5DVHA

Structure of the kunitz-type cysteine protease inhibitor pcpi-3 from potato
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
193
structure length
185
Chain Sequence
b'VSPPVLDMDGEPLKIDEEYSIISIPFGGGSVYLANLGNTKCPNGVVQDSSNKTPVLFYTMKLGSHFVSENQDVSIKFSTKSCINETVWKVAYSIVGPTHSPLRFVITGGTFGFPGPNNIENWFKIEKYETGRPHSYKLRYCPSQYICPTCQFDCADVGLYENKGYARLALNNKPYPFGFSKVNKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCPI-3
publication title Structure of the Kunitz-type cysteine protease inhibitor PCPI-3 from potato
rcsb
molecule tags Protease inhibitor
total genus 35
structure length 185
sequence length 193
ec nomenclature
pdb deposition date 2015-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5dvhA00
1S0CA 3FJAA 3ZC8A 5FZZA 2DRYA 3ZX7A 1SR4A 3O44A 1VCLA 1ILR1 2AAIB 1PUMB 3OJVA 5BP5C 3BADA 3BAGA 1DJSB 5BQUA 3BAVA 1CE7B 4QBCA 2ZR1B 4QALA 3AJ5A 3AZWA 2VSAA 3A23A 2D7RA 1Q1UA 1F31A 1JY0A 1V6UA 2NM1A 3KMVA 2HZ9A 4AN7B 1BASA 1W3FA 2RG9B 3H6SE 3PG0A 1Q03A 3OBRA 3FJDA 1FQ9A 5EG6C 3N7KA 1AVUA 2AXMA 3RMXA 3V0AA 3V0BA 1BA7A 2KKIA 1EVTA 4I4OA 1WD3A 2DRZA 3AH1A 2VSEA 4II0A 4X39A 8I1BA 5FNWA 3CA4A 3BA4A 1IOBA 1JT4A 1M2TB 4A7YA 1WD4A 1YXWA 4XFUA 1Z0HA 4LO7C 3A22A 2E4MC 1JT5A 4ZFUB 2VLCA 2NYYA 4I6IA 5B2HA 1I1EA 3FJ8A 4GAIA 4X3AA 3BA5A 5FZYA 4I37A 1BFCA 4R6UB 1J0SA 1E0OA 41BIA 2VXRA 4P0JA 5DSSB 3FJ9A 4EB2B 3CRIA 2F8XC 3H6RA 3C9ZA 4I4SA 1L2HA 1AFCA 1FMZA 4P0KA 3WO2A 3WMUA 4LO0C 3CRGA 3BX1C 4LO8B 3IM6A 1AF9A 1P63A 3UJ0A 3CAHA 3O49A 3N0KA 1DZCA 4LO1C 1PC8B 5DZUA 2F2FC 1IT0A 2KLLA 3OJ2A 3O4CA 3VSZA 3PMEA 4IZXA 4GOVA 3AH4A 3FUQA 4H9WA 4J23B 4IY9A 3HSMA 2P23A 3V0AB 1II4A 1BLDA 4HJJA 4IHZA 2NP0A 3H6QA 3RSJA 1V6XA 1HCEA 2GO2A 2AFGA 3F62B 4FGFA 1HCDA 3VT2A 2LIQA 1XYFA 3VT1A 4Z9WB 3W9TA 2QYIB 3IIRA 3LLPA 3MPPG 1RY7A 4LO3C 3SNVA 4KEIA 2NVHA 1TWEA 1FWUA 1DQGA 1WBAA 2D24A 3CA1A 1AVAC 3NJ5A 4J2SA 3OBTA 1NUNA 3TC2A 3O4AA 4G1RA 4G6MA 1AVXB 3I29B 1SR4C 4I4VA 1ISVA 3RMYA 3R4SA 2FFUA 4OW4A 5BQUC 1V6VA 1ISZA 3UD7A 1G82A 5D61A 2Q3NB 3H6RB 2K8RA 4EFRA 1ISYA 2MLLB 4QKRA 1QXMA 2UUSA 4D8HA 1V6WA 2ESUA 1TP0A 2D20A 4KEJA 4DENA 4ZOTA 7I1BA 4I4RA 1G9CA 5BXRA 3T8SA 3AH2A 1G9AA 1HKNA 3O4BA 3AKFA 1YBIA 3UD8A 2NTDA 1ABRB 4GOYA 4IONA 4JQ0A 2FDBM 3AKIA 2YUGA 3JRRA 3NBEA 3UD9A 1M16A 1G9BA 3P6IA 1S0GA 5BVPI 3AKGA 5F90A 1Q04A 2Z48A 3WINC 3N7MA 3FJCA 3BAQA 3JUTA 4J2KA 4EFQA 3I2XA 1DLLA 1IRAX 3PUBA 1XG6A 3CA3A 4OUJA 1ISXA 1FGAA 3WINA 1QQKA 2M49A 5EC5A 5D63A 4Q91A 5F8SA 3EF2A 5BOWA 3OJMA 1MD6A 3ILAA 4I1BA 1T9FA 1TWMA 3QR5A 1N4KA 21BIA 5F8YA 4IYBA 1NZKA 3VEQA 3P6JA 2D22A 4LO2A 4ZLBB 3FJFA 3A21A 4I7IA 1FWVA 4QD2B 3CU1B 3Q7XA 1DZDA 1OQLB 4G9MA 1EPWA 2KI4A 1HWOB 1ONKB 3POKA 4QKSA 3FUOA 4IQPA 3WO4A 3BAOA 3VT0A 4TLPA 3VWCA 1W3GA 4I8MA 4KBBA 4ZKTB 5E24E 3FJKA 3S8KA 3HBWA 1DIWA 2D44A 3K1XA 3O5WB 5D62A 4ZFYB 4D0ZA 5GAQA 2K4AB 1D0HA 2K43A 3V0BB 4ISQA 2ZQNA 1XHBA 4I1EA 4XFSA 1ISWA 4H04A 3WA1A 3CA5A 3R4UA 1HWPB 2NZ9A 4OWKA 2HWMA 3BAHA 1FMMS 2DS0A 6I1BA 4ZA3B 5F8WA 3FJHA 2HWAA 4I0YA 2D43A 4HR6C 2J3PA 3WO3A 4QD2C 2FO1A 4J2YA 4QBVA 1CVSA 1TTUA 4L4HA 1BFGA 2Y9FA 1IJTA 1SZ6B 2RQ9A 3QYDA 4F34A 1HWNB 1S0EA 1YF8B 2MC2A 4OEGA 1AVWB 3ZC9A 3PHZA 2Y9WC 3NBCA 2P39A 4GAFA 4QO3A 4XFTA 2KI6B 3CRHA 1YYNA 2I1BA 2Z49A 2IHOA 3D7WB 3BRFA 1FN0A 2D7IA 4YOLA 4CJMA 3FGMA 3CA6A 4IZEA 1DFCA 3OGFA 4X38A 1ITBA 4KC3A 4AN6A 4P0LA 5EHAA 5G00A 3RTJB 3MALA 2Q9XA 2L5XA 2AQZA 4HA2A 3O4DA 2X2TA 1WBCA 2QN4A 1DQOA 2DREA 3UJ4A 1RZOB 4OWLA 3IM5A 1BFBA 4JPZA 4D0TA 1AXMA 1BLAA 2WRYA 4ZGRB 4JKXB 4WBCA 1JTCA 3RTIB 3F1RA 1FV3A 1K5UA 31BIA 1JT7A 3IAGC 4Q9GA 4JAWA 1KNMA 5FZUA 3HALA 2D1ZA 3OGGA 4I2SA 4OEEA 4QC4A 1W3AA 4IY8A 5BP5A 1S0FA 2Y9GA 3AKHA 4EEEB 1EYLA 4Q9PA 4JKQA 3IM7A 4ENDA 1Z2VA 1JLYA 1JT3A 2ERMA 4LO2C 1IHKA 1R8OA 4X37A 2XOAA 1RG8A 3I2AA 3N7LA 4A7KA 3BRGC 2VUAA 4I4YA 3V79C 2BEAA 1S0DA 2GZBA 4EFPA 2IWTB 1BFFA 4ZFWB 4USOA 3B9UA 2Y9XE 3HOMA 3NBNA 3FJJA 4EKXB 3BRDA 1T4QA 5DVHA 3FFZA 5I1BA 4F83A 4I3NA 3Q7YA 1UPSA 1EV2A 1DFQA 5JLVA 3AJ6A 3FJIA 3N7JA 1K5VA 1MC9A 5HPZA 3ZXDA 3WMVA 2E4MA 4PC4A 3LTQA 1BARA 3BTAA 5BXPA 2KH2A 4GP0A 1XZZA 3FJEA 3Q7WA 4G6JA 1G9DA 1I1BA 1TIEA 1FV2A 2VU9A 1Z4SA 4GP3A 4JP0A 4I4QA 1IRPA 3BA7A 2RSTA 2VXTI 3AZVA 2MIBA 3CQAA 4LO0A 3VUOA 4I4UA 2BFHA 1GGPB 1JLXA 3HN1A 1PWAA 3P53A 1HIBA 3O3QA 4Z8SB 4LO1A 3CA0A 4KEKA 4I96A 1TFMB 2F2FA 5BXTA 1PZZA 2D23A 4ZBVB 3ZXGA 5JMCA 3HMYA 4DEPA 2BEBA 4XKIA 1PUUB 4OEFA 2FFVA 1QQLA 1S0LA 3E8LC 1TOOA 1JQZA 4G9NA 1R8NA 2FGFA 1IILA 4A7ZA 3NBDA 2WBCA 3FJBA 3BAUA 4OWJA 2LIEA 4ISRA 5DUYA 1YTOA 4I4XA 2HW9A 4JRAA 3UDAA 4DCKC 3S8JA 4P6AA 1RMLA 4L4IA 1A8DA 2R9KB 1HWMB 3BB2A 4LO3A 4USPA 5BXSA 2ZQOA 9ILBA 5FNXA 1S0BA 2ET2A 4FVVA 4LO7B 2X2SA 3A07A 3O4OA 4I4PA 3VSFA 4J2XA
chains in the Genus database with same CATH superfamily
1S0CA 3FJAA 3ZC8A 5FZZA 2DRYA 3ZX7A 1SR4A 3O44A 1VCLA 1ILR1 2AAIB 1PUMB 3OJVA 5BP5C 3BADA 3BAGA 1DJSB 5BQUA 3BAVA 1CE7B 4QBCA 2ZR1B 4QALA 3AJ5A 3AZWA 2VSAA 3A23A 2D7RA 1Q1UA 1F31A 1JY0A 1V6UA 2NM1A 3KMVA 2HZ9A 4AN7B 1BASA 1W3FA 2RG9B 3H6SE 3PG0A 1Q03A 3OBRA 3FJDA 1FQ9A 5EG6C 3N7KA 1AVUA 2AXMA 3RMXA 3V0AA 3V0BA 1BA7A 2KKIA 1EVTA 4I4OA 1WD3A 2DRZA 3AH1A 4MZHA 2VSEA 4II0A 4X39A 8I1BA 5FNWA 3CA4A 3BA4A 1IOBA 1JT4A 1M2TB 4A7YA 1WD4A 1YXWA 4XFUA 1Z0HA 4LO7C 3A22A 2E4MC 1JT5A 4ZFUB 2VLCA 2NYYA 4I6IA 5B2HA 1I1EA 3FJ8A 4GAIA 4X3AA 3BA5A 5FZYA 4I37A 1BFCA 4R6UB 1J0SA 1E0OA 41BIA 2VXRA 4P0JA 5DSSB 3FJ9A 4EB2B 3CRIA 2F8XC 3H6RA 3C9ZA 4I4SA 1L2HA 1AFCA 1FMZA 4P0KA 3WO2A 3WMUA 4LO0C 3CRGA 3BX1C 4LO8B 3IM6A 1AF9A 1P63A 3UJ0A 3CAHA 3O49A 3N0KA 1DZCA 4LO1C 1PC8B 5DZUA 2F2FC 1IT0A 2KLLA 3OJ2A 3O4CA 3VSZA 3PMEA 4IZXA 4GOVA 3AH4A 3FUQA 4H9WA 4J23B 4IY9A 3HSMA 2P23A 3V0AB 1II4A 1BLDA 4HJJA 4IHZA 2NP0A 3H6QA 3RSJA 1V6XA 1HCEA 2GO2A 2AFGA 3F62B 4FGFA 1HCDA 3VT2A 2LIQA 1XYFA 3VT1A 4Z9WB 3W9TA 2QYIB 3IIRA 3LLPA 3MPPG 1RY7A 4LO3C 3SNVA 4KEIA 2NVHA 1TWEA 1FWUA 1DQGA 1WBAA 2D24A 3CA1A 1AVAC 3NJ5A 4J2SA 3OBTA 1NUNA 3TC2A 3O4AA 4G1RA 4G6MA 1AVXB 3I29B 1SR4C 4I4VA 1ISVA 3RMYA 3R4SA 2FFUA 4OW4A 5BQUC 1V6VA 1ISZA 3UD7A 1G82A 5D61A 2Q3NB 3H6RB 2K8RA 4EFRA 1ISYA 2MLLB 4QKRA 1QXMA 2UUSA 4D8HA 1V6WA 2ESUA 1TP0A 2D20A 4KEJA 4DENA 4ZOTA 7I1BA 4I4RA 1G9CA 5BXRA 3T8SA 3AH2A 1G9AA 1HKNA 3O4BA 3AKFA 1YBIA 3UD8A 2NTDA 1ABRB 4GOYA 4IONA 4JQ0A 2FDBM 3AKIA 2YUGA 3JRRA 3NBEA 3UD9A 1M16A 1G9BA 3P6IA 1S0GA 5BVPI 3AKGA 5F90A 1Q04A 2Z48A 3WINC 3N7MA 3FJCA 3BAQA 3JUTA 4J2KA 4EFQA 3I2XA 1DLLA 1IRAX 3PUBA 1XG6A 3CA3A 4OUJA 1ISXA 1FGAA 3WINA 1QQKA 2M49A 5EC5A 5D63A 4Q91A 5F8SA 3EF2A 5BOWA 3OJMA 1MD6A 3ILAA 4I1BA 1T9FA 1TWMA 3QR5A 1N4KA 21BIA 5F8YA 4IYBA 1NZKA 3VEQA 3P6JA 2D22A 4LO2A 4ZLBB 3FJFA 3A21A 4I7IA 1FWVA 4QD2B 3CU1B 3Q7XA 1DZDA 1OQLB 4G9MA 1EPWA 2KI4A 1HWOB 1ONKB 3POKA 4QKSA 3FUOA 4IQPA 3WO4A 3BAOA 3VT0A 4TLPA 3VWCA 1W3GA 4I8MA 4KBBA 4ZKTB 5E24E 3FJKA 3S8KA 3HBWA 1DIWA 2D44A 3K1XA 3O5WB 4H75A 5D62A 4ZFYB 4D0ZA 5GAQA 2K4AB 1D0HA 2K43A 3V0BB 4ISQA 2ZQNA 1XHBA 4I1EA 4XFSA 1ISWA 4H04A 3WA1A 3CA5A 3R4UA 1HWPB 2NZ9A 4OWKA 2HWMA 3BAHA 1FMMS 2DS0A 6I1BA 4ZA3B 5F8WA 3FJHA 2HWAA 4I0YA 2D43A 4HR6C 2J3PA 3WO3A 4QD2C 2FO1A 4J2YA 4QBVA 1CVSA 1TTUA 4L4HA 1BFGA 2Y9FA 1IJTA 1SZ6B 2RQ9A 3QYDA 4F34A 1HWNB 1S0EA 1YF8B 2MC2A 4OEGA 1AVWB 3ZC9A 3PHZA 2Y9WC 3NBCA 2P39A 4GAFA 4QO3A 4XFTA 2KI6B 3CRHA 1YYNA 2I1BA 2Z49A 2IHOA 3D7WB 3BRFA 1FN0A 2D7IA 4YOLA 4CJMA 3FGMA 3CA6A 4IZEA 1DFCA 3OGFA 4X38A 1ITBA 4KC3A 4AN6A 4P0LA 5EHAA 5G00A 3RTJB 3MALA 2Q9XA 2L5XA 2AQZA 4HA2A 3O4DA 2X2TA 1WBCA 2QN4A 1DQOA 2DREA 3UJ4A 1RZOB 4OWLA 3IM5A 1BFBA 4JPZA 4D0TA 1AXMA 2NS2A 1BLAA 2WRYA 4ZGRB 4JKXB 4WBCA 1JTCA 3RTIB 3F1RA 1FV3A 1K5UA 31BIA 1JT7A 3IAGC 4Q9GA 4JAWA 1KNMA 5FZUA 3HALA 2D1ZA 3OGGA 4I2SA 4OEEA 4QC4A 1W3AA 4IY8A 5BP5A 1S0FA 2Y9GA 3AKHA 4EEEB 1EYLA 4Q9PA 4JKQA 3IM7A 4ENDA 1Z2VA 1JLYA 1JT3A 2ERMA 4LO2C 1IHKA 1R8OA 4X37A 2XOAA 1RG8A 3I2AA 3N7LA 4A7KA 3BRGC 2VUAA 4I4YA 3V79C 4MZGB 2BEAA 1S0DA 2GZBA 4EFPA 2IWTB 1BFFA 4ZFWB 4USOA 3B9UA 2Y9XE 3HOMA 3NBNA 3FJJA 4EKXB 3BRDA 1T4QA 5DVHA 3FFZA 5I1BA 4F83A 4I3NA 3Q7YA 1UPSA 1EV2A 1DFQA 5JLVA 3AJ6A 3FJIA 3N7JA 1K5VA 1MC9A 5HPZA 3ZXDA 3WMVA 2E4MA 4PC4A 3LTQA 1BARA 3BTAA 5BXPA 2KH2A 4GP0A 1XZZA 3FJEA 3Q7WA 4G6JA 1G9DA 1I1BA 1TIEA 1FV2A 2VU9A 1Z4SA 4GP3A 4JP0A 4I4QA 1IRPA 3BA7A 2RSTA 2VXTI 3AZVA 2MIBA 3CQAA 4LO0A 3VUOA 4I4UA 2BFHA 1GGPB 1JLXA 3HN1A 1PWAA 3P53A 1HIBA 4UY4A 3O3QA 4Z8SB 4LO1A 3CA0A 4KEKA 4I96A 1TFMB 2F2FA 5BXTA 1PZZA 2D23A 4ZBVB 3ZXGA 5JMCA 3HMYA 4DEPA 2BEBA 4XKIA 1PUUB 4OEFA 2FFVA 1QQLA 1S0LA 3E8LC 1TOOA 1JQZA 4G9NA 1R8NA 2FGFA 1IILA 4A7ZA 3NBDA 2WBCA 3FJBA 3BAUA 4OWJA 2LIEA 4ISRA 5DUYA 1YTOA 4I4XA 2HW9A 4JRAA 3UDAA 4DCKC 3S8JA 4P6AA 1RMLA 4L4IA 1A8DA 2R9KB 1HWMB 3BB2A 4LO3A 4USPA 5BXSA 2ZQOA 9ILBA 4MZFB 5FNXA 1S0BA 2ET2A 4FVVA 4LO7B 2X2SA 3A07A 3O4OA 4I4PA 3VSFA 4J2XA
chains in the Genus database with same CATH topology
1S0CA 3FJAA 3ZC8A 5FZZA 2DRYA 3ZX7A 1SR4A 3O44A 1VCLA 1ILR1 2AAIB 1PUMB 3OJVA 5BP5C 3BADA 3BAGA 1DJSB 5BQUA 3BAVA 1CE7B 4QBCA 2ZR1B 4QALA 3AJ5A 3AZWA 2VSAA 3A23A 2D7RA 1Q1UA 1F31A 1JY0A 1V6UA 2NM1A 3KMVA 2HZ9A 4AN7B 1BASA 1W3FA 2RG9B 3H6SE 3PG0A 1Q03A 3OBRA 3FJDA 1FQ9A 5EG6C 3N7KA 1AVUA 2AXMA 3RMXA 3V0AA 3V0BA 1BA7A 2KKIA 1EVTA 4I4OA 1WD3A 2DRZA 3AH1A 4MZHA 2VSEA 4II0A 4X39A 8I1BA 5FNWA 3CA4A 3BA4A 1IOBA 1JT4A 1M2TB 4A7YA 1WD4A 1YXWA 4XFUA 1Z0HA 4LO7C 3A22A 2E4MC 1JT5A 4ZFUB 2VLCA 2NYYA 4I6IA 5B2HA 1I1EA 3FJ8A 4GAIA 4X3AA 3BA5A 5FZYA 4I37A 1BFCA 4R6UB 1J0SA 1E0OA 41BIA 2VXRA 4P0JA 5DSSB 3FJ9A 4EB2B 3CRIA 2F8XC 3H6RA 3C9ZA 4I4SA 1L2HA 1AFCA 1FMZA 4P0KA 3WO2A 3WMUA 4LO0C 3CRGA 3BX1C 4LO8B 3IM6A 1AF9A 1P63A 3UJ0A 3CAHA 3O49A 3N0KA 1DZCA 4LO1C 1PC8B 5DZUA 2F2FC 1IT0A 2KLLA 3OJ2A 3O4CA 3VSZA 3PMEA 4IZXA 4GOVA 3AH4A 3FUQA 4H9WA 4J23B 4IY9A 3HSMA 2P23A 3V0AB 1II4A 1BLDA 4HJJA 4IHZA 2NP0A 3H6QA 3RSJA 1V6XA 1HCEA 2GO2A 2AFGA 3F62B 4FGFA 1HCDA 3VT2A 2LIQA 1XYFA 3VT1A 4Z9WB 3W9TA 2QYIB 3IIRA 3LLPA 3MPPG 1RY7A 4LO3C 3SNVA 4KEIA 2NVHA 1TWEA 1FWUA 1DQGA 1WBAA 2D24A 3CA1A 1AVAC 3NJ5A 4J2SA 3OBTA 1NUNA 3TC2A 3O4AA 4G1RA 4G6MA 1AVXB 3I29B 1SR4C 4I4VA 1ISVA 3RMYA 3R4SA 2FFUA 4OW4A 5BQUC 1V6VA 1ISZA 3UD7A 1G82A 5D61A 2Q3NB 3H6RB 2K8RA 4EFRA 1ISYA 2MLLB 4QKRA 1QXMA 2UUSA 4D8HA 1V6WA 2ESUA 1TP0A 2D20A 4KEJA 4DENA 4ZOTA 7I1BA 4I4RA 1G9CA 5BXRA 3T8SA 3AH2A 1G9AA 1HKNA 3O4BA 3AKFA 1YBIA 3UD8A 2NTDA 1ABRB 4GOYA 4IONA 4JQ0A 2FDBM 3AKIA 2YUGA 3JRRA 3NBEA 3UD9A 1M16A 1G9BA 3P6IA 1S0GA 5BVPI 3AKGA 5F90A 1Q04A 2Z48A 3WINC 3N7MA 3FJCA 3BAQA 3JUTA 4J2KA 4EFQA 3I2XA 1DLLA 1IRAX 3PUBA 1XG6A 3CA3A 4OUJA 1ISXA 1FGAA 3WINA 1QQKA 2M49A 5EC5A 5D63A 4Q91A 5F8SA 3EF2A 5BOWA 3OJMA 1MD6A 3ILAA 4I1BA 1T9FA 1TWMA 3QR5A 1N4KA 21BIA 5F8YA 4IYBA 1NZKA 3VEQA 3P6JA 2D22A 4LO2A 4ZLBB 3FJFA 3A21A 4I7IA 1FWVA 4QD2B 3CU1B 3Q7XA 1DZDA 1OQLB 4G9MA 1EPWA 2KI4A 1HWOB 1ONKB 3POKA 4QKSA 3FUOA 4IQPA 3WO4A 3BAOA 3VT0A 4TLPA 3VWCA 1W3GA 4I8MA 4KBBA 4ZKTB 5E24E 3FJKA 3S8KA 3HBWA 1DIWA 2D44A 3K1XA 3O5WB 4H75A 5D62A 4ZFYB 4D0ZA 5GAQA 2K4AB 1D0HA 2K43A 3V0BB 4ISQA 2ZQNA 1XHBA 4I1EA 4XFSA 1ISWA 4H04A 3WA1A 3CA5A 3R4UA 1HWPB 2NZ9A 4OWKA 2HWMA 3BAHA 1FMMS 2DS0A 6I1BA 4ZA3B 5F8WA 3FJHA 2HWAA 4I0YA 2D43A 4HR6C 2J3PA 3WO3A 4QD2C 2FO1A 4J2YA 4QBVA 1CVSA 1TTUA 4L4HA 1BFGA 2Y9FA 1IJTA 1SZ6B 2RQ9A 3QYDA 4F34A 1HWNB 1S0EA 1YF8B 2MC2A 4OEGA 1AVWB 3ZC9A 3PHZA 2Y9WC 3NBCA 2P39A 4GAFA 4QO3A 4XFTA 2KI6B 3CRHA 1YYNA 2I1BA 2Z49A 2IHOA 3D7WB 3BRFA 1FN0A 2D7IA 4YOLA 4CJMA 3FGMA 3CA6A 4IZEA 1DFCA 3OGFA 4X38A 1ITBA 4KC3A 4AN6A 4P0LA 5EHAA 5G00A 3RTJB 3MALA 2Q9XA 2L5XA 2AQZA 4HA2A 3O4DA 2X2TA 1WBCA 2QN4A 1DQOA 2DREA 3UJ4A 1RZOB 4OWLA 3IM5A 1BFBA 4JPZA 4D0TA 1AXMA 2NS2A 1BLAA 2WRYA 4ZGRB 4JKXB 4WBCA 1JTCA 3RTIB 3F1RA 1FV3A 1K5UA 31BIA 1JT7A 3IAGC 4Q9GA 4JAWA 1KNMA 5FZUA 3HALA 2D1ZA 3OGGA 4I2SA 4OEEA 4QC4A 1W3AA 4IY8A 5BP5A 1S0FA 2Y9GA 3AKHA 4EEEB 1EYLA 4Q9PA 4JKQA 3IM7A 4ENDA 1Z2VA 1JLYA 1JT3A 2ERMA 4LO2C 1IHKA 1R8OA 4X37A 2XOAA 1RG8A 3I2AA 3N7LA 4A7KA 3BRGC 2VUAA 4I4YA 3V79C 4MZGB 2BEAA 1S0DA 2GZBA 4EFPA 2IWTB 1BFFA 4ZFWB 4USOA 3B9UA 2Y9XE 3HOMA 3NBNA 3FJJA 4EKXB 3BRDA 1T4QA 5DVHA 3FFZA 5I1BA 4F83A 4I3NA 3Q7YA 1UPSA 1EV2A 1DFQA 5JLVA 3AJ6A 3FJIA 3N7JA 1K5VA 1MC9A 5HPZA 3ZXDA 3WMVA 2E4MA 4PC4A 3LTQA 1BARA 3BTAA 5BXPA 2KH2A 4GP0A 1XZZA 3FJEA 3Q7WA 4G6JA 1G9DA 1I1BA 1TIEA 1FV2A 2VU9A 1Z4SA 4GP3A 4JP0A 4I4QA 1IRPA 3BA7A 2RSTA 2VXTI 3AZVA 2MIBA 3CQAA 4LO0A 3VUOA 4I4UA 2BFHA 1GGPB 1JLXA 3HN1A 1PWAA 3P53A 1HIBA 4UY4A 3O3QA 4Z8SB 4LO1A 3CA0A 4KEKA 4I96A 1TFMB 2F2FA 5BXTA 1PZZA 2D23A 4ZBVB 3ZXGA 5JMCA 3HMYA 4DEPA 2BEBA 4XKIA 1PUUB 4OEFA 2FFVA 1QQLA 1S0LA 3E8LC 1TOOA 1JQZA 4G9NA 1R8NA 2FGFA 1IILA 4A7ZA 3NBDA 2WBCA 3FJBA 3BAUA 4OWJA 2LIEA 4ISRA 5DUYA 1YTOA 4I4XA 2HW9A 4JRAA 3UDAA 4DCKC 3S8JA 4P6AA 1RMLA 4L4IA 1A8DA 2R9KB 1HWMB 3BB2A 4LO3A 4USPA 5BXSA 2ZQOA 9ILBA 4MZFB 5FNXA 1S0BA 2ET2A 4FVVA 4LO7B 2X2SA 3A07A 3O4OA 4I4PA 3VSFA 4J2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0C A;  3FJA A;  3ZC8 A;  5FZZ A;  2DRY A;  3ZX7 A;  1SR4 A;  3O44 A;  1VCL A;  1ILR 1;  2AAI B;  1PUM B;  3OJV A;  5BP5 C;  3BAD A;  3BAG A;  1DJS B;  5BQU A;  3BAV A;  1CE7 B;  4QBC A;  2ZR1 B;  4QAL A;  3AJ5 A;  3AZW A;  2VSA A;  3A23 A;  2D7R A;  1Q1U A;  1F31 A;  1JY0 A;  1V6U A;  2NM1 A;  3KMV A;  2HZ9 A;  4AN7 B;  1BAS A;  1W3F A;  2RG9 B;  3H6S E;  3PG0 A;  1Q03 A;  3OBR A;  3FJD A;  1FQ9 A;  5EG6 C;  3N7K A;  1AVU A;  2AXM A;  3RMX A;  3V0A A;  3V0B A;  1BA7 A;  2KKI A;  1EVT A;  4I4O A;  1WD3 A;  2DRZ A;  3AH1 A;  2VSE A;  4II0 A;  4X39 A;  8I1B A;  5FNW A;  3CA4 A;  3BA4 A;  1IOB A;  1JT4 A;  1M2T B;  4A7Y A;  1WD4 A;  1YXW A;  4XFU A;  1Z0H A;  4LO7 C;  3A22 A;  2E4M C;  1JT5 A;  4ZFU B;  2VLC A;  2NYY A;  4I6I A;  5B2H A;  1I1E A;  3FJ8 A;  4GAI A;  4X3A A;  3BA5 A;  5FZY A;  4I37 A;  1BFC A;  4R6U B;  1J0S A;  1E0O A;  41BI A;  2VXR A;  4P0J A;  5DSS B;  3FJ9 A;  4EB2 B;  3CRI A;  2F8X C;  3H6R A;  3C9Z A;  4I4S A;  1L2H A;  1AFC A;  1FMZ A;  4P0K A;  3WO2 A;  3WMU A;  4LO0 C;  3CRG A;  3BX1 C;  4LO8 B;  3IM6 A;  1AF9 A;  1P63 A;  3UJ0 A;  3CAH A;  3O49 A;  3N0K A;  1DZC A;  4LO1 C;  1PC8 B;  5DZU A;  2F2F C;  1IT0 A;  2KLL A;  3OJ2 A;  3O4C A;  3VSZ A;  3PME A;  4IZX A;  4GOV A;  3AH4 A;  3FUQ A;  4H9W A;  4J23 B;  4IY9 A;  3HSM A;  2P23 A;  3V0A B;  1II4 A;  1BLD A;  4HJJ A;  4IHZ A;  2NP0 A;  3H6Q A;  3RSJ A;  1V6X A;  1HCE A;  2GO2 A;  2AFG A;  3F62 B;  4FGF A;  1HCD A;  3VT2 A;  2LIQ A;  1XYF A;  3VT1 A;  4Z9W B;  3W9T A;  2QYI B;  3IIR A;  3LLP A;  3MPP G;  1RY7 A;  4LO3 C;  3SNV A;  4KEI A;  2NVH A;  1TWE A;  1FWU A;  1DQG A;  1WBA A;  2D24 A;  3CA1 A;  1AVA C;  3NJ5 A;  4J2S A;  3OBT A;  1NUN A;  3TC2 A;  3O4A A;  4G1R A;  4G6M A;  1AVX B;  3I29 B;  1SR4 C;  4I4V A;  1ISV A;  3RMY A;  3R4S A;  2FFU A;  4OW4 A;  5BQU C;  1V6V A;  1ISZ A;  3UD7 A;  1G82 A;  5D61 A;  2Q3N B;  3H6R B;  2K8R A;  4EFR A;  1ISY A;  2MLL B;  4QKR A;  1QXM A;  2UUS A;  4D8H A;  1V6W A;  2ESU A;  1TP0 A;  2D20 A;  4KEJ A;  4DEN A;  4ZOT A;  7I1B A;  4I4R A;  1G9C A;  5BXR A;  3T8S A;  3AH2 A;  1G9A A;  1HKN A;  3O4B A;  3AKF A;  1YBI A;  3UD8 A;  2NTD A;  1ABR B;  4GOY A;  4ION A;  4JQ0 A;  2FDB M;  3AKI A;  2YUG A;  3JRR A;  3NBE A;  3UD9 A;  1M16 A;  1G9B A;  3P6I A;  1S0G A;  5BVP I;  3AKG A;  5F90 A;  1Q04 A;  2Z48 A;  3WIN C;  3N7M A;  3FJC A;  3BAQ A;  3JUT A;  4J2K A;  4EFQ A;  3I2X A;  1DLL A;  1IRA X;  3PUB A;  1XG6 A;  3CA3 A;  4OUJ A;  1ISX A;  1FGA A;  3WIN A;  1QQK A;  2M49 A;  5EC5 A;  5D63 A;  4Q91 A;  5F8S A;  3EF2 A;  5BOW A;  3OJM A;  1MD6 A;  3ILA A;  4I1B A;  1T9F A;  1TWM A;  3QR5 A;  1N4K A;  21BI A;  5F8Y A;  4IYB A;  1NZK A;  3VEQ A;  3P6J A;  2D22 A;  4LO2 A;  4ZLB B;  3FJF A;  3A21 A;  4I7I A;  1FWV A;  4QD2 B;  3CU1 B;  3Q7X A;  1DZD A;  1OQL B;  4G9M A;  1EPW A;  2KI4 A;  1HWO B;  1ONK B;  3POK A;  4QKS A;  3FUO A;  4IQP A;  3WO4 A;  3BAO A;  3VT0 A;  4TLP A;  3VWC A;  1W3G A;  4I8M A;  4KBB A;  4ZKT B;  5E24 E;  3FJK A;  3S8K A;  3HBW A;  1DIW A;  2D44 A;  3K1X A;  3O5W B;  5D62 A;  4ZFY B;  4D0Z A;  5GAQ A;  2K4A B;  1D0H A;  2K43 A;  3V0B B;  4ISQ A;  2ZQN A;  1XHB A;  4I1E A;  4XFS A;  1ISW A;  4H04 A;  3WA1 A;  3CA5 A;  3R4U A;  1HWP B;  2NZ9 A;  4OWK A;  2HWM A;  3BAH A;  1FMM S;  2DS0 A;  6I1B A;  4ZA3 B;  5F8W A;  3FJH A;  2HWA A;  4I0Y A;  2D43 A;  4HR6 C;  2J3P A;  3WO3 A;  4QD2 C;  2FO1 A;  4J2Y A;  4QBV A;  1CVS A;  1TTU A;  4L4H A;  1BFG A;  2Y9F A;  1IJT A;  1SZ6 B;  2RQ9 A;  3QYD A;  4F34 A;  1HWN B;  1S0E A;  1YF8 B;  2MC2 A;  4OEG A;  1AVW B;  3ZC9 A;  3PHZ A;  2Y9W C;  3NBC A;  2P39 A;  4GAF A;  4QO3 A;  4XFT A;  2KI6 B;  3CRH A;  1YYN A;  2I1B A;  2Z49 A;  2IHO A;  3D7W B;  3BRF A;  1FN0 A;  2D7I A;  4YOL A;  4CJM A;  3FGM A;  3CA6 A;  4IZE A;  1DFC A;  3OGF A;  4X38 A;  1ITB A;  4KC3 A;  4AN6 A;  4P0L A;  5EHA A;  5G00 A;  3RTJ B;  3MAL A;  2Q9X A;  2L5X A;  2AQZ A;  4HA2 A;  3O4D A;  2X2T A;  1WBC A;  2QN4 A;  1DQO A;  2DRE A;  3UJ4 A;  1RZO B;  4OWL A;  3IM5 A;  1BFB A;  4JPZ A;  4D0T A;  1AXM A;  1BLA A;  2WRY A;  4ZGR B;  4JKX B;  4WBC A;  1JTC A;  3RTI B;  3F1R A;  1FV3 A;  1K5U A;  31BI A;  1JT7 A;  3IAG C;  4Q9G A;  4JAW A;  1KNM A;  5FZU A;  3HAL A;  2D1Z A;  3OGG A;  4I2S A;  4OEE A;  4QC4 A;  1W3A A;  4IY8 A;  5BP5 A;  1S0F A;  2Y9G A;  3AKH A;  4EEE B;  1EYL A;  4Q9P A;  4JKQ A;  3IM7 A;  4END A;  1Z2V A;  1JLY A;  1JT3 A;  2ERM A;  4LO2 C;  1IHK A;  1R8O A;  4X37 A;  2XOA A;  1RG8 A;  3I2A A;  3N7L A;  4A7K A;  3BRG C;  2VUA A;  4I4Y A;  3V79 C;  2BEA A;  1S0D A;  2GZB A;  4EFP A;  2IWT B;  1BFF A;  4ZFW B;  4USO A;  3B9U A;  2Y9X E;  3HOM A;  3NBN A;  3FJJ A;  4EKX B;  3BRD A;  1T4Q A;  5DVH A;  3FFZ A;  5I1B A;  4F83 A;  4I3N A;  3Q7Y A;  1UPS A;  1EV2 A;  1DFQ A;  5JLV A;  3AJ6 A;  3FJI A;  3N7J A;  1K5V A;  1MC9 A;  5HPZ A;  3ZXD A;  3WMV A;  2E4M A;  4PC4 A;  3LTQ A;  1BAR A;  3BTA A;  5BXP A;  2KH2 A;  4GP0 A;  1XZZ A;  3FJE A;  3Q7W A;  4G6J A;  1G9D A;  1I1B A;  1TIE A;  1FV2 A;  2VU9 A;  1Z4S A;  4GP3 A;  4JP0 A;  4I4Q A;  1IRP A;  3BA7 A;  2RST A;  2VXT I;  3AZV A;  2MIB A;  3CQA A;  4LO0 A;  3VUO A;  4I4U A;  2BFH A;  1GGP B;  1JLX A;  3HN1 A;  1PWA A;  3P53 A;  1HIB A;  3O3Q A;  4Z8S B;  4LO1 A;  3CA0 A;  4KEK A;  4I96 A;  1TFM B;  2F2F A;  5BXT A;  1PZZ A;  2D23 A;  4ZBV B;  3ZXG A;  5JMC A;  3HMY A;  4DEP A;  2BEB A;  4XKI A;  1PUU B;  4OEF A;  2FFV A;  1QQL A;  1S0L A;  3E8L C;  1TOO A;  1JQZ A;  4G9N A;  1R8N A;  2FGF A;  1IIL A;  4A7Z A;  3NBD A;  2WBC A;  3FJB A;  3BAU A;  4OWJ A;  2LIE A;  4ISR A;  5DUY A;  1YTO A;  4I4X A;  2HW9 A;  4JRA A;  3UDA A;  4DCK C;  3S8J A;  4P6A A;  1RML A;  4L4I A;  1A8D A;  2R9K B;  1HWM B;  3BB2 A;  4LO3 A;  4USP A;  5BXS A;  2ZQO A;  9ILB A;  5FNX A;  1S0B A;  2ET2 A;  4FVV A;  4LO7 B;  2X2S A;  3A07 A;  3O4O A;  4I4P A;  3VSF A;  4J2X A; 
#chains in the Genus database with same CATH topology
 1S0C A;  3FJA A;  3ZC8 A;  5FZZ A;  2DRY A;  3ZX7 A;  1SR4 A;  3O44 A;  1VCL A;  1ILR 1;  2AAI B;  1PUM B;  3OJV A;  5BP5 C;  3BAD A;  3BAG A;  1DJS B;  5BQU A;  3BAV A;  1CE7 B;  4QBC A;  2ZR1 B;  4QAL A;  3AJ5 A;  3AZW A;  2VSA A;  3A23 A;  2D7R A;  1Q1U A;  1F31 A;  1JY0 A;  1V6U A;  2NM1 A;  3KMV A;  2HZ9 A;  4AN7 B;  1BAS A;  1W3F A;  2RG9 B;  3H6S E;  3PG0 A;  1Q03 A;  3OBR A;  3FJD A;  1FQ9 A;  5EG6 C;  3N7K A;  1AVU A;  2AXM A;  3RMX A;  3V0A A;  3V0B A;  1BA7 A;  2KKI A;  1EVT A;  4I4O A;  1WD3 A;  2DRZ A;  3AH1 A;  4MZH A;  2VSE A;  4II0 A;  4X39 A;  8I1B A;  5FNW A;  3CA4 A;  3BA4 A;  1IOB A;  1JT4 A;  1M2T B;  4A7Y A;  1WD4 A;  1YXW A;  4XFU A;  1Z0H A;  4LO7 C;  3A22 A;  2E4M C;  1JT5 A;  4ZFU B;  2VLC A;  2NYY A;  4I6I A;  5B2H A;  1I1E A;  3FJ8 A;  4GAI A;  4X3A A;  3BA5 A;  5FZY A;  4I37 A;  1BFC A;  4R6U B;  1J0S A;  1E0O A;  41BI A;  2VXR A;  4P0J A;  5DSS B;  3FJ9 A;  4EB2 B;  3CRI A;  2F8X C;  3H6R A;  3C9Z A;  4I4S A;  1L2H A;  1AFC A;  1FMZ A;  4P0K A;  3WO2 A;  3WMU A;  4LO0 C;  3CRG A;  3BX1 C;  4LO8 B;  3IM6 A;  1AF9 A;  1P63 A;  3UJ0 A;  3CAH A;  3O49 A;  3N0K A;  1DZC A;  4LO1 C;  1PC8 B;  5DZU A;  2F2F C;  1IT0 A;  2KLL A;  3OJ2 A;  3O4C A;  3VSZ A;  3PME A;  4IZX A;  4GOV A;  3AH4 A;  3FUQ A;  4H9W A;  4J23 B;  4IY9 A;  3HSM A;  2P23 A;  3V0A B;  1II4 A;  1BLD A;  4HJJ A;  4IHZ A;  2NP0 A;  3H6Q A;  3RSJ A;  1V6X A;  1HCE A;  2GO2 A;  2AFG A;  3F62 B;  4FGF A;  1HCD A;  3VT2 A;  2LIQ A;  1XYF A;  3VT1 A;  4Z9W B;  3W9T A;  2QYI B;  3IIR A;  3LLP A;  3MPP G;  1RY7 A;  4LO3 C;  3SNV A;  4KEI A;  2NVH A;  1TWE A;  1FWU A;  1DQG A;  1WBA A;  2D24 A;  3CA1 A;  1AVA C;  3NJ5 A;  4J2S A;  3OBT A;  1NUN A;  3TC2 A;  3O4A A;  4G1R A;  4G6M A;  1AVX B;  3I29 B;  1SR4 C;  4I4V A;  1ISV A;  3RMY A;  3R4S A;  2FFU A;  4OW4 A;  5BQU C;  1V6V A;  1ISZ A;  3UD7 A;  1G82 A;  5D61 A;  2Q3N B;  3H6R B;  2K8R A;  4EFR A;  1ISY A;  2MLL B;  4QKR A;  1QXM A;  2UUS A;  4D8H A;  1V6W A;  2ESU A;  1TP0 A;  2D20 A;  4KEJ A;  4DEN A;  4ZOT A;  7I1B A;  4I4R A;  1G9C A;  5BXR A;  3T8S A;  3AH2 A;  1G9A A;  1HKN A;  3O4B A;  3AKF A;  1YBI A;  3UD8 A;  2NTD A;  1ABR B;  4GOY A;  4ION A;  4JQ0 A;  2FDB M;  3AKI A;  2YUG A;  3JRR A;  3NBE A;  3UD9 A;  1M16 A;  1G9B A;  3P6I A;  1S0G A;  5BVP I;  3AKG A;  5F90 A;  1Q04 A;  2Z48 A;  3WIN C;  3N7M A;  3FJC A;  3BAQ A;  3JUT A;  4J2K A;  4EFQ A;  3I2X A;  1DLL A;  1IRA X;  3PUB A;  1XG6 A;  3CA3 A;  4OUJ A;  1ISX A;  1FGA A;  3WIN A;  1QQK A;  2M49 A;  5EC5 A;  5D63 A;  4Q91 A;  5F8S A;  3EF2 A;  5BOW A;  3OJM A;  1MD6 A;  3ILA A;  4I1B A;  1T9F A;  1TWM A;  3QR5 A;  1N4K A;  21BI A;  5F8Y A;  4IYB A;  1NZK A;  3VEQ A;  3P6J A;  2D22 A;  4LO2 A;  4ZLB B;  3FJF A;  3A21 A;  4I7I A;  1FWV A;  4QD2 B;  3CU1 B;  3Q7X A;  1DZD A;  1OQL B;  4G9M A;  1EPW A;  2KI4 A;  1HWO B;  1ONK B;  3POK A;  4QKS A;  3FUO A;  4IQP A;  3WO4 A;  3BAO A;  3VT0 A;  4TLP A;  3VWC A;  1W3G A;  4I8M A;  4KBB A;  4ZKT B;  5E24 E;  3FJK A;  3S8K A;  3HBW A;  1DIW A;  2D44 A;  3K1X A;  3O5W B;  4H75 A;  5D62 A;  4ZFY B;  4D0Z A;  5GAQ A;  2K4A B;  1D0H A;  2K43 A;  3V0B B;  4ISQ A;  2ZQN A;  1XHB A;  4I1E A;  4XFS A;  1ISW A;  4H04 A;  3WA1 A;  3CA5 A;  3R4U A;  1HWP B;  2NZ9 A;  4OWK A;  2HWM A;  3BAH A;  1FMM S;  2DS0 A;  6I1B A;  4ZA3 B;  5F8W A;  3FJH A;  2HWA A;  4I0Y A;  2D43 A;  4HR6 C;  2J3P A;  3WO3 A;  4QD2 C;  2FO1 A;  4J2Y A;  4QBV A;  1CVS A;  1TTU A;  4L4H A;  1BFG A;  2Y9F A;  1IJT A;  1SZ6 B;  2RQ9 A;  3QYD A;  4F34 A;  1HWN B;  1S0E A;  1YF8 B;  2MC2 A;  4OEG A;  1AVW B;  3ZC9 A;  3PHZ A;  2Y9W C;  3NBC A;  2P39 A;  4GAF A;  4QO3 A;  4XFT A;  2KI6 B;  3CRH A;  1YYN A;  2I1B A;  2Z49 A;  2IHO A;  3D7W B;  3BRF A;  1FN0 A;  2D7I A;  4YOL A;  4CJM A;  3FGM A;  3CA6 A;  4IZE A;  1DFC A;  3OGF A;  4X38 A;  1ITB A;  4KC3 A;  4AN6 A;  4P0L A;  5EHA A;  5G00 A;  3RTJ B;  3MAL A;  2Q9X A;  2L5X A;  2AQZ A;  4HA2 A;  3O4D A;  2X2T A;  1WBC A;  2QN4 A;  1DQO A;  2DRE A;  3UJ4 A;  1RZO B;  4OWL A;  3IM5 A;  1BFB A;  4JPZ A;  4D0T A;  1AXM A;  2NS2 A;  1BLA A;  2WRY A;  4ZGR B;  4JKX B;  4WBC A;  1JTC A;  3RTI B;  3F1R A;  1FV3 A;  1K5U A;  31BI A;  1JT7 A;  3IAG C;  4Q9G A;  4JAW A;  1KNM A;  5FZU A;  3HAL A;  2D1Z A;  3OGG A;  4I2S A;  4OEE A;  4QC4 A;  1W3A A;  4IY8 A;  5BP5 A;  1S0F A;  2Y9G A;  3AKH A;  4EEE B;  1EYL A;  4Q9P A;  4JKQ A;  3IM7 A;  4END A;  1Z2V A;  1JLY A;  1JT3 A;  2ERM A;  4LO2 C;  1IHK A;  1R8O A;  4X37 A;  2XOA A;  1RG8 A;  3I2A A;  3N7L A;  4A7K A;  3BRG C;  2VUA A;  4I4Y A;  3V79 C;  4MZG B;  2BEA A;  1S0D A;  2GZB A;  4EFP A;  2IWT B;  1BFF A;  4ZFW B;  4USO A;  3B9U A;  2Y9X E;  3HOM A;  3NBN A;  3FJJ A;  4EKX B;  3BRD A;  1T4Q A;  5DVH A;  3FFZ A;  5I1B A;  4F83 A;  4I3N A;  3Q7Y A;  1UPS A;  1EV2 A;  1DFQ A;  5JLV A;  3AJ6 A;  3FJI A;  3N7J A;  1K5V A;  1MC9 A;  5HPZ A;  3ZXD A;  3WMV A;  2E4M A;  4PC4 A;  3LTQ A;  1BAR A;  3BTA A;  5BXP A;  2KH2 A;  4GP0 A;  1XZZ A;  3FJE A;  3Q7W A;  4G6J A;  1G9D A;  1I1B A;  1TIE A;  1FV2 A;  2VU9 A;  1Z4S A;  4GP3 A;  4JP0 A;  4I4Q A;  1IRP A;  3BA7 A;  2RST A;  2VXT I;  3AZV A;  2MIB A;  3CQA A;  4LO0 A;  3VUO A;  4I4U A;  2BFH A;  1GGP B;  1JLX A;  3HN1 A;  1PWA A;  3P53 A;  1HIB A;  4UY4 A;  3O3Q A;  4Z8S B;  4LO1 A;  3CA0 A;  4KEK A;  4I96 A;  1TFM B;  2F2F A;  5BXT A;  1PZZ A;  2D23 A;  4ZBV B;  3ZXG A;  5JMC A;  3HMY A;  4DEP A;  2BEB A;  4XKI A;  1PUU B;  4OEF A;  2FFV A;  1QQL A;  1S0L A;  3E8L C;  1TOO A;  1JQZ A;  4G9N A;  1R8N A;  2FGF A;  1IIL A;  4A7Z A;  3NBD A;  2WBC A;  3FJB A;  3BAU A;  4OWJ A;  2LIE A;  4ISR A;  5DUY A;  1YTO A;  4I4X A;  2HW9 A;  4JRA A;  3UDA A;  4DCK C;  3S8J A;  4P6A A;  1RML A;  4L4I A;  1A8D A;  2R9K B;  1HWM B;  3BB2 A;  4LO3 A;  4USP A;  5BXS A;  2ZQO A;  9ILB A;  4MZF B;  5FNX A;  1S0B A;  2ET2 A;  4FVV A;  4LO7 B;  2X2S A;  3A07 A;  3O4O A;  4I4P A;  3VSF A;  4J2X A; 
#chains in the Genus database with same CATH homology
 1S0C A;  3FJA A;  3ZC8 A;  5FZZ A;  2DRY A;  3ZX7 A;  1SR4 A;  3O44 A;  1VCL A;  1ILR 1;  2AAI B;  1PUM B;  3OJV A;  5BP5 C;  3BAD A;  3BAG A;  1DJS B;  5BQU A;  3BAV A;  1CE7 B;  4QBC A;  2ZR1 B;  4QAL A;  3AJ5 A;  3AZW A;  2VSA A;  3A23 A;  2D7R A;  1Q1U A;  1F31 A;  1JY0 A;  1V6U A;  2NM1 A;  3KMV A;  2HZ9 A;  4AN7 B;  1BAS A;  1W3F A;  2RG9 B;  3H6S E;  3PG0 A;  1Q03 A;  3OBR A;  3FJD A;  1FQ9 A;  5EG6 C;  3N7K A;  1AVU A;  2AXM A;  3RMX A;  3V0A A;  3V0B A;  1BA7 A;  2KKI A;  1EVT A;  4I4O A;  1WD3 A;  2DRZ A;  3AH1 A;  4MZH A;  2VSE A;  4II0 A;  4X39 A;  8I1B A;  5FNW A;  3CA4 A;  3BA4 A;  1IOB A;  1JT4 A;  1M2T B;  4A7Y A;  1WD4 A;  1YXW A;  4XFU A;  1Z0H A;  4LO7 C;  3A22 A;  2E4M C;  1JT5 A;  4ZFU B;  2VLC A;  2NYY A;  4I6I A;  5B2H A;  1I1E A;  3FJ8 A;  4GAI A;  4X3A A;  3BA5 A;  5FZY A;  4I37 A;  1BFC A;  4R6U B;  1J0S A;  1E0O A;  41BI A;  2VXR A;  4P0J A;  5DSS B;  3FJ9 A;  4EB2 B;  3CRI A;  2F8X C;  3H6R A;  3C9Z A;  4I4S A;  1L2H A;  1AFC A;  1FMZ A;  4P0K A;  3WO2 A;  3WMU A;  4LO0 C;  3CRG A;  3BX1 C;  4LO8 B;  3IM6 A;  1AF9 A;  1P63 A;  3UJ0 A;  3CAH A;  3O49 A;  3N0K A;  1DZC A;  4LO1 C;  1PC8 B;  5DZU A;  2F2F C;  1IT0 A;  2KLL A;  3OJ2 A;  3O4C A;  3VSZ A;  3PME A;  4IZX A;  4GOV A;  3AH4 A;  3FUQ A;  4H9W A;  4J23 B;  4IY9 A;  3HSM A;  2P23 A;  3V0A B;  1II4 A;  1BLD A;  4HJJ A;  4IHZ A;  2NP0 A;  3H6Q A;  3RSJ A;  1V6X A;  1HCE A;  2GO2 A;  2AFG A;  3F62 B;  4FGF A;  1HCD A;  3VT2 A;  2LIQ A;  1XYF A;  3VT1 A;  4Z9W B;  3W9T A;  2QYI B;  3IIR A;  3LLP A;  3MPP G;  1RY7 A;  4LO3 C;  3SNV A;  4KEI A;  2NVH A;  1TWE A;  1FWU A;  1DQG A;  1WBA A;  2D24 A;  3CA1 A;  1AVA C;  3NJ5 A;  4J2S A;  3OBT A;  1NUN A;  3TC2 A;  3O4A A;  4G1R A;  4G6M A;  1AVX B;  3I29 B;  1SR4 C;  4I4V A;  1ISV A;  3RMY A;  3R4S A;  2FFU A;  4OW4 A;  5BQU C;  1V6V A;  1ISZ A;  3UD7 A;  1G82 A;  5D61 A;  2Q3N B;  3H6R B;  2K8R A;  4EFR A;  1ISY A;  2MLL B;  4QKR A;  1QXM A;  2UUS A;  4D8H A;  1V6W A;  2ESU A;  1TP0 A;  2D20 A;  4KEJ A;  4DEN A;  4ZOT A;  7I1B A;  4I4R A;  1G9C A;  5BXR A;  3T8S A;  3AH2 A;  1G9A A;  1HKN A;  3O4B A;  3AKF A;  1YBI A;  3UD8 A;  2NTD A;  1ABR B;  4GOY A;  4ION A;  4JQ0 A;  2FDB M;  3AKI A;  2YUG A;  3JRR A;  3NBE A;  3UD9 A;  1M16 A;  1G9B A;  3P6I A;  1S0G A;  5BVP I;  3AKG A;  5F90 A;  1Q04 A;  2Z48 A;  3WIN C;  3N7M A;  3FJC A;  3BAQ A;  3JUT A;  4J2K A;  4EFQ A;  3I2X A;  1DLL A;  1IRA X;  3PUB A;  1XG6 A;  3CA3 A;  4OUJ A;  1ISX A;  1FGA A;  3WIN A;  1QQK A;  2M49 A;  5EC5 A;  5D63 A;  4Q91 A;  5F8S A;  3EF2 A;  5BOW A;  3OJM A;  1MD6 A;  3ILA A;  4I1B A;  1T9F A;  1TWM A;  3QR5 A;  1N4K A;  21BI A;  5F8Y A;  4IYB A;  1NZK A;  3VEQ A;  3P6J A;  2D22 A;  4LO2 A;  4ZLB B;  3FJF A;  3A21 A;  4I7I A;  1FWV A;  4QD2 B;  3CU1 B;  3Q7X A;  1DZD A;  1OQL B;  4G9M A;  1EPW A;  2KI4 A;  1HWO B;  1ONK B;  3POK A;  4QKS A;  3FUO A;  4IQP A;  3WO4 A;  3BAO A;  3VT0 A;  4TLP A;  3VWC A;  1W3G A;  4I8M A;  4KBB A;  4ZKT B;  5E24 E;  3FJK A;  3S8K A;  3HBW A;  1DIW A;  2D44 A;  3K1X A;  3O5W B;  4H75 A;  5D62 A;  4ZFY B;  4D0Z A;  5GAQ A;  2K4A B;  1D0H A;  2K43 A;  3V0B B;  4ISQ A;  2ZQN A;  1XHB A;  4I1E A;  4XFS A;  1ISW A;  4H04 A;  3WA1 A;  3CA5 A;  3R4U A;  1HWP B;  2NZ9 A;  4OWK A;  2HWM A;  3BAH A;  1FMM S;  2DS0 A;  6I1B A;  4ZA3 B;  5F8W A;  3FJH A;  2HWA A;  4I0Y A;  2D43 A;  4HR6 C;  2J3P A;  3WO3 A;  4QD2 C;  2FO1 A;  4J2Y A;  4QBV A;  1CVS A;  1TTU A;  4L4H A;  1BFG A;  2Y9F A;  1IJT A;  1SZ6 B;  2RQ9 A;  3QYD A;  4F34 A;  1HWN B;  1S0E A;  1YF8 B;  2MC2 A;  4OEG A;  1AVW B;  3ZC9 A;  3PHZ A;  2Y9W C;  3NBC A;  2P39 A;  4GAF A;  4QO3 A;  4XFT A;  2KI6 B;  3CRH A;  1YYN A;  2I1B A;  2Z49 A;  2IHO A;  3D7W B;  3BRF A;  1FN0 A;  2D7I A;  4YOL A;  4CJM A;  3FGM A;  3CA6 A;  4IZE A;  1DFC A;  3OGF A;  4X38 A;  1ITB A;  4KC3 A;  4AN6 A;  4P0L A;  5EHA A;  5G00 A;  3RTJ B;  3MAL A;  2Q9X A;  2L5X A;  2AQZ A;  4HA2 A;  3O4D A;  2X2T A;  1WBC A;  2QN4 A;  1DQO A;  2DRE A;  3UJ4 A;  1RZO B;  4OWL A;  3IM5 A;  1BFB A;  4JPZ A;  4D0T A;  1AXM A;  2NS2 A;  1BLA A;  2WRY A;  4ZGR B;  4JKX B;  4WBC A;  1JTC A;  3RTI B;  3F1R A;  1FV3 A;  1K5U A;  31BI A;  1JT7 A;  3IAG C;  4Q9G A;  4JAW A;  1KNM A;  5FZU A;  3HAL A;  2D1Z A;  3OGG A;  4I2S A;  4OEE A;  4QC4 A;  1W3A A;  4IY8 A;  5BP5 A;  1S0F A;  2Y9G A;  3AKH A;  4EEE B;  1EYL A;  4Q9P A;  4JKQ A;  3IM7 A;  4END A;  1Z2V A;  1JLY A;  1JT3 A;  2ERM A;  4LO2 C;  1IHK A;  1R8O A;  4X37 A;  2XOA A;  1RG8 A;  3I2A A;  3N7L A;  4A7K A;  3BRG C;  2VUA A;  4I4Y A;  3V79 C;  4MZG B;  2BEA A;  1S0D A;  2GZB A;  4EFP A;  2IWT B;  1BFF A;  4ZFW B;  4USO A;  3B9U A;  2Y9X E;  3HOM A;  3NBN A;  3FJJ A;  4EKX B;  3BRD A;  1T4Q A;  5DVH A;  3FFZ A;  5I1B A;  4F83 A;  4I3N A;  3Q7Y A;  1UPS A;  1EV2 A;  1DFQ A;  5JLV A;  3AJ6 A;  3FJI A;  3N7J A;  1K5V A;  1MC9 A;  5HPZ A;  3ZXD A;  3WMV A;  2E4M A;  4PC4 A;  3LTQ A;  1BAR A;  3BTA A;  5BXP A;  2KH2 A;  4GP0 A;  1XZZ A;  3FJE A;  3Q7W A;  4G6J A;  1G9D A;  1I1B A;  1TIE A;  1FV2 A;  2VU9 A;  1Z4S A;  4GP3 A;  4JP0 A;  4I4Q A;  1IRP A;  3BA7 A;  2RST A;  2VXT I;  3AZV A;  2MIB A;  3CQA A;  4LO0 A;  3VUO A;  4I4U A;  2BFH A;  1GGP B;  1JLX A;  3HN1 A;  1PWA A;  3P53 A;  1HIB A;  4UY4 A;  3O3Q A;  4Z8S B;  4LO1 A;  3CA0 A;  4KEK A;  4I96 A;  1TFM B;  2F2F A;  5BXT A;  1PZZ A;  2D23 A;  4ZBV B;  3ZXG A;  5JMC A;  3HMY A;  4DEP A;  2BEB A;  4XKI A;  1PUU B;  4OEF A;  2FFV A;  1QQL A;  1S0L A;  3E8L C;  1TOO A;  1JQZ A;  4G9N A;  1R8N A;  2FGF A;  1IIL A;  4A7Z A;  3NBD A;  2WBC A;  3FJB A;  3BAU A;  4OWJ A;  2LIE A;  4ISR A;  5DUY A;  1YTO A;  4I4X A;  2HW9 A;  4JRA A;  3UDA A;  4DCK C;  3S8J A;  4P6A A;  1RML A;  4L4I A;  1A8D A;  2R9K B;  1HWM B;  3BB2 A;  4LO3 A;  4USP A;  5BXS A;  2ZQO A;  9ILB A;  4MZF B;  5FNX A;  1S0B A;  2ET2 A;  4FVV A;  4LO7 B;  2X2S A;  3A07 A;  3O4O A;  4I4P A;  3VSF A;  4J2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...