HNA A;  6GSS A;  5D9X A;  1B48 A;  1TI1 A;  3I43 A;  3Q74 A;  3CXG A;  4I5Q A;  2YJH A;  3KCM A;  3HVX A;  4HQS A;  2IFQ B;  4XS4 A;  1A8Y A;  1GTB A;  1E2Y A;  2LS5 A;  4GXZ A;  1RQM A;  1SKW B;  3GX0 A;  2FUG 2;  3TKS E;  2RUE A;  3BOA A;  3CYN A;  2WJU A;  3TKS C;  5FHI A;  1T3B A;  4JRR A;  4WF5 A;  2ZNM A;  2WS2 A;  3F4T A;  1ZZY A;  4PX1 A;  1O73 A;  2JZT A;  1OKD A;  3TJJ A;  5G31 A;  4H86 A;  3UMA A;  2MBS A;  4Q5R A;  3DEX A;  3W8J A;  5CAX A;  2NTO A;  1XW9 A;  1QMV A;  2L6D A;  1T1V A;  5ECM B;  3MNG A;  1F9M A;  2YWI A;  4KCA A;  4OWY A;  3Q18 A;  1IYI A;  5CP1 A;  4GQF A;  4KCE A;  3EUR A;  4WXT A;  4YQM A;  2GQK A;  3LYK A;  2MMO A;  1FB0 A;  4NXI A;  5IOX A;  2PGT A;  2C1Y A;  1ZMA A;  3PGT A;  3HJO A;  3EU3 A;  5HR0 A;  5DJL A;  1HQO A;  5HFI A;  4X1U A;  1BG5 A;  3H8Q A;  3F6D A;  4MJB A;  4ID0 A;  2L6C A;  4LA1 A;  1YDK A;  1M2B A;  4OO5 A;  2YV9 A;  3PIN A;  2B5X A;  3HCZ A;  2WDU A;  4NWY A;  4Q5N A;  5CYY A;  4HDE A;  4XIH A;  3BCK A;  3VWW A;  3SBC A;  1TOF A;  1B4Q A;  3GIX A;  3IV4 A;  2H66 A;  5ECN B;  2IPA A;  5ELG A;  2MMZ A;  1TK0 B;  4L5L A;  5EPF A;  3WD6 A;  1V40 A;  2PU9 C;  3FY7 A;  2V41 A;  2O7K A;  3RPP A;  3L0H A;  2A2S A;  5J4U A;  2OBI A;  2H19 A;  5AIX A;  1R5A A;  3IXR A;  2YWM A;  3EU4 A;  4BWQ A;  3J7Y k;  2VL9 A;  5GSS A;  1YY7 A;  12GS A;  1EWX A;  1XFL A;  2H6Y A;  2DC5 A;  3F0I A;  3IRA A;  4JZQ A;  3U6V A;  5DAK B;  1O8W A;  2VCQ A;  2JSZ A;  2GTU A;  1G7E A;  1BQ7 A;  1Z6M A;  1R26 A;  4TXO A;  3H93 A;  1SJ6 A;  1W4V A;  4HZ2 A;  2AJQ B;  1THO A;  3GTU A;  3LG6 A;  3L9S A;  4KDU A;  1MDK A;  1TW9 A;  3PH9 A;  1F37 A;  2IJY A;  3J7Y b;  2YN1 A;  4IN0 A;  3O3T A;  2DJ1 A;  4OFT A;  4E8H A;  1VRS D;  1X9S B;  4ILF A;  4NAX A;  3FR3 A;  1O8X A;  4NPB A;  4LLR A;  2F3M A;  4LMW A;  1FB6 A;  2CX4 A;  2AAW A;  3LQ7 A;  5ENU A;  2L5O A;  3NIV A;  4I8B A;  3HDC A;  1XW5 A;  1O7U A;  4MH2 A;  1N8J A;  1U87 A;  2H72 A;  2YCD A;  1GUK A;  2PMT A;  2K18 A;  1GLP A;  1ST9 A;  2EC4 A;  3GKX A;  1LBK A;  3C71 A;  4JBB A;  4MMM A;  3NZN A;  2OA7 A;  3UVH A;  5GZZ B;  2EIQ A;  5IO2 A;  2VM2 A;  2GZY A;  1A23 A;  1J0F A;  1GSE A;  1ACV A;  4BPY A;  5ID2 A;  4ACS A;  2HYX A;  2GVP A;  2YOI A;  3A5W A;  5COH A;  3HYP A;  1X5C A;  4IHU A;  2IL3 A;  2WFC A;  3A2X A;  1EEJ A;  3DWV A;  1BAY A;  4OD7 A;  2FGX A;  1F3B A;  1G6W A;  3BJ5 A;  1T8E B;  5FT3 A;  2EIO A;  3M0F A;  5EVO A;  1MD3 A;  1U6T A;  4KSM A;  4XS6 A;  1CQG A;  1GWC A;  2B6M A;  3ME8 A;  2PER A;  4OFN A;  4OCF A;  2GST A;  1VF2 A;  1OYJ A;  3RAZ A;  3VUR A;  1NSW A;  5JWR B;  1FOV A;  2ON5 A;  4AJ7 A;  2I4A A;  1GUM A;  2R6K A;  4BWS A;  3QAV A;  4TR3 A;  2F9S A;  1LJR A;  3EYT A;  5J9C A;  4MZB A;  4ZB8 A;  5DDL A;  4D73 B;  5D9V A;  2PBJ A;  1K0N A;  5CRE A;  2B7J A;  4G9H A;  3GSS A;  4BVX A;  5IO0 A;  1PQN A;  5INY A;  3ZZX A;  5ECQ B;  3LJR A;  5H5S A;  4K7I A;  2NPB A;  1WJK A;  4N10 A;  4Q5Q A;  3G7I A;  3L9V A;  2H6Z A;  4POM A;  2R2J A;  1A0F A;  2X99 A;  3G9B A;  1OC3 A;  4HU7 A;  2WZ9 A;  5AIS A;  2HSY A;  2LUS A;  3TKQ A;  1Z3E A;  4GCI A;  1J08 A;  1M2D A;  1S3D A;  2NBS A;  1Z7P A;  3CMI A;  5E4W A;  4MA9 A;  1M0U A;  4EO3 A;  4N0V A;  3FK8 A;  3KD0 A;  3QPM A;  4KE3 A;  3U5R E;  4ZBA A;  4FH8 A;  2DJ0 A;  3QFA C;  5D8I A;  4XRA A;  1XWA A;  4I6X A;  2F8A A;  3KIJ A;  2LJR A;  1JZR A;  1JZD A;  3FZ5 A;  3NOF A;  1YZX A;  1Q4J A;  1YKA A;  2IN3 A;  1UVZ A;  4XS4 B;  4L5O A;  2VLU A;  1T00 A;  4WBJ A;  2DMM A;  4IQA A;  2LJK A;  2NDO A;  1F2E A;  1MEK A;  2F51 A;  3MAK A;  3ZVJ A;  2YWN A;  4ML6 A;  2V6K A;  1ZYQ B;  4ZB9 A;  5J3R A;  4AJ6 A;  3UBL A;  4IGJ A;  2H75 A;  3W6G A;  1A8L A;  2LRN A;  5IMD A;  2OJL A;  1TJD A;  1WIK A;  4EDY A;  2LRT A;  1QK8 A;  4EL1 A;  1FW1 A;  3TJB A;  4JED A;  1ABA A;  1TRW A;  1SEN A;  1V98 A;  1BJX A;  1SK2 A;  5DAL A;  3P90 A;  3GA4 A;  5IMZ A;  5D73 A;  2JZR A;  4K8M A;  2AB6 A;  4TXV A;  5J41 A;  5EL8 A;  3QDN A;  2CX3 A;  1T4Z A;  2WRT A;  2RM6 A;  4IKH A;  1EV4 A;  3CSJ A;  4I2U A;  4MH3 A;  1R4W A;  4HU9 A;  2CVK A;  3HA9 A;  4WET A;  2HNL A;  1G0T A;  2OAD A;  1GSY A;  4Q5F A;  1PX7 A;  1GSU A;  2K9F A;  5A4V A;  1AQX A;  3C1S A;  5AIV A;  2LEG A;  3C73 A;  1XPV A;  2WUL A;  2LTK A;  1AAZ A;  1E6B A;  2H0H A;  1MTC A;  1WOU A;  4TN8 A;  4K0N A;  5D9T A;  19GS A;  3GKM A;  4FYB A;  3VLN A;  4IJ3 A;  5GAP D;  4WR5 A;  2VL3 A;  2YV7 A;  18GS A;  2H6X A;  1AUC A;  1TRS A;  2VO4 A;  3UBK A;  4PQ1 A;  2WB9 A;  1XBS A;  5IMC A;  3GST A;  2C8U A;  2ALB A;  4BL7 A;  2DJK A;  4PNF A;  5A4U A;  4J56 E;  5C00 A;  3A2W A;  1CQH A;  4TR4 A;  3ZRD A;  1JZO A;  1FVK A;  4MZW A;  1WE0 A;  3FRC A;  1FVJ A;  3HD5 A;  2EIR A;  5ECH B;  2I1U A;  4G2E A;  4MZC A;  1EP8 A;  1XVQ A;  2KHP A;  3QR6 A;  3TJG A;  4QL9 A;  4V2M A;  4TR1 A;  1T4Y A;  3O6T A;  4FYU A;  4MDC A;  3ZYW A;  1THX A;  2CVB A;  1AW9 A;  2C80 A;  3ZVJ D;  2CZ2 A;  3FR9 A;  2CZ3 A;  1Y6E A;  2O8V B;  1H75 A;  3D21 A;  2LST A;  3CSH A;  3DXB A;  2MMA A;  3LGC A;  1F6M C;  2VUP A;  2VCW A;  5LCZ A;  2N5A A;  3ERG A;  4GLT A;  1Z7R A;  1ZOF A;  17GS A;  2GT5 A; 
#chains in the Genus database with same CATH topology
 1DE2 A;  1PRX A;  3C7M A;  3ZIT A;  2YWO A;  2H30 A;  4Z2T A;  5D96 A;  4USS A;  4ULX A;  3LFL A;  16GS A;  6GSX A;  5F05 A;  4ISD A;  4MF6 A;  4MLY A;  2C0G A;  1SU9 A;  1EOH A;  3KP8 A;  1JHB A;  2REM A;  3DRN A;  2Z9S A;  3DVX A;  4G0I A;  4QQ7 A;  1G7O A;  3IOS A;  4EXJ A;  5D9W A;  4K7N A;  1X9M B;  1XZO A;  4J2F A;  4K0G A;  1SL0 B;  1PD2 1;  3F9U A;  1ERU A;  4F0C A;  5KN3 A;  1DE1 A;  3G7Y A;  4TW5 A;  2YAN A;  1GL8 A;  2AUV A;  1TTZ A;  1YEX A;  4PNG A;  1PSQ A;  4RI7 A;  2VOC A;  5HQP A;  4YAP A;  4IEL A;  4CHS A;  2JAD A;  4OMV A;  2DML A;  3F4S A;  4I97 A;  1HNB A;  5B8A A;  4DSS A;  1EP7 A;  3TRQ A;  1SKR B;  3F63 A;  3E9J B;  5ECP B;  4YKG A;  5CRG A;  4KW6 A;  4AJ8 A;  1OAZ A;  3O76 A;  5IMF A;  1OE7 A;  3IE3 A;  3VI5 A;  2K8V A;  3UVT A;  4L0U A;  4NHW A;  1U88 A;  1UA5 A;  1BED A;  5DCH A;  1LU4 A;  1SL1 B;  5IOW A;  3VWX A;  1WWJ A;  4MAB A;  3LXT A;  1QQ2 A;  5ECK B;  3OR5 A;  2E2M A;  5KEJ A;  3EE2 A;  3FR6 A;  2GSR A;  3GYK A;  3ERW A;  4WF4 A;  5J9B A;  2VD1 A;  3WT2 A;  1ZGN A;  4HUA A;  3I9V 2;  4MJE A;  2PVQ A;  3Q6O A;  1KEB A;  3HZ8 A;  2M46 A;  2V32 A;  2CQ9 A;  1XVW A;  3M8N A;  2AYT A;  2V1M A;  2X8C A;  3IPZ A;  3TOT A;  1XCC A;  1URM A;  4ZIJ A;  4FYC A;  2L5L A;  1X5E A;  1XWK A;  4GTU A;  3TUE A;  2FLS A;  2H0G A;  2LV3 A;  3IHQ A;  1SD8 A;  1SYR A;  5L71 A;  4E8E A;  4CW9 A;  4BVY A;  3IHG A;  4O32 A;  2HZE A;  4O92 A;  1TXX A;  3GKK A;  4RQR A;  1DBY A;  5G1L A;  4K7O A;  4YKF A;  5FWG A;  5KN0 A;  3RDW A;  2ON7 A;  3ZMK A;  2K8S A;  5JCG A;  1X9W B;  3TGZ A;  3APO A;  2GS3 A;  3D6I A;  4GWR A;  2IFQ A;  2H1G A;  3CQF A;  4HOJ A;  4XS1 A;  2O89 A;  3F8U A;  2HRK A;  4G19 A;  3ED3 A;  2VLV A;  4EUY A;  2JZS A;  3TJK A;  4K5R A;  4KDY A;  1GSS A;  1A24 A;  3BD2 A;  1TU7 A;  2HE3 A;  3GUS A;  4OO4 A;  4ZB6 A;  1ERV A;  2RUF A;  4TOP A;  1K0M A;  2L59 A;  3GFK A;  2GGT A;  3FEU A;  3GL5 A;  2HT9 A;  2CVD A;  5HR1 A;  3E0U A;  4POL A;  3QOU A;  8GSS A;  2VIM A;  2QGV A;  3D22 A;  3FKF A;  1O6J A;  1YJ6 A;  3ZLP A;  5IM9 A;  2DBC A;  3KXO A;  1AQW A;  1BYE A;  3DGQ A;  1A2L A;  3L4N A;  2XPD A;  2OAC A;  1PN9 A;  4FIW A;  2B1K A;  3S9F A;  5H5R A;  1FO5 A;  3FZA A;  1PN0 A;  3IC4 A;  5G30 A;  5DAL B;  2AHE A;  1OVN A;  1M9A A;  2VL2 A;  3TOU A;  2JAC A;  3WGE A;  1ERT A;  4YAV A;  4TR0 A;  3ZIV A;  1PKZ A;  2HRA A;  3GX8 A;  3SWL A;  1DSB A;  2IMD A;  3UAR A;  4KSO A;  2ZUP A;  1EEM A;  3GKN A;  1GSD A;  4KGI A;  2GSS A;  3DIE A;  2HLS A;  4EF0 A;  1VGL A;  4ZL7 A;  5EY6 A;  4N30 A;  5A4W A;  4MNN A;  1S3A A;  5CRW A;  2HZF A;  3TKR A;  4X0X A;  3QMX A;  4TKY A;  4BA7 A;  4POB A;  1K3Y A;  1B9Y C;  3CSI A;  1SKS B;  1GSF A;  5A5K A;  1SJZ A;  1A2J A;  2CA8 A;  3TKS A;  2A2R A;  1UC7 A;  2JSY A;  5J5N A;  2KP1 A;  1UN2 A;  3F3Q A;  5CRD A;  4MK3 A;  2B5E A;  4RQX A;  1V2A A;  2AV4 A;  3HKR A;  5CRH A;  3I69 A;  3KMO A;  4JR6 A;  4V2L A;  1GNE A;  2LRC A;  4ML1 A;  3W8S A;  2KOK A;  4KAE A;  3VWU A;  3RHC A;  5DAK A;  1AXD A;  5IIZ A;  2IIY A;  2BMX A;  1OC9 B;  1PL1 A;  3FZ9 A;  1ZYE A;  2QSI A;  2NVL A;  2FWE A;  3P8W A;  1A0R P;  2X8H A;  2GSQ A;  3VWV A;  7GSS A;  3KTL A;  1NW2 A;  2HRN A;  3K8N A;  1PX6 A;  3TJF A;  4IP1 A;  2I3Y A;  4I2T A;  2YZU A;  1MDI A;  4WBR D;  1HD2 A;  4K9Z A;  3VK9 A;  3DD3 A;  4HS1 A;  3F4R A;  1Z9H A;  3TRP A;  1K3O A;  4EC0 A;  4J57 E;  1W89 A;  4OFM A;  4KUN A;  3EIN A;  3P7X A;  3APS A;  3N5O A;  1X5D A;  4EE0 A;  1ZL9 A;  2H8L A;  2VCX A;  2DSA A;  6GSV A;  3MDK A;  2G2Q A;  2RII A;  1QGV A;  3RPN A;  2CAI A;  3V1W A;  4GQC A;  2WGR A;  4V1A p;  3L78 A;  1GTU A;  2C4J A;  1T7P B;  2BJX A;  4EDZ A;  1V58 A;  2P31 A;  4NHZ A;  4O7H A;  2QA1 A;  2YPM A;  3IDV A;  4KA0 A;  1KTE A;  3ZIJ A;  2PPT A;  3CBU A;  5DCG A;  3LXZ A;  4JU5 A;  2PVO C;  2LKU A;  4GST A;  5DVB A;  5B8B A;  1QUW A;  4XRD A;  3HXS A;  5IPH A;  5IMA A;  2MYG A;  3C8E A;  4KH7 A;  2I9H A;  5ECO B;  2DIZ A;  2VCT A;  1FG4 A;  1EGO A;  1TKD B;  2PWJ A;  1ON4 A;  5B7C A;  1EV9 A;  2R0C A;  1TRU A;  5IQY A;  5IPG A;  1JLW A;  5G2Z A;  3IA1 A;  6GSY A;  2HSH A;  5KN1 A;  1ERW A;  4OCE A;  1JLV A;  2H0I A;  5JWQ B;  1H4O A;  2H71 A;  2C3T A;  3LOR A;  3M3M A;  4F9Z A;  2JU5 A;  4TVE A;  4D73 A;  1K0A A;  3G7J A;  1J9B A;  1V57 A;  2VM1 A;  4ZBD A;  3US3 A;  1TU8 A;  3FZ4 A;  4KND A;  3F3R A;  5DQY A;  2X49 A;  1K0O A;  4PGT A;  1PL2 A;  3UAP A;  4XHM A;  4IS0 A;  4AGS A;  3EWL A;  5ABR A;  2QKE A;  2A4V A;  3EMP A;  1EOG A;  4MJC A;  4TXO B;  5C04 A;  2MZC A;  3UJ1 A;  2TRC P;  2XC2 A;  3GTU B;  4ZL9 A;  4BVY B;  1R7H A;  5B6M A;  4WEY A;  3A5I A;  4ZIL A;  1AIU A;  1Z5Y E;  4EIP A;  4CY8 A;  6GST A;  1C72 A;  5B6N A;  4L8E A;  1O81 A;  4G0K A;  3PPU A;  2G0F A;  1NHY A;  4PUR A;  3CTG A;  1WP0 A;  5G5E A;  3KTB A;  4HJM A;  3IAS 2;  5JWO B;  20GS A;  5F8B A;  1U3A A;  2J23 A;  3DYR A;  2MMN A;  1QXH A;  3D4T A;  2IMK A;  1XW6 A;  1USB A;  2IME A;  2P5R A;  4F03 A;  4GSS A;  4YH2 A;  3IBH A;  3GMF A;  1OE8 A;  4ECB A;  3KMN A;  4FO5 A;  4MF7 A;  4V2N A;  2H70 A;  4HI7 A;  1VF4 A;  1PA3 A;  1WMJ A;  1EGR A;  4LL4 B;  4PUA A;  4KF9 A;  4CDO A;  5ID2 B;  3HVS A;  1JFU A;  3ZTL A;  1IYH A;  2B3S A;  1ZYN A;  3KJY A;  3GL3 A;  1B4P A;  2GDR A;  1PMT A;  4PQH A;  4ZBB A;  4MP4 A;  1SJI A;  2PUK C;  1ML6 A;  2V2G A;  3Q19 A;  4IP6 A;  1GTI A;  1YKC A;  2CT6 A;  3GV1 A;  4BIK A;  2L4C A;  3C1R A;  3VFI A;  2XPE A;  3F6F A;  4YQV A;  3AY8 A;  1GTA A;  2FNO A;  4NMU A;  5G5F A;  1YF1 A;  1JZW A;  1XG8 A;  2H01 A;  3RBT A;  3P2A A;  2YNX A;  3QAG A;  3JCM L;  4A5P A;  1B9X C;  3M1G A;  4MPF A;  2M72 A;  2M80 A;  3WGD A;  2HI7 A;  2LNT A;  4MJA A;  1TDI A;  1MD4 A;  4POK A;  5HR3 A;  5F06 A;  3VPQ A;  2CV4 A;  1XIY A;  3FHK A;  3UL3 A;  3WGX A;  3MWH A;  4BVX B;  4RI6 A;  5CNW A;  1WPI A;  4HZ4 A;  4XTS A;  3GRX A;  2LQQ A;  2DJ2 A;  1N2A A;  2C3Q A;  4O5R A;  3GNJ A;  2DKI A;  1U3I A;  1G6Y A;  6GSW A;  3HHV A;  3H4K A;  5H5Q A;  4KX4 A;  2JL4 A;  3WT1 A;  3CTF A;  4IW9 A;  3APQ A;  1R5P A;  4N0Z A;  3D4M A;  1MDJ A;  3HJM A;  1ZCP A;  2A2P A;  10GS A;  5ECR B;  4YQU A;  4DEJ A;  3FMW A;  4RUV A;  3LYP A;  2R3X A;  3DVW A;  2O87 A;  4G10 A;  1M2A A;  4K2X A;  5JCU A;  3TDG A;  2C0F A;  1SK1 A;  1RK4 A;  4PUF C;  2ZCT A;  2H1B A;  3RHB A;  2FCH A;  3BBY A;  1K0D A;  1RW1 A;  4ZL8 A;  9GSS A;  3LWA A;  3L9U A;  2IMI A;  4DSR A;  1SL2 B;  4P3Y B;  1FAA A;  2GZP A;  3KEB A;  1TRV A;  5JCW A;  2B7K A;  4MCU A;  2OE1 A;  2TRX A;  2R37 A;  1SYX A;  1XWG A;  4JE1 A;  1GUL A;  2WCI A;  5LD0 A;  1YQ1 A;  1YF0 A;  3D5J A;  3ME7 A;  1TK5 B;  2FHE A;  1GNW A;  1TI3 A;  4PXO A;  1SD9 A;  1FHE A;  1S3C A;  2IWT A;  3CRU A;  1NM3 A;  4F2I A;  3EC3 A;  4XCS A;  2KP2 A;  5ECI B;  2R4V A;  1XOA A;  1AC1 A;  22GS A;  1VF3 A;  4CY6 A;  1YEP A;  5AGY A;  4LMV A;  2OE0 A;  2E0Q A;  2VCV A;  5F07 A;  3KGK A;  2FD3 A;  1ILO A;  4HJ2 A;  2YJ7 A;  4IQ1 A;  2TIR A;  4X4J A;  3R2Q A;  1GUH A;  3A2V A;  5DBQ A;  1X0R A;  3EVI A;  1GP1 A;  2DKH A;  1TK8 B;  1XOB A;  14GS A;  1HYU A;  2R5G A;  2B1L A;  1SK0 A;  2VAF A;  3KM6 A;  2BTO T;  6GSU A;  4HEA 2;  3HY2 A;  1PFO A;  3IK9 A;  4HQZ A;  2LQO A;  2E7P A;  1EZK A;  4IBP A;  5KOW A;  5F0G A;  2V6O A;  3BCI A;  3N9J A;  3HVV A;  2KUC A;  3CRT A;  5CO3 A;  1OKT A;  4ECI A;  2C0E A;  2X4A A;  3MSZ A;  1K0C A;  2HFD A;  2F8F A;  1PKW A;  3TCO A;  2VLT A;  4BL7 B;  1K0B A;  2GZZ A;  3FW2 A;  3IAM 2;  3GH9 A;  1M99 A;  2OBK A;  2KLX A;  2P5Q A;  11GS A;  4TR1 B;  4EVM A;  2DJJ A;  2R0G A;  2CAQ A;  4IVF A;  1K3L A;  1M9B A;  13GS A;  4K2D A;  4K6X A;  3HJP A;  3ZFL A;  4DSQ A;  2X64 A;  3LSZ A;  3FYG A;  5IMV A;  4Z7X A;  5ECS A;  4NV2 A;  4PTS A;  2MBT A;  4X43 A;  2B5Y A;  2P0G A;  1WRY A;  3ISO A;  4GSN A;  3I6A A;  3LEF A;  3VPT A;  3QAW A;  2DLX A;  2VD0 A;  2OKA A;  3MIX A;  3KZQ A;  1BX9 A;  3KP9 A;  3IK7 A;  2L57 A;  4K1F A;  4F0B A;  5DJM A;  3EMX A;  1PGT A;  2QC7 A;  3TRX A;  2LNS A;  3UIW A;  2N5B A;  4QL7 A;  4IJI A;  1XWC A;  1OC8 A;  2FY6 A;  5GAN D;  3UEM A;  3D0Z A;  1AQV A;  1TP9 A;  1KBN A;  5HR2 A;  5ECL B;  4GRF A;  2H74 A;  4NV5 A;  4K5S A;  1GSQ A;  2D2Z A;  2HXK A;  4LL1 B;  3DKS A;  1O85 A;  2GT6 A;  4V1A g;  5HFK A;  3H1N A;  4ZXG A;  2ES7 A;  4GF0 A;  2X8G A;  3R3E A;  2FA4 A;  3GHA A;  3E3E A;  2FWF A;  2H1D A;  4AF2 A;  3H79 A;  2FWH A;  5KN2 A;  1I5G A;  2GQL A;  3HZ4 A;  5D93 A;  1Y25 A;  2GQM A;  1Q98 A;  4JR4 A;  1GH2 A;  2VCZ A;  2PN8 A;  3ZRE A;  3PR8 A;  4DSS B;  3UOM A;  4KDX A;  1B8X A;  5LNK e;  3ZML A;  3LW9 A;  4KB3 A;  2H73 A;  2C0D A;  1Z6N A;  4PQI A;  1VF1 A;  2FWG A;  2DJ3 A;  3DML A;  1NHO A;  2FA8 A;  4MPG A;  1F3A A;  3GUR A;  1GLQ A;  5HFG A;  2XBI A;  2XBQ A;  3IC8 A;  2K6V A;  2H1A A;  4EKZ A;  2E2G A;  2I81 A;  3TKP A;  1M7T A;  3QD9 A;  4F82 A;  3VI7 A;  2L4Q A;  2DIY A;  5DQS A;  2A4H A;  4MF5 A;  2HRF A;  3A3T A;  3IR4 A;  2O85 A;  4WKW A;  2IMF A;  3TB2 A;  2GLR A;  2XHF A;  2J9H A;  1XXU A;  4WR4 A;  3M9J A;  5ELA A;  3ERF A;  4ECC A;  2C3N A;  4L0W A;  5G1K A;  3QCP A;  2YZH A;  4TRX A;  5GST A;  1XWB A;  2LJA A;  2VL2 C;  5E59 A;  2RLI A;  1A2M A;  3GN3 A;  1GRX A;  1I9D A;  2OE3 A;  3ZL5 A;  2YP6 A;  3WYW A;  2RM5 A;  2N5F A;  3M9K A;  1QFN A;  3QFB C;  1OC9 A;  3KH7 A;  3ZFB A;  1V9W A;  4ECJ A;  4FQU A;  3GH6 A;  5AN1 A;  1DUG A;  4N11 A;  2HZE B;  1FOH A;  4DVC A;  4HSC X;  1HNC A;  2H76 A;  3KH9 A;  1KNG A;  1HNA A;  1ZYP A;  6GSS A;  5D9X A;  1B48 A;  1TI1 A;  3I43 A;  3Q74 A;  3CXG A;  4I5Q A;  2YJH A;  3KCM A;  3HVX A;  4HQS A;  4Z2U A;  2IFQ B;  4XS4 A;  1A8Y A;  1GTB A;  1E2Y A;  2LS5 A;  4GXZ A;  1RQM A;  1SKW B;  3GX0 A;  2FUG 2;  3TKS E;  2RUE A;  3BOA A;  3CYN A;  2WJU A;  3TKS C;  1S3R A;  5FHI A;  1T3B A;  4JRR A;  4WF5 A;  2ZNM A;  2WS2 A;  3F4T A;  1ZZY A;  4PX1 A;  1O73 A;  2JZT A;  1OKD A;  3TJJ A;  5G31 A;  4H86 A;  3UMA A;  2MBS A;  4Q5R A;  3DEX A;  3W8J A;  5CAX A;  2NTO A;  1XW9 A;  1QMV A;  2L6D A;  1T1V A;  5ECM B;  3MNG A;  1F9M A;  2YWI A;  4KCA A;  4OWY A;  3Q18 A;  1IYI A;  5CP1 A;  4GQF A;  2UZ8 A;  4KCE A;  3EUR A;  4WXT A;  4YQM A;  2GQK A;  3LYK A;  2MMO A;  1FB0 A;  4NXI A;  5IOX A;  2PGT A;  5BRT A;  2C1Y A;  1ZMA A;  3PGT A;  3HJO A;  3EU3 A;  5HR0 A;  5DJL A;  1HQO A;  5HFI A;  4X1U A;  1BG5 A;  3H8Q A;  3F6D A;  4MJB A;  4ID0 A;  2L6C A;  4LA1 A;  1YDK A;  1M2B A;  4OO5 A;  2YV9 A;  3PIN A;  2B5X A;  3HCZ A;  2WDU A;  4NWY A;  4Q5N A;  5CYY A;  5BMU A;  4HDE A;  4XIH A;  3EPT A;  3BCK A;  3VWW A;  4ICY A;  3SBC A;  1TOF A;  1B4Q A;  3GIX A;  3IV4 A;  2H66 A;  5ECN B;  2IPA A;  5ELG A;  2MMZ A;  1TK0 B;  4L5L A;  5EPF A;  3WD6 A;  1V40 A;  2PU9 C;  3FY7 A;  2V41 A;  2O7K A;  3RPP A;  3L0H A;  2A2S A;  5J4U A;  2OBI A;  2H19 A;  5AIX A;  1R5A A;  3IXR A;  2YWM A;  3EU4 A;  4BWQ A;  3J7Y k;  2VL9 A;  5GSS A;  1YY7 A;  1M3I A;  12GS A;  1EWX A;  1XFL A;  2H6Y A;  2DC5 A;  3F0I A;  3IRA A;  4JZQ A;  3U6V A;  5DAK B;  1O8W A;  2VCQ A;  2JSZ A;  2GTU A;  1G7E A;  1BQ7 A;  1Z6M A;  1R26 A;  4TXO A;  3H93 A;  1SJ6 A;  1W4V A;  4HZ2 A;  2AJQ B;  1THO A;  3GTU A;  3LG6 A;  3L9S A;  4KDU A;  1MDK A;  1TW9 A;  3PH9 A;  1F37 A;  5KOX A;  2IJY A;  3J7Y b;  2YN1 A;  4IN0 A;  3O3T A;  2DJ1 A;  4OFT A;  4E8H A;  1VRS D;  1X9S B;  4ILF A;  4NAX A;  3FR3 A;  1O8X A;  4NPB A;  4LLR A;  2F3M A;  4LMW A;  1FB6 A;  2CX4 A;  2AAW A;  3LQ7 A;  5ENU A;  2L5O A;  3NIV A;  4I8B A;  3HDC A;  1XW5 A;  1O7U A;  4MH2 A;  1N8J A;  1U87 A;  2H72 A;  2YCD A;  1GUK A;  2PMT A;  2K18 A;  1GLP A;  1ST9 A;  2EC4 A;  3GKX A;  1LBK A;  3C71 A;  4JBB A;  4MMM A;  4EIQ A;  3NZN A;  2OA7 A;  3UVH A;  5GZZ B;  2EIQ A;  5IO2 A;  2VM2 A;  2GZY A;  1A23 A;  1J0F A;  1GSE A;  1ACV A;  4BPY A;  5ID2 A;  4ACS A;  2HYX A;  2GVP A;  2YOI A;  3A5W A;  5COH A;  3HYP A;  1X5C A;  4IHU A;  2IL3 A;  2WFC A;  3A2X A;  1EEJ A;  3DWV A;  1BAY A;  4OD7 A;  2FGX A;  1F3B A;  1G6W A;  3BJ5 A;  1T8E B;  5FT3 A;  2EIO A;  3M0F A;  5EVO A;  1MD3 A;  1U6T A;  4KSM A;  4XS6 A;  1CQG A;  1GWC A;  2B6M A;  3ME8 A;  2PER A;  2R0P A;  4OFN A;  1M3J A;  4OCF A;  2GST A;  1VF2 A;  1OYJ A;  3RAZ A;  3VUR A;  1NSW A;  5JWR B;  1FOV A;  2ON5 A;  2QA2 A;  4AJ7 A;  2I4A A;  1GUM A;  2R6K A;  4BWS A;  3MYD A;  3QAV A;  4TR3 A;  2F9S A;  1LJR A;  3EYT A;  2HSM A;  5J9C A;  4MZB A;  4ZB8 A;  5DDL A;  4D73 B;  5D9V A;  2PBJ A;  1K0N A;  5CRE A;  2B7J A;  4G9H A;  3GSS A;  4BVX A;  5IO0 A;  1PQN A;  5INY A;  3ZZX A;  5ECQ B;  3LJR A;  5H5S A;  4K7I A;  2NPB A;  1WJK A;  4N10 A;  4Q5Q A;  3G7I A;  3L9V A;  2H6Z A;  4POM A;  2R2J A;  1A0F A;  2X99 A;  3G9B A;  1OC3 A;  4HU7 A;  2WZ9 A;  5AIS A;  2HSY A;  2LUS A;  3TKQ A;  1Z3E A;  4GCI A;  4O5U A;  1J08 A;  1M2D A;  1S3D A;  2NBS A;  1Z7P A;  3CMI A;  5E4W A;  4MA9 A;  1M0U A;  4EO3 A;  4N0V A;  3FK8 A;  3KD0 A;  3QPM A;  4KE3 A;  3U5R E;  4ZBA A;  4FH8 A;  3HVN A;  2DJ0 A;  3QFA C;  5D8I A;  4XRA A;  1XWA A;  4I6X A;  4G0L A;  2F8A A;  3KIJ A;  2LJR A;  1JZR A;  1JZD A;  3FZ5 A;  3NOF A;  1YZX A;  1Q4J A;  1YKA A;  2IN3 A;  1UVZ A;  4XS4 B;  4Z2R A;  4L5O A;  2VLU A;  1T00 A;  4WBJ A;  2DMM A;  4IQA A;  2LJK A;  2NDO A;  1F2E A;  1MEK A;  2F51 A;  3MAK A;  3ZVJ A;  2YWN A;  4ML6 A;  2V6K A;  1ZYQ B;  4ZB9 A;  5J3R A;  4AJ6 A;  3UBL A;  4IGJ A;  2H75 A;  3W6G A;  1A8L A;  2LRN A;  5IMD A;  2OJL A;  1TJD A;  1WIK A;  4EDY A;  2LRT A;  1QK8 A;  4EL1 A;  1FW1 A;  3TJB A;  4JED A;  1ABA A;  1TRW A;  1SEN A;  1V98 A;  1BJX A;  1SK2 A;  5DAL A;  3P90 A;  3GA4 A;  5IMZ A;  5D73 A;  2JZR A;  4K8M A;  2AB6 A;  4TXV A;  5J41 A;  5EL8 A;  3QDN A;  2CX3 A;  1T4Z A;  2WRT A;  2RM6 A;  4IKH A;  1EV4 A;  3CSJ A;  4I2U A;  4MH3 A;  1R4W A;  4HU9 A;  2CVK A;  3HA9 A;  4WET A;  2HNL A;  1G0T A;  2OAD A;  1GSY A;  4Q5F A;  1PX7 A;  1GSU A;  2K9F A;  5A4V A;  1AQX A;  3C1S A;  5AIV A;  2LEG A;  3C73 A;  1XPV A;  2WUL A;  2LTK A;  1AAZ A;  1E6B A;  2H0H A;  1MTC A;  1WOU A;  4TN8 A;  4K0N A;  5D9T A;  19GS A;  3GKM A;  4FYB A;  3VLN A;  4IJ3 A;  5GAP D;  4WR5 A;  2VL3 A;  2YV7 A;  18GS A;  2H6X A;  1AUC A;  1TRS A;  2VO4 A;  3UBK A;  4PQ1 A;  2WB9 A;  1XBS A;  5IMC A;  3GST A;  2C8U A;  2ALB A;  4BL7 A;  2DJK A;  4PNF A;  5A4U A;  4J56 E;  5C00 A;  3A2W A;  1CQH A;  4TR4 A;  3ZRD A;  1JZO A;  1FVK A;  4MZW A;  1WE0 A;  3FRC A;  1FVJ A;  3HD5 A;  2EIR A;  5ECH B;  2I1U A;  4G2E A;  4MZC A;  1EP8 A;  1XVQ A;  2KHP A;  3QR6 A;  3TJG A;  4QL9 A;  4V2M A;  4TR1 A;  1T4Y A;  3O6T A;  4FYU A;  4MDC A;  4O5Q A;  3ZYW A;  1THX A;  2CVB A;  1AW9 A;  2C80 A;  3ZVJ D;  2CZ2 A;  3FR9 A;  2CZ3 A;  1Y6E A;  2O8V B;  1H75 A;  3D21 A;  2LST A;  3CSH A;  3DXB A;  2MMA A;  3LGC A;  1F6M C;  2VUP A;  2VCW A;  5LCZ A;  2N5A A;  3ERG A;  4GLT A;  1Z7R A;  1ZOF A;  17GS A;  2GT5 A; 
#chains in the Genus database with same CATH homology
 1DE2 A;  1PRX A;  3C7M A;  3ZIT A;  2YWO A;  2H30 A;  4Z2T A;  5D96 A;  4USS A;  4ULX A;  3LFL A;  16GS A;  6GSX A;  5F05 A;  4ISD A;  4MF6 A;  4MLY A;  2C0G A;  1SU9 A;  1EOH A;  3KP8 A;  1JHB A;  2REM A;  3DRN A;  2Z9S A;  3DVX A;  4G0I A;  4QQ7 A;  1G7O A;  3IOS A;  4EXJ A;  5D9W A;  4K7N A;  1X9M B;  1XZO A;  4J2F A;  4K0G A;  1SL0 B;  1PD2 1;  3F9U A;  1ERU A;  4F0C A;  5KN3 A;  1DE1 A;  3G7Y A;  4TW5 A;  2YAN A;  1GL8 A;  2AUV A;  1TTZ A;  1YEX A;  4PNG A;  1PSQ A;  4RI7 A;  2VOC A;  5HQP A;  4YAP A;  4IEL A;  4CHS A;  2JAD A;  4OMV A;  2DML A;  3F4S A;  4I97 A;  1HNB A;  5B8A A;  4DSS A;  1EP7 A;  3TRQ A;  1SKR B;  3F63 A;  3E9J B;  5ECP B;  4YKG A;  5CRG A;  4KW6 A;  4AJ8 A;  1OAZ A;  3O76 A;  5IMF A;  1OE7 A;  3IE3 A;  3VI5 A;  2K8V A;  3UVT A;  4L0U A;  4NHW A;  1U88 A;  1UA5 A;  1BED A;  5DCH A;  1LU4 A;  1SL1 B;  5IOW A;  3VWX A;  1WWJ A;  4MAB A;  3LXT A;  1QQ2 A;  5ECK B;  3OR5 A;  2E2M A;  5KEJ A;  3EE2 A;  3FR6 A;  2GSR A;  3GYK A;  3ERW A;  4WF4 A;  5J9B A;  2VD1 A;  3WT2 A;  1ZGN A;  4HUA A;  3I9V 2;  4MJE A;  2PVQ A;  3Q6O A;  1KEB A;  3HZ8 A;  2M46 A;  2V32 A;  2CQ9 A;  1XVW A;  3M8N A;  2AYT A;  2V1M A;  2X8C A;  3IPZ A;  3TOT A;  1XCC A;  1URM A;  4ZIJ A;  4FYC A;  2L5L A;  1X5E A;  1XWK A;  4GTU A;  3TUE A;  2FLS A;  2H0G A;  2LV3 A;  3IHQ A;  1SD8 A;  1SYR A;  5L71 A;  4E8E A;  4CW9 A;  4BVY A;  3IHG A;  4O32 A;  2HZE A;  4O92 A;  1TXX A;  3GKK A;  4RQR A;  1DBY A;  5G1L A;  4K7O A;  4YKF A;  5FWG A;  5KN0 A;  3RDW A;  2ON7 A;  3ZMK A;  2K8S A;  5JCG A;  1X9W B;  3TGZ A;  3APO A;  2GS3 A;  3D6I A;  4GWR A;  2IFQ A;  2H1G A;  4XS1 A;  4HOJ A;  2O89 A;  3F8U A;  2HRK A;  4G19 A;  3ED3 A;  2VLV A;  4EUY A;  2JZS A;  3TJK A;  4K5R A;  4KDY A;  1GSS A;  1A24 A;  3BD2 A;  1TU7 A;  2HE3 A;  3GUS A;  4OO4 A;  4ZB6 A;  1ERV A;  2RUF A;  4TOP A;  1K0M A;  2L59 A;  3GFK A;  2GGT A;  3FEU A;  3GL5 A;  2HT9 A;  2CVD A;  5HR1 A;  3E0U A;  4POL A;  3QOU A;  8GSS A;  2VIM A;  2QGV A;  3D22 A;  3FKF A;  1O6J A;  1YJ6 A;  3ZLP A;  5IM9 A;  2DBC A;  3KXO A;  1AQW A;  1BYE A;  3DGQ A;  1A2L A;  3L4N A;  2XPD A;  2OAC A;  1PN9 A;  4FIW A;  2B1K A;  3S9F A;  5H5R A;  1FO5 A;  3FZA A;  1PN0 A;  3IC4 A;  5G30 A;  5DAL B;  2AHE A;  1OVN A;  1M9A A;  2VL2 A;  3TOU A;  2JAC A;  3WGE A;  1ERT A;  4YAV A;  4TR0 A;  3ZIV A;  1PKZ A;  2HRA A;  3GX8 A;  3SWL A;  1DSB A;  2IMD A;  3UAR A;  4KSO A;  2ZUP A;  1EEM A;  3GKN A;  1GSD A;  4KGI A;  2GSS A;  3DIE A;  2HLS A;  4EF0 A;  1VGL A;  4ZL7 A;  5EY6 A;  4N30 A;  5A4W A;  4MNN A;  1S3A A;  5CRW A;  2HZF A;  3TKR A;  4X0X A;  3QMX A;  4TKY A;  4BA7 A;  4POB A;  1K3Y A;  1B9Y C;  3CSI A;  1SKS B;  1GSF A;  5A5K A;  1SJZ A;  1A2J A;  2CA8 A;  3TKS A;  2A2R A;  1UC7 A;  2JSY A;  5J5N A;  2KP1 A;  1UN2 A;  3F3Q A;  5CRD A;  4MK3 A;  2B5E A;  4RQX A;  1V2A A;  2AV4 A;  3HKR A;  5CRH A;  3I69 A;  3KMO A;  4JR6 A;  4V2L A;  1GNE A;  2LRC A;  4ML1 A;  3W8S A;  2KOK A;  4KAE A;  3VWU A;  3RHC A;  5DAK A;  1AXD A;  5IIZ A;  2IIY A;  2BMX A;  1OC9 B;  1PL1 A;  3FZ9 A;  1ZYE A;  2QSI A;  2NVL A;  2FWE A;  3P8W A;  1A0R P;  2X8H A;  2GSQ A;  3VWV A;  7GSS A;  3KTL A;  1NW2 A;  2HRN A;  3K8N A;  1PX6 A;  3TJF A;  4IP1 A;  2I3Y A;  4I2T A;  2YZU A;  1MDI A;  4WBR D;  1HD2 A;  4K9Z A;  3VK9 A;  3DD3 A;  4HS1 A;  3F4R A;  1Z9H A;  3TRP A;  1K3O A;  4EC0 A;  4J57 E;  1W89 A;  4OFM A;  4KUN A;  3EIN A;  3P7X A;  3APS A;  3N5O A;  1X5D A;  4EE0 A;  1ZL9 A;  2H8L A;  2VCX A;  2DSA A;  6GSV A;  3MDK A;  2G2Q A;  2RII A;  1QGV A;  3RPN A;  2CAI A;  3V1W A;  4GQC A;  2WGR A;  4V1A p;  3L78 A;  1GTU A;  2C4J A;  1T7P B;  2BJX A;  4EDZ A;  1V58 A;  2P31 A;  4NHZ A;  4O7H A;  2QA1 A;  2YPM A;  3IDV A;  4KA0 A;  1KTE A;  3ZIJ A;  2PPT A;  3CBU A;  5DCG A;  3LXZ A;  4JU5 A;  2PVO C;  2LKU A;  4GST A;  5DVB A;  5B8B A;  1QUW A;  4XRD A;  3HXS A;  5IPH A;  5IMA A;  2MYG A;  3C8E A;  4KH7 A;  2I9H A;  5ECO B;  2DIZ A;  2VCT A;  1FG4 A;  1EGO A;  1TKD B;  2PWJ A;  1ON4 A;  5B7C A;  1EV9 A;  2R0C A;  1TRU A;  5IQY A;  5IPG A;  1JLW A;  5G2Z A;  3IA1 A;  6GSY A;  2HSH A;  5KN1 A;  1ERW A;  4OCE A;  1JLV A;  2H0I A;  5JWQ B;  1H4O A;  2H71 A;  2C3T A;  3LOR A;  3M3M A;  4F9Z A;  2JU5 A;  4TVE A;  4D73 A;  1K0A A;  3G7J A;  1J9B A;  1V57 A;  2VM1 A;  4ZBD A;  3US3 A;  1TU8 A;  3FZ4 A;  4KND A;  3F3R A;  5DQY A;  2X49 A;  1K0O A;  4PGT A;  1PL2 A;  3UAP A;  4XHM A;  4IS0 A;  4AGS A;  3EWL A;  5ABR A;  2QKE A;  2A4V A;  3EMP A;  1EOG A;  4MJC A;  4TXO B;  5C04 A;  2MZC A;  3UJ1 A;  2TRC P;  2XC2 A;  3GTU B;  4ZL9 A;  4BVY B;  1R7H A;  5B6M A;  4WEY A;  3A5I A;  4ZIL A;  1AIU A;  1Z5Y E;  4EIP A;  4CY8 A;  6GST A;  1C72 A;  5B6N A;  4L8E A;  1O81 A;  4G0K A;  3PPU A;  2G0F A;  1NHY A;  4PUR A;  3CTG A;  1WP0 A;  5G5E A;  3KTB A;  4HJM A;  3IAS 2;  5JWO B;  20GS A;  5F8B A;  1U3A A;  2J23 A;  3DYR A;  2MMN A;  1QXH A;  3D4T A;  2IMK A;  1XW6 A;  1USB A;  2IME A;  2P5R A;  4F03 A;  4GSS A;  4YH2 A;  3IBH A;  3GMF A;  1OE8 A;  4ECB A;  3KMN A;  4FO5 A;  4MF7 A;  4V2N A;  2H70 A;  4HI7 A;  1VF4 A;  1PA3 A;  1WMJ A;  1EGR A;  4LL4 B;  4PUA A;  4KF9 A;  4CDO A;  5ID2 B;  3HVS A;  1JFU A;  3ZTL A;  1IYH A;  2B3S A;  1ZYN A;  3KJY A;  3GL3 A;  1B4P A;  2GDR A;  1PMT A;  4PQH A;  4ZBB A;  4MP4 A;  1SJI A;  2PUK C;  1ML6 A;  2V2G A;  3Q19 A;  4IP6 A;  1GTI A;  1YKC A;  2CT6 A;  3GV1 A;  2L4C A;  3C1R A;  3VFI A;  2XPE A;  3F6F A;  4YQV A;  3AY8 A;  1GTA A;  2FNO A;  4NMU A;  5G5F A;  1YF1 A;  1JZW A;  2H01 A;  3RBT A;  3P2A A;  2YNX A;  3QAG A;  3JCM L;  4A5P A;  1B9X C;  3M1G A;  4MPF A;  2M72 A;  2M80 A;  3WGD A;  2HI7 A;  2LNT A;  4MJA A;  1TDI A;  1MD4 A;  4POK A;  5HR3 A;  5F06 A;  3VPQ A;  2CV4 A;  1XIY A;  3FHK A;  3UL3 A;  3WGX A;  3MWH A;  4BVX B;  4RI6 A;  5CNW A;  1WPI A;  4HZ4 A;  4XTS A;  3GRX A;  2LQQ A;  2DJ2 A;  1N2A A;  2C3Q A;  4O5R A;  3GNJ A;  2DKI A;  1U3I A;  1G6Y A;  6GSW A;  3HHV A;  3H4K A;  5H5Q A;  4KX4 A;  2JL4 A;  3WT1 A;  3CTF A;  4IW9 A;  3APQ A;  1R5P A;  4N0Z A;  3D4M A;  1MDJ A;  3HJM A;  1ZCP A;  2A2P A;  10GS A;  5ECR B;  4YQU A;  4DEJ A;  3FMW A;  4RUV A;  3LYP A;  2R3X A;  3DVW A;  2O87 A;  4G10 A;  1M2A A;  4K2X A;  5JCU A;  3TDG A;  2C0F A;  1SK1 A;  1RK4 A;  4PUF C;  2ZCT A;  2H1B A;  3RHB A;  2FCH A;  3BBY A;  1K0D A;  1RW1 A;  4ZL8 A;  9GSS A;  3LWA A;  3L9U A;  2IMI A;  4DSR A;  1SL2 B;  4P3Y B;  1FAA A;  2GZP A;  3KEB A;  1TRV A;  5JCW A;  2B7K A;  4MCU A;  2OE1 A;  2TRX A;  2R37 A;  1SYX A;  1XWG A;  4JE1 A;  1GUL A;  2WCI A;  5LD0 A;  1YQ1 A;  1YF0 A;  3D5J A;  3ME7 A;  1TK5 B;  2FHE A;  1GNW A;  1TI3 A;  4PXO A;  1SD9 A;  1FHE A;  1S3C A;  2IWT A;  3CRU A;  1NM3 A;  4F2I A;  3EC3 A;  4XCS A;  2KP2 A;  5ECI B;  2R4V A;  1XOA A;  1AC1 A;  22GS A;  1VF3 A;  4CY6 A;  1YEP A;  5AGY A;  4LMV A;  2OE0 A;  2E0Q A;  2VCV A;  5F07 A;  3KGK A;  2FD3 A;  1ILO A;  4HJ2 A;  2YJ7 A;  4IQ1 A;  2TIR A;  4X4J A;  3R2Q A;  1GUH A;  3A2V A;  5DBQ A;  1X0R A;  3EVI A;  1GP1 A;  2DKH A;  1TK8 B;  1XOB A;  14GS A;  1HYU A;  2R5G A;  2B1L A;  1SK0 A;  2VAF A;  3KM6 A;  2BTO T;  6GSU A;  4HEA 2;  3HY2 A;  3IK9 A;  4HQZ A;  2LQO A;  2E7P A;  1EZK A;  4IBP A;  5KOW A;  5F0G A;  2V6O A;  3BCI A;  3N9J A;  3HVV A;  2KUC A;  3CRT A;  5CO3 A;  1OKT A;  4ECI A;  2C0E A;  2X4A A;  3MSZ A;  1K0C A;  2HFD A;  2F8F A;  1PKW A;  3TCO A;  2VLT A;  4BL7 B;  1K0B A;  2GZZ A;  3FW2 A;  3IAM 2;  3GH9 A;  1M99 A;  2OBK A;  2KLX A;  2P5Q A;  11GS A;  4TR1 B;  4EVM A;  2DJJ A;  2R0G A;  2CAQ A;  4IVF A;  1K3L A;  1M9B A;  13GS A;  4K2D A;  4K6X A;  3HJP A;  3ZFL A;  4DSQ A;  2X64 A;  3LSZ A;  3FYG A;  5IMV A;  4Z7X A;  5ECS A;  4NV2 A;  4PTS A;  2MBT A;  4X43 A;  2B5Y A;  2P0G A;  1WRY A;  3ISO A;  4GSN A;  3I6A A;  3LEF A;  3VPT A;  3QAW A;  2DLX A;  2VD0 A;  2OKA A;  3MIX A;  3KZQ A;  1BX9 A;  3KP9 A;  3IK7 A;  2L57 A;  4K1F A;  4F0B A;  5DJM A;  3EMX A;  1PGT A;  2QC7 A;  3TRX A;  2LNS A;  3UIW A;  2N5B A;  4QL7 A;  4IJI A;  1XWC A;  1OC8 A;  2FY6 A;  5GAN D;  3UEM A;  3D0Z A;  1AQV A;  1TP9 A;  1KBN A;  5HR2 A;  5ECL B;  4GRF A;  2H74 A;  4NV5 A;  4K5S A;  1GSQ A;  2D2Z A;  2HXK A;  4LL1 B;  3DKS A;  1O85 A;  2GT6 A;  4V1A g;  5HFK A;  3H1N A;  4ZXG A;  2ES7 A;  4GF0 A;  2X8G A;  3R3E A;  2FA4 A;  3GHA A;  3E3E A;  2FWF A;  2H1D A;  4AF2 A;  3H79 A;  2FWH A;  5KN2 A;  1I5G A;  2GQL A;  3HZ4 A;  5D93 A;  1Y25 A;  2GQM A;  1Q98 A;  4JR4 A;  1GH2 A;  2VCZ A;  2PN8 A;  3ZRE A;  3PR8 A;  4DSS B;  3UOM A;  4KDX A;  1B8X A;  5LNK e;  3ZML A;  3LW9 A;  4KB3 A;  2H73 A;  2C0D A;  1Z6N A;  4PQI A;  1VF1 A;  2FWG A;  2DJ3 A;  3DML A;  1NHO A;  2FA8 A;  4MPG A;  1F3A A;  3GUR A;  1GLQ A;  5HFG A;  2XBI A;  2XBQ A;  3IC8 A;  2K6V A;  2H1A A;  4EKZ A;  2E2G A;  2I81 A;  3TKP A;  1M7T A;  3QD9 A;  4F82 A;  3VI7 A;  2L4Q A;  2DIY A;  5DQS A;  2A4H A;  4MF5 A;  2HRF A;  3A3T A;  3IR4 A;  2O85 A;  4WKW A;  2IMF A;  3TB2 A;  2GLR A;  2XHF A;  2J9H A;  1XXU A;  4WR4 A;  3M9J A;  5ELA A;  3ERF A;  4ECC A;  2C3N A;  4L0W A;  5G1K A;  3QCP A;  2YZH A;  4TRX A;  5GST A;  1XWB A;  2LJA A;  2VL2 C;  5E59 A;  2RLI A;  1A2M A;  3GN3 A;  1GRX A;  1I9D A;  2OE3 A;  3ZL5 A;  2YP6 A;  3WYW A;  2RM5 A;  2N5F A;  3M9K A;  1QFN A;  3QFB C;  1OC9 A;  3KH7 A;  3ZFB A;  1V9W A;  4ECJ A;  4FQU A;  3GH6 A;  5AN1 A;  1DUG A;  4N11 A;  2HZE B;  1FOH A;  4DVC A;  1HNC A;  2H76 A;  3KH9 A;  1KNG A;  1HNA A;  1ZYP A;  6GSS A;  5D9X A;  1B48 A;  1TI1 A;  3I43 A;  3Q74 A;  3CXG A;  4I5Q A;  2YJH A;  3KCM A;  3HVX A;  4HQS A;  4Z2U A;  2IFQ B;  4XS4 A;  1A8Y A;  1GTB A;  1E2Y A;  2LS5 A;  4GXZ A;  1RQM A;  1SKW B;  3GX0 A;  2FUG 2;  3TKS E;  2RUE A;  3BOA A;  3CYN A;  2WJU A;  3TKS C;  5FHI A;  1T3B A;  4JRR A;  4WF5 A;  2ZNM A;  2WS2 A;  3F4T A;  1ZZY A;  4PX1 A;  1O73 A;  2JZT A;  1OKD A;  3TJJ A;  5G31 A;  4H86 A;  3UMA A;  2MBS A;  4Q5R A;  3DEX A;  3W8J A;  5CAX A;  2NTO A;  1XW9 A;  1QMV A;  2L6D A;  1T1V A;  5ECM B;  3MNG A;  1F9M A;  2YWI A;  4KCA A;  4OWY A;  3Q18 A;  1IYI A;  5CP1 A;  4GQF A;  2UZ8 A;  4KCE A;  3EUR A;  4WXT A;  4YQM A;  2GQK A;  3LYK A;  2MMO A;  1FB0 A;  4NXI A;  5IOX A;  2PGT A;  5BRT A;  2C1Y A;  1ZMA A;  3PGT A;  3HJO A;  3EU3 A;  5HR0 A;  5DJL A;  1HQO A;  5HFI A;  4X1U A;  1BG5 A;  3H8Q A;  3F6D A;  4MJB A;  4ID0 A;  2L6C A;  4LA1 A;  1YDK A;  1M2B A;  4OO5 A;  2YV9 A;  3PIN A;  2B5X A;  3HCZ A;  2WDU A;  4NWY A;  4Q5N A;  5CYY A;  5BMU A;  4HDE A;  4XIH A;  3EPT A;  3BCK A;  3VWW A;  4ICY A;  3SBC A;  1TOF A;  1B4Q A;  3GIX A;  3IV4 A;  2H66 A;  5ECN B;  2IPA A;  5ELG A;  2MMZ A;  1TK0 B;  4L5L A;  5EPF A;  3WD6 A;  1V40 A;  2PU9 C;  3FY7 A;  2V41 A;  2O7K A;  3RPP A;  3L0H A;  2A2S A;  5J4U A;  2OBI A;  2H19 A;  5AIX A;  1R5A A;  3IXR A;  2YWM A;  3EU4 A;  4BWQ A;  3J7Y k;  2VL9 A;  5GSS A;  1YY7 A;  12GS A;  1EWX A;  1XFL A;  2H6Y A;  2DC5 A;  3F0I A;  3IRA A;  4JZQ A;  3U6V A;  5DAK B;  1O8W A;  2VCQ A;  2JSZ A;  2GTU A;  1G7E A;  1BQ7 A;  1Z6M A;  1R26 A;  4TXO A;  3H93 A;  1SJ6 A;  1W4V A;  4HZ2 A;  2AJQ B;  1THO A;  3GTU A;  3LG6 A;  3L9S A;  4KDU A;  1MDK A;  1TW9 A;  3PH9 A;  1F37 A;  5KOX A;  2IJY A;  3J7Y b;  2YN1 A;  4IN0 A;  3O3T A;  2DJ1 A;  4OFT A;  4E8H A;  1VRS D;  1X9S B;  4ILF A;  4NAX A;  3FR3 A;  1O8X A;  4NPB A;  4LLR A;  2F3M A;  4LMW A;  1FB6 A;  2CX4 A;  2AAW A;  3LQ7 A;  5ENU A;  2L5O A;  3NIV A;  4I8B A;  3HDC A;  1XW5 A;  1O7U A;  4MH2 A;  1N8J A;  1U87 A;  2H72 A;  2YCD A;  1GUK A;  2PMT A;  2K18 A;  1GLP A;  1ST9 A;  2EC4 A;  3GKX A;  1LBK A;  3C71 A;  4JBB A;  4MMM A;  4EIQ A;  3NZN A;  2OA7 A;  3UVH A;  5GZZ B;  2EIQ A;  5IO2 A;  2VM2 A;  2GZY A;  1A23 A;  1J0F A;  1GSE A;  1ACV A;  4BPY A;  5ID2 A;  4ACS A;  2HYX A;  2GVP A;  2YOI A;  3A5W A;  5COH A;  3HYP A;  1X5C A;  4IHU A;  2IL3 A;  2WFC A;  3A2X A;  1EEJ A;  3DWV A;  1BAY A;  4OD7 A;  2FGX A;  1F3B A;  1G6W A;  3BJ5 A;  1T8E B;  5FT3 A;  2EIO A;  3M0F A;  5EVO A;  1MD3 A;  1U6T A;  4KSM A;  4XS6 A;  1CQG A;  1GWC A;  2B6M A;  3ME8 A;  2PER A;  2R0P A;  4OFN A;  4OCF A;  2GST A;  1VF2 A;  1OYJ A;  3RAZ A;  3VUR A;  1NSW A;  5JWR B;  1FOV A;  2ON5 A;  2QA2 A;  4AJ7 A;  2I4A A;  1GUM A;  2R6K A;  4BWS A;  3MYD A;  3QAV A;  4TR3 A;  2F9S A;  1LJR A;  3EYT A;  2HSM A;  5J9C A;  4MZB A;  4ZB8 A;  5DDL A;  4D73 B;  5D9V A;  2PBJ A;  1K0N A;  5CRE A;  2B7J A;  4G9H A;  3GSS A;  4BVX A;  5IO0 A;  1PQN A;  5INY A;  3ZZX A;  5ECQ B;  3LJR A;  5H5S A;  4K7I A;  2NPB A;  1WJK A;  4N10 A;  4Q5Q A;  3G7I A;  3L9V A;  2H6Z A;  4POM A;  2R2J A;  1A0F A;  2X99 A;  3G9B A;  1OC3 A;  4HU7 A;  2WZ9 A;  5AIS A;  2HSY A;  2LUS A;  3TKQ A;  1Z3E A;  4GCI A;  4O5U A;  1J08 A;  1M2D A;  1S3D A;  2NBS A;  1Z7P A;  3CMI A;  5E4W A;  4MA9 A;  1M0U A;  4EO3 A;  4N0V A;  3FK8 A;  3KD0 A;  3QPM A;  4KE3 A;  3U5R E;  4ZBA A;  4FH8 A;  2DJ0 A;  3QFA C;  5D8I A;  4XRA A;  1XWA A;  4I6X A;  4G0L A;  2F8A A;  3KIJ A;  2LJR A;  1JZR A;  1JZD A;  3FZ5 A;  3NOF A;  1YZX A;  1Q4J A;  1YKA A;  2IN3 A;  1UVZ A;  4XS4 B;  4Z2R A;  4L5O A;  2VLU A;  1T00 A;  4WBJ A;  2DMM A;  4IQA A;  2LJK A;  2NDO A;  1F2E A;  1MEK A;  2F51 A;  3MAK A;  3ZVJ A;  2YWN A;  4ML6 A;  2V6K A;  1ZYQ B;  4ZB9 A;  5J3R A;  4AJ6 A;  3UBL A;  4IGJ A;  2H75 A;  3W6G A;  1A8L A;  2LRN A;  5IMD A;  2OJL A;  1TJD A;  1WIK A;  4EDY A;  2LRT A;  1QK8 A;  4EL1 A;  1FW1 A;  3TJB A;  4JED A;  1ABA A;  1TRW A;  1SEN A;  1V98 A;  1BJX A;  1SK2 A;  5DAL A;  3P90 A;  3GA4 A;  5IMZ A;  5D73 A;  2JZR A;  4K8M A;  2AB6 A;  4TXV A;  5J41 A;  5EL8 A;  3QDN A;  2CX3 A;  1T4Z A;  2WRT A;  2RM6 A;  4IKH A;  1EV4 A;  3CSJ A;  4I2U A;  4MH3 A;  1R4W A;  4HU9 A;  2CVK A;  3HA9 A;  4WET A;  2HNL A;  1G0T A;  2OAD A;  1GSY A;  4Q5F A;  1PX7 A;  1GSU A;  2K9F A;  5A4V A;  1AQX A;  3C1S A;  5AIV A;  2LEG A;  3C73 A;  1XPV A;  2WUL A;  2LTK A;  1AAZ A;  1E6B A;  2H0H A;  1MTC A;  1WOU A;  4TN8 A;  4K0N A;  5D9T A;  19GS A;  3GKM A;  4FYB A;  3VLN A;  4IJ3 A;  5GAP D;  4WR5 A;  2VL3 A;  2YV7 A;  18GS A;  2H6X A;  1AUC A;  1TRS A;  2VO4 A;  3UBK A;  4PQ1 A;  2WB9 A;  1XBS A;  5IMC A;  3GST A;  2C8U A;  2ALB A;  4BL7 A;  2DJK A;  4PNF A;  5A4U A;  4J56 E;  5C00 A;  3A2W A;  1CQH A;  4TR4 A;  3ZRD A;  1JZO A;  1FVK A;  4MZW A;  1WE0 A;  3FRC A;  1FVJ A;  3HD5 A;  2EIR A;  5ECH B;  2I1U A;  4G2E A;  4MZC A;  1EP8 A;  1XVQ A;  2KHP A;  3QR6 A;  3TJG A;  4QL9 A;  4V2M A;  4TR1 A;  1T4Y A;  3O6T A;  4FYU A;  4MDC A;  4O5Q A;  3ZYW A;  1THX A;  2CVB A;  1AW9 A;  2C80 A;  3ZVJ D;  2CZ2 A;  3FR9 A;  2CZ3 A;  1Y6E A;  2O8V B;  1H75 A;  3D21 A;  2LST A;  3CSH A;  3DXB A;  2MMA A;  3LGC A;  1F6M C;  2VUP A;  2VCW A;  5LCZ A;  2N5A A;  3ERG A;  4GLT A;  1Z7R A;  1ZOF A;  17GS A;  2GT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...