5DVHA

Structure of the kunitz-type cysteine protease inhibitor pcpi-3 from potato
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
193
structure length
185
Chain Sequence
VSPPVLDMDGEPLKIDEEYSIISIPFGGGSVYLANLGNTKCPNGVVQDSSNKTPVLFYTMKLGSHFVSENQDVSIKFSTKSCINETVWKVAYSIVGPTHSPLRFVITGGTFGFPGPNNIENWFKIEKYETGRPHSYKLRYCPSQYICPTCQFDCADVGLYENKGYARLALNNKPYPFGFSKVNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCPI-3
publication title Structure of the Kunitz-type cysteine protease inhibitor PCPI-3 from potato
rcsb
molecule tags Protease inhibitor
total genus 35
structure length 185
sequence length 193
ec nomenclature
pdb deposition date 2015-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5dvhA00
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 3FFZA 4QD2C 4I37A 3FJHA 1V6VA 4ZFWB 1QXMA 3AZWA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 4F83A 3CA3A 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 5DUYA 1WBAA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 4I4PA 2XOAA 3O4OA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 1W3FA 2LIQA 1MD6A 5D62A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 1HWPB 4OEGA 2NP0A 2QN4A 3AKFA 4KEJA 4HR6C 2IWTB 5D61A 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 2RQ9A 1RY7A 3BAOA 1AXMA 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 4ZOTA 2RG9B 2VUAA 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 4JP0A 3CA6A 3WO4A 3BA7A 1FGAA 3CRIA 1IRPA 4DENA 3JRRA 4EEEB 2MIBA 3AH4A 5BXPA 3FJJA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2FDBM 1TOOA 3BAGA 1G9BA 3BAHA 4I4UA 4IQPA 1RG8A 4ZFUB 1BFGA 3CU1B 1HWOB 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 2MC2A 4IY8A 3IIRA 2BEAA 4QKRA 1ABRB 3O4CA 4I3NA 4I96A 4I4QA 3A23A 1I1BA 3BAQA 3LTQA 2HWMA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 3I2AA 1TFMB 1G9CA 4A7YA 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 1AF9A 3VSZA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 5FZUA 3RMYA 3RSJA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 2DRZA 5DZUA 1FWUA 4Q9GA 4JPZA 3W9TA 4IZXA 3AKGA 3NBEA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 4JAWA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 1AFCA 4LO8B 3V0AB 1SR4A 4I6IA 3N7MA 3T8SA 5HPZA 3V0BA 4QC4A 1DZCA 1G9AA 3VEQA 1L2HA 4L4HA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 1E0OA 4AN7B 1YTOA 3CRHA 4USOA 4P0LA 2ET2A 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 4J2KA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 1WD3A 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 2RSTA 4H9WA 5D63A 1RMLA 4F34A 4EB2B 1IHKA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 4OEEA 1M2TB 4G9NA 8I1BA 3H6RA 3BAVA 2FGFA 3CQAA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2KKIA 1BASA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 1FN0A 4OWJA 1XZZA 3IM6A 4Z8SB 3ZC9A 3BA5A 3POKA 3WMVA 4ZLBB 5DSSB 1XYFA 1FQ9A 5BQUC 3O4BA 3FJBA 3CRGA 9ILBA 1IOBA 1M16A 5F8WA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 4I7IA 2D20A 2VLCA 4R6UB 1TIEA 3O44A 4CJMA 1F31A 2NM1A 2WBCA 3NBCA 4X38A 4J2XA 5FNXA 1R8OA 4EFPA 5GAQA 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 3D7WB 3IM5A 2HZ9A 1NZKA 3SNVA 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 3FGMA 2F8XC 3B9UA 4QBCA 1BLAA 5F8YA 1IT0A 4Z9WB 1JLYA 3A07A 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 1YBIA 2KI6B 3VT1A 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 1DFQA 1WBCA 4A7KA 4GAFA 5FNWA 3V0BB 3VWCA 5BVPI 2VXTI 1Q1UA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 5EC5A 4EFQA 1DJSB 1DQGA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS
chains in the Genus database with same CATH superfamily
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 3FFZA 4QD2C 4I37A 3FJHA 1V6VA 4ZFWB 1QXMA 3AZWA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 2NS2A 4F83A 3CA3A 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 5DUYA 1WBAA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 4I4PA 2XOAA 3O4OA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 1W3FA 2LIQA 1MD6A 5D62A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 1HWPB 4OEGA 2NP0A 2QN4A 3AKFA 4KEJA 4HR6C 2IWTB 5D61A 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 2RQ9A 1RY7A 3BAOA 1AXMA 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 4ZOTA 2RG9B 2VUAA 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 4JP0A 3CA6A 3WO4A 3BA7A 1FGAA 3CRIA 1IRPA 4DENA 3JRRA 4EEEB 2MIBA 3AH4A 5BXPA 3FJJA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2FDBM 1TOOA 3BAGA 1G9BA 3BAHA 4I4UA 4IQPA 1RG8A 4ZFUB 1BFGA 3CU1B 1HWOB 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 2MC2A 4IY8A 3IIRA 2BEAA 4QKRA 1ABRB 3O4CA 4I3NA 4I96A 4I4QA 3A23A 1I1BA 3BAQA 3LTQA 2HWMA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 4MZHA 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 3I2AA 1TFMB 1G9CA 4A7YA 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 1AF9A 3VSZA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 5FZUA 3RMYA 3RSJA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 2DRZA 5DZUA 1FWUA 4Q9GA 4JPZA 3W9TA 4IZXA 3AKGA 3NBEA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 4JAWA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 1AFCA 4LO8B 3V0AB 1SR4A 4I6IA 3N7MA 3T8SA 4UY4A 5HPZA 3V0BA 4QC4A 1DZCA 1G9AA 3VEQA 1L2HA 4L4HA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 4MZFB 1E0OA 4AN7B 1YTOA 3CRHA 4USOA 4P0LA 2ET2A 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 4J2KA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 1WD3A 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 2RSTA 4H9WA 5D63A 1RMLA 4F34A 4EB2B 1IHKA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 4OEEA 1M2TB 4G9NA 8I1BA 3H6RA 3BAVA 2FGFA 3CQAA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2KKIA 1BASA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 1FN0A 4OWJA 1XZZA 3IM6A 4Z8SB 3ZC9A 3BA5A 3POKA 3WMVA 4ZLBB 5DSSB 1XYFA 1FQ9A 5BQUC 3O4BA 3FJBA 3CRGA 9ILBA 1IOBA 1M16A 5F8WA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 4I7IA 2D20A 2VLCA 4R6UB 1TIEA 3O44A 4CJMA 1F31A 2NM1A 2WBCA 3NBCA 4X38A 4J2XA 5FNXA 1R8OA 4EFPA 5GAQA 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 3D7WB 3IM5A 2HZ9A 1NZKA 3SNVA 4H75A 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 3FGMA 2F8XC 4MZGB 3B9UA 4QBCA 1BLAA 5F8YA 1IT0A 4Z9WB 1JLYA 3A07A 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 1YBIA 2KI6B 3VT1A 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 1DFQA 1WBCA 4A7KA 4GAFA 5FNWA 3V0BB 3VWCA 5BVPI 2VXTI 1Q1UA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 5EC5A 4EFQA 1DJSB 1DQGA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS
chains in the Genus database with same CATH topology
2D24A 3BADA 1HCEA 4GP3A 4QKSA 3MPPG 1J0SA 4PC4A 2VXRA 5DVHA 1WD4A 3WA1A 3FFZA 4QD2C 4I37A 3FJHA 1V6VA 4ZFWB 1QXMA 3AZWA 1TWMA 3CA1A 4G9MA 2X2SA 3EF2A 3HOMA 2NS2A 4F83A 3CA3A 4ISQA 2HWAA 3Q7WA 5F8SA 2D7IA 1JY0A 2D44A 5DUYA 1WBAA 3O4AA 3OJMA 4LO1C 3BAUA 1JLXA 1AVXB 1Z0HA 4LO7B 3FUOA 2NYYA 4Q9PA 4ZBVB 3RTJB 3O49A 1HKNA 4XFTA 3H6RB 4LO0C 4J23B 4OWKA 4I4SA 1V6UA 1SR4C 5BXTA 3AJ6A 4I0YA 4DCKC 3QR5A 4X39A 2FFVA 1PWAA 1YXWA 3FJDA 4FVVA 1JT5A 1Q03A 1I1EA 4XFSA 4AN6A 4I4YA 3BA4A 1P63A 3BRFA 3CA4A 4I4PA 2XOAA 3O4OA 3AH1A 3MALA 3HSMA 3V0AA 1BFFA 2GO2A 3OBTA 4ISRA 1BFCA 2R9KB 4P0KA 1NUNA 4X37A 3HMYA 3IAGC 1JTCA 4GOVA 4I4OA 3ZX7A 1A8DA 21BIA 3UD9A 1TWEA 1SZ6B 4WBCA 1S0GA 3ZXGA 2DREA 2NZ9A 1UPSA 2K4AB 2Y9FA 3F1RA 4GAIA 3WINC 3FJFA 1BARA 1FWVA 1G9DA 1W3FA 2LIQA 1MD6A 5D62A 3NJ5A 1II4A 2BEBA 4L4IA 5BQUA 2Z48A 4ZGRB 1HWPB 4OEGA 2NP0A 2QN4A 3AKFA 4KEJA 4HR6C 2IWTB 5D61A 3O3QA 4A7ZA 3BB2A 4ENDA 4LO7C 1XG6A 3OGGA 2RQ9A 1RY7A 3BAOA 1AXMA 4QALA 4JRAA 1BFBA 4G1RA 4IHZA 3ZXDA 1Z2VA 4D0ZA 3OJVA 4ZOTA 2RG9B 2VUAA 2KH2A 3CA0A 1AVUA 4KBBA 1T9FA 3FJEA 2D7RA 1PUMB 3P6IA 3RTIB 3S8KA 2ERMA 4ZFYB 1D0HA 3VUOA 2L5XA 3WO3A 4JP0A 3CA6A 3WO4A 3BA7A 1FGAA 3CRIA 1IRPA 4DENA 3JRRA 4EEEB 2MIBA 3AH4A 5BXPA 3FJJA 2P23A 3WINA 4HA2A 3BTAA 2MLLB 4YOLA 2FDBM 1TOOA 3BAGA 1G9BA 3BAHA 4I4UA 4IQPA 1RG8A 4ZFUB 1BFGA 3CU1B 1HWOB 2AFGA 2QYIB 1PZZA 3Q7YA 1S0BA 2MC2A 4IY8A 3IIRA 2BEAA 4QKRA 1ABRB 3O4CA 4I3NA 4I96A 4I4QA 3A23A 1I1BA 3BAQA 3LTQA 2HWMA 3R4SA 1V6WA 1FV2A 3K1XA 4DEPA 3UD8A 3OBRA 4MZHA 3OJ2A 3HN1A 1Q04A 3CAHA 2VU9A 3TC2A 1YYNA 1ISWA 3FJKA 4EKXB 3JUTA 1S0DA 2ZR1B 3FJ8A 1DLLA 1AVAC 3I2AA 1TFMB 1G9CA 4A7YA 1AVWB 1DZDA 2Y9GA 4LO3C 3N7KA 1AF9A 3VSZA 5EHAA 1OQLB 3O4DA 2F2FC 1ISVA 4J2YA 4LO2C 5G00A 5FZUA 3RMYA 3RSJA 3F62B 2E4MA 2Y9WC 1T4QA 2FFUA 1JT4A 1TP0A 4QBVA 5BP5A 2VSEA 4H04A 4IY9A 5BXSA 1XHBA 3V79C 1BLDA 1JQZA 1EPWA 2FO1A 1RZOB 5FZYA 1EYLA 3AKHA 3I29B 3OGFA 1YF8B 4OW4A 2KI4A 3ZC8A 3BX1C 3H6QA 1G82A 2M49A 1HWNB 5JLVA 2J3PA 3IM7A 2DRZA 5DZUA 1FWUA 4Q9GA 4JPZA 3W9TA 4IZXA 3AKGA 3NBEA 3P6JA 1EVTA 2I1BA 1K5VA 2VSAA 3PHZA 4KC3A 1TTUA 1S0FA 4I2SA 4LO1A 4JAWA 1GGPB 4JQ0A 2P39A 2WRYA 1CE7B 4IONA 3BRGC 2LIEA 1ITBA 2UUSA 3LLPA 1IRAX 2BFHA 3WMUA 1DFCA 3QYDA 3AZVA 4XFUA 4LO0A 4J2SA 4LO3A 1JT3A 1AFCA 4LO8B 3V0AB 1SR4A 4I6IA 3N7MA 3T8SA 4UY4A 5HPZA 3V0BA 4QC4A 1DZCA 1G9AA 3VEQA 1L2HA 4L4HA 2X2TA 3N7JA 5BXRA 4Q91A 6I1BA 3O5WB 1R8NA 2Q3NB 3E8LC 4MZFB 1E0OA 4AN7B 1YTOA 3CRHA 4USOA 4P0LA 2ET2A 3FUQA 4IZEA 1DIWA 4P6AA 4ZA3B 3HBWA 3AKIA 3CA5A 3R4UA 2D23A 2AXMA 1ISZA 3FJCA 3UJ4A 4J2KA 1Z4SA 5B2HA 1MC9A 2KLLA 2AQZA 3KMVA 1WD3A 4TLPA 3PUBA 3N0KA 5EG6C 4X3AA 2RSTA 4H9WA 5D63A 1RMLA 4F34A 4EB2B 1IHKA 5F90A 3FJAA 4KEIA 3A21A 1CVSA 2YUGA 5FZZA 3ILAA 4GP0A 3H6SE 2D22A 1BA7A 3WO2A 5E24E 4OEEA 1M2TB 4G9NA 8I1BA 3H6RA 3BAVA 2FGFA 3CQAA 1FV3A 4I4XA 2K8RA 2NVHA 3PG0A 2HW9A 1IJTA 5JMCA 3I2XA 4I1EA 1V6XA 1W3AA 2KKIA 1BASA 4XKIA 5I1BA 1S0CA 3VSFA 2Q9XA 1PUUB 2Y9XE 1VCLA 1ILR1 4G6JA 1FN0A 4OWJA 1XZZA 3IM6A 4Z8SB 3ZC9A 3BA5A 3POKA 3WMVA 4ZLBB 5DSSB 1XYFA 1FQ9A 5BQUC 3O4BA 3FJBA 3CRGA 9ILBA 1IOBA 1M16A 5F8WA 3AH2A 4OEFA 3UDAA 3HALA 3Q7XA 2AAIB 4FGFA 4I7IA 2D20A 2VLCA 4R6UB 1TIEA 3O44A 4CJMA 1F31A 2NM1A 2WBCA 3NBCA 4X38A 4J2XA 5FNXA 1R8OA 4EFPA 5GAQA 2DS0A 3NBDA 2GZBA 2ZQNA 4I1BA 2K43A 4JKXB 31BIA 3C9ZA 3UJ0A 1EV2A 4I4VA 4GOYA 4D8HA 3BRDA 1QQKA 3VT2A 4P0JA 4QD2B 1W3GA 2F2FA 4USPA 4LO2A 4IYBA 3S8JA 3NBNA 3D7WB 3IM5A 2HZ9A 1NZKA 3SNVA 4H75A 1ISXA 2NTDA 2ZQOA 3RMXA 4JKQA 3VT0A 3FGMA 2F8XC 4MZGB 3B9UA 4QBCA 1BLAA 5F8YA 1IT0A 4Z9WB 1JLYA 3A07A 1IILA 3N7LA 1N4KA 4OUJA 5BOWA 4QO3A 3P53A 1YBIA 2KI6B 3VT1A 2IHOA 1ONKB 4I8MA 1FMZA 1HIBA 2Z49A 4KEKA 4OWLA 1QQLA 3A22A 2DRYA 1KNMA 1S0EA 3FJIA 3UD7A 1DFQA 1WBCA 4A7KA 4GAFA 5FNWA 3V0BB 3VWCA 5BVPI 2VXTI 1Q1UA 2D43A 1K5UA 1HCDA 1S0LA 7I1BA 5EC5A 4EFQA 1DJSB 1DQGA 2D1ZA 1ISYA 1JT7A 1PC8B 41BIA 1DQOA 4HJJA 2ESUA 2E4MC 3AJ5A 4G6MA 4ZKTB 4D0TA 1HWMB 3FJ9A 5BP5C 4I4RA 3PMEA 4EFRA 4II0A 1FMMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  3FFZ A;  4QD2 C;  4I37 A;  3FJH A;  1V6V A;  4ZFW B;  1QXM A;  3AZW A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  4F83 A;  3CA3 A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  5DUY A;  1WBA A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  4I4P A;  2XOA A;  3O4O A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  1W3F A;  2LIQ A;  1MD6 A;  5D62 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  1HWP B;  4OEG A;  2NP0 A;  2QN4 A;  3AKF A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  4ZOT A;  2RG9 B;  2VUA A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  4JP0 A;  3CA6 A;  3WO4 A;  3BA7 A;  1FGA A;  3CRI A;  1IRP A;  4DEN A;  3JRR A;  4EEE B;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2FDB M;  1TOO A;  3BAG A;  1G9B A;  3BAH A;  4I4U A;  4IQP A;  1RG8 A;  4ZFU B;  1BFG A;  3CU1 B;  1HWO B;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  4QKR A;  1ABR B;  3O4C A;  4I3N A;  4I96 A;  4I4Q A;  3A23 A;  1I1B A;  3BAQ A;  3LTQ A;  2HWM A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  1AF9 A;  3VSZ A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  5FZU A;  3RMY A;  3RSJ A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  4JPZ A;  3W9T A;  4IZX A;  3AKG A;  3NBE A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  4JAW A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  4I6I A;  3N7M A;  3T8S A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  4USO A;  4P0L A;  2ET2 A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  4J2K A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  1WD3 A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  2RST A;  4H9W A;  5D63 A;  1RML A;  4F34 A;  4EB2 B;  1IHK A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  3H6R A;  3BAV A;  2FGF A;  3CQA A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2KKI A;  1BAS A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  1FN0 A;  4OWJ A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  3BA5 A;  3POK A;  3WMV A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  5BQU C;  3O4B A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  1M16 A;  5F8W A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  4I7I A;  2D20 A;  2VLC A;  4R6U B;  1TIE A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  2WBC A;  3NBC A;  4X38 A;  4J2X A;  5FNX A;  1R8O A;  4EFP A;  5GAQ A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  3D7W B;  3IM5 A;  2HZ9 A;  1NZK A;  3SNV A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  3FGM A;  2F8X C;  3B9U A;  4QBC A;  1BLA A;  5F8Y A;  1IT0 A;  4Z9W B;  1JLY A;  3A07 A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  1YBI A;  2KI6 B;  3VT1 A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  1DFQ A;  1WBC A;  4A7K A;  4GAF A;  5FNW A;  3V0B B;  3VWC A;  5BVP I;  2VXT I;  1Q1U A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  5EC5 A;  4EFQ A;  1DJS B;  1DQG A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S; 
#chains in the Genus database with same CATH topology
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  3FFZ A;  4QD2 C;  4I37 A;  3FJH A;  1V6V A;  4ZFW B;  1QXM A;  3AZW A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  2NS2 A;  4F83 A;  3CA3 A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  5DUY A;  1WBA A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  4I4P A;  2XOA A;  3O4O A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  1W3F A;  2LIQ A;  1MD6 A;  5D62 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  1HWP B;  4OEG A;  2NP0 A;  2QN4 A;  3AKF A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  4ZOT A;  2RG9 B;  2VUA A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  4JP0 A;  3CA6 A;  3WO4 A;  3BA7 A;  1FGA A;  3CRI A;  1IRP A;  4DEN A;  3JRR A;  4EEE B;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2FDB M;  1TOO A;  3BAG A;  1G9B A;  3BAH A;  4I4U A;  4IQP A;  1RG8 A;  4ZFU B;  1BFG A;  3CU1 B;  1HWO B;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  4QKR A;  1ABR B;  3O4C A;  4I3N A;  4I96 A;  4I4Q A;  3A23 A;  1I1B A;  3BAQ A;  3LTQ A;  2HWM A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  4MZH A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  1AF9 A;  3VSZ A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  5FZU A;  3RMY A;  3RSJ A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  4JPZ A;  3W9T A;  4IZX A;  3AKG A;  3NBE A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  4JAW A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  4I6I A;  3N7M A;  3T8S A;  4UY4 A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  4MZF B;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  4USO A;  4P0L A;  2ET2 A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  4J2K A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  1WD3 A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  2RST A;  4H9W A;  5D63 A;  1RML A;  4F34 A;  4EB2 B;  1IHK A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  3H6R A;  3BAV A;  2FGF A;  3CQA A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2KKI A;  1BAS A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  1FN0 A;  4OWJ A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  3BA5 A;  3POK A;  3WMV A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  5BQU C;  3O4B A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  1M16 A;  5F8W A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  4I7I A;  2D20 A;  2VLC A;  4R6U B;  1TIE A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  2WBC A;  3NBC A;  4X38 A;  4J2X A;  5FNX A;  1R8O A;  4EFP A;  5GAQ A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  3D7W B;  3IM5 A;  2HZ9 A;  1NZK A;  3SNV A;  4H75 A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  3FGM A;  2F8X C;  4MZG B;  3B9U A;  4QBC A;  1BLA A;  5F8Y A;  1IT0 A;  4Z9W B;  1JLY A;  3A07 A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  1YBI A;  2KI6 B;  3VT1 A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  1DFQ A;  1WBC A;  4A7K A;  4GAF A;  5FNW A;  3V0B B;  3VWC A;  5BVP I;  2VXT I;  1Q1U A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  5EC5 A;  4EFQ A;  1DJS B;  1DQG A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S; 
#chains in the Genus database with same CATH homology
 2D24 A;  3BAD A;  1HCE A;  4GP3 A;  4QKS A;  3MPP G;  1J0S A;  4PC4 A;  2VXR A;  5DVH A;  1WD4 A;  3WA1 A;  3FFZ A;  4QD2 C;  4I37 A;  3FJH A;  1V6V A;  4ZFW B;  1QXM A;  3AZW A;  1TWM A;  3CA1 A;  4G9M A;  2X2S A;  3EF2 A;  3HOM A;  2NS2 A;  4F83 A;  3CA3 A;  4ISQ A;  2HWA A;  3Q7W A;  5F8S A;  2D7I A;  1JY0 A;  2D44 A;  5DUY A;  1WBA A;  3O4A A;  3OJM A;  4LO1 C;  3BAU A;  1JLX A;  1AVX B;  1Z0H A;  4LO7 B;  3FUO A;  2NYY A;  4Q9P A;  4ZBV B;  3RTJ B;  3O49 A;  1HKN A;  4XFT A;  3H6R B;  4LO0 C;  4J23 B;  4OWK A;  4I4S A;  1V6U A;  1SR4 C;  5BXT A;  3AJ6 A;  4I0Y A;  4DCK C;  3QR5 A;  4X39 A;  2FFV A;  1PWA A;  1YXW A;  3FJD A;  4FVV A;  1JT5 A;  1Q03 A;  1I1E A;  4XFS A;  4AN6 A;  4I4Y A;  3BA4 A;  1P63 A;  3BRF A;  3CA4 A;  4I4P A;  2XOA A;  3O4O A;  3AH1 A;  3MAL A;  3HSM A;  3V0A A;  1BFF A;  2GO2 A;  3OBT A;  4ISR A;  1BFC A;  2R9K B;  4P0K A;  1NUN A;  4X37 A;  3HMY A;  3IAG C;  1JTC A;  4GOV A;  4I4O A;  3ZX7 A;  1A8D A;  21BI A;  3UD9 A;  1TWE A;  1SZ6 B;  4WBC A;  1S0G A;  3ZXG A;  2DRE A;  2NZ9 A;  1UPS A;  2K4A B;  2Y9F A;  3F1R A;  4GAI A;  3WIN C;  3FJF A;  1BAR A;  1FWV A;  1G9D A;  1W3F A;  2LIQ A;  1MD6 A;  5D62 A;  3NJ5 A;  1II4 A;  2BEB A;  4L4I A;  5BQU A;  2Z48 A;  4ZGR B;  1HWP B;  4OEG A;  2NP0 A;  2QN4 A;  3AKF A;  4KEJ A;  4HR6 C;  2IWT B;  5D61 A;  3O3Q A;  4A7Z A;  3BB2 A;  4END A;  4LO7 C;  1XG6 A;  3OGG A;  2RQ9 A;  1RY7 A;  3BAO A;  1AXM A;  4QAL A;  4JRA A;  1BFB A;  4G1R A;  4IHZ A;  3ZXD A;  1Z2V A;  4D0Z A;  3OJV A;  4ZOT A;  2RG9 B;  2VUA A;  2KH2 A;  3CA0 A;  1AVU A;  4KBB A;  1T9F A;  3FJE A;  2D7R A;  1PUM B;  3P6I A;  3RTI B;  3S8K A;  2ERM A;  4ZFY B;  1D0H A;  3VUO A;  2L5X A;  3WO3 A;  4JP0 A;  3CA6 A;  3WO4 A;  3BA7 A;  1FGA A;  3CRI A;  1IRP A;  4DEN A;  3JRR A;  4EEE B;  2MIB A;  3AH4 A;  5BXP A;  3FJJ A;  2P23 A;  3WIN A;  4HA2 A;  3BTA A;  2MLL B;  4YOL A;  2FDB M;  1TOO A;  3BAG A;  1G9B A;  3BAH A;  4I4U A;  4IQP A;  1RG8 A;  4ZFU B;  1BFG A;  3CU1 B;  1HWO B;  2AFG A;  2QYI B;  1PZZ A;  3Q7Y A;  1S0B A;  2MC2 A;  4IY8 A;  3IIR A;  2BEA A;  4QKR A;  1ABR B;  3O4C A;  4I3N A;  4I96 A;  4I4Q A;  3A23 A;  1I1B A;  3BAQ A;  3LTQ A;  2HWM A;  3R4S A;  1V6W A;  1FV2 A;  3K1X A;  4DEP A;  3UD8 A;  3OBR A;  4MZH A;  3OJ2 A;  3HN1 A;  1Q04 A;  3CAH A;  2VU9 A;  3TC2 A;  1YYN A;  1ISW A;  3FJK A;  4EKX B;  3JUT A;  1S0D A;  2ZR1 B;  3FJ8 A;  1DLL A;  1AVA C;  3I2A A;  1TFM B;  1G9C A;  4A7Y A;  1AVW B;  1DZD A;  2Y9G A;  4LO3 C;  3N7K A;  1AF9 A;  3VSZ A;  5EHA A;  1OQL B;  3O4D A;  2F2F C;  1ISV A;  4J2Y A;  4LO2 C;  5G00 A;  5FZU A;  3RMY A;  3RSJ A;  3F62 B;  2E4M A;  2Y9W C;  1T4Q A;  2FFU A;  1JT4 A;  1TP0 A;  4QBV A;  5BP5 A;  2VSE A;  4H04 A;  4IY9 A;  5BXS A;  1XHB A;  3V79 C;  1BLD A;  1JQZ A;  1EPW A;  2FO1 A;  1RZO B;  5FZY A;  1EYL A;  3AKH A;  3I29 B;  3OGF A;  1YF8 B;  4OW4 A;  2KI4 A;  3ZC8 A;  3BX1 C;  3H6Q A;  1G82 A;  2M49 A;  1HWN B;  5JLV A;  2J3P A;  3IM7 A;  2DRZ A;  5DZU A;  1FWU A;  4Q9G A;  4JPZ A;  3W9T A;  4IZX A;  3AKG A;  3NBE A;  3P6J A;  1EVT A;  2I1B A;  1K5V A;  2VSA A;  3PHZ A;  4KC3 A;  1TTU A;  1S0F A;  4I2S A;  4LO1 A;  4JAW A;  1GGP B;  4JQ0 A;  2P39 A;  2WRY A;  1CE7 B;  4ION A;  3BRG C;  2LIE A;  1ITB A;  2UUS A;  3LLP A;  1IRA X;  2BFH A;  3WMU A;  1DFC A;  3QYD A;  3AZV A;  4XFU A;  4LO0 A;  4J2S A;  4LO3 A;  1JT3 A;  1AFC A;  4LO8 B;  3V0A B;  1SR4 A;  4I6I A;  3N7M A;  3T8S A;  4UY4 A;  5HPZ A;  3V0B A;  4QC4 A;  1DZC A;  1G9A A;  3VEQ A;  1L2H A;  4L4H A;  2X2T A;  3N7J A;  5BXR A;  4Q91 A;  6I1B A;  3O5W B;  1R8N A;  2Q3N B;  3E8L C;  4MZF B;  1E0O A;  4AN7 B;  1YTO A;  3CRH A;  4USO A;  4P0L A;  2ET2 A;  3FUQ A;  4IZE A;  1DIW A;  4P6A A;  4ZA3 B;  3HBW A;  3AKI A;  3CA5 A;  3R4U A;  2D23 A;  2AXM A;  1ISZ A;  3FJC A;  3UJ4 A;  4J2K A;  1Z4S A;  5B2H A;  1MC9 A;  2KLL A;  2AQZ A;  3KMV A;  1WD3 A;  4TLP A;  3PUB A;  3N0K A;  5EG6 C;  4X3A A;  2RST A;  4H9W A;  5D63 A;  1RML A;  4F34 A;  4EB2 B;  1IHK A;  5F90 A;  3FJA A;  4KEI A;  3A21 A;  1CVS A;  2YUG A;  5FZZ A;  3ILA A;  4GP0 A;  3H6S E;  2D22 A;  1BA7 A;  3WO2 A;  5E24 E;  4OEE A;  1M2T B;  4G9N A;  8I1B A;  3H6R A;  3BAV A;  2FGF A;  3CQA A;  1FV3 A;  4I4X A;  2K8R A;  2NVH A;  3PG0 A;  2HW9 A;  1IJT A;  5JMC A;  3I2X A;  4I1E A;  1V6X A;  1W3A A;  2KKI A;  1BAS A;  4XKI A;  5I1B A;  1S0C A;  3VSF A;  2Q9X A;  1PUU B;  2Y9X E;  1VCL A;  1ILR 1;  4G6J A;  1FN0 A;  4OWJ A;  1XZZ A;  3IM6 A;  4Z8S B;  3ZC9 A;  3BA5 A;  3POK A;  3WMV A;  4ZLB B;  5DSS B;  1XYF A;  1FQ9 A;  5BQU C;  3O4B A;  3FJB A;  3CRG A;  9ILB A;  1IOB A;  1M16 A;  5F8W A;  3AH2 A;  4OEF A;  3UDA A;  3HAL A;  3Q7X A;  2AAI B;  4FGF A;  4I7I A;  2D20 A;  2VLC A;  4R6U B;  1TIE A;  3O44 A;  4CJM A;  1F31 A;  2NM1 A;  2WBC A;  3NBC A;  4X38 A;  4J2X A;  5FNX A;  1R8O A;  4EFP A;  5GAQ A;  2DS0 A;  3NBD A;  2GZB A;  2ZQN A;  4I1B A;  2K43 A;  4JKX B;  31BI A;  3C9Z A;  3UJ0 A;  1EV2 A;  4I4V A;  4GOY A;  4D8H A;  3BRD A;  1QQK A;  3VT2 A;  4P0J A;  4QD2 B;  1W3G A;  2F2F A;  4USP A;  4LO2 A;  4IYB A;  3S8J A;  3NBN A;  3D7W B;  3IM5 A;  2HZ9 A;  1NZK A;  3SNV A;  4H75 A;  1ISX A;  2NTD A;  2ZQO A;  3RMX A;  4JKQ A;  3VT0 A;  3FGM A;  2F8X C;  4MZG B;  3B9U A;  4QBC A;  1BLA A;  5F8Y A;  1IT0 A;  4Z9W B;  1JLY A;  3A07 A;  1IIL A;  3N7L A;  1N4K A;  4OUJ A;  5BOW A;  4QO3 A;  3P53 A;  1YBI A;  2KI6 B;  3VT1 A;  2IHO A;  1ONK B;  4I8M A;  1FMZ A;  1HIB A;  2Z49 A;  4KEK A;  4OWL A;  1QQL A;  3A22 A;  2DRY A;  1KNM A;  1S0E A;  3FJI A;  3UD7 A;  1DFQ A;  1WBC A;  4A7K A;  4GAF A;  5FNW A;  3V0B B;  3VWC A;  5BVP I;  2VXT I;  1Q1U A;  2D43 A;  1K5U A;  1HCD A;  1S0L A;  7I1B A;  5EC5 A;  4EFQ A;  1DJS B;  1DQG A;  2D1Z A;  1ISY A;  1JT7 A;  1PC8 B;  41BI A;  1DQO A;  4HJJ A;  2ESU A;  2E4M C;  3AJ5 A;  4G6M A;  4ZKT B;  4D0T A;  1HWM B;  3FJ9 A;  5BP5 C;  4I4R A;  3PME A;  4EFR A;  4II0 A;  1FMM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...