5DVIA

High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. putida csv86
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
396
structure length
395
Chain Sequence
NPGTVDVLHWWTSGGEAKAVETLKQQIQKDGFIWKDNAVAGGGGAAAMTVLKTRAISGNPPSAAQIKGPDIQEWGALGLLTELDDVAAANKWDDLLPRQVADIMKYDGHYVAVPVNIHRVNWLWINPQVFDKAGAKVPTTLDELFAAADKLKAAGFIPLAHGGQPWQDSTVFEDLVLSILGPKGYHAAFVDLDEKTLTGPQMTEAFATLKRLGTYMDPNRAGRDWNIAAAEVINGKAGMQIMGDWAKSEWSAAGKVAGKDYQVAFPGTQGSFAYNIDSLAMFKLKDANDIKAQNDLAKVALEPEFQTVFNQNKGSLPVRQDMDMSKFDACTQKSAADFKEAAKGDGLQPSMAHNMATTLAVQGAIFDVVTNFLNDPQAEPATAVKQLNAAIKAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Binding protein component of ABC sugar transporter
publication title High Resolution Structures of Periplasmic Glucose-binding Protein of Pseudomonas putida CSV86 Reveal Structural Basis of Its Substrate Specificity
pubmed doi rcsb
source organism Pseudomonas putida csv86
molecule tags Transport protein
total genus 142
structure length 395
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dviA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5dviA02
4KCDA 3C32A 3VXCA 3DM0A 2H9BA 3C35A 4X9TA 3K1NA 3ONMA 3KSJA 4AB5A 1OLCA 4YKKA 4ECFA 3T22A 3HSTA 3UGWA 3OENA 3CVGA 4EQ9A 1MDP1 1SW4A 1JW5A 4IGRA 1URDA 4NF5A 3T9VA 3IX1A 4RK2A 3PPQA 2I3VA 1MPDA 4EXKA 3FXQA 4R9FA 2ZMBA 1FQBA 1DOTA 1WDNA 4F19A 4RJZA 4TLLB 2E1SA 4G8NA 4KYDA 4KD5A 1LCFA 3ODBA 1B4HA 3F11A 4OQOA 3VV5A 3IAZA 4NF8A 2G29A 4IO2A 5CMKA 3SEVA 1IXGA 1BKAA 3DP4A 3ZKLA 1P1OA 1Y3PA 4F3SA 2DWAA 1PC3A 3W15C 1SI0A 4TLMB 1MQGA 4I62A 2DYXA 4RXLA 4KYEA 2FYIA 1UTHB 4ZE8A 2XXYA 1MM6A 1A54A 4DE8A 1MQIA 2H25A 4BDNA 2HAVA 1Z7ME 3PMXA 2O69A 1UIVA 2Q8JA 4OESA 3QUJA 1TFDA 2IEEA 3ILUB 4F1YA 5CBRA 4G68A 3RQTA 4GVOA 3UA8A 3V89B 2QMXA 4F3GA 5ICTA 4EUOA 3TUSA 3QIMA 1Q1KA 5AA4A 4YKJA 2PT2A 5I59B 5CMMA 3MPLA 3SETA 3TTMA 2DXRA 1PBQA 2CMOA 1II5A 1TFAA 5TU0A 3IOUA 2HZKA 3HPIA 2D21A 2YLNA 3K00A 4F2OA 4LONB 4KHZE 4E0WA 2PT1A 3TODA 1VR5A 4FE8A 1NKXA 5TPAA 2B65A 4Q0CA 2UVGA 2REGA 1QULA 3TQWA 4XXUA 1EU8A 2Y7PA 4ZE9A 1MXVA 5DVJA 4F29A 1FQAA 4GF8A 1RYXA 1FTJA 1BP5A 4QFNA 4OVJA 3FZVA 2XD3A 5J1DA 4QF9A 2Z8DA 1D4NA 4IO3A 1D9YA 3KJTA 4FIMA 3BFUA 3LSFB 5AA3A 3LSLA 3PMVA 1VFEA 2O84X 3LSWA 3EF7A 5H8HB 1IXCA 3ZKKA 1UTBA 1HSEA 3JYRA 5HM4B 3RNNA 4OHNA 4RNSA 3R6UA 1NFTA 2P0SA 3CSBA 4ISUA 4M4GA 1OLAA 5ITOA 3H3GA 2GH9A 3OMBA 2NWJA 4MLVA 4JWXA 1PEBA 2UVIA 3N26A 4ZZEA 3SEXA 5BWJA 1RYOA 3K6WA 1JVYA 3R26A 4QFPA 4PETA 4NTLA 4C1UA 1O63A 4FORA 3VVDA 3RTWB 5ITPA 1OVTA 1B7HA 4QSDA 1QUKA 3PPNA 5AA2B 3GLBA 1IXIA 1QKAA 3MQ9A 1A40A 3CIJA 4JBZA 4LZ8A 3OELA 3RY3A 3LBSA 3K6XA 2XX7A 4E0XA 1P1NA 1PB9A 1URGA 3MP1A 4GL0A 4DLDA 3TCFA 2QMWA 5HPQA 3PPRA 5JEIA 2H4IA 1ELJA 3E4RA 3O66A 4POXA 2I48A 1SDXA 5I58A 5CMBA 4XKRA 3K2DA 4H5GA 1YCJA 3T9XB 4ESWA 3DP6A 3GXAA 3KOTA 1S50A 3OXNA 2AL4A 4GQOA 3TQLA 2RC8A 3V5AA 5CRYA 3S9MC 1JEUA 2UYFA 1OQHA 4BDLA 1SW5A 5L9OA 5B7DA 1JW1A 1Y20A 3OO7A 1PB7A 3MVXA 3MJNA 4FEBA 3E9XA 4R75A 3OO8A 2V25A 4NF5B 1DMBA 5B70A 3C34A 1SVXB 1IQ7A 2YPNA 3C4MA 3RT8A 3MVZA 1LB9A 1Y3NA 2I58A 3KBRA 3TTNA 2XX9A 4F3BA 1B4ZA 1NNFA 5I57A 4MFIA 3EHUA 4RY1A 3KEIA 4EQBA 1B05A 4LZ7A 2DQVA 1JQFA 4NF8B 4LP2B 3MC2A 4H0WA 4H8IA 1YAEA 3S4UA 5DVIA 1GTKA 3SEYA 3O2AA 4GWOA 3RN8A 1PDAA 4YKPA 2ZYMA 3BFTA 3MZ1A 3GZGA 1N7XA 3N5LA 4H65A 4KFQA 4WKMA 3WAEA 3M3KA 2QS3A 1B51A 3PU5A 3U94A 1IITA 3B6WA 3FJ7A 4N13A 5A5XA 4LATA 4YMBA 3O29A 3AXFA 3G7WA 5H8NA 1CE2A 3D4GA 4XKPA 1N3XA 3A3CA 4O3CA 5F7VA 2HAUA 5AA4B 4F2QA 2DVCA 1ZBMA 3IOVA 5DTBA 3O6IA 2I4CA 4X48A 2ZYOA 1ZMGA 2RC7A 5I56A 2O7IA 1D9VA 4POWA 5KCJA 1XVYA 5I84A 2R9JA 1B7ZA 4I9DA 3ZSFA 5CI5A 1PB8A 1OMPA 1NNPA 1OVBA 4YU0A 4ELOA 1CB6A 4KYSA 2Y7WA 4R6HA 3TKDA 2DE4A 2PX1A 2DP8A 1IZ1A 4I8CA 3FVGA 3CFLA 3S9NC 4F39A 4ZEKA 1L5TA 3UN6A 4F1UA 1TXFA 3GBAA 4U2RA 4DXUA 1USYE 1B5JA 1MPBA 2OWTA 3CG3A 3H7MA 4X1BA 4H6DA 3R7XA 1JEVA 3FASA 5L9MA 1B52A 5TP9A 3FJMA 4OERA 4NF4A 2DWIA 3P7IA 3IJOB 3TMGA 1B1XA 4YB7A 3IOWA 1UIUA 5BUUA 2F6PA 4LQ5A 3E3KA 2Y84A 2O7UA 5ISUA 5HBCA 4YZZA 2QS4A 3QSLA 3N6TA 1UTBB 4BDRA 1H44A 3T96B 5IAIA 2Q89A 3THIA 1B3GA 2F5XA 1FQFA 2DXYA 4XKQA 3IB2A 2O1MA 3VDFA 5AE4A 4F22A 3FATA 4KCCA 1B7UA 3TYHA 2QS1A 3FVNA 4TQUQ 1MY1A 1B46A 4KPTA 4TOZA 4OZ9A 4EDPA 4Q30B 1N3WA 2NXOA 2I49A 1USYH 1B3HA 1FQEA 1FTLA 1BLFA 3PUYE 1YPNA 3VVEA 1B9JA 1HSJA 4U4SA 4QRZA 3MPKA 4DCYA 3EHTA 3TDJA 2A5TA 4UA8A 1R1NA 2UVHA 1LGBC 4P0IA 1BTJA 2Q2CA 2GRVA 3TAJA 3K0VA 3LUYA 2ZYNA 4RK9A 1XHYA 2E0SA 1DTZA 1PBPA 4YICA 3PPPA 2R6GE 3C9HA 1M5CA 3C33A 2O1LA 3FXUA 4ZECA 5ELVA 3A09A 4THIA 1B2HA 5EHMA 3O97A 1P99A 1Q35A 5H8QA 4OETA 3RUMA 5I58B 4PFWA 1MY3A 4BLAA 3K1MA 5I2KA 4FJPA 3HCQA 1MH4A 1R9QA 2XXVA 1OIBA 1B32A 2VOZA 1SW2A 2A5SA 2PMSA 3T93B 1MY4A 4QHQA 2DWJA 1M5BA 1Y1MA 3TCGA 2DVZA 3QAXA 3CFXA 2VD3A 2DS9A 2HFBA 3OO6A 4BDQA 1B5IA 2LAOA 4AB6A 3FD3A 5CBSA 1IIWA 1AL3A 4Q8RA 3HHGA 5FTHA 1P1QA 2XXUA 3G3IA 4PFUA 4ELQA 1FQCA 2ZNTA 3TEPA 1DSNA 1NNKA 4F1VA 2HEUA 1VSOA 2F8DA 3IO6A 3OD7A 2NUVA 4PE5B 1JETA 4PFTA 1S9TA 4JXIA 1NL5A 2Q2AA 1JW4A 1D3KA 1P1UA 1NH8A 4U1OA 4U23A 1JVXA 2QRYA 3QYTA 4JSOA 1AH5A 1NMUA 1TWYA 3OEMA 5KDTA 3G3FA 4ZS9A 1A8FA 2ONKE 4HW8A 4RYAA 2PYYA 1N7WA 2ALUA 4R72A 4K3FA 1O64A 3QXMA 1XC1A 1ZLQA 4PP0A 1T0KA 3UP9A 1POY1 2OJTA 5H8SA 1IUDA 4X1DA 1ZJLA 4JSDA 5L9SA 2XXXA 3Q28A 5JK4A 2RF1A 3G3HA 4IO7A 5A5XB 3UK4A 2X7PA 5H8NB 5AA2D 3OSRA 2VGQA 2REJA 3SEWA 3FVOA 1B0HA 4FEDA 4G77A 5DEXA 3OEKA 2V3TA 4BDOA 2F35A 2XXPA 2Y7RA 3A3UA 1B40A 1I69A 3Q29A 2ANJA 3TZAA 3CI8A 5KCJB 1UTHA 4GXAA 1B3EA 1SW1A 3PUXE 3KGCA 2AL5A 4O3BA 3G3GA 1XVXA 3KG2A 1HSLA 3IK6B 2F36A 3H6VA 3O6HA 3VLVA 2XHDA 5CM6A 3FVKA 1I6BA 3LC8A 2VHAA 1NH7A 4GL8A 1MM7A 5TP9B 3VFJA 1MRPA 1J1NA 1LAGE 3UIFA 5I59A 3FV2A 2B3FA 2OCUA 1SD3A 3ILTB 4ZEDA 4MBPA 4OEVA 5ICQA 3DP8A 1Y4CA 2IA4A 2OWSA 1QJMA 5EHSA 3I6VA 2B3BA 3FXRA 1GGGA 1I6QA 2W7YA 4NEDA 3EPEA 3OOAA 2QJEA 5FHMA 3PUVE 1Y4TA 1H76A 3EN3A 1RKMA 3MWBA 5LOMA 2GFEA 4OFLA 4P0GA 2DSFA 3IB0A 1GV8A 3CR9A 2OZZA 1FTKA 5JTYA 4M1VA 2V93A 5FHNA 1GR2A 4LZ5A 1WODA 5DT6A 4DDDA 3WAFA 1WVJA 4WEDA 5CC2A 1B6HA 2OK2A 3QUFA 1ZTYA 2O68A 5H8HA 5CMCA 4RPNA 1B5HA 1MXYA 5K2XA 1EZOA 3VVFA 3CFZA 4GRKA 2A5TB 2VP1A 1JNFA 4FAJA 2V3UA 3EHSA 4U21A 1ZIUA 1MDQA 4NF6A 1VE4A 1LSTA 1XT8A 3ECRA 3FIRA 1LLSA 2I0CA 5FTIA 3PD9A 3K01A 4G68B 3M3FA 4WXJA 3K4UA 2P2AA 1M5EA 4G8MA 1FW0A 1F9BA 3BKIB 1LFGA 4FATA 3IJXB 1LAXA 4R73A 3PV0E 4IO4A 4IY6A 4H8JA 2PBWA 3SKPA 3TFLA 4OEUA 3EQ1A 3PUWE 1QVSA 2THIA 1Z7NE 2Z23A 3MP6A 3MZ9A 1QKBA 3E13X 4ELRA 4QFOA 1LB8A 4KI0E 1LCTA 3PMWA 3I3VA 3V83A 3Q26A 4EF1A 4GD5A 4GOTA 4HCYA 5TPAB 4UACA 2XD2A 1MQHA 3H6WA 2D3IA 1GVCA 3JZJA 4O3AA 4C0RA 2QPQA 4IB2A 2M8CA 4P11A 4ZZAA 3TELA 3LR1A 5DYHA 3QK6A 3VLWA 2DE3A 1ZKBA 3S2VA 2H98A 1H43A 1AMFA 4ONYA 4NWDA 3O6GA 3TTKA 2F97A 1P1WA 4G2ZA 2F7CA 1N84A 1KWHA 4GXSB 3B7DA 3MAMA 4JB7A 2D5WA 2ZNSA 3TTLA 2RINA 5FHOA 5I2NA 1MXXA 4N07A 4KQPA 1B58A 2Q9TA 5KDTB 3MBPA 3TCHA 2I3WA 1A7LA 4QSCA 4ND9A 4DZ1A 3TTRA 2X26A 2HCAA 3BBRA 4MLQA 4H1XA 4WEPA 2XX8A 1AOVA 3RLFE 1US4A 2F78A 1S7YA 3KOSA 2G93A 4XIGQ 1I6AA 4XKNA 4BDMA 2O6AA 4G4PA 3L6GA 4JDFA 1FQDA 1US5A 1QW0A 4OXVA 3DELB 2F7AA 4GIZA 2PVUA 5H8FA 5DEXB 4U1ZA 2H99A 4I1DA 3IO4A 4YB6A 2HZLA 2RCAA 2UVJA 4ZEBA 3L6HA 3H4ZA 3B6TA 2ESNA 4NE4A 1MY2A 3W9VA 5EYFA 2ZNUA 4PFYA 4IGTA 2AIXA 1EZPA 3G3KA 3KN8A 4F18A 2Z22A 3VXBA 1VFDA 1N04A 3KN7A 1N76A 3ZS6A 4ZEFA 1XS5A 1A8EA 2ONRA 3PPOA 3M8UA 3O28A 4YAHX 3V8XB 4G8HA 1MH3A 2OBGA 3MP8A 4QFLA 4AQ4A 3CG1A 2I0BA 1QUIA 4Z7EA 2Z8EA 1Y9UA 4R6KA 2FNCA 4F31B 3IORA 3K6VA 4QFKA 2QS2A 4U22A 4IY5A 3W9WA 3KZGA 3DLNA 3UORA 3OO9A 4RPOA 3B6QA 3LSXA 5I57B 3KN3A 1ATGA 3VE1B 2ABHA 3O9PA 1SI1A 1DPEA 1H3DA 4QSEA 5JTYB 2WKYA 2R71A 5DVFA 4U4XA 5F1QA 4R6YA 1MPCA 4Z0IA 4ESXA 2HXWA 3S9EA 1N0TA 1Y1ZA 1POTA 4ELPA 1MQJA 1LAFE 4JWYA 4MH5A 4YKIA 4OFJA 5M2VA 4GFRA 4NF6B 1UQWA 1AIVA 3HV1A 3CSGA 2NVUB 3HN0A 3MZBA 3KSXA 1ANFA 2DWHA 2X7QA 1R9LA 4GLIA 3M3LA 3USDA 4DXCA 3PUZE 2F7BA 4ZDMA 1B1HA 2QL3A 2RKMA 2GHAA 4LUBA 3D4CA 3OSQA 4HCWA 1O7TA 2VD2A 5I56B 2UYEA 4ZEIA 1QUJA 3IR1A 4N6PA 2O51A 3FJGA 1B3FA 4G68C 3PGFA 4XTCQ 3PD8A 1B0LA 4OYVA 4DCXA 1Y3QA 1MXUA 4OFOA 3T9UA 2H5YA 4JWOA 1TT1A 2RCBA 3T66A 3H06B 4H67A 3RPWA 3Q27A 4HTGA 1MG1A 2YJPA 1IEJA 4NF4B 2XXWA 3H03A 4PQJA 1R6ZA 2AYSA 4NWCA 2BJJX 3U92A 4EF2A 1LBBA 3RT6B 3FGSA 1LBCA 3Q25A 4R9GA 3RTFB 2NOOA 3HHFA 5I2NB 3I5OA 2XXRA 3MUQA 3VLUA 2HQ0A 3N6UA 1SYIA 3GBBA 1LAHE 1EZ9A 3K1PA 4MF3A 1LFIA 5IKBA 3U72A 1MY0A 1FCKA 4EXLA 4R2BA 3K02A 4LA9A 2FA7A 4R74A 2Z8FA 1MS7A 1SQYA 1DTGA 3JV9A 4EQ7A 3SEUA 4OMBA 4NMYA 1IXHA 4YMAA 5AA1A 1OQGA 4YB5A 3SESA 2V84A 3H6TA 2I4BA 3CRBA 3HO7A 1YTVA 3FV1A 2XXTA 3IB1A 2CZLA 1A99A 1FTMA 3H6UA 1NNTA 3MVYA 5H8FB 3T9HB 2QSXA 1SBPA 3KJ7A 3U8QA 2F6GA 4KR5A 2ZXTA 4C1TA 1B3LA 4IO5A 3S9LC 1MXWA 4L17A 2XXHA 1SYHA 3FUZA 3U93A 2GHBA 3N94A 2ONSA 3U1OA 1DPPA 4FECA 2XXQA 2V3QA 3IOTA 3C36A 5L8DA 3C31A 3KFMA 3MW0A 2ZYKA 2UXAA 5KZTA 4OWDA 5H8QB 2Y7KA 3MVWA 1H45A 5I2KB 5AA2A 4DXBA 4OENA 4R2FA 3SERA 3RGYA 1A55A 1LFHA 2Y7IA 2OLBA 4IO6A 3K6UA 3IL1B 2P1SA 2XXIA 1FTOA 2Q88A 3SDFA 2I6EA 4Q5TA 2KLFA 1MXZA 1ZU0A 1BIYA 2RC9A 4RA1A 1XOCA 5K2YA 2F34A 1M5FA 2DOJA 1M5DA 4F3PA 1EH3A 3TPAA 4HS7A 4DIGA 4H5FA 2DE2A 1MQDA 4LVQA 1URSA 3G3JA 4OTEA 4LQ2A
chains in the Genus database with same CATH superfamily
4KCDA 3C32A 3VXCA 3DM0A 2H9BA 3C35A 4X9TA 1AWBA 3K1NA 3ONMA 3KSJA 4AB5A 1LBXA 1OLCA 4YKKA 4ECFA 3T22A 5J16A 3HSTA 3UGWA 3OENA 3CVGA 4EQ9A 1MDP1 1FBEA 1SW4A 1JW5A 3T1BA 4IGRA 1URDA 4NF5A 3T9VA 3IX1A 4N91A 4RK2A 3PPQA 2I3VA 1MPDA 1NV4A 4EXKA 3FXQA 4R9FA 2ZMBA 3CHGA 1FQBA 1DOTA 1WDNA 4FBPA 4F19A 4RJZA 4TLLB 2E1SA 4G8NA 4KYDA 4KD5A 1LCFA 3ODBA 1B4HA 3F11A 4OQOA 3VV5A 3IAZA 4NF8A 2G29A 5EQ9A 4IO2A 5CMKA 3SEVA 1IXGA 1BKAA 3DP4A 3ZKLA 2B4MA 1P1OA 1Y3PA 4F3SA 2DWAA 2Y5KA 1PC3A 3W15C 1SI0A 4TLMB 1MQGA 4I62A 4GX6A 2DYXA 4RXLA 4KYEA 2FYIA 4LN5A 1UTHB 4ZE8A 2XXYA 1MM6A 1A54A 4DE8A 1MQIA 2H25A 4BDNA 2HAVA 1Z7ME 3PMXA 2O69A 1UIVA 1NV0A 2Q8JA 4OESA 1LBZA 3QUJA 1TFDA 2IEEA 3ILUB 4F1YA 3EKIA 5CBRA 4G68A 3RQTA 4GVOA 3UA8A 3V89B 2QMXA 4F3GA 5ICTA 4EUOA 3TUSA 3QIMA 1Q1KA 5AA4A 4P9KA 4YKJA 2PT2A 5I59B 5CMMA 1IMEA 3MPLA 3SETA 3TTMA 2DXRA 1PBQA 2CMOA 1II5A 1TFAA 4JVIA 5TU0A 3IOUA 2HZKA 3HPIA 2D21A 2YLNA 3K00A 1IMFA 4PDDA 3E78A 4F2OA 4LONB 4KHZE 4E0WA 2PT1A 3TODA 2FIEA 1VR5A 1K9YA 4FE8A 1NKXA 5TPAA 2B65A 4PDHA 4Q0CA 1NV3A 2UVGA 2PCRA 2REGA 1QULA 1DK4A 2Q8MA 3TQWA 4XXUA 1EU8A 2Y7PA 4AS4A 4ZE9A 1MXVA 5DVJA 4F29A 1FQAA 4GF8A 1RYXA 1FTJA 1BP5A 4QFNA 4OVJA 3FZVA 2XD3A 5LDZA 5J1DA 4QF9A 4GWYA 2Z8DA 1D4NA 4IO3A 1D9YA 3KJTA 4FIMA 3BFUA 3LSFB 5AA3A 3LSLA 4P8BA 3PMVA 1VFEA 2O84X 3LSWA 2MKZA 3EF7A 4MNPA 5H8HB 1IXCA 3ZKKA 1UTBA 1HSEA 3JYRA 5HM4B 2HXRA 3RNNA 4OHNA 4RNSA 3T0JA 3R6UA 1NFTA 2P0SA 3CSBA 4ISUA 4M4GA 1FBCA 2B4LA 1OLAA 5ITOA 3H3GA 2GH9A 3OMBA 2NWJA 4MLVA 4JWXA 1PEBA 3BIHA 2UVIA 3N26A 4ZZEA 3SEXA 5BWJA 1RYOA 2WX9A 5I5PA 4H45A 3K6WA 3KBZA 1JVYA 3R26A 2PFZA 4HE1A 4QFPA 2HPGA 4PETA 4NTLA 4C1UA 1O63A 4FORA 3VVDA 3RTWB 5ITPA 1OVTA 1B7HA 4QSDA 4PAKA 1QUKA 3PPNA 4P47A 5AA2B 3GLBA 1IXIA 1QKAA 3MQ9A 1A40A 3CIJA 4JBZA 4MCOA 5IZ1A 2F3DA 4LZ8A 3OELA 1RDZA 3RY3A 3LBSA 3K6XA 2XX7A 4E0XA 1P1NA 1PB9A 1URGA 3MP1A 4GL0A 4DLDA 3TCFA 4OVQA 2QMWA 1NV5A 3RYDA 4OVTA 5HPQA 2XWKA 3PPRA 3B50A 5JEIA 2H4IA 1ELJA 3E4RA 3O66A 4POXA 2I48A 1SDXA 5I58A 5CMBA 4XKRA 4PC9A 3K2DA 4H5GA 1YCJA 3T9XB 4ESWA 3DP6A 3GXAA 4HE0A 3KOTA 1S50A 3OXNA 2AL4A 4GQOA 3TQLA 2RC8A 3V5AA 5CRYA 3S9MC 1JEUA 2UYFA 1OQHA 4BDLA 1SW5A 5L9OA 5B7DA 1JW1A 4OANA 4NF0A 4NGUA 1Y20A 3OO7A 2XWVA 1PB7A 2FIXA 4N15A 2QVUA 3IFCA 3MVXA 3MJNA 4FEBA 3E9XA 4R75A 3OO8A 2V25A 4NF5B 1DMBA 3C34A 5B70A 1SVXB 1IQ7A 2YPNA 3C4MA 3RT8A 3MVZA 2V4CA 1LB9A 1Y3NA 2I58A 3KBRA 4MMPA 3TTNA 2XX9A 4F3BA 1B4ZA 1NNFA 4X8RA 5I57A 4MFIA 3EHUA 4RY1A 3KEIA 4EQBA 1B05A 4LZ7A 2DQVA 1JQFA 4NF8B 4LP2B 3MC2A 1LEVA 4H0WA 4H8IA 1YAEA 3S4UA 5DVIA 1GTKA 2CZIA 1EYKA 3SEYA 3O2AA 4GWOA 3RN8A 1PDAA 4YKPA 2ZYMA 4MNCA 1EYJA 3BFTA 3MZ1A 3GZGA 1N7XA 3N5LA 4H65A 3RPLB 4KFQA 4WKMA 3WAEA 3M3KA 2QS3A 1B51A 1NV2A 3PU5A 3U94A 1IITA 3B6WA 3FJ7A 4N13A 4PF8A 1FPBA 2QFLA 5A5XA 4LATA 4HE2A 4YMBA 3O29A 2VT5A 3AXFA 3G7WA 5H8NA 4PBHA 1CE2A 5IZZA 3D4GA 4XKPA 1N3XA 3A3CA 4O3CA 5F7VA 2HAUA 5AA4B 4F2QA 2DVCA 1ZBMA 3IOVA 5DTBA 3O6IA 2I4CA 4X48A 2ZYOA 1ZMGA 2RC7A 5I56A 3FXBA 2O7IA 1D9VA 4POWA 5KCJA 1XVYA 5I84A 2R9JA 1NV1A 1B7ZA 4I9DA 3ZSFA 5CI5A 1PB8A 4NQ8A 1OMPA 1NNPA 1OVBA 4YU0A 4ELOA 1CB6A 4KYSA 2Y7WA 4R6HA 3TKDA 2DE4A 2PX1A 2DP8A 1IZ1A 4I8CA 3FVGA 3CFLA 3S9NC 4F39A 4ZEKA 4O7IA 1L5TA 3UN6A 4F1UA 3GYYA 1TXFA 3GBAA 4U2RA 4DXUA 1USYE 1B5JA 1LBVA 1MPBA 2OWTA 3CG3A 3H7MA 4X1BA 4H6DA 3R7XA 1JEVA 3FASA 5L9MA 1B52A 5TP9A 3FJMA 2ZZVA 4OERA 4NF4A 2DWIA 3ROJA 3P7IA 3IJOB 3TMGA 1B1XA 4YB7A 3IOWA 1UIUA 5BUUA 5F24A 2F6PA 4LQ5A 3E3KA 3IFAA 2Y84A 5ET5A 1IMBA 2O7UA 5ISUA 5HBCA 4YZZA 2XA5A 2QS4A 1G0IA 3PTYA 3QSLA 4N4UA 3N6TA 1UTBB 4BDRA 1H44A 3T96B 5IAIA 2Q89A 3THIA 1B3GA 2F5XA 1FQFA 2DXYA 4XKQA 3IB2A 2O1MA 3VDFA 5AE4A 4XF5A 4F22A 3FATA 4NG7A 4DI3D 4KCCA 1B7UA 1QGXA 3TYHA 2QS1A 3FVNA 4TQUQ 1MY1A 1B46A 4I40A 4KPTA 4TOZA 4OZ9A 4MJOA 4EDPA 4Q30B 1N3WA 5ET8A 2NXOA 2I49A 1USYH 1B3HA 1FQEA 1FTLA 1BLFA 3PUYE 1YPNA 3VVEA 1B9JA 1HSJA 4U4SA 2XXKA 4QRZA 1D9QA 3MPKA 4DCYA 3EHTA 4P1LA 3TDJA 2A5TA 4UA8A 1NI9A 1R1NA 2UVHA 1LGBC 4P0IA 4HXVA 1BTJA 2Q2CA 2GRVA 3TAJA 3K0VA 3LUYA 3FBPA 2ZYNA 4RK9A 1XHYA 2E0SA 1DTZA 1PBPA 4YICA 3KC0A 3PPPA 2R6GE 3C9HA 1M5CA 4MIJA 3C33A 2O1LA 3FXUA 4ZECA 5ELVA 3A09A 2L5VA 2FBPA 4THIA 1SPIA 1B2HA 5EHMA 3O97A 4QBAA 1P99A 1Q35A 5H8QA 4OETA 3RUMA 5I58B 4PFWA 1MY3A 4BLAA 3K1MA 5I2KA 4FJPA 1FPFA 3HCQA 1MH4A 1R9QA 2XXVA 2WYPA 1OIBA 1B32A 2VOZA 4OA4A 1SW2A 2A5SA 4O8MA 2PMSA 3T93B 1MY4A 4QHQA 2DWJA 1M5BA 1Y1MA 3TCGA 2DVZA 3QAXA 3CFXA 2VD3A 1FSAA 2DS9A 2HFBA 3OO6A 1FTAA 4BDQA 1B5IA 2LAOA 4AB6A 3FD3A 2JJKA 5CBSA 1IIWA 1AL3A 2FVZA 4Q8RA 3HHGA 5FTHA 1P1QA 2XXUA 3G3IA 4P3LA 4PFUA 4ELQA 1FQCA 2ZNTA 3TEPA 1DSNA 5EQ8A 1NNKA 4F1VA 4PBQA 2HEUA 1FBPA 1VSOA 2F8DA 3IO6A 3OD7A 2NUVA 5EQAA 4PE5B 4PAFA 1JETA 4PFTA 1S9TA 4JXIA 1NL5A 2Q2AA 1JW4A 1D3KA 1P1UA 1K9ZA 1NH8A 4U1OA 4U23A 1JVXA 2QRYA 5IZ3A 3QYTA 4JSOA 1AH5A 1NMUA 1TWYA 3OEMA 5KDTA 3G3FA 4ZS9A 1A8FA 2ONKE 4HW8A 4RYAA 2PYYA 1N7WA 4MX6A 2ALUA 4R72A 4K3FA 1O64A 3QXMA 1XC1A 1ZLQA 4PP0A 1T0KA 3UP9A 1POY1 2OJTA 5H8SA 1IUDA 4X1DA 1ZJLA 4JSDA 5L9SA 2XXXA 2PFYA 3Q28A 5JK4A 2RF1A 3G3HA 4IR8A 4IO7A 2WEFA 5A5XB 3UK4A 4MAGA 2X7PA 4KXPA 5H8NB 1XI6A 5AA2D 2WYKA 3OSRA 2VGQA 2REJA 3SEWA 3FVOA 1B0HA 4FEDA 4G77A 3HFUA 5DEXA 3OEKA 2CEYA 2V3TA 1NUYA 4BDOA 2F35A 2XXPA 2Y7RA 3A3UA 1B40A 1I69A 3Q29A 2ANJA 3TZAA 3CI8A 5KCJB 1UTHA 4PF6A 4GXAA 1B3EA 1SW1A 1NUZA 3PUXE 3KGCA 2AL5A 4O3BA 3G3GA 1XVXA 3KG2A 5DW8A 1HSLA 2P3VA 1Q9DA 3IK6B 2F36A 3H6VA 3O6HA 3VLVA 2FHYA 2XHDA 4MHFA 5CM6A 3FVKA 1I6BA 3LC8A 2VHAA 1NH7A 4GL8A 1MM7A 5TP9B 4N8YA 3VFJA 1MRPA 1J1NA 1LAGE 3UIFA 5I59A 2Y5LA 3FV2A 2B3FA 2OCUA 1SD3A 4N81A 3ILTB 4ZEDA 4MBPA 4OEVA 5ICQA 3DP8A 1Y4CA 2IA4A 1INPA 2OWSA 1QJMA 5EHSA 1FRPA 3I6VA 2B3BA 3FXRA 1GGGA 1I6QA 5EYHA 2W7YA 5I7IA 4NEDA 3EPEA 3OOAA 2QJEA 4G61A 1RDXA 5FHMA 4PTKA 3PUVE 1Y4TA 1H76A 3BIGA 2VPOA 3EN3A 1RKMA 3MWBA 5LOMA 2GFEA 4OFLA 4P0GA 4O7MA 2DSFA 3IB0A 1GV8A 3CR9A 2OZZA 1LBYA 3U65A 1FTKA 5JTYA 4M1VA 2V93A 5FHNA 1GR2A 4LZ5A 1WODA 1FPIA 4QXDA 5DT6A 4DDDA 3WAFA 1WVJA 4WEDA 5CC2A 1B6HA 2OK2A 3QUFA 1ZTYA 2O68A 5H8HA 5CMCA 2KR0A 4RPNA 1B5HA 1MXYA 5K2XA 2QVVA 1EZOA 3VVFA 2OX3A 4GBVA 3CFZA 5EYGA 4GRKA 2A5TB 2VP1A 1JNFA 4FAJA 3D1RA 2V3UA 3EHSA 4U21A 1ZIUA 2XWOA 1FJ6A 5FBPA 1MDQA 4NF6A 1VE4A 1LSTA 4UABA 1XT8A 3ECRA 3FIRA 4P1EA 1LLSA 2ZZXA 2CEXA 2I0CA 4NAPA 5FTIA 3PD9A 3K01A 4G68B 3M3FA 4WXJA 3K4UA 2P2AA 1M5EA 4G8MA 1FW0A 4DI4B 1F9BA 3BKIB 1LFGA 4FATA 3IJXB 1LAXA 4R73A 1FPDA 1FJ9A 3PV0E 4IO4A 4IY6A 4H8JA 2PBWA 3SKPA 3TFLA 4OEUA 3EQ1A 1FPKA 3PUWE 1QVSA 2THIA 1Z7NE 2Z23A 5ET7A 3MP6A 3MZ9A 1QKBA 1VDWA 3E13X 4ELRA 5IGAA 4QFOA 1LB8A 4KI0E 1LCTA 4NHBA 3PMWA 3I3VA 3V83A 3Q26A 4EF1A 4GD5A 4GOTA 4NN3A 4HCYA 5TPAB 3LV0A 4UACA 2XD2A 1MQHA 2HHMA 3H6WA 2D3IA 1GVCA 3JZJA 1JP4A 4O3AA 4C0RA 1FPGA 2QPQA 4IB2A 2M8CA 5T3JA 4P11A 4ZZAA 5EQ7A 3TELA 3LR1A 5DYHA 3QK6A 3VLWA 2DE3A 2R8TA 1ZKBA 3S2VA 2H98A 1H43A 1AMFA 4ONYA 4NWDA 3O6GA 3TTKA 2F97A 1IMAA 1P1WA 4G2ZA 2F7CA 1N84A 1KWHA 4N6KA 4GXSB 3B7DA 3MAMA 4JB7A 2D5WA 2ZNSA 3TTLA 2RINA 5FHOA 5I2NA 1MXXA 4N07A 4KQPA 1B58A 2Q9TA 5IZ3B 5ET6A 5KDTB 3MBPA 3TCHA 2I3WA 4I3YA 4JVCA 1A7LA 4QSCA 4ND9A 4DZ1A 3TTRA 2X26A 2HCAA 3BBRA 4MLQA 4H1XA 4WEPA 2XX8A 1AOVA 1NUWA 5ESYA 3RLFE 1US4A 2F78A 1S7YA 5I3SA 3KOSA 2G93A 4XIGQ 1I6AA 1RDYA 2GQ1A 4XKNA 4BDMA 4P56A 2O6AA 1NV6A 4G4PA 4GX4A 3L6GA 4JDFA 1FQDA 1US5A 4OXVA 1QW0A 3DELB 2F7AA 4GIZA 2PVUA 5H8FA 5DEXB 4N17A 4U1ZA 2H99A 4I1DA 3IO4A 1YZ0A 4O94A 4YB6A 2HZLA 2RCAA 2UVJA 4ZEBA 3L6HA 2VPNA 3A29A 3H4ZA 3B6TA 2ESNA 3RPLA 4NE4A 1LBWA 1MY2A 3W9VA 5EYFA 2ZNUA 4PFYA 4IGTA 2AIXA 1EZPA 3G3KA 1FBFA 3KN8A 4F18A 2Z22A 3VXBA 1VFDA 1N04A 3KN7A 1N76A 3ZS6A 3LUZA 4ZEFA 1XS5A 1A8EA 2ONRA 3PPOA 2QVRA 3M8UA 3O28A 4YAHX 3V8XB 4G8HA 1MH3A 2OBGA 1KZ8A 3MP8A 4QFLA 4AQ4A 3CG1A 2I0BA 1QUIA 4Z7EA 2Z8EA 1Y9UA 4R6KA 2FNCA 4F31B 3IORA 3K6VA 4PGNA 3B8BA 4QFKA 2QS2A 4GWUA 4PGPA 4GBWA 1FBDA 4U22A 4IY5A 3W9WA 3KZGA 3DLNA 3UORA 3OO9A 4RPOA 3B6QA 3LSXA 5I57B 3KN3A 1ATGA 3VE1B 2ABHA 3O9PA 4H46A 1SI1A 1DPEA 1H3DA 4QSEA 5JTYB 2WKYA 4OVSA 2CZKA 2R71A 3MYUA 5DVFA 4U4XA 5F1QA 4R6YA 1MPCA 4Z0IA 4ESXA 4AS5A 2HXWA 3S9EA 1N0TA 1Y1ZA 1POTA 4JVDA 4ELPA 1MQJA 1LAFE 4JWYA 4MH5A 4YKIA 4OFJA 5M2VA 4GFRA 4NF6B 1UQWA 1AIVA 3HV1A 1IMCA 3CSGA 2NVUB 3HN0A 2WBBA 3MZBA 3KSXA 1ANFA 2DWHA 2X7QA 1R9LA 4GLIA 3M3LA 3USDA 1FBGA 2ZZWA 4DXCA 3PUZE 2F7BA 4ZDMA 1B1HA 2QL3A 4X04A 2RKMA 2GHAA 4LUBA 3D4CA 1KA1A 3OSQA 4HCWA 1O7TA 2VD2A 5I56B 2UYEA 4ZEIA 1QUJA 3SZPA 3IR1A 4N6PA 2O51A 3FJGA 1B3FA 4G68C 3E79A 3PGFA 4XTCQ 3PD8A 1B0LA 4OYVA 4DCXA 1Y3QA 1MXUA 4OFOA 3T9UA 4PE3A 2BJIA 2DDKA 2H5YA 4JWOA 1TT1A 2RCBA 3T66A 3H06B 4H67A 3RPWA 3Q27A 2F3BA 4HTGA 1MG1A 2YJPA 1IEJA 4NF4B 1DCUA 2XXWA 3QMFA 4I3EA 3H03A 2Q74A 4PQJA 1R6ZA 2AYSA 4NWCA 4N6DA 2BJJX 3U92A 4EF2A 1LBBA 3RT6B 3FGSA 1LBCA 1CNQA 3Q25A 1FPEA 4R9GA 1G0HA 3RTFB 2NOOA 3HHFA 2CZHA 5I2NB 3I5OA 2XXRA 3MUQA 2HQ0A 3VLUA 2XWIA 3N6UA 1SYIA 3GBBA 5A5LA 1LAHE 1EZ9A 1FPJA 3K1PA 4MF3A 1LFIA 5IKBA 3U72A 1MY0A 1YXIA 1FCKA 4EXLA 4R2BA 3K02A 4LA9A 2FA7A 3MSTA 4R74A 2Z8FA 1MS7A 1SQYA 1DTGA 4XEQA 3JV9A 4EQ7A 3SEUA 4OMBA 4NMYA 1IXHA 4YMAA 5AA1A 2OWZA 1OQGA 4YB5A 3SESA 2V84A 1FBHA 3H6TA 4MNIA 2I4BA 3CRBA 3HO7A 1YTVA 3FV1A 2XXTA 4PCDA 3IB1A 2CZLA 1A99A 1FTMA 3H6UA 1NNTA 3MVYA 4PAIA 5H8FB 3KJ7A 2QSXA 1SBPA 3T9HB 1BK4A 3U8QA 2F6GA 4KR5A 2ZXTA 4C1TA 1B3LA 4IO5A 3S9LC 4N8GA 1DBZA 4OVPA 1MXWA 4L17A 2XXHA 1SYHA 3FUZA 5IM2A 3U93A 2GHBA 3N94A 2ONSA 3U1OA 1DPPA 4FECA 2XXQA 2WBDA 2V3QA 3IOTA 3C36A 5L8DA 4NX1A 2P3NA 3C31A 3KFMA 3MW0A 2ZYKA 4PFIA 2KQZA 2UXAA 4OVRA 5KZTA 4GWSA 4MEVA 4OWDA 5H8QB 2Y7KA 3MVWA 4GX3A 1H45A 5I2KB 5AA2A 1YYZA 4DXBA 4OENA 4R2FA 3SERA 1IMDA 3NOHA 3RGYA 1A55A 1LFHA 1NV7A 2Y7IA 4XFEA 3KC1A 2OLBA 4IO6A 3K6UA 4GWZA 4PFBA 3IL1B 2P1SA 2XXIA 1FTOA 2Q88A 4GWWA 3SDFA 2I6EA 3ISPA 4GWXA 4Q5TA 2KLFA 1MXZA 1ZU0A 1BIYA 2RC9A 4PFRA 5LTCA 4RA1A 1XOCA 5K2YA 2F34A 1M5FA 2DOJA 1M5DA 1KA0A 1NUXA 4F3PA 1EH3A 3TPAA 1EYIA 4HS7A 4DIGA 4H5FA 2DE2A 1MQDA 1FPLA 4LVQA 1URSA 3G3JA 4OTEA 4LQ2A
chains in the Genus database with same CATH topology
4KCDA 3C32A 3VXCA 3DM0A 2H9BA 3C35A 4X9TA 3K1NA 3ONMA 3KSJA 4AB5A 1OLCA 4YKKA 4ECFA 3T22A 3HSTA 3UGWA 3OENA 3CVGA 4EQ9A 1MDP1 1SW4A 1JW5A 4IGRA 1URDA 4NF5A 3T9VA 3IX1A 4RK2A 3PPQA 2I3VA 1MPDA 4EXKA 3FXQA 4R9FA 2ZMBA 1FQBA 1DOTA 1WDNA 4F19A 4RJZA 4TLLB 2E1SA 4G8NA 4KYDA 4KD5A 1LCFA 3ODBA 1B4HA 3F11A 4OQOA 3VV5A 3IAZA 4NF8A 2G29A 4IO2A 5CMKA 3SEVA 1IXGA 1BKAA 3DP4A 3ZKLA 1P1OA 1Y3PA 4F3SA 2DWAA 1PC3A 3W15C 1SI0A 4TLMB 1MQGA 4I62A 2DYXA 4RXLA 4KYEA 2FYIA 1UTHB 4ZE8A 2XXYA 1MM6A 1A54A 4DE8A 1MQIA 2H25A 4BDNA 2HAVA 1Z7ME 3PMXA 2O69A 1UIVA 2Q8JA 4OESA 3QUJA 1TFDA 2IEEA 3ILUB 4F1YA 5CBRA 4G68A 3RQTA 4GVOA 3UA8A 3V89B 2QMXA 4F3GA 5ICTA 4EUOA 3TUSA 3QIMA 1Q1KA 5AA4A 4YKJA 2PT2A 5I59B 5CMMA 3MPLA 3SETA 3TTMA 2DXRA 1PBQA 2CMOA 1II5A 1TFAA 5TU0A 3IOUA 2HZKA 3HPIA 2D21A 2YLNA 3K00A 4F2OA 4LONB 4KHZE 4E0WA 2PT1A 3TODA 1VR5A 4FE8A 1NKXA 5TPAA 2B65A 4Q0CA 2UVGA 2REGA 1QULA 3TQWA 4XXUA 1EU8A 2Y7PA 4ZE9A 1MXVA 5DVJA 4F29A 1FQAA 4GF8A 1RYXA 1FTJA 1BP5A 4QFNA 4OVJA 3FZVA 2XD3A 5J1DA 4QF9A 2Z8DA 1D4NA 4IO3A 1D9YA 3KJTA 4FIMA 3BFUA 3LSFB 5AA3A 3LSLA 3PMVA 1VFEA 2O84X 3LSWA 3EF7A 5H8HB 1IXCA 3ZKKA 1UTBA 1HSEA 3JYRA 5HM4B 3RNNA 4OHNA 4RNSA 3R6UA 1NFTA 2P0SA 3CSBA 4ISUA 4M4GA 1OLAA 5ITOA 3H3GA 2GH9A 3OMBA 2NWJA 4MLVA 4JWXA 1PEBA 2UVIA 3N26A 4ZZEA 3SEXA 5BWJA 1RYOA 3K6WA 1JVYA 3R26A 4QFPA 4PETA 4NTLA 4C1UA 1O63A 4FORA 3VVDA 3RTWB 5ITPA 1OVTA 1B7HA 4QSDA 1QUKA 3PPNA 5AA2B 3GLBA 1IXIA 1QKAA 3MQ9A 1A40A 3CIJA 4JBZA 4LZ8A 3OELA 3RY3A 3LBSA 3K6XA 2XX7A 4E0XA 1P1NA 1PB9A 1URGA 3MP1A 4GL0A 4DLDA 3TCFA 2QMWA 5HPQA 3PPRA 5JEIA 2H4IA 1ELJA 3E4RA 3O66A 4POXA 2I48A 1SDXA 5I58A 5CMBA 4XKRA 3K2DA 4H5GA 1YCJA 3T9XB 4ESWA 3DP6A 3GXAA 3KOTA 1S50A 3OXNA 2AL4A 4GQOA 3TQLA 2RC8A 3V5AA 5CRYA 3S9MC 1JEUA 2UYFA 1OQHA 4BDLA 1SW5A 5L9OA 5B7DA 1JW1A 1Y20A 3OO7A 1PB7A 3MVXA 3MJNA 4FEBA 3E9XA 4R75A 3OO8A 2V25A 4NF5B 1DMBA 5B70A 3C34A 1SVXB 1IQ7A 2YPNA 3C4MA 3RT8A 3MVZA 1LB9A 1Y3NA 2I58A 3KBRA 3TTNA 2XX9A 4F3BA 1B4ZA 1NNFA 5I57A 4MFIA 3EHUA 4RY1A 3KEIA 4EQBA 1B05A 4LZ7A 2DQVA 1JQFA 4NF8B 4LP2B 3MC2A 4H0WA 4H8IA 1YAEA 3S4UA 5DVIA 1GTKA 3SEYA 3O2AA 4GWOA 3RN8A 1PDAA 4YKPA 2ZYMA 3BFTA 3MZ1A 3GZGA 1N7XA 3N5LA 4H65A 4KFQA 4WKMA 3WAEA 3M3KA 2QS3A 1B51A 3PU5A 3U94A 1IITA 3B6WA 3FJ7A 4N13A 5A5XA 4LATA 4YMBA 3O29A 3AXFA 3G7WA 5H8NA 1CE2A 3D4GA 4XKPA 1N3XA 3A3CA 4O3CA 5F7VA 2HAUA 5AA4B 4F2QA 2DVCA 1ZBMA 3IOVA 5DTBA 3O6IA 2I4CA 4X48A 2ZYOA 1ZMGA 2RC7A 5I56A 2O7IA 1D9VA 4POWA 5KCJA 1XVYA 5I84A 2R9JA 1B7ZA 4I9DA 3ZSFA 5CI5A 1PB8A 1OMPA 1NNPA 1OVBA 4YU0A 4ELOA 1CB6A 4KYSA 2Y7WA 4R6HA 3TKDA 2DE4A 2PX1A 2DP8A 1IZ1A 4I8CA 3FVGA 3CFLA 3S9NC 4F39A 4ZEKA 1L5TA 3UN6A 4F1UA 1TXFA 3GBAA 4U2RA 4DXUA 1USYE 1B5JA 1MPBA 2OWTA 3CG3A 3H7MA 4X1BA 4H6DA 3R7XA 1JEVA 3FASA 5L9MA 1B52A 5TP9A 3FJMA 4OERA 4NF4A 2DWIA 3P7IA 3IJOB 3TMGA 1B1XA 4YB7A 3IOWA 1UIUA 5BUUA 2F6PA 4LQ5A 3E3KA 2Y84A 2O7UA 5ISUA 5HBCA 4YZZA 2QS4A 3QSLA 3N6TA 1UTBB 4BDRA 1H44A 3T96B 5IAIA 2Q89A 3THIA 1B3GA 2F5XA 1FQFA 2DXYA 4XKQA 3IB2A 2O1MA 3VDFA 5AE4A 4F22A 3FATA 4KCCA 1B7UA 3TYHA 2QS1A 3FVNA 4TQUQ 1MY1A 1B46A 4KPTA 4TOZA 4OZ9A 4EDPA 4Q30B 1N3WA 2NXOA 2I49A 1USYH 1B3HA 1FQEA 1FTLA 1BLFA 3PUYE 1YPNA 3VVEA 1B9JA 1HSJA 4U4SA 4QRZA 3MPKA 4DCYA 3EHTA 3TDJA 2A5TA 4UA8A 1R1NA 2UVHA 1LGBC 4P0IA 1BTJA 2Q2CA 2GRVA 3TAJA 3K0VA 3LUYA 2ZYNA 4RK9A 1XHYA 2E0SA 1DTZA 1PBPA 4YICA 3PPPA 2R6GE 3C9HA 1M5CA 3C33A 2O1LA 3FXUA 4ZECA 5ELVA 3A09A 4THIA 1B2HA 5EHMA 3O97A 1P99A 1Q35A 5H8QA 4OETA 3RUMA 5I58B 4PFWA 1MY3A 4BLAA 3K1MA 5I2KA 4FJPA 3HCQA 1MH4A 1R9QA 2XXVA 1OIBA 1B32A 2VOZA 1SW2A 2A5SA 2PMSA 3T93B 1MY4A 4QHQA 2DWJA 1M5BA 1Y1MA 3TCGA 2DVZA 3QAXA 3CFXA 2VD3A 2DS9A 2HFBA 3OO6A 4BDQA 1B5IA 2LAOA 4AB6A 3FD3A 5CBSA 1IIWA 1AL3A 4Q8RA 3HHGA 5FTHA 1P1QA 2XXUA 3G3IA 4PFUA 4ELQA 1FQCA 2ZNTA 3TEPA 1DSNA 1NNKA 4F1VA 2HEUA 1VSOA 2F8DA 3IO6A 3OD7A 2NUVA 4PE5B 1JETA 4PFTA 1S9TA 4JXIA 1NL5A 2Q2AA 1JW4A 1D3KA 1P1UA 1NH8A 4U1OA 4U23A 1JVXA 2QRYA 3QYTA 4JSOA 1AH5A 1NMUA 1TWYA 3OEMA 5KDTA 3G3FA 4ZS9A 1A8FA 2ONKE 4HW8A 4RYAA 2PYYA 1N7WA 2ALUA 4R72A 4K3FA 1O64A 3QXMA 1XC1A 1ZLQA 4PP0A 1T0KA 3UP9A 1POY1 2OJTA 5H8SA 1IUDA 4X1DA 1ZJLA 4JSDA 5L9SA 2XXXA 3Q28A 5JK4A 2RF1A 3G3HA 4IO7A 5A5XB 3UK4A 2X7PA 5H8NB 5AA2D 3OSRA 2VGQA 2REJA 3SEWA 3FVOA 1B0HA 4FEDA 4G77A 5DEXA 3OEKA 2V3TA 4BDOA 2F35A 2XXPA 2Y7RA 3A3UA 1B40A 1I69A 3Q29A 2ANJA 3TZAA 3CI8A 5KCJB 1UTHA 4GXAA 1B3EA 1SW1A 3PUXE 3KGCA 2AL5A 4O3BA 3G3GA 1XVXA 3KG2A 1HSLA 3IK6B 2F36A 3H6VA 3O6HA 3VLVA 2XHDA 5CM6A 3FVKA 1I6BA 3LC8A 2VHAA 1NH7A 4GL8A 1MM7A 5TP9B 3VFJA 1MRPA 1J1NA 1LAGE 3UIFA 5I59A 3FV2A 2B3FA 2OCUA 1SD3A 3ILTB 4ZEDA 4MBPA 4OEVA 5ICQA 3DP8A 1Y4CA 2IA4A 2OWSA 1QJMA 5EHSA 3I6VA 2B3BA 3FXRA 1GGGA 1I6QA 2W7YA 4NEDA 3EPEA 3OOAA 2QJEA 5FHMA 3PUVE 1Y4TA 1H76A 3EN3A 1RKMA 3MWBA 5LOMA 2GFEA 4OFLA 4P0GA 2DSFA 3IB0A 1GV8A 3CR9A 2OZZA 1FTKA 5JTYA 4M1VA 2V93A 5FHNA 1GR2A 4LZ5A 1WODA 5DT6A 4DDDA 3WAFA 1WVJA 4WEDA 5CC2A 1B6HA 2OK2A 3QUFA 1ZTYA 2O68A 5H8HA 5CMCA 4RPNA 1B5HA 1MXYA 5K2XA 1EZOA 3VVFA 3CFZA 4GRKA 2A5TB 2VP1A 1JNFA 4FAJA 2V3UA 3EHSA 4U21A 1ZIUA 1MDQA 4NF6A 1VE4A 1LSTA 1XT8A 3ECRA 3FIRA 1LLSA 2I0CA 5FTIA 3PD9A 3K01A 4G68B 3M3FA 4WXJA 3K4UA 2P2AA 1M5EA 4G8MA 1FW0A 1F9BA 3BKIB 1LFGA 4FATA 3IJXB 1LAXA 4R73A 3PV0E 4IO4A 4IY6A 4H8JA 2PBWA 3SKPA 3TFLA 4OEUA 3EQ1A 3PUWE 1QVSA 2THIA 1Z7NE 2Z23A 3MP6A 3MZ9A 1QKBA 3E13X 4ELRA 4QFOA 1LB8A 4KI0E 1LCTA 3PMWA 3I3VA 3V83A 3Q26A 4EF1A 4GD5A 4GOTA 4HCYA 5TPAB 4UACA 2XD2A 1MQHA 3H6WA 2D3IA 1GVCA 3JZJA 4O3AA 4C0RA 2QPQA 4IB2A 2M8CA 4P11A 4ZZAA 3TELA 3LR1A 5DYHA 3QK6A 3VLWA 2DE3A 1ZKBA 3S2VA 2H98A 1H43A 1AMFA 4ONYA 4NWDA 3O6GA 3TTKA 2F97A 1P1WA 4G2ZA 2F7CA 1N84A 1KWHA 4GXSB 3B7DA 3MAMA 4JB7A 2D5WA 2ZNSA 3TTLA 2RINA 5FHOA 5I2NA 1MXXA 4N07A 4KQPA 1B58A 2Q9TA 5KDTB 3MBPA 3TCHA 2I3WA 1A7LA 4QSCA 4ND9A 4DZ1A 3TTRA 2X26A 2HCAA 3BBRA 4MLQA 4H1XA 4WEPA 2XX8A 1AOVA 3RLFE 1US4A 2F78A 1S7YA 3KOSA 2G93A 4XIGQ 1I6AA 4XKNA 4BDMA 2O6AA 4G4PA 3L6GA 4JDFA 1FQDA 1US5A 1QW0A 4OXVA 3DELB 2F7AA 4GIZA 2PVUA 5H8FA 5DEXB 4U1ZA 2H99A 4I1DA 3IO4A 4YB6A 2HZLA 2RCAA 2UVJA 4ZEBA 3L6HA 3H4ZA 3B6TA 2ESNA 4NE4A 1MY2A 3W9VA 5EYFA 2ZNUA 4PFYA 4IGTA 2AIXA 1EZPA 3G3KA 3KN8A 4F18A 2Z22A 3VXBA 1VFDA 1N04A 3KN7A 1N76A 3ZS6A 4ZEFA 1XS5A 1A8EA 2ONRA 3PPOA 3M8UA 3O28A 4YAHX 3V8XB 4G8HA 1MH3A 2OBGA 3MP8A 4QFLA 4AQ4A 3CG1A 2I0BA 1QUIA 4Z7EA 2Z8EA 1Y9UA 4R6KA 2FNCA 4F31B 3IORA 3K6VA 4QFKA 2QS2A 4U22A 4IY5A 3W9WA 3KZGA 3DLNA 3UORA 3OO9A 4RPOA 3B6QA 3LSXA 5I57B 3KN3A 1ATGA 3VE1B 2ABHA 3O9PA 1SI1A 1DPEA 1H3DA 4QSEA 5JTYB 2WKYA 2R71A 5DVFA 4U4XA 5F1QA 4R6YA 1MPCA 4Z0IA 4ESXA 2HXWA 3S9EA 1N0TA 1Y1ZA 1POTA 4ELPA 1MQJA 1LAFE 4JWYA 4MH5A 4YKIA 4OFJA 5M2VA 4GFRA 4NF6B 1UQWA 1AIVA 3HV1A 3CSGA 2NVUB 3HN0A 3MZBA 3KSXA 1ANFA 2DWHA 2X7QA 1R9LA 4GLIA 3M3LA 3USDA 4DXCA 3PUZE 2F7BA 4ZDMA 1B1HA 2QL3A 2RKMA 2GHAA 4LUBA 3D4CA 3OSQA 4HCWA 1O7TA 2VD2A 5I56B 2UYEA 4ZEIA 1QUJA 3IR1A 4N6PA 2O51A 3FJGA 1B3FA 4G68C 3PGFA 4XTCQ 3PD8A 1B0LA 4OYVA 4DCXA 1Y3QA 1MXUA 4OFOA 3T9UA 2H5YA 4JWOA 1TT1A 2RCBA 3T66A 3H06B 4H67A 3RPWA 3Q27A 4HTGA 1MG1A 2YJPA 1IEJA 4NF4B 2XXWA 3H03A 4PQJA 1R6ZA 2AYSA 4NWCA 2BJJX 3U92A 4EF2A 1LBBA 3RT6B 3FGSA 1LBCA 3Q25A 4R9GA 3RTFB 2NOOA 3HHFA 5I2NB 3I5OA 2XXRA 3MUQA 3VLUA 2HQ0A 3N6UA 1SYIA 3GBBA 1LAHE 1EZ9A 3K1PA 4MF3A 1LFIA 5IKBA 3U72A 1MY0A 1FCKA 4EXLA 4R2BA 3K02A 4LA9A 2FA7A 4R74A 2Z8FA 1MS7A 1SQYA 1DTGA 3JV9A 4EQ7A 3SEUA 4OMBA 4NMYA 1IXHA 4YMAA 5AA1A 1OQGA 4YB5A 3SESA 2V84A 3H6TA 2I4BA 3CRBA 3HO7A 1YTVA 3FV1A 2XXTA 3IB1A 2CZLA 1A99A 1FTMA 3H6UA 1NNTA 3MVYA 5H8FB 3T9HB 2QSXA 1SBPA 3KJ7A 3U8QA 2F6GA 4KR5A 2ZXTA 4C1TA 1B3LA 4IO5A 3S9LC 1MXWA 4L17A 2XXHA 1SYHA 3FUZA 3U93A 2GHBA 3N94A 2ONSA 3U1OA 1DPPA 4FECA 2XXQA 2V3QA 3IOTA 3C36A 5L8DA 3C31A 3KFMA 3MW0A 2ZYKA 2UXAA 5KZTA 4OWDA 5H8QB 2Y7KA 3MVWA 1H45A 5I2KB 5AA2A 4DXBA 4OENA 4R2FA 3SERA 3RGYA 1A55A 1LFHA 2Y7IA 2OLBA 4IO6A 3K6UA 3IL1B 2P1SA 2XXIA 1FTOA 2Q88A 3SDFA 2I6EA 4Q5TA 2KLFA 1MXZA 1ZU0A 1BIYA 2RC9A 4RA1A 1XOCA 5K2YA 2F34A 1M5FA 2DOJA 1M5DA 4F3PA 1EH3A 3TPAA 4HS7A 4DIGA 4H5FA 2DE2A 1MQDA 4LVQA 1URSA 3G3JA 4OTEA 4LQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCD A;  3C32 A;  3VXC A;  3DM0 A;  2H9B A;  3C35 A;  4X9T A;  3K1N A;  3ONM A;  3KSJ A;  4AB5 A;  1OLC A;  4YKK A;  4ECF A;  3T22 A;  3HST A;  3UGW A;  3OEN A;  3CVG A;  4EQ9 A;  1MDP 1;  1SW4 A;  1JW5 A;  4IGR A;  1URD A;  4NF5 A;  3T9V A;  3IX1 A;  4RK2 A;  3PPQ A;  2I3V A;  1MPD A;  4EXK A;  3FXQ A;  4R9F A;  2ZMB A;  1FQB A;  1DOT A;  1WDN A;  4F19 A;  4RJZ A;  4TLL B;  2E1S A;  4G8N A;  4KYD A;  4KD5 A;  1LCF A;  3ODB A;  1B4H A;  3F11 A;  4OQO A;  3VV5 A;  3IAZ A;  4NF8 A;  2G29 A;  4IO2 A;  5CMK A;  3SEV A;  1IXG A;  1BKA A;  3DP4 A;  3ZKL A;  1P1O A;  1Y3P A;  4F3S A;  2DWA A;  1PC3 A;  3W15 C;  1SI0 A;  4TLM B;  1MQG A;  4I62 A;  2DYX A;  4RXL A;  4KYE A;  2FYI A;  1UTH B;  4ZE8 A;  2XXY A;  1MM6 A;  1A54 A;  4DE8 A;  1MQI A;  2H25 A;  4BDN A;  2HAV A;  1Z7M E;  3PMX A;  2O69 A;  1UIV A;  2Q8J A;  4OES A;  3QUJ A;  1TFD A;  2IEE A;  3ILU B;  4F1Y A;  5CBR A;  4G68 A;  3RQT A;  4GVO A;  3UA8 A;  3V89 B;  2QMX A;  4F3G A;  5ICT A;  4EUO A;  3TUS A;  3QIM A;  1Q1K A;  5AA4 A;  4YKJ A;  2PT2 A;  5I59 B;  5CMM A;  3MPL A;  3SET A;  3TTM A;  2DXR A;  1PBQ A;  2CMO A;  1II5 A;  1TFA A;  5TU0 A;  3IOU A;  2HZK A;  3HPI A;  2D21 A;  2YLN A;  3K00 A;  4F2O A;  4LON B;  4KHZ E;  4E0W A;  2PT1 A;  3TOD A;  1VR5 A;  4FE8 A;  1NKX A;  5TPA A;  2B65 A;  4Q0C A;  2UVG A;  2REG A;  1QUL A;  3TQW A;  4XXU A;  1EU8 A;  2Y7P A;  4ZE9 A;  1MXV A;  5DVJ A;  4F29 A;  1FQA A;  4GF8 A;  1RYX A;  1FTJ A;  1BP5 A;  4QFN A;  4OVJ A;  3FZV A;  2XD3 A;  5J1D A;  4QF9 A;  2Z8D A;  1D4N A;  4IO3 A;  1D9Y A;  3KJT A;  4FIM A;  3BFU A;  3LSF B;  5AA3 A;  3LSL A;  3PMV A;  1VFE A;  2O84 X;  3LSW A;  3EF7 A;  5H8H B;  1IXC A;  3ZKK A;  1UTB A;  1HSE A;  3JYR A;  5HM4 B;  3RNN A;  4OHN A;  4RNS A;  3R6U A;  1NFT A;  2P0S A;  3CSB A;  4ISU A;  4M4G A;  1OLA A;  5ITO A;  3H3G A;  2GH9 A;  3OMB A;  2NWJ A;  4MLV A;  4JWX A;  1PEB A;  2UVI A;  3N26 A;  4ZZE A;  3SEX A;  5BWJ A;  1RYO A;  3K6W A;  1JVY A;  3R26 A;  4QFP A;  4PET A;  4NTL A;  4C1U A;  1O63 A;  4FOR A;  3VVD A;  3RTW B;  5ITP A;  1OVT A;  1B7H A;  4QSD A;  1QUK A;  3PPN A;  5AA2 B;  3GLB A;  1IXI A;  1QKA A;  3MQ9 A;  1A40 A;  3CIJ A;  4JBZ A;  4LZ8 A;  3OEL A;  3RY3 A;  3LBS A;  3K6X A;  2XX7 A;  4E0X A;  1P1N A;  1PB9 A;  1URG A;  3MP1 A;  4GL0 A;  4DLD A;  3TCF A;  2QMW A;  5HPQ A;  3PPR A;  5JEI A;  2H4I A;  1ELJ A;  3E4R A;  3O66 A;  4POX A;  2I48 A;  1SDX A;  5I58 A;  5CMB A;  4XKR A;  3K2D A;  4H5G A;  1YCJ A;  3T9X B;  4ESW A;  3DP6 A;  3GXA A;  3KOT A;  1S50 A;  3OXN A;  2AL4 A;  4GQO A;  3TQL A;  2RC8 A;  3V5A A;  5CRY A;  3S9M C;  1JEU A;  2UYF A;  1OQH A;  4BDL A;  1SW5 A;  5L9O A;  5B7D A;  1JW1 A;  1Y20 A;  3OO7 A;  1PB7 A;  3MVX A;  3MJN A;  4FEB A;  3E9X A;  4R75 A;  3OO8 A;  2V25 A;  4NF5 B;  1DMB A;  5B70 A;  3C34 A;  1SVX B;  1IQ7 A;  2YPN A;  3C4M A;  3RT8 A;  3MVZ A;  1LB9 A;  1Y3N A;  2I58 A;  3KBR A;  3TTN A;  2XX9 A;  4F3B A;  1B4Z A;  1NNF A;  5I57 A;  4MFI A;  3EHU A;  4RY1 A;  3KEI A;  4EQB A;  1B05 A;  4LZ7 A;  2DQV A;  1JQF A;  4NF8 B;  4LP2 B;  3MC2 A;  4H0W A;  4H8I A;  1YAE A;  3S4U A;  5DVI A;  1GTK A;  3SEY A;  3O2A A;  4GWO A;  3RN8 A;  1PDA A;  4YKP A;  2ZYM A;  3BFT A;  3MZ1 A;  3GZG A;  1N7X A;  3N5L A;  4H65 A;  4KFQ A;  4WKM A;  3WAE A;  3M3K A;  2QS3 A;  1B51 A;  3PU5 A;  3U94 A;  1IIT A;  3B6W A;  3FJ7 A;  4N13 A;  5A5X A;  4LAT A;  4YMB A;  3O29 A;  3AXF A;  3G7W A;  5H8N A;  1CE2 A;  3D4G A;  4XKP A;  1N3X A;  3A3C A;  4O3C A;  5F7V A;  2HAU A;  5AA4 B;  4F2Q A;  2DVC A;  1ZBM A;  3IOV A;  5DTB A;  3O6I A;  2I4C A;  4X48 A;  2ZYO A;  1ZMG A;  2RC7 A;  5I56 A;  2O7I A;  1D9V A;  4POW A;  5KCJ A;  1XVY A;  5I84 A;  2R9J A;  1B7Z A;  4I9D A;  3ZSF A;  5CI5 A;  1PB8 A;  1OMP A;  1NNP A;  1OVB A;  4YU0 A;  4ELO A;  1CB6 A;  4KYS A;  2Y7W A;  4R6H A;  3TKD A;  2DE4 A;  2PX1 A;  2DP8 A;  1IZ1 A;  4I8C A;  3FVG A;  3CFL A;  3S9N C;  4F39 A;  4ZEK A;  1L5T A;  3UN6 A;  4F1U A;  1TXF A;  3GBA A;  4U2R A;  4DXU A;  1USY E;  1B5J A;  1MPB A;  2OWT A;  3CG3 A;  3H7M A;  4X1B A;  4H6D A;  3R7X A;  1JEV A;  3FAS A;  5L9M A;  1B52 A;  5TP9 A;  3FJM A;  4OER A;  4NF4 A;  2DWI A;  3P7I A;  3IJO B;  3TMG A;  1B1X A;  4YB7 A;  3IOW A;  1UIU A;  5BUU A;  2F6P A;  4LQ5 A;  3E3K A;  2Y84 A;  2O7U A;  5ISU A;  5HBC A;  4YZZ A;  2QS4 A;  3QSL A;  3N6T A;  1UTB B;  4BDR A;  1H44 A;  3T96 B;  5IAI A;  2Q89 A;  3THI A;  1B3G A;  2F5X A;  1FQF A;  2DXY A;  4XKQ A;  3IB2 A;  2O1M A;  3VDF A;  5AE4 A;  4F22 A;  3FAT A;  4KCC A;  1B7U A;  3TYH A;  2QS1 A;  3FVN A;  4TQU Q;  1MY1 A;  1B46 A;  4KPT A;  4TOZ A;  4OZ9 A;  4EDP A;  4Q30 B;  1N3W A;  2NXO A;  2I49 A;  1USY H;  1B3H A;  1FQE A;  1FTL A;  1BLF A;  3PUY E;  1YPN A;  3VVE A;  1B9J A;  1HSJ A;  4U4S A;  4QRZ A;  3MPK A;  4DCY A;  3EHT A;  3TDJ A;  2A5T A;  4UA8 A;  1R1N A;  2UVH A;  1LGB C;  4P0I A;  1BTJ A;  2Q2C A;  2GRV A;  3TAJ A;  3K0V A;  3LUY A;  2ZYN A;  4RK9 A;  1XHY A;  2E0S A;  1DTZ A;  1PBP A;  4YIC A;  3PPP A;  2R6G E;  3C9H A;  1M5C A;  3C33 A;  2O1L A;  3FXU A;  4ZEC A;  5ELV A;  3A09 A;  4THI A;  1B2H A;  5EHM A;  3O97 A;  1P99 A;  1Q35 A;  5H8Q A;  4OET A;  3RUM A;  5I58 B;  4PFW A;  1MY3 A;  4BLA A;  3K1M A;  5I2K A;  4FJP A;  3HCQ A;  1MH4 A;  1R9Q A;  2XXV A;  1OIB A;  1B32 A;  2VOZ A;  1SW2 A;  2A5S A;  2PMS A;  3T93 B;  1MY4 A;  4QHQ A;  2DWJ A;  1M5B A;  1Y1M A;  3TCG A;  2DVZ A;  3QAX A;  3CFX A;  2VD3 A;  2DS9 A;  2HFB A;  3OO6 A;  4BDQ A;  1B5I A;  2LAO A;  4AB6 A;  3FD3 A;  5CBS A;  1IIW A;  1AL3 A;  4Q8R A;  3HHG A;  5FTH A;  1P1Q A;  2XXU A;  3G3I A;  4PFU A;  4ELQ A;  1FQC A;  2ZNT A;  3TEP A;  1DSN A;  1NNK A;  4F1V A;  2HEU A;  1VSO A;  2F8D A;  3IO6 A;  3OD7 A;  2NUV A;  4PE5 B;  1JET A;  4PFT A;  1S9T A;  4JXI A;  1NL5 A;  2Q2A A;  1JW4 A;  1D3K A;  1P1U A;  1NH8 A;  4U1O A;  4U23 A;  1JVX A;  2QRY A;  3QYT A;  4JSO A;  1AH5 A;  1NMU A;  1TWY A;  3OEM A;  5KDT A;  3G3F A;  4ZS9 A;  1A8F A;  2ONK E;  4HW8 A;  4RYA A;  2PYY A;  1N7W A;  2ALU A;  4R72 A;  4K3F A;  1O64 A;  3QXM A;  1XC1 A;  1ZLQ A;  4PP0 A;  1T0K A;  3UP9 A;  1POY 1;  2OJT A;  5H8S A;  1IUD A;  4X1D A;  1ZJL A;  4JSD A;  5L9S A;  2XXX A;  3Q28 A;  5JK4 A;  2RF1 A;  3G3H A;  4IO7 A;  5A5X B;  3UK4 A;  2X7P A;  5H8N B;  5AA2 D;  3OSR A;  2VGQ A;  2REJ A;  3SEW A;  3FVO A;  1B0H A;  4FED A;  4G77 A;  5DEX A;  3OEK A;  2V3T A;  4BDO A;  2F35 A;  2XXP A;  2Y7R A;  3A3U A;  1B40 A;  1I69 A;  3Q29 A;  2ANJ A;  3TZA A;  3CI8 A;  5KCJ B;  1UTH A;  4GXA A;  1B3E A;  1SW1 A;  3PUX E;  3KGC A;  2AL5 A;  4O3B A;  3G3G A;  1XVX A;  3KG2 A;  1HSL A;  3IK6 B;  2F36 A;  3H6V A;  3O6H A;  3VLV A;  2XHD A;  5CM6 A;  3FVK A;  1I6B A;  3LC8 A;  2VHA A;  1NH7 A;  4GL8 A;  1MM7 A;  5TP9 B;  3VFJ A;  1MRP A;  1J1N A;  1LAG E;  3UIF A;  5I59 A;  3FV2 A;  2B3F A;  2OCU A;  1SD3 A;  3ILT B;  4ZED A;  4MBP A;  4OEV A;  5ICQ A;  3DP8 A;  1Y4C A;  2IA4 A;  2OWS A;  1QJM A;  5EHS A;  3I6V A;  2B3B A;  3FXR A;  1GGG A;  1I6Q A;  2W7Y A;  4NED A;  3EPE A;  3OOA A;  2QJE A;  5FHM A;  3PUV E;  1Y4T A;  1H76 A;  3EN3 A;  1RKM A;  3MWB A;  5LOM A;  2GFE A;  4OFL A;  4P0G A;  2DSF A;  3IB0 A;  1GV8 A;  3CR9 A;  2OZZ A;  1FTK A;  5JTY A;  4M1V A;  2V93 A;  5FHN A;  1GR2 A;  4LZ5 A;  1WOD A;  5DT6 A;  4DDD A;  3WAF A;  1WVJ A;  4WED A;  5CC2 A;  1B6H A;  2OK2 A;  3QUF A;  1ZTY A;  2O68 A;  5H8H A;  5CMC A;  4RPN A;  1B5H A;  1MXY A;  5K2X A;  1EZO A;  3VVF A;  3CFZ A;  4GRK A;  2A5T B;  2VP1 A;  1JNF A;  4FAJ A;  2V3U A;  3EHS A;  4U21 A;  1ZIU A;  1MDQ A;  4NF6 A;  1VE4 A;  1LST A;  1XT8 A;  3ECR A;  3FIR A;  1LLS A;  2I0C A;  5FTI A;  3PD9 A;  3K01 A;  4G68 B;  3M3F A;  4WXJ A;  3K4U A;  2P2A A;  1M5E A;  4G8M A;  1FW0 A;  1F9B A;  3BKI B;  1LFG A;  4FAT A;  3IJX B;  1LAX A;  4R73 A;  3PV0 E;  4IO4 A;  4IY6 A;  4H8J A;  2PBW A;  3SKP A;  3TFL A;  4OEU A;  3EQ1 A;  3PUW E;  1QVS A;  2THI A;  1Z7N E;  2Z23 A;  3MP6 A;  3MZ9 A;  1QKB A;  3E13 X;  4ELR A;  4QFO A;  1LB8 A;  4KI0 E;  1LCT A;  3PMW A;  3I3V A;  3V83 A;  3Q26 A;  4EF1 A;  4GD5 A;  4GOT A;  4HCY A;  5TPA B;  4UAC A;  2XD2 A;  1MQH A;  3H6W A;  2D3I A;  1GVC A;  3JZJ A;  4O3A A;  4C0R A;  2QPQ A;  4IB2 A;  2M8C A;  4P11 A;  4ZZA A;  3TEL A;  3LR1 A;  5DYH A;  3QK6 A;  3VLW A;  2DE3 A;  1ZKB A;  3S2V A;  2H98 A;  1H43 A;  1AMF A;  4ONY A;  4NWD A;  3O6G A;  3TTK A;  2F97 A;  1P1W A;  4G2Z A;  2F7C A;  1N84 A;  1KWH A;  4GXS B;  3B7D A;  3MAM A;  4JB7 A;  2D5W A;  2ZNS A;  3TTL A;  2RIN A;  5FHO A;  5I2N A;  1MXX A;  4N07 A;  4KQP A;  1B58 A;  2Q9T A;  5KDT B;  3MBP A;  3TCH A;  2I3W A;  1A7L A;  4QSC A;  4ND9 A;  4DZ1 A;  3TTR A;  2X26 A;  2HCA A;  3BBR A;  4MLQ A;  4H1X A;  4WEP A;  2XX8 A;  1AOV A;  3RLF E;  1US4 A;  2F78 A;  1S7Y A;  3KOS A;  2G93 A;  4XIG Q;  1I6A A;  4XKN A;  4BDM A;  2O6A A;  4G4P A;  3L6G A;  4JDF A;  1FQD A;  1US5 A;  1QW0 A;  4OXV A;  3DEL B;  2F7A A;  4GIZ A;  2PVU A;  5H8F A;  5DEX B;  4U1Z A;  2H99 A;  4I1D A;  3IO4 A;  4YB6 A;  2HZL A;  2RCA A;  2UVJ A;  4ZEB A;  3L6H A;  3H4Z A;  3B6T A;  2ESN A;  4NE4 A;  1MY2 A;  3W9V A;  5EYF A;  2ZNU A;  4PFY A;  4IGT A;  2AIX A;  1EZP A;  3G3K A;  3KN8 A;  4F18 A;  2Z22 A;  3VXB A;  1VFD A;  1N04 A;  3KN7 A;  1N76 A;  3ZS6 A;  4ZEF A;  1XS5 A;  1A8E A;  2ONR A;  3PPO A;  3M8U A;  3O28 A;  4YAH X;  3V8X B;  4G8H A;  1MH3 A;  2OBG A;  3MP8 A;  4QFL A;  4AQ4 A;  3CG1 A;  2I0B A;  1QUI A;  4Z7E A;  2Z8E A;  1Y9U A;  4R6K A;  2FNC A;  4F31 B;  3IOR A;  3K6V A;  4QFK A;  2QS2 A;  4U22 A;  4IY5 A;  3W9W A;  3KZG A;  3DLN A;  3UOR A;  3OO9 A;  4RPO A;  3B6Q A;  3LSX A;  5I57 B;  3KN3 A;  1ATG A;  3VE1 B;  2ABH A;  3O9P A;  1SI1 A;  1DPE A;  1H3D A;  4QSE A;  5JTY B;  2WKY A;  2R71 A;  5DVF A;  4U4X A;  5F1Q A;  4R6Y A;  1MPC A;  4Z0I A;  4ESX A;  2HXW A;  3S9E A;  1N0T A;  1Y1Z A;  1POT A;  4ELP A;  1MQJ A;  1LAF E;  4JWY A;  4MH5 A;  4YKI A;  4OFJ A;  5M2V A;  4GFR A;  4NF6 B;  1UQW A;  1AIV A;  3HV1 A;  3CSG A;  2NVU B;  3HN0 A;  3MZB A;  3KSX A;  1ANF A;  2DWH A;  2X7Q A;  1R9L A;  4GLI A;  3M3L A;  3USD A;  4DXC A;  3PUZ E;  2F7B A;  4ZDM A;  1B1H A;  2QL3 A;  2RKM A;  2GHA A;  4LUB A;  3D4C A;  3OSQ A;  4HCW A;  1O7T A;  2VD2 A;  5I56 B;  2UYE A;  4ZEI A;  1QUJ A;  3IR1 A;  4N6P A;  2O51 A;  3FJG A;  1B3F A;  4G68 C;  3PGF A;  4XTC Q;  3PD8 A;  1B0L A;  4OYV A;  4DCX A;  1Y3Q A;  1MXU A;  4OFO A;  3T9U A;  2H5Y A;  4JWO A;  1TT1 A;  2RCB A;  3T66 A;  3H06 B;  4H67 A;  3RPW A;  3Q27 A;  4HTG A;  1MG1 A;  2YJP A;  1IEJ A;  4NF4 B;  2XXW A;  3H03 A;  4PQJ A;  1R6Z A;  2AYS A;  4NWC A;  2BJJ X;  3U92 A;  4EF2 A;  1LBB A;  3RT6 B;  3FGS A;  1LBC A;  3Q25 A;  4R9G A;  3RTF B;  2NOO A;  3HHF A;  5I2N B;  3I5O A;  2XXR A;  3MUQ A;  3VLU A;  2HQ0 A;  3N6U A;  1SYI A;  3GBB A;  1LAH E;  1EZ9 A;  3K1P A;  4MF3 A;  1LFI A;  5IKB A;  3U72 A;  1MY0 A;  1FCK A;  4EXL A;  4R2B A;  3K02 A;  4LA9 A;  2FA7 A;  4R74 A;  2Z8F A;  1MS7 A;  1SQY A;  1DTG A;  3JV9 A;  4EQ7 A;  3SEU A;  4OMB A;  4NMY A;  1IXH A;  4YMA A;  5AA1 A;  1OQG A;  4YB5 A;  3SES A;  2V84 A;  3H6T A;  2I4B A;  3CRB A;  3HO7 A;  1YTV A;  3FV1 A;  2XXT A;  3IB1 A;  2CZL A;  1A99 A;  1FTM A;  3H6U A;  1NNT A;  3MVY A;  5H8F B;  3T9H B;  2QSX A;  1SBP A;  3KJ7 A;  3U8Q A;  2F6G A;  4KR5 A;  2ZXT A;  4C1T A;  1B3L A;  4IO5 A;  3S9L C;  1MXW A;  4L17 A;  2XXH A;  1SYH A;  3FUZ A;  3U93 A;  2GHB A;  3N94 A;  2ONS A;  3U1O A;  1DPP A;  4FEC A;  2XXQ A;  2V3Q A;  3IOT A;  3C36 A;  5L8D A;  3C31 A;  3KFM A;  3MW0 A;  2ZYK A;  2UXA A;  5KZT A;  4OWD A;  5H8Q B;  2Y7K A;  3MVW A;  1H45 A;  5I2K B;  5AA2 A;  4DXB A;  4OEN A;  4R2F A;  3SER A;  3RGY A;  1A55 A;  1LFH A;  2Y7I A;  2OLB A;  4IO6 A;  3K6U A;  3IL1 B;  2P1S A;  2XXI A;  1FTO A;  2Q88 A;  3SDF A;  2I6E A;  4Q5T A;  2KLF A;  1MXZ A;  1ZU0 A;  1BIY A;  2RC9 A;  4RA1 A;  1XOC A;  5K2Y A;  2F34 A;  1M5F A;  2DOJ A;  1M5D A;  4F3P A;  1EH3 A;  3TPA A;  4HS7 A;  4DIG A;  4H5F A;  2DE2 A;  1MQD A;  4LVQ A;  1URS A;  3G3J A;  4OTE A;  4LQ2 A; 
#chains in the Genus database with same CATH topology
 4KCD A;  3C32 A;  3VXC A;  3DM0 A;  2H9B A;  3C35 A;  4X9T A;  1AWB A;  3K1N A;  3ONM A;  3KSJ A;  4AB5 A;  1LBX A;  1OLC A;  4YKK A;  4ECF A;  3T22 A;  5J16 A;  3HST A;  3UGW A;  3OEN A;  3CVG A;  4EQ9 A;  1MDP 1;  1FBE A;  1SW4 A;  1JW5 A;  3T1B A;  4IGR A;  1URD A;  4NF5 A;  3T9V A;  3IX1 A;  4N91 A;  4RK2 A;  3PPQ A;  2I3V A;  1MPD A;  1NV4 A;  4EXK A;  3FXQ A;  4R9F A;  2ZMB A;  3CHG A;  1FQB A;  1DOT A;  1WDN A;  4FBP A;  4F19 A;  4RJZ A;  4TLL B;  2E1S A;  4G8N A;  4KYD A;  4KD5 A;  1LCF A;  3ODB A;  1B4H A;  3F11 A;  4OQO A;  3VV5 A;  3IAZ A;  4NF8 A;  2G29 A;  5EQ9 A;  4IO2 A;  5CMK A;  3SEV A;  1IXG A;  1BKA A;  3DP4 A;  3ZKL A;  2B4M A;  1P1O A;  1Y3P A;  4F3S A;  2DWA A;  2Y5K A;  1PC3 A;  3W15 C;  1SI0 A;  4TLM B;  1MQG A;  4I62 A;  4GX6 A;  2DYX A;  4RXL A;  4KYE A;  2FYI A;  4LN5 A;  1UTH B;  4ZE8 A;  2XXY A;  1MM6 A;  1A54 A;  4DE8 A;  1MQI A;  2H25 A;  4BDN A;  2HAV A;  1Z7M E;  3PMX A;  2O69 A;  1UIV A;  1NV0 A;  2Q8J A;  4OES A;  1LBZ A;  3QUJ A;  1TFD A;  2IEE A;  3ILU B;  4F1Y A;  3EKI A;  5CBR A;  4G68 A;  3RQT A;  4GVO A;  3UA8 A;  3V89 B;  2QMX A;  4F3G A;  5ICT A;  4EUO A;  3TUS A;  3QIM A;  1Q1K A;  5AA4 A;  4P9K A;  4YKJ A;  2PT2 A;  5I59 B;  5CMM A;  1IME A;  3MPL A;  3SET A;  3TTM A;  2DXR A;  1PBQ A;  2CMO A;  1II5 A;  1TFA A;  4JVI A;  5TU0 A;  3IOU A;  2HZK A;  3HPI A;  2D21 A;  2YLN A;  3K00 A;  1IMF A;  4PDD A;  3E78 A;  4F2O A;  4LON B;  4KHZ E;  4E0W A;  2PT1 A;  3TOD A;  2FIE A;  1VR5 A;  1K9Y A;  4FE8 A;  1NKX A;  5TPA A;  2B65 A;  4PDH A;  4Q0C A;  1NV3 A;  2UVG A;  2PCR A;  2REG A;  1QUL A;  1DK4 A;  2Q8M A;  3TQW A;  4XXU A;  1EU8 A;  2Y7P A;  4AS4 A;  4ZE9 A;  1MXV A;  5DVJ A;  4F29 A;  1FQA A;  4GF8 A;  1RYX A;  1FTJ A;  1BP5 A;  4QFN A;  4OVJ A;  3FZV A;  2XD3 A;  5LDZ A;  5J1D A;  4QF9 A;  4GWY A;  2Z8D A;  1D4N A;  4IO3 A;  1D9Y A;  3KJT A;  4FIM A;  3BFU A;  3LSF B;  5AA3 A;  3LSL A;  4P8B A;  3PMV A;  1VFE A;  2O84 X;  3LSW A;  2MKZ A;  3EF7 A;  4MNP A;  5H8H B;  1IXC A;  3ZKK A;  1UTB A;  1HSE A;  3JYR A;  5HM4 B;  2HXR A;  3RNN A;  4OHN A;  4RNS A;  3T0J A;  3R6U A;  1NFT A;  2P0S A;  3CSB A;  4ISU A;  4M4G A;  1FBC A;  2B4L A;  1OLA A;  5ITO A;  3H3G A;  2GH9 A;  3OMB A;  2NWJ A;  4MLV A;  4JWX A;  1PEB A;  3BIH A;  2UVI A;  3N26 A;  4ZZE A;  3SEX A;  5BWJ A;  1RYO A;  2WX9 A;  5I5P A;  4H45 A;  3K6W A;  3KBZ A;  1JVY A;  3R26 A;  2PFZ A;  4HE1 A;  4QFP A;  2HPG A;  4PET A;  4NTL A;  4C1U A;  1O63 A;  4FOR A;  3VVD A;  3RTW B;  5ITP A;  1OVT A;  1B7H A;  4QSD A;  4PAK A;  1QUK A;  3PPN A;  4P47 A;  5AA2 B;  3GLB A;  1IXI A;  1QKA A;  3MQ9 A;  1A40 A;  3CIJ A;  4JBZ A;  4MCO A;  5IZ1 A;  2F3D A;  4LZ8 A;  3OEL A;  1RDZ A;  3RY3 A;  3LBS A;  3K6X A;  2XX7 A;  4E0X A;  1P1N A;  1PB9 A;  1URG A;  3MP1 A;  4GL0 A;  4DLD A;  3TCF A;  4OVQ A;  2QMW A;  1NV5 A;  3RYD A;  4OVT A;  5HPQ A;  2XWK A;  3PPR A;  3B50 A;  5JEI A;  2H4I A;  1ELJ A;  3E4R A;  3O66 A;  4POX A;  2I48 A;  1SDX A;  5I58 A;  5CMB A;  4XKR A;  4PC9 A;  3K2D A;  4H5G A;  1YCJ A;  3T9X B;  4ESW A;  3DP6 A;  3GXA A;  4HE0 A;  3KOT A;  1S50 A;  3OXN A;  2AL4 A;  4GQO A;  3TQL A;  2RC8 A;  3V5A A;  5CRY A;  3S9M C;  1JEU A;  2UYF A;  1OQH A;  4BDL A;  1SW5 A;  5L9O A;  5B7D A;  1JW1 A;  4OAN A;  4NF0 A;  4NGU A;  1Y20 A;  3OO7 A;  2XWV A;  1PB7 A;  2FIX A;  4N15 A;  2QVU A;  3IFC A;  3MVX A;  3MJN A;  4FEB A;  3E9X A;  4R75 A;  3OO8 A;  2V25 A;  4NF5 B;  1DMB A;  3C34 A;  5B70 A;  1SVX B;  1IQ7 A;  2YPN A;  3C4M A;  3RT8 A;  3MVZ A;  2V4C A;  1LB9 A;  1Y3N A;  2I58 A;  3KBR A;  4MMP A;  3TTN A;  2XX9 A;  4F3B A;  1B4Z A;  1NNF A;  4X8R A;  5I57 A;  4MFI A;  3EHU A;  4RY1 A;  3KEI A;  4EQB A;  1B05 A;  4LZ7 A;  2DQV A;  1JQF A;  4NF8 B;  4LP2 B;  3MC2 A;  1LEV A;  4H0W A;  4H8I A;  1YAE A;  3S4U A;  5DVI A;  1GTK A;  2CZI A;  1EYK A;  3SEY A;  3O2A A;  4GWO A;  3RN8 A;  1PDA A;  4YKP A;  2ZYM A;  4MNC A;  1EYJ A;  3BFT A;  3MZ1 A;  3GZG A;  1N7X A;  3N5L A;  4H65 A;  3RPL B;  4KFQ A;  4WKM A;  3WAE A;  3M3K A;  2QS3 A;  1B51 A;  1NV2 A;  3PU5 A;  3U94 A;  1IIT A;  3B6W A;  3FJ7 A;  4N13 A;  4PF8 A;  1FPB A;  2QFL A;  5A5X A;  4LAT A;  4HE2 A;  4YMB A;  3O29 A;  2VT5 A;  3AXF A;  3G7W A;  5H8N A;  4PBH A;  1CE2 A;  5IZZ A;  3D4G A;  4XKP A;  1N3X A;  3A3C A;  4O3C A;  5F7V A;  2HAU A;  5AA4 B;  4F2Q A;  2DVC A;  1ZBM A;  3IOV A;  5DTB A;  3O6I A;  2I4C A;  4X48 A;  2ZYO A;  1ZMG A;  2RC7 A;  5I56 A;  3FXB A;  2O7I A;  1D9V A;  4POW A;  5KCJ A;  1XVY A;  5I84 A;  2R9J A;  1NV1 A;  1B7Z A;  4I9D A;  3ZSF A;  5CI5 A;  1PB8 A;  4NQ8 A;  1OMP A;  1NNP A;  1OVB A;  4YU0 A;  4ELO A;  1CB6 A;  4KYS A;  2Y7W A;  4R6H A;  3TKD A;  2DE4 A;  2PX1 A;  2DP8 A;  1IZ1 A;  4I8C A;  3FVG A;  3CFL A;  3S9N C;  4F39 A;  4ZEK A;  4O7I A;  1L5T A;  3UN6 A;  4F1U A;  3GYY A;  1TXF A;  3GBA A;  4U2R A;  4DXU A;  1USY E;  1B5J A;  1LBV A;  1MPB A;  2OWT A;  3CG3 A;  3H7M A;  4X1B A;  4H6D A;  3R7X A;  1JEV A;  3FAS A;  5L9M A;  1B52 A;  5TP9 A;  3FJM A;  2ZZV A;  4OER A;  4NF4 A;  2DWI A;  3ROJ A;  3P7I A;  3IJO B;  3TMG A;  1B1X A;  4YB7 A;  3IOW A;  1UIU A;  5BUU A;  5F24 A;  2F6P A;  4LQ5 A;  3E3K A;  3IFA A;  2Y84 A;  5ET5 A;  1IMB A;  2O7U A;  5ISU A;  5HBC A;  4YZZ A;  2XA5 A;  2QS4 A;  1G0I A;  3PTY A;  3QSL A;  4N4U A;  3N6T A;  1UTB B;  4BDR A;  1H44 A;  3T96 B;  5IAI A;  2Q89 A;  3THI A;  1B3G A;  2F5X A;  1FQF A;  2DXY A;  4XKQ A;  3IB2 A;  2O1M A;  3VDF A;  5AE4 A;  4XF5 A;  4F22 A;  3FAT A;  4NG7 A;  4DI3 D;  4KCC A;  1B7U A;  1QGX A;  3TYH A;  2QS1 A;  3FVN A;  4TQU Q;  1MY1 A;  1B46 A;  4I40 A;  4KPT A;  4TOZ A;  4OZ9 A;  4MJO A;  4EDP A;  4Q30 B;  1N3W A;  5ET8 A;  2NXO A;  2I49 A;  1USY H;  1B3H A;  1FQE A;  1FTL A;  1BLF A;  3PUY E;  1YPN A;  3VVE A;  1B9J A;  1HSJ A;  4U4S A;  2XXK A;  4QRZ A;  1D9Q A;  3MPK A;  4DCY A;  3EHT A;  4P1L A;  3TDJ A;  2A5T A;  4UA8 A;  1NI9 A;  1R1N A;  2UVH A;  1LGB C;  4P0I A;  4HXV A;  1BTJ A;  2Q2C A;  2GRV A;  3TAJ A;  3K0V A;  3LUY A;  3FBP A;  2ZYN A;  4RK9 A;  1XHY A;  2E0S A;  1DTZ A;  1PBP A;  4YIC A;  3KC0 A;  3PPP A;  2R6G E;  3C9H A;  1M5C A;  4MIJ A;  3C33 A;  2O1L A;  3FXU A;  4ZEC A;  5ELV A;  3A09 A;  2L5V A;  2FBP A;  4THI A;  1SPI A;  1B2H A;  5EHM A;  3O97 A;  4QBA A;  1P99 A;  1Q35 A;  5H8Q A;  4OET A;  3RUM A;  5I58 B;  4PFW A;  1MY3 A;  4BLA A;  3K1M A;  5I2K A;  4FJP A;  1FPF A;  3HCQ A;  1MH4 A;  1R9Q A;  2XXV A;  2WYP A;  1OIB A;  1B32 A;  2VOZ A;  4OA4 A;  1SW2 A;  2A5S A;  4O8M A;  2PMS A;  3T93 B;  1MY4 A;  4QHQ A;  2DWJ A;  1M5B A;  1Y1M A;  3TCG A;  2DVZ A;  3QAX A;  3CFX A;  2VD3 A;  1FSA A;  2DS9 A;  2HFB A;  3OO6 A;  1FTA A;  4BDQ A;  1B5I A;  2LAO A;  4AB6 A;  3FD3 A;  2JJK A;  5CBS A;  1IIW A;  1AL3 A;  2FVZ A;  4Q8R A;  3HHG A;  5FTH A;  1P1Q A;  2XXU A;  3G3I A;  4P3L A;  4PFU A;  4ELQ A;  1FQC A;  2ZNT A;  3TEP A;  1DSN A;  5EQ8 A;  1NNK A;  4F1V A;  4PBQ A;  2HEU A;  1FBP A;  1VSO A;  2F8D A;  3IO6 A;  3OD7 A;  2NUV A;  5EQA A;  4PE5 B;  4PAF A;  1JET A;  4PFT A;  1S9T A;  4JXI A;  1NL5 A;  2Q2A A;  1JW4 A;  1D3K A;  1P1U A;  1K9Z A;  1NH8 A;  4U1O A;  4U23 A;  1JVX A;  2QRY A;  5IZ3 A;  3QYT A;  4JSO A;  1AH5 A;  1NMU A;  1TWY A;  3OEM A;  5KDT A;  3G3F A;  4ZS9 A;  1A8F A;  2ONK E;  4HW8 A;  4RYA A;  2PYY A;  1N7W A;  4MX6 A;  2ALU A;  4R72 A;  4K3F A;  1O64 A;  3QXM A;  1XC1 A;  1ZLQ A;  4PP0 A;  1T0K A;  3UP9 A;  1POY 1;  2OJT A;  5H8S A;  1IUD A;  4X1D A;  1ZJL A;  4JSD A;  5L9S A;  2XXX A;  2PFY A;  3Q28 A;  5JK4 A;  2RF1 A;  3G3H A;  4IR8 A;  4IO7 A;  2WEF A;  5A5X B;  3UK4 A;  4MAG A;  2X7P A;  4KXP A;  5H8N B;  1XI6 A;  5AA2 D;  2WYK A;  3OSR A;  2VGQ A;  2REJ A;  3SEW A;  3FVO A;  1B0H A;  4FED A;  4G77 A;  3HFU A;  5DEX A;  3OEK A;  2CEY A;  2V3T A;  1NUY A;  4BDO A;  2F35 A;  2XXP A;  2Y7R A;  3A3U A;  1B40 A;  1I69 A;  3Q29 A;  2ANJ A;  3TZA A;  3CI8 A;  5KCJ B;  1UTH A;  4PF6 A;  4GXA A;  1B3E A;  1SW1 A;  1NUZ A;  3PUX E;  3KGC A;  2AL5 A;  4O3B A;  3G3G A;  1XVX A;  3KG2 A;  5DW8 A;  1HSL A;  2P3V A;  1Q9D A;  3IK6 B;  2F36 A;  3H6V A;  3O6H A;  3VLV A;  2FHY A;  2XHD A;  4MHF A;  5CM6 A;  3FVK A;  1I6B A;  3LC8 A;  2VHA A;  1NH7 A;  4GL8 A;  1MM7 A;  5TP9 B;  4N8Y A;  3VFJ A;  1MRP A;  1J1N A;  1LAG E;  3UIF A;  5I59 A;  2Y5L A;  3FV2 A;  2B3F A;  2OCU A;  1SD3 A;  4N81 A;  3ILT B;  4ZED A;  4MBP A;  4OEV A;  5ICQ A;  3DP8 A;  1Y4C A;  2IA4 A;  1INP A;  2OWS A;  1QJM A;  5EHS A;  1FRP A;  3I6V A;  2B3B A;  3FXR A;  1GGG A;  1I6Q A;  5EYH A;  2W7Y A;  5I7I A;  4NED A;  3EPE A;  3OOA A;  2QJE A;  4G61 A;  1RDX A;  5FHM A;  4PTK A;  3PUV E;  1Y4T A;  1H76 A;  3BIG A;  2VPO A;  3EN3 A;  1RKM A;  3MWB A;  5LOM A;  2GFE A;  4OFL A;  4P0G A;  4O7M A;  2DSF A;  3IB0 A;  1GV8 A;  3CR9 A;  2OZZ A;  1LBY A;  3U65 A;  1FTK A;  5JTY A;  4M1V A;  2V93 A;  5FHN A;  1GR2 A;  4LZ5 A;  1WOD A;  1FPI A;  4QXD A;  5DT6 A;  4DDD A;  3WAF A;  1WVJ A;  4WED A;  5CC2 A;  1B6H A;  2OK2 A;  3QUF A;  1ZTY A;  2O68 A;  5H8H A;  5CMC A;  2KR0 A;  4RPN A;  1B5H A;  1MXY A;  5K2X A;  2QVV A;  1EZO A;  3VVF A;  2OX3 A;  4GBV A;  3CFZ A;  5EYG A;  4GRK A;  2A5T B;  2VP1 A;  1JNF A;  4FAJ A;  3D1R A;  2V3U A;  3EHS A;  4U21 A;  1ZIU A;  2XWO A;  1FJ6 A;  5FBP A;  1MDQ A;  4NF6 A;  1VE4 A;  1LST A;  4UAB A;  1XT8 A;  3ECR A;  3FIR A;  4P1E A;  1LLS A;  2ZZX A;  2CEX A;  2I0C A;  4NAP A;  5FTI A;  3PD9 A;  3K01 A;  4G68 B;  3M3F A;  4WXJ A;  3K4U A;  2P2A A;  1M5E A;  4G8M A;  1FW0 A;  4DI4 B;  1F9B A;  3BKI B;  1LFG A;  4FAT A;  3IJX B;  1LAX A;  4R73 A;  1FPD A;  1FJ9 A;  3PV0 E;  4IO4 A;  4IY6 A;  4H8J A;  2PBW A;  3SKP A;  3TFL A;  4OEU A;  3EQ1 A;  1FPK A;  3PUW E;  1QVS A;  2THI A;  1Z7N E;  2Z23 A;  5ET7 A;  3MP6 A;  3MZ9 A;  1QKB A;  1VDW A;  3E13 X;  4ELR A;  5IGA A;  4QFO A;  1LB8 A;  4KI0 E;  1LCT A;  4NHB A;  3PMW A;  3I3V A;  3V83 A;  3Q26 A;  4EF1 A;  4GD5 A;  4GOT A;  4NN3 A;  4HCY A;  5TPA B;  3LV0 A;  4UAC A;  2XD2 A;  1MQH A;  2HHM A;  3H6W A;  2D3I A;  1GVC A;  3JZJ A;  1JP4 A;  4O3A A;  4C0R A;  1FPG A;  2QPQ A;  4IB2 A;  2M8C A;  5T3J A;  4P11 A;  4ZZA A;  5EQ7 A;  3TEL A;  3LR1 A;  5DYH A;  3QK6 A;  3VLW A;  2DE3 A;  2R8T A;  1ZKB A;  3S2V A;  2H98 A;  1H43 A;  1AMF A;  4ONY A;  4NWD A;  3O6G A;  3TTK A;  2F97 A;  1IMA A;  1P1W A;  4G2Z A;  2F7C A;  1N84 A;  1KWH A;  4N6K A;  4GXS B;  3B7D A;  3MAM A;  4JB7 A;  2D5W A;  2ZNS A;  3TTL A;  2RIN A;  5FHO A;  5I2N A;  1MXX A;  4N07 A;  4KQP A;  1B58 A;  2Q9T A;  5IZ3 B;  5ET6 A;  5KDT B;  3MBP A;  3TCH A;  2I3W A;  4I3Y A;  4JVC A;  1A7L A;  4QSC A;  4ND9 A;  4DZ1 A;  3TTR A;  2X26 A;  2HCA A;  3BBR A;  4MLQ A;  4H1X A;  4WEP A;  2XX8 A;  1AOV A;  1NUW A;  5ESY A;  3RLF E;  1US4 A;  2F78 A;  1S7Y A;  5I3S A;  3KOS A;  2G93 A;  4XIG Q;  1I6A A;  1RDY A;  2GQ1 A;  4XKN A;  4BDM A;  4P56 A;  2O6A A;  1NV6 A;  4G4P A;  4GX4 A;  3L6G A;  4JDF A;  1FQD A;  1US5 A;  4OXV A;  1QW0 A;  3DEL B;  2F7A A;  4GIZ A;  2PVU A;  5H8F A;  5DEX B;  4N17 A;  4U1Z A;  2H99 A;  4I1D A;  3IO4 A;  1YZ0 A;  4O94 A;  4YB6 A;  2HZL A;  2RCA A;  2UVJ A;  4ZEB A;  3L6H A;  2VPN A;  3A29 A;  3H4Z A;  3B6T A;  2ESN A;  3RPL A;  4NE4 A;  1LBW A;  1MY2 A;  3W9V A;  5EYF A;  2ZNU A;  4PFY A;  4IGT A;  2AIX A;  1EZP A;  3G3K A;  1FBF A;  3KN8 A;  4F18 A;  2Z22 A;  3VXB A;  1VFD A;  1N04 A;  3KN7 A;  1N76 A;  3ZS6 A;  3LUZ A;  4ZEF A;  1XS5 A;  1A8E A;  2ONR A;  3PPO A;  2QVR A;  3M8U A;  3O28 A;  4YAH X;  3V8X B;  4G8H A;  1MH3 A;  2OBG A;  1KZ8 A;  3MP8 A;  4QFL A;  4AQ4 A;  3CG1 A;  2I0B A;  1QUI A;  4Z7E A;  2Z8E A;  1Y9U A;  4R6K A;  2FNC A;  4F31 B;  3IOR A;  3K6V A;  4PGN A;  3B8B A;  4QFK A;  2QS2 A;  4GWU A;  4PGP A;  4GBW A;  1FBD A;  4U22 A;  4IY5 A;  3W9W A;  3KZG A;  3DLN A;  3UOR A;  3OO9 A;  4RPO A;  3B6Q A;  3LSX A;  5I57 B;  3KN3 A;  1ATG A;  3VE1 B;  2ABH A;  3O9P A;  4H46 A;  1SI1 A;  1DPE A;  1H3D A;  4QSE A;  5JTY B;  2WKY A;  4OVS A;  2CZK A;  2R71 A;  3MYU A;  5DVF A;  4U4X A;  5F1Q A;  4R6Y A;  1MPC A;  4Z0I A;  4ESX A;  4AS5 A;  2HXW A;  3S9E A;  1N0T A;  1Y1Z A;  1POT A;  4JVD A;  4ELP A;  1MQJ A;  1LAF E;  4JWY A;  4MH5 A;  4YKI A;  4OFJ A;  5M2V A;  4GFR A;  4NF6 B;  1UQW A;  1AIV A;  3HV1 A;  1IMC A;  3CSG A;  2NVU B;  3HN0 A;  2WBB A;  3MZB A;  3KSX A;  1ANF A;  2DWH A;  2X7Q A;  1R9L A;  4GLI A;  3M3L A;  3USD A;  1FBG A;  2ZZW A;  4DXC A;  3PUZ E;  2F7B A;  4ZDM A;  1B1H A;  2QL3 A;  4X04 A;  2RKM A;  2GHA A;  4LUB A;  3D4C A;  1KA1 A;  3OSQ A;  4HCW A;  1O7T A;  2VD2 A;  5I56 B;  2UYE A;  4ZEI A;  1QUJ A;  3SZP A;  3IR1 A;  4N6P A;  2O51 A;  3FJG A;  1B3F A;  4G68 C;  3E79 A;  3PGF A;  4XTC Q;  3PD8 A;  1B0L A;  4OYV A;  4DCX A;  1Y3Q A;  1MXU A;  4OFO A;  3T9U A;  4PE3 A;  2BJI A;  2DDK A;  2H5Y A;  4JWO A;  1TT1 A;  2RCB A;  3T66 A;  3H06 B;  4H67 A;  3RPW A;  3Q27 A;  2F3B A;  4HTG A;  1MG1 A;  2YJP A;  1IEJ A;  4NF4 B;  1DCU A;  2XXW A;  3QMF A;  4I3E A;  3H03 A;  2Q74 A;  4PQJ A;  1R6Z A;  2AYS A;  4NWC A;  4N6D A;  2BJJ X;  3U92 A;  4EF2 A;  1LBB A;  3RT6 B;  3FGS A;  1LBC A;  1CNQ A;  3Q25 A;  1FPE A;  4R9G A;  1G0H A;  3RTF B;  2NOO A;  3HHF A;  2CZH A;  5I2N B;  3I5O A;  2XXR A;  3MUQ A;  2HQ0 A;  3VLU A;  2XWI A;  3N6U A;  1SYI A;  3GBB A;  5A5L A;  1LAH E;  1EZ9 A;  1FPJ A;  3K1P A;  4MF3 A;  1LFI A;  5IKB A;  3U72 A;  1MY0 A;  1YXI A;  1FCK A;  4EXL A;  4R2B A;  3K02 A;  4LA9 A;  2FA7 A;  3MST A;  4R74 A;  2Z8F A;  1MS7 A;  1SQY A;  1DTG A;  4XEQ A;  3JV9 A;  4EQ7 A;  3SEU A;  4OMB A;  4NMY A;  1IXH A;  4YMA A;  5AA1 A;  2OWZ A;  1OQG A;  4YB5 A;  3SES A;  2V84 A;  1FBH A;  3H6T A;  4MNI A;  2I4B A;  3CRB A;  3HO7 A;  1YTV A;  3FV1 A;  2XXT A;  4PCD A;  3IB1 A;  2CZL A;  1A99 A;  1FTM A;  3H6U A;  1NNT A;  3MVY A;  4PAI A;  5H8F B;  3KJ7 A;  2QSX A;  1SBP A;  3T9H B;  1BK4 A;  3U8Q A;  2F6G A;  4KR5 A;  2ZXT A;  4C1T A;  1B3L A;  4IO5 A;  3S9L C;  4N8G A;  1DBZ A;  4OVP A;  1MXW A;  4L17 A;  2XXH A;  1SYH A;  3FUZ A;  5IM2 A;  3U93 A;  2GHB A;  3N94 A;  2ONS A;  3U1O A;  1DPP A;  4FEC A;  2XXQ A;  2WBD A;  2V3Q A;  3IOT A;  3C36 A;  5L8D A;  4NX1 A;  2P3N A;  3C31 A;  3KFM A;  3MW0 A;  2ZYK A;  4PFI A;  2KQZ A;  2UXA A;  4OVR A;  5KZT A;  4GWS A;  4MEV A;  4OWD A;  5H8Q B;  2Y7K A;  3MVW A;  4GX3 A;  1H45 A;  5I2K B;  5AA2 A;  1YYZ A;  4DXB A;  4OEN A;  4R2F A;  3SER A;  1IMD A;  3NOH A;  3RGY A;  1A55 A;  1LFH A;  1NV7 A;  2Y7I A;  4XFE A;  3KC1 A;  2OLB A;  4IO6 A;  3K6U A;  4GWZ A;  4PFB A;  3IL1 B;  2P1S A;  2XXI A;  1FTO A;  2Q88 A;  4GWW A;  3SDF A;  2I6E A;  3ISP A;  4GWX A;  4Q5T A;  2KLF A;  1MXZ A;  1ZU0 A;  1BIY A;  2RC9 A;  4PFR A;  5LTC A;  4RA1 A;  1XOC A;  5K2Y A;  2F34 A;  1M5F A;  2DOJ A;  1M5D A;  1KA0 A;  1NUX A;  4F3P A;  1EH3 A;  3TPA A;  1EYI A;  4HS7 A;  4DIG A;  4H5F A;  2DE2 A;  1MQD A;  1FPL A;  4LVQ A;  1URS A;  3G3J A;  4OTE A;  4LQ2 A; 
#chains in the Genus database with same CATH homology
 4KCD A;  3C32 A;  3VXC A;  3DM0 A;  2H9B A;  3C35 A;  4X9T A;  3K1N A;  3ONM A;  3KSJ A;  4AB5 A;  1OLC A;  4YKK A;  4ECF A;  3T22 A;  3HST A;  3UGW A;  3OEN A;  3CVG A;  4EQ9 A;  1MDP 1;  1SW4 A;  1JW5 A;  4IGR A;  1URD A;  4NF5 A;  3T9V A;  3IX1 A;  4RK2 A;  3PPQ A;  2I3V A;  1MPD A;  4EXK A;  3FXQ A;  4R9F A;  2ZMB A;  1FQB A;  1DOT A;  1WDN A;  4F19 A;  4RJZ A;  4TLL B;  2E1S A;  4G8N A;  4KYD A;  4KD5 A;  1LCF A;  3ODB A;  1B4H A;  3F11 A;  4OQO A;  3VV5 A;  3IAZ A;  4NF8 A;  2G29 A;  4IO2 A;  5CMK A;  3SEV A;  1IXG A;  1BKA A;  3DP4 A;  3ZKL A;  1P1O A;  1Y3P A;  4F3S A;  2DWA A;  1PC3 A;  3W15 C;  1SI0 A;  4TLM B;  1MQG A;  4I62 A;  2DYX A;  4RXL A;  4KYE A;  2FYI A;  1UTH B;  4ZE8 A;  2XXY A;  1MM6 A;  1A54 A;  4DE8 A;  1MQI A;  2H25 A;  4BDN A;  2HAV A;  1Z7M E;  3PMX A;  2O69 A;  1UIV A;  2Q8J A;  4OES A;  3QUJ A;  1TFD A;  2IEE A;  3ILU B;  4F1Y A;  5CBR A;  4G68 A;  3RQT A;  4GVO A;  3UA8 A;  3V89 B;  2QMX A;  4F3G A;  5ICT A;  4EUO A;  3TUS A;  3QIM A;  1Q1K A;  5AA4 A;  4YKJ A;  2PT2 A;  5I59 B;  5CMM A;  3MPL A;  3SET A;  3TTM A;  2DXR A;  1PBQ A;  2CMO A;  1II5 A;  1TFA A;  5TU0 A;  3IOU A;  2HZK A;  3HPI A;  2D21 A;  2YLN A;  3K00 A;  4F2O A;  4LON B;  4KHZ E;  4E0W A;  2PT1 A;  3TOD A;  1VR5 A;  4FE8 A;  1NKX A;  5TPA A;  2B65 A;  4Q0C A;  2UVG A;  2REG A;  1QUL A;  3TQW A;  4XXU A;  1EU8 A;  2Y7P A;  4ZE9 A;  1MXV A;  5DVJ A;  4F29 A;  1FQA A;  4GF8 A;  1RYX A;  1FTJ A;  1BP5 A;  4QFN A;  4OVJ A;  3FZV A;  2XD3 A;  5J1D A;  4QF9 A;  2Z8D A;  1D4N A;  4IO3 A;  1D9Y A;  3KJT A;  4FIM A;  3BFU A;  3LSF B;  5AA3 A;  3LSL A;  3PMV A;  1VFE A;  2O84 X;  3LSW A;  3EF7 A;  5H8H B;  1IXC A;  3ZKK A;  1UTB A;  1HSE A;  3JYR A;  5HM4 B;  3RNN A;  4OHN A;  4RNS A;  3R6U A;  1NFT A;  2P0S A;  3CSB A;  4ISU A;  4M4G A;  1OLA A;  5ITO A;  3H3G A;  2GH9 A;  3OMB A;  2NWJ A;  4MLV A;  4JWX A;  1PEB A;  2UVI A;  3N26 A;  4ZZE A;  3SEX A;  5BWJ A;  1RYO A;  3K6W A;  1JVY A;  3R26 A;  4QFP A;  4PET A;  4NTL A;  4C1U A;  1O63 A;  4FOR A;  3VVD A;  3RTW B;  5ITP A;  1OVT A;  1B7H A;  4QSD A;  1QUK A;  3PPN A;  5AA2 B;  3GLB A;  1IXI A;  1QKA A;  3MQ9 A;  1A40 A;  3CIJ A;  4JBZ A;  4LZ8 A;  3OEL A;  3RY3 A;  3LBS A;  3K6X A;  2XX7 A;  4E0X A;  1P1N A;  1PB9 A;  1URG A;  3MP1 A;  4GL0 A;  4DLD A;  3TCF A;  2QMW A;  5HPQ A;  3PPR A;  5JEI A;  2H4I A;  1ELJ A;  3E4R A;  3O66 A;  4POX A;  2I48 A;  1SDX A;  5I58 A;  5CMB A;  4XKR A;  3K2D A;  4H5G A;  1YCJ A;  3T9X B;  4ESW A;  3DP6 A;  3GXA A;  3KOT A;  1S50 A;  3OXN A;  2AL4 A;  4GQO A;  3TQL A;  2RC8 A;  3V5A A;  5CRY A;  3S9M C;  1JEU A;  2UYF A;  1OQH A;  4BDL A;  1SW5 A;  5L9O A;  5B7D A;  1JW1 A;  1Y20 A;  3OO7 A;  1PB7 A;  3MVX A;  3MJN A;  4FEB A;  3E9X A;  4R75 A;  3OO8 A;  2V25 A;  4NF5 B;  1DMB A;  5B70 A;  3C34 A;  1SVX B;  1IQ7 A;  2YPN A;  3C4M A;  3RT8 A;  3MVZ A;  1LB9 A;  1Y3N A;  2I58 A;  3KBR A;  3TTN A;  2XX9 A;  4F3B A;  1B4Z A;  1NNF A;  5I57 A;  4MFI A;  3EHU A;  4RY1 A;  3KEI A;  4EQB A;  1B05 A;  4LZ7 A;  2DQV A;  1JQF A;  4NF8 B;  4LP2 B;  3MC2 A;  4H0W A;  4H8I A;  1YAE A;  3S4U A;  5DVI A;  1GTK A;  3SEY A;  3O2A A;  4GWO A;  3RN8 A;  1PDA A;  4YKP A;  2ZYM A;  3BFT A;  3MZ1 A;  3GZG A;  1N7X A;  3N5L A;  4H65 A;  4KFQ A;  4WKM A;  3WAE A;  3M3K A;  2QS3 A;  1B51 A;  3PU5 A;  3U94 A;  1IIT A;  3B6W A;  3FJ7 A;  4N13 A;  5A5X A;  4LAT A;  4YMB A;  3O29 A;  3AXF A;  3G7W A;  5H8N A;  1CE2 A;  3D4G A;  4XKP A;  1N3X A;  3A3C A;  4O3C A;  5F7V A;  2HAU A;  5AA4 B;  4F2Q A;  2DVC A;  1ZBM A;  3IOV A;  5DTB A;  3O6I A;  2I4C A;  4X48 A;  2ZYO A;  1ZMG A;  2RC7 A;  5I56 A;  2O7I A;  1D9V A;  4POW A;  5KCJ A;  1XVY A;  5I84 A;  2R9J A;  1B7Z A;  4I9D A;  3ZSF A;  5CI5 A;  1PB8 A;  1OMP A;  1NNP A;  1OVB A;  4YU0 A;  4ELO A;  1CB6 A;  4KYS A;  2Y7W A;  4R6H A;  3TKD A;  2DE4 A;  2PX1 A;  2DP8 A;  1IZ1 A;  4I8C A;  3FVG A;  3CFL A;  3S9N C;  4F39 A;  4ZEK A;  1L5T A;  3UN6 A;  4F1U A;  1TXF A;  3GBA A;  4U2R A;  4DXU A;  1USY E;  1B5J A;  1MPB A;  2OWT A;  3CG3 A;  3H7M A;  4X1B A;  4H6D A;  3R7X A;  1JEV A;  3FAS A;  5L9M A;  1B52 A;  5TP9 A;  3FJM A;  4OER A;  4NF4 A;  2DWI A;  3P7I A;  3IJO B;  3TMG A;  1B1X A;  4YB7 A;  3IOW A;  1UIU A;  5BUU A;  2F6P A;  4LQ5 A;  3E3K A;  2Y84 A;  2O7U A;  5ISU A;  5HBC A;  4YZZ A;  2QS4 A;  3QSL A;  3N6T A;  1UTB B;  4BDR A;  1H44 A;  3T96 B;  5IAI A;  2Q89 A;  3THI A;  1B3G A;  2F5X A;  1FQF A;  2DXY A;  4XKQ A;  3IB2 A;  2O1M A;  3VDF A;  5AE4 A;  4F22 A;  3FAT A;  4KCC A;  1B7U A;  3TYH A;  2QS1 A;  3FVN A;  4TQU Q;  1MY1 A;  1B46 A;  4KPT A;  4TOZ A;  4OZ9 A;  4EDP A;  4Q30 B;  1N3W A;  2NXO A;  2I49 A;  1USY H;  1B3H A;  1FQE A;  1FTL A;  1BLF A;  3PUY E;  1YPN A;  3VVE A;  1B9J A;  1HSJ A;  4U4S A;  4QRZ A;  3MPK A;  4DCY A;  3EHT A;  3TDJ A;  2A5T A;  4UA8 A;  1R1N A;  2UVH A;  1LGB C;  4P0I A;  1BTJ A;  2Q2C A;  2GRV A;  3TAJ A;  3K0V A;  3LUY A;  2ZYN A;  4RK9 A;  1XHY A;  2E0S A;  1DTZ A;  1PBP A;  4YIC A;  3PPP A;  2R6G E;  3C9H A;  1M5C A;  3C33 A;  2O1L A;  3FXU A;  4ZEC A;  5ELV A;  3A09 A;  4THI A;  1B2H A;  5EHM A;  3O97 A;  1P99 A;  1Q35 A;  5H8Q A;  4OET A;  3RUM A;  5I58 B;  4PFW A;  1MY3 A;  4BLA A;  3K1M A;  5I2K A;  4FJP A;  3HCQ A;  1MH4 A;  1R9Q A;  2XXV A;  1OIB A;  1B32 A;  2VOZ A;  1SW2 A;  2A5S A;  2PMS A;  3T93 B;  1MY4 A;  4QHQ A;  2DWJ A;  1M5B A;  1Y1M A;  3TCG A;  2DVZ A;  3QAX A;  3CFX A;  2VD3 A;  2DS9 A;  2HFB A;  3OO6 A;  4BDQ A;  1B5I A;  2LAO A;  4AB6 A;  3FD3 A;  5CBS A;  1IIW A;  1AL3 A;  4Q8R A;  3HHG A;  5FTH A;  1P1Q A;  2XXU A;  3G3I A;  4PFU A;  4ELQ A;  1FQC A;  2ZNT A;  3TEP A;  1DSN A;  1NNK A;  4F1V A;  2HEU A;  1VSO A;  2F8D A;  3IO6 A;  3OD7 A;  2NUV A;  4PE5 B;  1JET A;  4PFT A;  1S9T A;  4JXI A;  1NL5 A;  2Q2A A;  1JW4 A;  1D3K A;  1P1U A;  1NH8 A;  4U1O A;  4U23 A;  1JVX A;  2QRY A;  3QYT A;  4JSO A;  1AH5 A;  1NMU A;  1TWY A;  3OEM A;  5KDT A;  3G3F A;  4ZS9 A;  1A8F A;  2ONK E;  4HW8 A;  4RYA A;  2PYY A;  1N7W A;  2ALU A;  4R72 A;  4K3F A;  1O64 A;  3QXM A;  1XC1 A;  1ZLQ A;  4PP0 A;  1T0K A;  3UP9 A;  1POY 1;  2OJT A;  5H8S A;  1IUD A;  4X1D A;  1ZJL A;  4JSD A;  5L9S A;  2XXX A;  3Q28 A;  5JK4 A;  2RF1 A;  3G3H A;  4IO7 A;  5A5X B;  3UK4 A;  2X7P A;  5H8N B;  5AA2 D;  3OSR A;  2VGQ A;  2REJ A;  3SEW A;  3FVO A;  1B0H A;  4FED A;  4G77 A;  5DEX A;  3OEK A;  2V3T A;  4BDO A;  2F35 A;  2XXP A;  2Y7R A;  3A3U A;  1B40 A;  1I69 A;  3Q29 A;  2ANJ A;  3TZA A;  3CI8 A;  5KCJ B;  1UTH A;  4GXA A;  1B3E A;  1SW1 A;  3PUX E;  3KGC A;  2AL5 A;  4O3B A;  3G3G A;  1XVX A;  3KG2 A;  1HSL A;  3IK6 B;  2F36 A;  3H6V A;  3O6H A;  3VLV A;  2XHD A;  5CM6 A;  3FVK A;  1I6B A;  3LC8 A;  2VHA A;  1NH7 A;  4GL8 A;  1MM7 A;  5TP9 B;  3VFJ A;  1MRP A;  1J1N A;  1LAG E;  3UIF A;  5I59 A;  3FV2 A;  2B3F A;  2OCU A;  1SD3 A;  3ILT B;  4ZED A;  4MBP A;  4OEV A;  5ICQ A;  3DP8 A;  1Y4C A;  2IA4 A;  2OWS A;  1QJM A;  5EHS A;  3I6V A;  2B3B A;  3FXR A;  1GGG A;  1I6Q A;  2W7Y A;  4NED A;  3EPE A;  3OOA A;  2QJE A;  5FHM A;  3PUV E;  1Y4T A;  1H76 A;  3EN3 A;  1RKM A;  3MWB A;  5LOM A;  2GFE A;  4OFL A;  4P0G A;  2DSF A;  3IB0 A;  1GV8 A;  3CR9 A;  2OZZ A;  1FTK A;  5JTY A;  4M1V A;  2V93 A;  5FHN A;  1GR2 A;  4LZ5 A;  1WOD A;  5DT6 A;  4DDD A;  3WAF A;  1WVJ A;  4WED A;  5CC2 A;  1B6H A;  2OK2 A;  3QUF A;  1ZTY A;  2O68 A;  5H8H A;  5CMC A;  4RPN A;  1B5H A;  1MXY A;  5K2X A;  1EZO A;  3VVF A;  3CFZ A;  4GRK A;  2A5T B;  2VP1 A;  1JNF A;  4FAJ A;  2V3U A;  3EHS A;  4U21 A;  1ZIU A;  1MDQ A;  4NF6 A;  1VE4 A;  1LST A;  1XT8 A;  3ECR A;  3FIR A;  1LLS A;  2I0C A;  5FTI A;  3PD9 A;  3K01 A;  4G68 B;  3M3F A;  4WXJ A;  3K4U A;  2P2A A;  1M5E A;  4G8M A;  1FW0 A;  1F9B A;  3BKI B;  1LFG A;  4FAT A;  3IJX B;  1LAX A;  4R73 A;  3PV0 E;  4IO4 A;  4IY6 A;  4H8J A;  2PBW A;  3SKP A;  3TFL A;  4OEU A;  3EQ1 A;  3PUW E;  1QVS A;  2THI A;  1Z7N E;  2Z23 A;  3MP6 A;  3MZ9 A;  1QKB A;  3E13 X;  4ELR A;  4QFO A;  1LB8 A;  4KI0 E;  1LCT A;  3PMW A;  3I3V A;  3V83 A;  3Q26 A;  4EF1 A;  4GD5 A;  4GOT A;  4HCY A;  5TPA B;  4UAC A;  2XD2 A;  1MQH A;  3H6W A;  2D3I A;  1GVC A;  3JZJ A;  4O3A A;  4C0R A;  2QPQ A;  4IB2 A;  2M8C A;  4P11 A;  4ZZA A;  3TEL A;  3LR1 A;  5DYH A;  3QK6 A;  3VLW A;  2DE3 A;  1ZKB A;  3S2V A;  2H98 A;  1H43 A;  1AMF A;  4ONY A;  4NWD A;  3O6G A;  3TTK A;  2F97 A;  1P1W A;  4G2Z A;  2F7C A;  1N84 A;  1KWH A;  4GXS B;  3B7D A;  3MAM A;  4JB7 A;  2D5W A;  2ZNS A;  3TTL A;  2RIN A;  5FHO A;  5I2N A;  1MXX A;  4N07 A;  4KQP A;  1B58 A;  2Q9T A;  5KDT B;  3MBP A;  3TCH A;  2I3W A;  1A7L A;  4QSC A;  4ND9 A;  4DZ1 A;  3TTR A;  2X26 A;  2HCA A;  3BBR A;  4MLQ A;  4H1X A;  4WEP A;  2XX8 A;  1AOV A;  3RLF E;  1US4 A;  2F78 A;  1S7Y A;  3KOS A;  2G93 A;  4XIG Q;  1I6A A;  4XKN A;  4BDM A;  2O6A A;  4G4P A;  3L6G A;  4JDF A;  1FQD A;  1US5 A;  1QW0 A;  4OXV A;  3DEL B;  2F7A A;  4GIZ A;  2PVU A;  5H8F A;  5DEX B;  4U1Z A;  2H99 A;  4I1D A;  3IO4 A;  4YB6 A;  2HZL A;  2RCA A;  2UVJ A;  4ZEB A;  3L6H A;  3H4Z A;  3B6T A;  2ESN A;  4NE4 A;  1MY2 A;  3W9V A;  5EYF A;  2ZNU A;  4PFY A;  4IGT A;  2AIX A;  1EZP A;  3G3K A;  3KN8 A;  4F18 A;  2Z22 A;  3VXB A;  1VFD A;  1N04 A;  3KN7 A;  1N76 A;  3ZS6 A;  4ZEF A;  1XS5 A;  1A8E A;  2ONR A;  3PPO A;  3M8U A;  3O28 A;  4YAH X;  3V8X B;  4G8H A;  1MH3 A;  2OBG A;  3MP8 A;  4QFL A;  4AQ4 A;  3CG1 A;  2I0B A;  1QUI A;  4Z7E A;  2Z8E A;  1Y9U A;  4R6K A;  2FNC A;  4F31 B;  3IOR A;  3K6V A;  4QFK A;  2QS2 A;  4U22 A;  4IY5 A;  3W9W A;  3KZG A;  3DLN A;  3UOR A;  3OO9 A;  4RPO A;  3B6Q A;  3LSX A;  5I57 B;  3KN3 A;  1ATG A;  3VE1 B;  2ABH A;  3O9P A;  1SI1 A;  1DPE A;  1H3D A;  4QSE A;  5JTY B;  2WKY A;  2R71 A;  5DVF A;  4U4X A;  5F1Q A;  4R6Y A;  1MPC A;  4Z0I A;  4ESX A;  2HXW A;  3S9E A;  1N0T A;  1Y1Z A;  1POT A;  4ELP A;  1MQJ A;  1LAF E;  4JWY A;  4MH5 A;  4YKI A;  4OFJ A;  5M2V A;  4GFR A;  4NF6 B;  1UQW A;  1AIV A;  3HV1 A;  3CSG A;  2NVU B;  3HN0 A;  3MZB A;  3KSX A;  1ANF A;  2DWH A;  2X7Q A;  1R9L A;  4GLI A;  3M3L A;  3USD A;  4DXC A;  3PUZ E;  2F7B A;  4ZDM A;  1B1H A;  2QL3 A;  2RKM A;  2GHA A;  4LUB A;  3D4C A;  3OSQ A;  4HCW A;  1O7T A;  2VD2 A;  5I56 B;  2UYE A;  4ZEI A;  1QUJ A;  3IR1 A;  4N6P A;  2O51 A;  3FJG A;  1B3F A;  4G68 C;  3PGF A;  4XTC Q;  3PD8 A;  1B0L A;  4OYV A;  4DCX A;  1Y3Q A;  1MXU A;  4OFO A;  3T9U A;  2H5Y A;  4JWO A;  1TT1 A;  2RCB A;  3T66 A;  3H06 B;  4H67 A;  3RPW A;  3Q27 A;  4HTG A;  1MG1 A;  2YJP A;  1IEJ A;  4NF4 B;  2XXW A;  3H03 A;  4PQJ A;  1R6Z A;  2AYS A;  4NWC A;  2BJJ X;  3U92 A;  4EF2 A;  1LBB A;  3RT6 B;  3FGS A;  1LBC A;  3Q25 A;  4R9G A;  3RTF B;  2NOO A;  3HHF A;  5I2N B;  3I5O A;  2XXR A;  3MUQ A;  3VLU A;  2HQ0 A;  3N6U A;  1SYI A;  3GBB A;  1LAH E;  1EZ9 A;  3K1P A;  4MF3 A;  1LFI A;  5IKB A;  3U72 A;  1MY0 A;  1FCK A;  4EXL A;  4R2B A;  3K02 A;  4LA9 A;  2FA7 A;  4R74 A;  2Z8F A;  1MS7 A;  1SQY A;  1DTG A;  3JV9 A;  4EQ7 A;  3SEU A;  4OMB A;  4NMY A;  1IXH A;  4YMA A;  5AA1 A;  1OQG A;  4YB5 A;  3SES A;  2V84 A;  3H6T A;  2I4B A;  3CRB A;  3HO7 A;  1YTV A;  3FV1 A;  2XXT A;  3IB1 A;  2CZL A;  1A99 A;  1FTM A;  3H6U A;  1NNT A;  3MVY A;  5H8F B;  3T9H B;  2QSX A;  1SBP A;  3KJ7 A;  3U8Q A;  2F6G A;  4KR5 A;  2ZXT A;  4C1T A;  1B3L A;  4IO5 A;  3S9L C;  1MXW A;  4L17 A;  2XXH A;  1SYH A;  3FUZ A;  3U93 A;  2GHB A;  3N94 A;  2ONS A;  3U1O A;  1DPP A;  4FEC A;  2XXQ A;  2V3Q A;  3IOT A;  3C36 A;  5L8D A;  3C31 A;  3KFM A;  3MW0 A;  2ZYK A;  2UXA A;  5KZT A;  4OWD A;  5H8Q B;  2Y7K A;  3MVW A;  1H45 A;  5I2K B;  5AA2 A;  4DXB A;  4OEN A;  4R2F A;  3SER A;  3RGY A;  1A55 A;  1LFH A;  2Y7I A;  2OLB A;  4IO6 A;  3K6U A;  3IL1 B;  2P1S A;  2XXI A;  1FTO A;  2Q88 A;  3SDF A;  2I6E A;  4Q5T A;  2KLF A;  1MXZ A;  1ZU0 A;  1BIY A;  2RC9 A;  4RA1 A;  1XOC A;  5K2Y A;  2F34 A;  1M5F A;  2DOJ A;  1M5D A;  4F3P A;  1EH3 A;  3TPA A;  4HS7 A;  4DIG A;  4H5F A;  2DE2 A;  1MQD A;  4LVQ A;  1URS A;  3G3J A;  4OTE A;  4LQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...