5DVKA

Fc design 7.7 b chain homodimer t366v/k409i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA01
5J3HC 3MFFB 4MHHI 3RA7H 4RFEB 3QQ4A 2Z93B 3KS0J 5H94A 4M1CD 1YC7A 3T0EC 3MV7B 3QEQE 4WWKD 4QKXB 5IHZB 2CK2A 4ZFFA 2Q8BL 3ARPA 1IGFH 4Z77B 3VI4E 3L7EA 1F5WA 4EXKA 1QLFA 1IGYA 4NKIH 1CICD 1KN2L 3SDCD 5DXWA 4EOWL 4EI5B 4IEFB 1INQB 5T33L 3QNZA 5LGJB 1DDHB 1ADQL 3MRQB 3IJYA 2Y06L 3T0ED 4R7NA 3VGHA 1EFXA 4UDUA 3DTXA 1TVBB 1MI5B 3INUH 3RL2B 1SJVA 1MFCL 1MJJB 3D0LA 2ZKHL 5BVPL 2GJ6E 1F4XH 4CU6A 4Z78A 4PGEB 2FJFB 1S7TB 4M93B 3ZKQD 1ITBB 3K8LA 2ZP0T 1JNHA 2APWA 3QQNA 4X8JB 1KLGA 1LDPH 1J0KA 3V6ZB 2E7CA 4LSTH 2AGJL 2RHEA 2IF7A 4HF5H 2CUIA 1LQSR 4FFWC 3FKUS 4PJCE 2CDFB 2ID5A 5B38A 5JHLL 4K3EL 2BNQD 1JK8A 3ALXA 3AXLB 3ARQA 2BC4A 3F7YA 5J11B 3TNNB 4RGMC 3SE9H 4OGYL 1FL5B 4YDIL 4EVNA 3WJLC 3BESR 1S3KH 2IQ9H 5DJ8A 1VFMA 4RSVA 3L5WA 4KQ3H 4FFWD 4YHOL 2FZ3A 2E9BA 3MA7A 3BO8A 3OKEA 4APQB 1N3NA 1OARL 2O61B 1INDH 1VFOA 3HZVB 1ITCA 1GPOL 4WFED 3F7QA 1CXEA 3PG2A 3GJEA 4AEIH 3IJHA 2BNRA 4S0SD 3O9WA 2F53B 3QXDB 1QO3A 3WUZA 4AMKH 3WIIL 1QP1A 4J3SA 4UTAH 1AR1C 1ULVA 4LLQB 4ZOCA 1FJ1B 4OM0H 3SE8L 1HOCA 2KL6A 4QXTB 4YFEA 5HGDA 4UIMB 1GGYA 3PE9A 4JY6B 5AAWA 3WHXA 4GBXD 5EUKB 4HS8L 4NWTH 1VENA 1NBQA 4H0IA 4WTZG 3WBDA 2HN7B 3OJMB 4XVSL 1SMAA 4HPOH 5HPOA 5IESL 1AR1D 1IC1A 2VWEC 3WHE0 4P5TB 3VGFA 4BFIA 2VSDA 3DO7A 3L3KB 4PGJA 2JIXD 3BVNA 3EGSB 5TDPA 1YN6B 4EI6A 4NFDA 3MNWB 3IAQA 5C0RL 1A7QH 4JRXA 1NUFA 1T83A 2JJSC 1RFDH 4K7FA 3FB6B 5J4MA 5FV1L 5D2NE 3UC0H 4L9LC 3P73B 5FK9A 1NDGA 4WWKB 3T09A 4JJ5A 2E9IA 5E2UH 5I1KH 4UV4L 3ECBA 5DEGB 5EBMB 1RIHH 2X1QA 5IGXH 2VN4A 2HA1A 1W8NA 3F5WB 2DN7A 4OKVA 4U1GC 4OD2B 4JN1L 5CCKL 4E41E 2D31B 1NC4A 3SDCB 4NO0A 3BQUC 3D3VB 4J3VA 5FOBB 1FNEA 4XZUA 4FFZH 5JOPE 3T0EB 1RIVL 2Q20A 1RULL 4PJGA 4U1NA 5DJYA 2GTWA 5BVJA 3NIFF 6FABH 4U1HA 4RBPK 1SJEA 2D0HA 3GI9L 3P11L 3WXWH 3R06A 1CD9B 2V9QA 4P9HL 4TNWK 3SDXE 2VLRD 2BRRL 1G7QB 3BQUD 1MFEH 2B1HL 3ET9F 3ULSA 3ABZA 5E94B 1ZT7B 2AV1A 1X5IA 4GRWE 5DJ2A 2A83B 3GMPA 5L88H 2Y6SC 4GG6E 2ZCLH 1I3UA 3F12A 4U6VL 4JDVB 2NW3A 2B5IC 3PABB 3T3PE 4QF1B 4BSWB 4LHQB 4QT5A 2VXVH 3T1WA 1I9RL 2BNQB 2YOCA 5E2VH 2DMKA 7FABL 4OZFA 4OLEA 1N59B 2J4WH 5IKCA 1J86A 3GBLA 4HJ0C 2Y6SD 4KZDL 1IC5L 5FB8A 2FO4A 3HUJA 3LVEA 1WBZB 1NGXB 4HPYL 1T03H 1FNLA 1CLYL 35C8L 4XP1H 1FO0A 4LDEB 3P9MA 1JZ7A 2VDMH 2Z31C 4M7LT 3TV3L 1KFAL 5KSVB 4WRLA 1CCZA 4RGMB 1DQML 4DGIH 1ZT1B 5AD0B 1XGYL 4KHXH 4HJ0D 2ADIA 5J8OA 1I3RA 1C5BH 5D7JA 1TXKA 4FQHB 1CZ8H 5DHVA 4TPRL 1YEEL 3QDHA 4JZNA 4PTTA 3UAJC 1ORQA 2G2RB 1NLDH 2Z31D 3SEPA 3HI5H 3TWCL 3GHEL 4Z7UE 1YYLL 1XIWC 3RIFK 2CLRB 1P9MC 3RIFF 4JFFA 5IMKB 5DR5H 1PKQA 2XWTB 5I1GH 3HZYA 4OM1L 3TIDA 4YR6B 3NTCL 3HZKA 1IAIH 5D1QA 1I9IH 1AQDB 4BQ6A 3BUTA 4YE4H 2JIXB 1WF5A 4GG8A 2P8PA 5DQ9A 1YA5A 4NHCH 5IB5A 2GFBA 1IGCH 3UAJD 1XFPA 1A7BA 1CD8A 1RMFH 2F8OA 3NN8B 4CN4A 1FIGL 5JA9A 3HI6H 3EYVA 4JB9L 5T1KA 1XIWD 1OQXA 1AHWC 5I1HH 4ORGB 2NPLX 1T7WA 1JGVH 1XR9A 4BELD 2GK2A 2M1KA 4NC0B 3QPXH 5FGCB 5ADOL 1NJ9B 4Z9KB 1FCCA 5C6TH 5F3BB 3I6GB 1HHJB 5KTEH 2H1PL 5C08E 2XA8H 1VB9A 2QLVB 1R3LA 5IR1B 4KUZH 2ADGA 4NQXA 3K1DA 4XXCA 5DDHB 3OAZK 4Z7OE 3S96A 2EYTA 5EBWA 5BZWA 4S2SB 5D71L 2ZUWA 2UV3A 3BRDA 3GGWA 2A77H 4Y4KA 1EK3A 4R90H 1N2RB 1UB5B 4U1GB 3X12B 4EDWL 15C8H 2AK1L 4L4VE 3U6RA 4TUOA 3MRIA 3BQUB 4Z5RB 1JE6A 1N0XL 1OHQA 3QZWG 4XPBL 4GMTH 3MACH 3TBYB 4XWGL 5EO9A 3IDGB 2JELL 2OMBA 1DZBA 5DJ0A 4AENB 3DIFB 4FA8A 5KVEL 4X7EC 3V5HB 4JPWH 3U7YH 1RZ7L 4UTBH 2R23B 1ZTXL 1G6VK 1PY9A 1WAAA 3X17A 4NJ9L 5DQDH 1WT5C 4NNYA 3MXWH 5FHBL 3LKSB 4XCYA 4A2LA 3BW9B 3BH8B 2CRZA 3QEQD 3SE3A 4N9GB 3LV3B 1I1CA 3DX9A 3FFCA 4J3XA 4YPJA 5BMFH 2BVQA 3PJSB 4FTVD 4Y16C 5DMGC 5ISZE 4L3EA 2I07A 4HBCL 1DBJL 1NGQH 4UB0H 2NW2B 2FR4B 2P45B 3MJ7A 3SY0B 4JPVH 4UUJA 2B5IB 3G6JB 3NCYS 1FPTH 2Q3AA 2DQCL 5SWZE 4CMHC 3Q1SL 2QR0B 4LBEB 5BV7C 1J8KA 4F9LA 4YXHL 4NYLA 4OIAA 3F7VA 1HEZA 1S9WA 3U4BH 1T7ZA 2E8YA 3IDIB 4GXVH 1ZSDB 3L3JB 4YUEL 3GNMH 2EC9T 3V7MA 4Y16D 3BWAB 1CD1A 2GJ6D 5DMGD 2ILLA 4X6BA 3GMQA 4LOUC 5JW5B 4E9LA 2NY3D 4JFYB 1WCQA 3HI1A 2E9WA 1A2YA 3HE7A 3AY4A 5C3TA 4Y2DC 3QG6B 5D70L 2ORBL 4PJIA 3S37L 4G3YH 5C09D 4Z0BH 1H3WM 5I8KL 4NFCA 5D7IF 2APXA 1AO7E 3RPIA 1P2CA 4R2GC 2MQ0A 2B1AH 1RUMH 3LPGA 3IFOB 2UZYB 3BT2H 3T8XA 3D2UA 5CEZH 1HXYB 1A1OB 2AV7B 5D7KE 3QQ3A 4LLDB 4LOUD 3JTTA 1MRDH 2GITA 3ZTNH 3BHBB 4YDKH 1WVZA 5EOTB 5GGVH 4JFQA 3KPNA 5CSBA 2GEEA 1N4XH 2H6PB 2ADJB 3LQZB 4ZFZB 1AGCB 5C0EB 3MLXH 1XR8A 2HLAA 3EHBC 4OCLC 4NQUA 4R2GD 4XNYH 1XIWB 5L2KA 2EKSB 2J8OA 1K4CB 3UCRA 4CMMA 2GSIA 5IMOA 3MLYH 5FUCE 4DZBA 1QSVA 1H3UA 3IDMA 5L2JB 3EO9H 1OWRM 1UJ3A 4YWGH 5JIIA 4KTEH 1NGWB 3O6LL 3EHBD 2UZIL 1B3JA 5MP6L 3NFNA 3HS0A 4HKZB 1AXSB 1AHWB 1BOGA 4G43B 4JG1L 2H2PC 3KYNA 3QWQB 1JNLH 1XZ0B 3UTPE 3VI3F 2BK8A 4Z0XA 4F7PB 1VDGA 5GS2D 5I1CH 1BFVH 3CH1B 4PJ5E 1ZGLP 4QXUH 2IC2A 5D7LA 5T1LA 1CDHA 3HPJA 2E8ZA 3DX7B 1EEZA 1Q72H 3GIZH 3B9VA 2P5EE 3L5IA 1T5XB 5ITFA 1EJOH 2OK0L 2A9NL 3CCHB 2H2PD 4MA7L 1I8LA 4LLWB 1CDIA 2G60H 2G75B 1TPXB 5HHQB 3CVHA 5T3ZE 3P4MB 4TQEL 3EO1A 4TRPL 4Y5VC 3WKNA 2NZIA 4K94H 3MRRA 1ZV5A 1JV5A 2QQKH 3K3QA 3S5LG 3QHTC 3T0WA 3MGOB 5DUML 2V9RA 1RUPL 1RZJC 3U48A 1QFWI 4GXUN 1I8MB 4NCC2 1ZHBA 4FTVB 5DURD 3MO1B 5JR1H 5HHPB 3TEUA 4E41D 3FO1B 3QPQC 1FV1B 4RGOL 3V2AR 5IROC 4ODVL 3IAGC 3MPCA 4NPYA 1KC5L 2VQ1B 4Y89A 5KBNC 2R9HD 4Q2ZA 4WEMB 2F58L 3QP3A 4X98A 4AEFA 4FRWA 2IGFL 3QHZL 1SYSA 3P30L 5I66A 3SPVA 4PLKC 3P0GB 2ZCKH 3G5XB 4Y16B 1OT2A 1MCLA 4RMSA 2XA3A 5IT2H 3HRPA 3E3QC 4S10A 2Q7NA 3CX5K 3QPQD 4R6UA 4CMHB 5BV7B 4PYHA 2VMFA 5C09B 4ONOA 4HG4J 4XH2B 4K3JL 2N4IA 5FYKU 3VRIB 4QRPA 4YDJB 5SWSE 4PJDA 1XGPA 4X6CB 3NIFE 5F44A 1X5FA 1HHKA 5EOCH 1R0AH 1CF8H 5ID1A 1I1RA 2IANA 4PLKD 1IGML 4U0RC 1BLNA 1JPFA 4U7KA 3F8UB 4LSSH 4HMCA 2FJGA 4GMSH 3O2DL 4I48A 3NCFB 5IQ7L 1TZIA 2YSSB 3EYFA 1MVFA 4PJCB 3WFEH 4OFKA 2EZ0C 4OZGF 4Y2DB 1G7JA 4NKOA 5CEYA 4QLRA 5H37H 1QBML 5BS0A 2W0FA 1LEKB 5GRXG 2VUYA 4MAUH 4R2GB 3VXPA 4M6ML 1D5IL 3MBEA 2XWJA 3IETA 2EDLA 1NAKH 3HNSL 4MQXC 1VEPA 4JZOA 1JWUA 2V7NB 4XP9H 3I02A 2P44B 4PJ8C 4F7CB 5ESVA 2EZ0D 1QTYT 4U7MA 4JG0H 1V7NH 3ZYJA 3KYKH 4D9RE 3KWWA 4XPAH 5IB4A 1FFOA 1P7KA 3PIQA 5ECJE 3QUXA 4JQXC 4ZPTA 1ZA6A 2AJXL 3OF6A 4MQXD 1KJMB 2DJSA 2A6IA 4KDVA 1EVUA 3UBXG 3TNMA 3NGBC 2HKFH 2VDOL 1PYWA 2FH6A 2VXSH 1U95B 4KDTC 4NQCA 4P2QA 2OX5A 5I8EA 4ZFGH 1F90H 3V0WL 1NSNL 4EUPA 2Z8RA 3MOAH 4O5LH 3X11A 1N7MH 3QNXA 1G7PA 2XIDA 2YK1H 3WFHA 5EPMA 3TT1L 3GRWA 5E8PA 3C2SA 3X3FL 2VERN 1FZKA 4KWUA 1T3FB 4PRHA 1IC7L 1GYAA 3TT3H 5F7NC 5IW1B 4JE4B 3DXAE 3AS2A 3PL6D 2D03L 3THMH 5FDWA 5FUZL 1FP5A 3O2WL 2PTVA 5DURB 1UC6A 3BXNB 4JDTL 2DIAA 2H32B 4E41B 2WWKT 1PG7H 3QULA 4Y5VB 5C08D 1I7ZA 2B7DT 4Q9QH 4K3DH 5ACZA 1M05A 2P5WE 4L8BB 3FRUB 4ZNCD 5HYJA 4WWID 2D0GA 1Z0NA 5D1XC 4RWYL 1NMAH 2QQLL 1MCCA 5E2TH 5TFSL 1IGTB 1B2WL 1Q9WA 1XCTB 1T5WB 2ICCA 1A9BB 4EJ1C 4QRRB 3V52H 5GGTL 1N8ZB 5JPMA 1UFUA 4L4VD 4P4KA 1FNSL 1LK3L 3RGHA 1A6AB 5M7QA 4RFNC 1TCMA 4M43H 3CC5A 3EZJB 1V7MH 4ZAKC 4X5WA 1G6RA 1EJ6A 5J57B 3CFEB 4AEHL 2Z4QB 1XCQB 5D1XD 3MNVA 3UTTE 2ESVD 1MNUL 3E6FB 5DJXA 2VTFA 5IMLB 1YJDC 2MOVA 2NR6C 4UILL 4F8QA 1FHGA 3W11D 3HC0A 4F2MB 5KOVC 2Q86A 2R1WA 1SY6L 4JVPA 3FQTB 5JNYB 4UT6H 4DZ8A 4GLRI 3EOYG 4JQIL 4PGCA 3G5YB 1IGIH 1T1WA 3GSXA 4ZAKD 2FB4H 3QCVH 1CDGA 4JPIA 4AZ8A 4N8VB 4WJ5A 2BSTA 2Z91A 3PHOB 4H8WH 4F9PA 5ISZD 2E5EA 1U8PB 1MAMH 3VU2A 4MS8D 4U0RB 4FXKA 2VXQH 2NR6D 1T0MA 4O2FB 1MLBA 2ZOKA 3CUPB 5HVGB 1G7HA 1N64H 1I7TB 2A38A 5SWZD 4RAVB 4I9WE 2IQAA 1ZGLM 1NCWL 1FORL 1ADQA 5EU6B 1I4FA 1FYTE 3FB7A 4OZFH 4QTIL 5C6PB 2HT2C 3TBVA 3DVNB 3ARSA 3U0WH 1NCTA 3NFPA 4PG2C 1LD9B 3HFMH 2JE8A 3KXFA 1RZ8B 3GSRA 2I27N 4HIJA 4PB9L 1UQSA 3HE6C 2X1OA 3VMNA 3GO1H 5FYLL 3MR9B 2FL5B 4FQCH 4M1GL 5HGBB 4KVNL 5JXAL 4PJ8B 5GGUB 5DMKB 1MIEH 4J3OC 1I1FA 1AO7D 3NIDF 4KJYB 3DHMA 2ZUVA 3G6AA 3VCLA 2EEBA 2ZJSH 2HT2D 1CN4A 4PPTA 4QRTB 3JXAA 4J6RL 1AKJD 5DZNA 3RIAK 3MROA 2BCKB 5D7KD 1SYVB 1FAKT 4XC1H 3HE6D 3OXSB 3LQAC 5DHVH 5JUEL 3SDAA 4OD3L 5D7IE 4P2RE 3JV4A 2D9QB 2VH5L 2VAJA 3MLUL 5JW4N 5DEFA 1UWEH 3NGBB 3LD8C 2AJYL 1CQKA 3O4LB 1QEWB 5F1SA 3FONA 3FCTA 4I77H 4QRQA 4QRUA 4ENEC 5C0JA 2APVA 1AC0A 1RK1B 4HUMB 4NC1C 4C83A 3O2VH 1T20B 2QQNH 4FHBD 4PR5B 5DJCB 3DVGB 2GCYA 4KXZH 4H25B 3L6FA 3QDGA 5D6DC 2EIBA 5C08B 1J8HB 2FX7H 3VXNB 2CR3A 1MQKH 4FQPA 2MCPL 4B0MM 3WYRA 4E42A 3DRQB 4L4TA 3IDJB 3TA3C 4ENED 3D25B 1M71A 5DD6B 4RMRA 2PCPB 3D85D 3E1F1 1KNOB 3UTPD 4JO4H 4PJ5D 4X7SL 3VH8G 2FNBA 1YPZE 4L4VB 1QLRA 1BQHG 3D5OF 4WUKH 3NCCB 3C5JB 3C08H 4ZXBA 4WHTB 4XHJC 4BFBD 1GZQB 3KAAA 3NIGE 2WMPA 5DJZB 5IEHA 2E6PA 5D1XB 3TA3D 3H3BC 2ESVB 2XTJE 2YPVL 1SEQH 3SGEH 3VI3E 3C6LC 2R0ZL 4WENB 2FYYB 5T3ZD 2OJZL 1JPST 2VN7A 3L3OB 4F33B 2AXFA 2VLLB 5A43C 4K7PL 1BBDL 4JLRB 4RFNB 4QHMA 4ZAKB 1F2XK 2EE6A 2B4CL 4XHJD 2QADD 4PD4K 5L9DL 4ZTOH 4EQ3A 5BZDA 4MNQA 3GI8H 1UCBL 5BW7A 4M7KL 5K9QG 5E08H 1NEZG 3QFDB 5C0CE 2F19H 4J4PA 2V5MA 1W0VB 1VFAB 3C6LD 1Z9MA 1CFVH 3RVUC 3GM0A 3Q5OA 1GGTA 3VFNA 4GSDL 3O3AB 3O6KL 4XCCL 3R8BB 5F7DA 2WIIB 3RY6C 3C5ZC 1BIIA 5GISL 2F15A 4XCNA 3RWHB 1NEUA 2AI0L 2V7HA 1A4JB 4OLYH 1R5WA 2R1XA 2DJ4A 3RVUD 5IB2A 2ZNXA 5BOPA 1NMBH 4ZUVB 3IFNH 1JYVA 1H3GA 4PJ9C 1NBVL 1IEAB 3HR5A 4PTUB 2QEJA 5SX4H 4OAWA 3WO4C 5FKPA 1ZANH 4LARH 5EORL 3P4OA 3C5ZD 4DW2H 4F37K 3CK0H 4JAMB 1JHLL 2DIJA 1R3HB 4F37F 4ZUUA 2BVOB 4DN3H 1AKJB 4G8FA 1E4KA 4N90E 4IM8A 2Y07H 3GMOB 1NANH 5HGGS 1WBXB 3HE6B 3TZVA 3H3KA 1BFOA 5IEKB 4QYOB 2O26U 2W91A 3MRLA 4XAWL 1CTNA 2X4SB 2X44D 4UIKL 3K74B 4MD0B 3CFBB 4UV7L 1MHHB 5F9AC 4M5YL 3H3PL 5K9OB 1AH1A 1EPFA 4JHBA 3DBXB 1IEHA 1FL3B 4OZGE 5BQ7A 1UXSA 4F57L 5IFJA 4X4YB 2N56A 2X42A 4D9RD 1KPUA 4OIBA 5CHNA 3BJLA 5L6YH 3LD8B 2FIKB 2RB8A 5A16A 1MJ7L 4HUVB 4MHHG 1E4XH 3D85B 4MQSB 1A14H 1KIPA 1JPTL 1MLCB 3OG4B 1FN4B 1X4YA 2FGWH 4B41A 1WEJH 5JO5B 2DKSA 1I85A 4PJ5B 3HG1A 3UO1L 3VFUB 3MUJA 5LJYH 3CPLB 3MRHA 4YK4C 3BPNB 1MCKA 5E99L 1WTGT 1I1AA 3MRCB 1HIML 2XZQH 5DVKA 2ZSVA 3ZO0A 3QI9C 5CBAB 4NO3A 5IHBA 4EDXB 3MOBH 3TA3B 2QSTA 5I8CA 3G04A 3CFCL 5D93C 1DFBH 3QEUA 5D1ZA 2JTDA 3LZFL 2NXYB 4Y88A 4P5MB 3WE6B 1Z5LA 4NQVB 2CO6B 1IM9D 3L7FB 5IFHH 3D69A 3L5XH 1ZWIB 2P7TB 4PJAA 5ENWB 1UEYA 1BM3H 4GAJL 4KTDL 3MBXL 1E6OH 3QI9D 4XMPH 5JZ7C 25C8H 4R4FH 3JWOH 2B0SH 4KAQH 3V4VH 4PV9A 3MZTA 2ARJB 3CVHH 1S9XB 4O2EA 5F93C 1LO0H 4HGWB 1TJGH 3MNZB 5ICYB 5FCUH 3CDCA 1AC6A 5LBSL 4MJIE 4FFVC 5TGBA 5EN2A 5JMRA 3VG0L 5TF1H 3U9PL 4OCWH 5T3XE 5D5MA 1X5JA 3WL9B 1J1PL 2NQCA 1OAXH 1IBGH 4X0KA 2YN3A 2YC1B 1FNGB 1NL0H 2ZPKH 5CMAB 4ZNEE 4WTXA 4R4BB 3VXSA 4WDIB 2JJTA 3FQWA 3S3JA 1H0DA 3HNVL 1KCUL 1J1XH 8FABA 2PYEE 2P1YA 2J8UF 2IFFH 4FFVD 3CMOL 2C7UA 4LAQH 1T1XB 1ZE3C 1P1ZA 3V8CA 3PP3H 3O6FA 2IG2H 3RNKA 3C5ZB 2BSSB 1EFXD 2EEAA 1EO8L 3U79A 3ZE2E 1WBYB 1N6QH 1KELH 2KBGA 1IEBB 2LABA 1YNTA 4LFHG 2C3VA 2HJLA 5KW9L 5GRWA 4MD4A 4I4WB 1UM4L 3BZ4A 2X1XR 4PJ9B 5CD5C 1AD9A 1JPSL 1U8NB 4KPHH 3TLRA 3MTRA 4OFYD 3WO4B 2GJZA 4JKPH 3LEVH 4LIQH 3HR6A 4WTZA 3CSYB 4FQLH 4OQ1A 5KVFH 5H35B 4NJAL 4P3DB 1U93B 2OXHA 1GHFH 1X5LA 1C12B 3QFJA 4PBVC 4I9WD 3LIZH 2X4OB 1CD0A 1AGFA 4WFHE 5CD5D 3BZEA 1FYTD 5A2IH 1MQ8A 3WS3B 4O9HH 5BV7L 2R1YA 1A5FL 1KJ2L 1CDYA 2EDNA 3OAUL 4MA3A 2VDQL 1SVZA 3QJHA 2RJMA 5I2IB 3UROR 4LKXB 4OIIL 1CGSL 4JDZA 3IFPB 1UZ6F 2DWDA 3TN0C 1A22B 3CH8A 4IRSC 3MJ8B 2XXCB 3QH3B 2FD6H 2XZCH 1EERB 3MC0A 4XT1C 4DKFH 3QXAA 3MCLL 2FBJH 4U33A 5DO2C 4M8QA 5IFAL 4UINH 4JFXA 5CILH 1GGCL 1MHEB 3VFTA 5I1IL 1YEKH 2DKMA 2AK4A 5CEXB 3TN0D 1Q0YL 4IRSD 5ANMB 3MGTB 4N0YH 2W60B 3NIDE 1WSST 2Y36H 3GB7A 2A6DB 4U2ZA 2HT4C 5DHYA 1IM9B 4HQQL 4LLVA 5KG9A 3CXHK 3VXRD 4YK4B 1Q9OA 1TQBC 3C60A 5HJ3B 5DO2D 5C6WH 1BWWA 1ZT4A 4AL8H 3U82B 4EUPH 5CIPA 43CAB 4DTGH 3QI9B 3A6CH 4Q6IA 1D5BB 1GGBL 2JLLA 5EZLB 4BSVA 2ICEA 5HGAB 1A7PH 5D93B 5MEQB 3NCEB 1ORSB 4L1HA 5A40E 4H88H 4PJEF 3ARVA 1MCHA 1UKSA 1A3RH 4X99B 1OT1A 3ETBF 4JVUA 2ADFH 1RZFL 2A6KB 1CFBA 1CDBA 3S35X 2HT4D 5I76A 1KEGH 1LO2L 4F7TA 4DUWA 2AABL 1X5GA 3QQ4B 2JJWA 2DQHL 4I3SL 4LMQI 2SEBA 4FQIH 1NLBL 4ZFFB 1E6JH 2E7BA 3U46A 1S9YA 4X6EA 4AM0B 1JZ3A 2OR9H 4NM8L 1U2HA 3L7EB 3H8NA 5HYIA 5I30H 1CLOL 1WFOA 4HHAB 4DAGH 2XQYG 2XRAL 5IIEB 3D39D 3IJYB 4MB5A 1EAPA 2DQTL 1RHHA 1I8KA 2CR6A 1D6VH 1EFXB 4NBXB 4UDUB 3QCUH 2DLFH 3QA3A 4UT9L 4H8WC 3D0LB 2A73B 1S7WA 4IDLA 4LSDA 1R5VA 3RVWC 1OTSC 4OSUL 1I9JH 4Z78B 3QIWD 4JZJA 3G5VB 4FP8H 1ACYL 3ARFC 3BRGC 2MQCA 4R7DA 2CK0L 1NFIA 3DLQR 3LN5B 3HNTH 4JFEE 3O41B 3TBWA 3UJIL 4LHJB 2EDOA 1MAJA 4D0CA 3T4AA 3BEVA 3MV9E 3B9KC 1KLGB 2YA1A 3BKJH 4OZIA 1CFNA 2HJFA 1WZ1H 1MJ8H 3RX5A 1IM3A 4YBQC 3RVWD 1OTSD 5IWLC 1JYNA 1HQRB 4JO2L 5IVXA 3ARFD 4J23A 3VRJB 1U8LA 1IAII 5KSUB 2Q8BH 1ED3B 1J5OL 1QSEA 3OJDA 4NRZB 1JK8B 3QIBC 3BP7A 1FG2B 4ZTPL 2BC4B 3B9KD 1JF6A 7CGTA 3S34L 4FQJH 2NMSA 4EVNB 1NGYA 1KN2H 3O8XC 2NY0C 4GH7B 3TYGL 4ISVA 2OXGA 2ZOLB 1HKLL 3O45A 3FB5A 5GSVA 1WUNT 1F4AA 5T33H 2WP3T 5DJ8B 2O5ZL 3WN5C 2PW1B 1ADQH 1JRHH 1ZVSA 3CX5J 4U6HA 4D9QD 2FZ3B 3H6JA 1EZVX 1N3NB 3MFFA 1YEIH 2YD3A 1MFCH 5KANI 3RWEB 3QIBD 3MV7A 2CUHA 2CKBB 5IHZA 3G08B 3IDYC 4L3CA 2EECA 1QO3B 3O8XD 2NY0D 3TN0B 4Z77A 5LG1A 3O2DA 3BE1L 4IRSB 4X83A 5D4QA 4MJ5B 1JYXA 4J2XA 1HOCB 4GO6B 5AZEL 2HKHH 3MXVL 1INQA 3VXRB 5LGJA 3KLSA 1DDHA 3MRQA 5J1TC 4N0UA 2AGJH 1MPAH 4XAKE 3FJTA 1TVBA 3LH2L 2JCCB 1MI5A 3WHE1 3RL2A 1KJ3L 1MJJA 1QUNA 5F9OL 1DQLL 2OZ4L 3UTSE 5JHLH 2WNGA 4K3EH 4PGEA 5E8EA 1QACA 1S7TA 3C8KB 5ERWB 3DO7B 1I75A 3BVNB 2VITB 3GSWB 4OGYH 4R96A 4YDIH 1X5KA 2OL3B 4KK8C 4EI6B 1KPRB 1TQBB 5DVOA 5IBUB 4X8JA 4YHML 2NX5D 1CE1L 4NO2A 3RWCA 3V6ZA 1OAUL 4JJ5B 1H15A 5D2LF 1OARH 5FUOH 4HWNA 4WI8A 1NQBA 1MRFL 5GXBB 1GPOH 1YPZB 3VWJA 1GCFA 3MA9L 3ULUF 4TOYL 4XPTL 1WZLA 3LSOB 3QWRD 1IZKA 4NO0B 1A02N 4KK8D 1FNEB 3AXLA 5GGRY 1ZMYA 2YZ1A 4YC2C 3TNNA 3D39B 1BPVA 5EOQL 3SE8H 2BP3A 3KPSD 1E4WH 5DJYB 2EDWA 5F7MC 1QVOB 2PR4L 4HS8H 1SJEB 2EXYD 2Q8AL 1KXQE 1K3IA 4APQA 2O61A 3FN0H 3HZVA 4XVSH 5IESH 3SE3C 1DBAH 3VJ6A 1GOHA 3O3UN 2RQ8A 3HAEG 2AV1B 2F53A 3UMTA 4CN6A 3QXDA 4IMKA 3OX8A 4YFDB 2RIKA 4IRZL 5JXED 4LLQA 1FJ1A 1PD6A 4PJFF 5EIIA 2AKRB 2VXTL 5C0RH 4G6FD 3F12B 3IYLW 2NW3B 5IV2A 4UIMA 3ARFB 4RAUB 4JY6A 4HCRL 2CKNA 5EUKA 2EDXA 2AJ3B 5T3XD 4UV4H 5GGSB 3FL7A 3STBA 2ZCHL 4JY5L 5ESQB 4LCUB 3FFCD 2HN7A 3B9KB 5CCKH 4JN1H 4Z7WA 2F54E 4L3ED 4WU7B 1V3MA 4P5TA 3OGCA 2PYED 1PVHA 5F7FA 3L3KA 3E6HA 3EGSA 1YN6A 3IGAA 2ERJC 1RIVH 3MNWA 1RULH 4OCRH 1FO0B 3FB6A 3QIBB 5MENE 4FQ1L 2FECI 5D96C 5I1LA 3P73A 1JMZA 5IQ9B 4WWKA 3GI9H 3P11H 5DVNA 5EBMA 1G7MB 5FKAA 2J7LA 2VZVA 3O8XB 4P9HH 1F3DJ 3O3BA 2J8UE 2NY0B 1ZVYA 1SY6A 4ALAL 2BRRH 1BZ7B 1MRCL 1YJDL 2CJUL 3F5WA 1EXUB 4F58L 3WN5B 2D31A 3QDMD 2DL9A 1CICA 2PKDA 3SDCA 5DHVB 1JP5A 1HI6A 1UVQA 4JZNB 5F7WC 3CDGB 4PTTB 1ORQB 4WEUD 3TC9A 3T0EA 2C4FU 4MQ7A 4U6VH 2VIRA 4JFFB 2R39A 4S1QH 1J05A 4OZGB 4I0KA 3FB8B 3HZYB 3IB4A 3D6GA 4WFHD 1W72B 2VLMD 1I9RH 2YD4A 2Z35A 4PRPE 3OR7B 3MRGB 7FABH 5FO8A 2P8PB 1G7QA 2W9LA 3S5LA 3QUML 1RUAL 5IB5B 5E8NA 2P8LB 3LHPL 4XVUD 3UYRL 3UZQA 2R8SL 2NCMA 2NX5B 1OSZA 3EYVB 1C1EL 1JPGB 4NO5B 4Q0XL 5T1KB 4KZDH 4Y4HC 3TBSB 4ZG1A 4G8EA 4OB5L 4HPYH 2R4SL 4S1RL 1QKZL 2DQIL 35C8H 1XR9B 5DZLA 5EU3B 1F8TL 3RNQB 3V6FB 4JDVA 1X5AA 5CKAA 1NUNB 3PABA 3VD9A 2VDPL 1X5YA 3IVKB 3ZL4L 3TV3H 4M7ZC 1KFAH 3T2OA 1DQMH 4MXWL 2GHWB 1R3LB 1XGYH 2BNQA 1J1OL 1UZ6E 2ADGB 3WO3B 4M03A 3HUJF 4Y4HD 1X4XA 3I3EA 1GAFL 3F7RA 5T1MB 2VLJE 1I8LC 3KPSB 5EBWB 1LNUA 1YEEH 3OTTA 3GGWB 1WBZA 1FC2D 3LQAL 1NGXA 2LU3A 1FL6B 3TWCH 4NT6A 1F4WL 3U6RB 5I1JL 4M48L 2Z8VC 1G0DA 4OM1H 4H5SA 4YHKH 4BH8A 1S7QA 4KH2A 4YC2B 3NTCH 5DJ0B 5FA3B 3WIFB 1ZA3A 4KC3B 2W07A 1ZT1A 5AD0A 1CFQA 2DI9A 2VR5A 4XB8A 1OGAE 1VGKB 4Y8DC 2DYPA 4LGSB 4G6FB 4LASL 4CN1A 1FIGH 4NNYB 3LKQB 4JB9H 4XCYB 4PRNB 5JW3L 3AGVA 3LN9A 5CEZE 3KR3L 2VZTA 4GBXA 4K71C 4GAYA 2XZAH 3FFCB 4NZTL 4PJEE 4NQEE 2CLRA 5JW4R 2M2DA 5ADOH 3PDGA 2Z8SA 4NFBA 2XWTA 1L6ZA 4ZDHA 5MI0C 4G6KL 4L3EB 2H1PH 3K8KA 4YR6A 5T3ZL 3VFRB 1MCWM 3MJ7B 3A67H 2JIXA 5CJQL 3EZ8A 5HSFA 1RVFL 2OTWB 4L8CA 3ME0A 2OM5A 2VDNL 3F7VB 4FQXD 5D71H 4KHTH 4LLYB 4EEEA 5KJRL 5IBLC 1UM6L 1CD1B 3B3IB 4EDWH 1CGXA 2AK1H 2YD6A 3GMQB 1HCVA 2Y1VA 1K2DB 1FZOA 3DI2B 2W9EL 1N0XH 4XPBH 5E4EC 5F1NB 3UBXA 5F3BA 3I6GA 3BRFA 1HHJA 1O0VA 4XWGH 1JZ8A 3QDMB 2DTML 1ZHNA 2JELH 3UZVB 4JFED 1YY8B 3OHXA 4PJIB 4DK3A 1JWSB 2ERJB 3JV6B 2NY4C 2X1WL 2DLEA 2JJSA 4PD4J 1RZ7H 1ZTXH 5D96B 4L9LA 4NJ9H 3ZLQC 3S3SA 5FHBH 5IBLD 3BIBX 3T8XB 1QR1B 3PXJA 3UJTL 2GITB 1IKFL 1N2RA 1UB5A 3PWJB 3KPNB 3LN4A 5HDLA 4X9BA 2VLRA 2YZ8A 1X4ZA 1BZ9A 1XGQB 4BH7B 3BQUA 3JUZA 3WNPA 2NY4D 5JORB 3TBYA 1UA6L 3IDGA 4HBCH 4AENA 3NCMA 4XBEL 3DIFA 4BK4A 5DRWA 5L2KB 5T1DL 4KMLB 5BJTB 3Q1SH 4XI5C 2R23A 3WUWB 3N1MC 4M7JL 4YXHH 4QWWC 1YNKL 2VISB 4CMMB 2PO6C 5DD0L 5IMOB 3RWDA 3UDWC 3BW9A 1Z9SA 1QRKA 3BH8A 3ULVC 4OZHF 2XI9A 4YUEH 1DUZB 1OAZH 1OPGL 4FFYL 3LV3A 1OLZA 5DFVC 1OAQL 2H26B 4PUBL 4Q97A 4Y4HB 3SBWC 5I9QC 4DQOL 2CH8A 2VXUL 3IJSA 1A0QH 3KYNB 4G5ZL 5D70H 3S37H 1EO7A 4XI5D 2NW2A 2FR4A 5I8KH 3SY0A 3P0VL 4QWWD 2PO6D 5ETUB 3G6JA 4GAFB 3FHQA 2FDBP 4LBEA 2QR0A 4M7ZB 3ULVD 2UY7A 1RZKL 5DS8B 2BOBB 5F1OB 2WM0A 1T2QL 3U2SA 1OB1B 5DFVD 4EKXA 1ZSDA 3L3JA 3V0AC 3I2CL 3STLB 3BWAA 1YECL 4JFYA 5HHME 2RCSL 2I60L 1K8DB 4R8WL 2YEZB 4P57A 1NCAL 1CL7L 3MRRB 5GJTL 3BPCA 5CIPH 4PP2A 3GIVB 4WW2F 4WHDA 2Z31A 5E8OB 5KS9F 1P4IL 2EEDA 2MMXA 3JZ7A 1CBVL 1HXYA 3B9DA 2AV7A 4LLDA 3RKDD 4CVXB 3BHBA 4ELKB 5EOTA 1Q9KA 2UZIH 1P7QA 5MP6H 3OKYA 1Q8MA 2H6PA 3BD5A 2DM2A 4LCYB 3LQZA 2MCG1 4ZFZA 4P2OC 2VQUA 4Z6AT 3VDAA 4K71B 1HILB 4Q2ZB 5D2LE 4X98B 3EDKA 1G1CA 1XIWA 3KDMB 5LAXB 3MLRL 4JHAL 1P9MA 1K4CA 3F58L 3SPVB 3MRFB 1ACZA 5MI0B 3DURA 5CZXC 2LE9A 5AUMB 2YPKA 3ULUE 1JFQL 2MQ3A 4D3CL 1CG9A 2BVYA 3MYJA 3RL1B 4FZEL 3SKJL 5L2JA 1M7IB 1NGWA 4P2OD 2OK0H 2A9NH 5EWIL 3VGGA 1VEOA 4MA7H 4MA8L 1MELA 4M1DL 2QSQA 2R15A 1ZLUH 4HKZA 1AXSA 2VZOA 4TQEH 4TRPH 3SHSA 5ID1B 1JGLL 2IANB 3PWLB 5CZXD 2DQFB 4H0GA 1XZ0A 3WNMA 4F7PA 5DUMH 3EYFB 1RUPH 2DBLL 4O00A 3DX7A 3RBGA 1KBGH 2NY4B 5DUPL 1XGRA 5BS0B 4PJFE 3IS0X 1T5XA 2F54D 3VXPB 4X80H 2XWJB 3CCHA 4RGOH 1EMTL 2YWYA 4LLWA 4LK4A 2ITCB 4ODVH 2AEPL 3G6DL 3T1FB 2G75A 4YHZL 5HHQA 3VXTA 1MH5B 1QLEH 3KPPA 2F58H 1PEWA 3I02B 1P4LA 2IGFH 4KXZI 3QHZH 3QR2A 1LILA 5ESVB 3BKML 1JI2A 3MYZA 4I13B 5MEND 1AXTH 3QEQA 1MAKA 1HDMB 1N5AB 2GJJA 2X4TB 2GKIA 1S7UA 1I8MA 3ZDXF 3MO1A 4W4OC 1MCNA 2VZ3A 1L7IL 1BEYL 1A7NL 1MOEA 4OI7A 4JANB 4K3JH 5J1AA 2A6IB 2PO6B 2VQ1A 4XNQA 5MEOA 1IGMH 1PYWB 1NUGA 2HVKA 1XH3A 5IQ7H 1JVKA 4Y16A 2GJ6A 4GT7A 5I9QB 5I8EB 2VR9A 1NFDF 3CGTA 4QOKE 3SGEI 3U1SL 3X11B 3QNXB 1QRNE 3WFCL 1G7PB 1FRGL 3WFHB 3DYOA 1JHKL 4PRPD 4PJDF 3H9SE 1QBMH 4EZMA 5E9DE 4BKLB 4M6MH 1D5IH 3VRIA 3OKKB 5J13C 1S8DB 1SBSL 4KU1A 5C07E 3HNSH 2W65B 4RNRA 2CKBL 1NEZA 8CGTA 5F88B 4G7VL 5CJOL 2YSSA 4PJCA 2E6JA 3QDGD 4KZEL 5I1DA 3KPRD 4ZXBC 2IMNA 4UQ2A 1WWBX 3EFDL 2AJXH 4HWBH 5CP7A 3EJZC 5CINL 1LEKA 4NBYB 5IUSA 1S7VB 4R0LA 3CFDB 1PKOA 3EYUL 1Q9WB 4UDTA 5C0FA 3T77A 1LO4H 3HRZB 4OLXL 4OV5B 1H8OA 2V7NA 2VDOH 4U3HA 5F7EL 2D7MA 1ZLWH 4X9IA 1J10A 3PHQA 3REVB 1DN2A 3O3EA 4O2CB 3HUJE 3CXHJ 2H3NB 4JGUA 4ZSOE 2NY1C 4P2OB 3V0WH 1G6RB 2F5AL 2OL3L 5SX4I 3EJZD 1T22B 4S1DD 5ELIA 1HH6B 1L0QA 2DQGH 5DJXB 4JJHA 3TT1H 1OGAD 5EBLB 3X3FH 3QQ9C 2BHZA 4KMTL 4YX2H 1IC7H 3WDIA 1NANI 4LPVA 2Q86B 2R1WB 4OGXL 1JZ2A 4C4KT 4PGCB 2D03H 1OM3L 5FUZH 1NGPL 2NY1D 4I5BB 1NH6A 1BAFL 4JDTH 4NQED 1BVKB 1U95A 4HZAA 2BSTB 4LSQL 2CLVA 5FM5M 2R0LL 2A74B 2F54B 3C5SB 1MCOH 1T1ZA 3ZKNC 3QQ9D 1T0MB 1FVDB 4XBGA 3IDUA 4JFDE 4ODXA 1G7HB 4TSCL 1PKQE 3N85L 3IU4L 4DOHB 1T3FA 2QQLH 3BPLC 3KJ4C 1G7IA 5HVWA 5IW1A 5TFSH 1B2WH 3FB7B 5MENB 4U1LB 2Y5EA 3TBVB 1VPOL 3H2WA 1ZS8B 2H8PB 4HIHB 4NZDA 3RWJA 3PWPD 2DQJL 4OLZH 1FNSH 1LK3H 3HCVB 1E4XI 3ZKND 3TZVC 1HINL 2H32A 2NTFA 4HUWA 2PN5A 4E41A 4AEHH 1BBJB 2YXFA 4YPGB 4U31A 1MNUH 4L8BA 1NAML 1I1FB 1ZLVH 5FEBA 5KSBF 4UILH 4Z18A 2BVTA 4RAHA 4PRAB 1YC8A 1SY6H 3S36X 4Y4FC 4O02H 1IGTA 4JQIH 3ARWA 3SGJC 3VMPA 4MSWA 2V5SA 4XMKL 1A9BA 1N8ZA 2IPUK 5FM4A 4L8DA 4LPWA 3SDXA 2WWKO 5DC4B 2F5BL 3OKMB 3I84A 1MREL 5DEFB 1XCQA 3A0OA 1OWWA 3E6FA 3FCTB 4QRQB 3RUGF 3V7AE 3QUKB 5E8DL 4M61B 4Y4FD 4GG6A 5IMLA 1HE7A 1JZ5A 2YD9A 1E28B 4F2MA 2J12B 3O6ML 1I85C 2BJML 2KKQA 1F4HA 3QDGB 1FQ9C 1CK0L 1C7SA 3KPRB 4XVJL 3TO2B 4KY1L 4FS0A 3IF1B 5J13B 4PB9H 4HAFA 2CDGB 4L4TB 3QHFL 3RAJL 2HT3C 1U8PA 4M1GH 1L0YA 3PQYE 3N0PB 2F9BT 4KVNH 4O2FA 5JXAH 1JGEA 4JFPB 2YUZA 2UVFA 3CUPA 3QO1B 4OZHE 4PFEA 4PRDA 1I7TA 4P2CG 1HSAB 4JCMA 1WZKA 3D18B 1A47A 4CADB 4N0RA 1ND0B 4ZXBB 5EOCJ 4KK6C 1DEEB 3DVNA 4ZS7L 1LD9A 1S7RB 3PNWB 4LL9A 1U8JB 5JUEH 2HTLC 2R56L 1UCTA 2HT3D 4GRLC 2OZ4A 4OD3H 1RZ8A 3CFIC 5HHMD 2HVJB 5IVOA 3T0XA 2VH5H 3MR9A 4JQVA 1VGEL 2FL5A 3ROOB 1YEDA 2VL5A 2AJSL 5I71C 5JIKA 1W0YT 2AJYH 5HGBA 5KVDL 5IHUH 5GGUA 4N8CL 1FVEB 2YPLD 1PZ5A 4KJYA 2P8MB 1TIUA 2V5YA 1W8OA 4QHMB 4Z7UA 2A1WL 2NY1B 1IAOB 4PJEB 4QRTA 1NGZA 5AYUL 2HTLD 2BDNH 4GRLD 4OUUA 2BCKA 2L7JA 4JQXA 3ULUC 1SYVA 2ZUUA 3OXSA 1YEJL 4ODBD 4S1SL 2Z92A 3GBML 4WNQB 2Q87A 1UKQA 2MCPH 4V1DD 3CMGA 2YBRA 3UTOA 1QBLL 5KS9E 3GBNL 5B22A 3PL6A 1QEWA 4HV8B 2XV6B 5HI4C 4KDTA 4YBHA 5IVNA 4X7SH 3PWPB 3ULUD 2V7HB 1LO3H 3TP4A 4PGBA 2DKUA 4PR5A 1EVTC 2EDBA 5DJCA 3WNOA 3DVGA 3MRDB 3BP4B 4H25A 1U6AH 3HR5B 1RZGB 3OKNA 5C08A 4LSVH 2DMCA 3DUSA 3VXNA 1DBBL 3BPLB 2YPVH 3KJ4B 4JFHE 4PREB 2R0ZH 3K46A 4LQFL 3P4OB 4CKVX 5T3XL 2OJZH 4J3TA 3IDJA 5BO1L 3D25A 5HI4D 2PCPA 4PJXF 4ZUUB 4Z7NF 2AQ2A 1EHLL 1TJIL 4TUKL 3KLAB 1KNOA 4K7PH 1AGBA 1BBDH 3TZVB 3RTQC 1PG7X 5L9DH 4L4VA 4HCRA 3C5JA 1UCBH 5TH2B 4M7KH 4WHTA 3WKML 1GZQA 3DX6A 3Q6FA 5D1XA 2ESVA 4BQCA 4TTDC 2QHRL 1F6FB 2HJKB 4Y4FB 4GSDH 1R24B 1PW3A 2FYYA 2X4QB 3I50H 4GJTB 4WU5B 4XCCH 3DNKA 1T0NB 3RTQD 1KGCD 3L3OA 4F33A 1X5ZA 4JM2C 5DF0A 2VLLA 5GJSL 2Y4SA 3GM8A 5GISH 4JLRA 4YZFF 4ZAKA 2HWZL 4OF8A 5CHNB 2AI0H 2ICWJ 1WQVT 1A6VL 4HKBB 3SKNB 3BUYA 1R3IL 4TTDD 5ISZA 4RX4D 1W0VA 4HX1A 1UB6B 1Z2KA 3BN3B 3QISA 4JRYE 3ZKSD 5EORH 2JB5L 3KPLA 4JM2D 2R69L 4YEEA 5SWZA 3O3AA 1DCLA 3GHBL 1JHLH 5L8KB 2FWOB 1I3GL 3LQMA 3CU7A 4RMQA 3QXTA 1CFTA 3RU8L 2VNCA 3IFLL 4WEBL 3ZDXE 3V6OE 3UPAA 3SN6N 4Q6IC 5B39G 3RWHA 4DK6A 3ZZ1A 4P23C 3V6BR 1K6QL 5I8CB 3G04B 4QOKD 1J0ZA 1QRND 5HHMB 4PB0L 1J87A 3RA7L 4XAWH 1WC7B 4K8RL 1EX0A 5DJDA 5IW3A 4ZUVA 2WZPD 5FO7B 3MLZL 4UV7H 4WI9A 5E9DD 4M5YH 4R3SB 2P47B 3KYAA 4PTUA 4CU8A 3I75A 5DD3L 3DARA 1HNGA 1TZHA 2YPLB 1EHNA 1NKOA 3D69B 1AO7A 3B8YA 4OZ4A 5C07D 1S78C 3DVFA 2NY5C 4JAMA 1NFDE 1R3HA 1BD2D 4PG2A 1AKJA 4NKIL 3BOVA 4P23D 4GRLB 1QFWM 4F57H 4PV9B 5L0QC 1XMWA 2EDEA 2WUBL 3BDXA 3GMOA 4PJDE 3TPUA 4CRPA 3HE6A 3SJVD 4ZMAT 2N7AA 1A6PA 2J3SA 5I71B 4V1DB 4ORZC 4W70A 5DUBB 1MJ7H 4MXQC 3UXFA 3INUL 2X4SA 5TGBB 5F8QC 4MD0A 3CFBA 5EN2B 1F4XL 1AD0B 5D2LB 5I73C 1ETZB 1JPTH 4N1HB 4X0KB 5EC1A 3AS0A 1MFDH 2Y5TB 3DBXA 2FLRT 1OTUD 3G9VA 3UO1H 1FL3A 4R26L 3T0VA 3MCKA 3OXRB 4LNRA 5E99H 2HLFC 1L7TL 1DP0A 4JZJC 4ODWA 4X4YA 3OL2A 8FABB 4FABH 2BXYA 1JRHI 4MXQD 3QWOB 4P5KA 1YQ2A 3CFCH 1FGNH 2FIKA 1P1ZB 2E7HA 3LZFH 3RNKB 5IM7B 4HUVA 3BD3A 4X5LA 3WXVH 2JB6B 5KANG 4GXUM 3ZDZF 4XX1E 3D85A 1M6OB 3VXUD 3ZSSA 3BX7C 1YNTB 1MLCA 1FN4A 3LB6C 4S11A 2HLFD 5JO5A 2D4DA 3AMKA 4PJ5A 4N5EC 3BZ4B 4GAJH 4KTDH 3MBXH 3VFUA 3QDJD 3P40A 5D6DA 3CPLA 3HPLA 3MRCA 4K2UL 1RJLA 1F00I 4ZPVA 4XP6L 4KV5F 4FZ8H 4PJFB 5CBAA 1KV3A 1MEXL 3UTQB 3TA3A 4X5XB 5JPNB 1GSMA 5E5MA 5E24E 4NCC1 4JFDD 3LB6D 5LBSH 5GS0C 4NQCE 5C92A 1KPVA 4P2QE 3RTQB 32C2A 4P5MA 3WE6A 4NQVA 3VG0H 1KACB 2EDRA 4KVCH 3L7FA 4LP4A 4HLZG 5K93A 1J1PH 4PRID 3BZEB 3MV11 1MHPL 2P7TA 3RHWF 1LEIB 2UVEA 4AJ0A 1EUUA 4MA3B 3QJHB 4PRHE 1KCUH 4A2MA 1S5HB 1BZQK 2ARJA 5DD5L 4J8RA 3C6LA 5GS0D 2OLDA 3CMOH 1FZJA 4HGWA 3MNZA 5ICYA 1C08B 5D5MF 3VFVA 4RFOL 4JM2B 4TVSa 4ELMF 3UX9B 5C0BE 3QXAB 1EO8H 3MCG1 4HPOL 4WY7L 4M8QB 3WL9A 3VFTB 3BKCL 5KW9H 2YC1A 1FNGA 1PSKL 5CMAA 3KYMB 4Z7VF 1UM4H 4M5ZL 4NWUL 4R4BA 4WDIA 5TQ2L 4FMKA 5D8JL 1JPSH 1JTPA 3W0WD 3S88L 3FMGH 1RFDL 5CJBA 5KSBE 5E9DB 2FEDD 1P6FA 3M07A 1T1XA 4NJAH 4MD5A 5SWSA 3SGKC 1LE9A 5C07B 5IGXL 1EEUA 3C5ZA 2BSSA 2JJVA 1BD2B 1WBYA 4Q6IB 5IMMB 4P23B 3JSSA 2ICEB 3DSFL 5JA8B 2EIEA 3FN3A 1XF4B 4I4WA 5BV7H 3SJVB 3VWJC 1A5FH 1S7SB 3OAUH 2VDQH 5I76B 1U8NA 3RUGE 3GSUB 4OIIH 1CGSH 5EUOB 2LFGA 4F7TB 3ULVL 12E8L 2EDJA 5HYSG 3UPRB 1NCUA 4KKCC 3WXWL 3CSYA 5H35A 1DBKL 3K4DA 1TZGL 5JOEA 4LVHC 4HZLB 4P3DA 2X70A 3I3DA 3U46B 1U93A 5L0QB 1S9YB 3QG7H 5E95B 3PWNA 2Q3ZA 2Z8WC 1XF1A 4KI5C 4M62L 3E8UL 4TULH 1KCSL 5GS1C 1GGCH 1PX3A 5K59F 3K4AA 5I1IH 1U58B 3MLVL 5LGKA 4YAQB 3K2UH 1Q0YH 1J0HA 5I73B 2JK5B 1D5MA 2YD5A 4KKCD 4LKXA 4B53A 4IMKC 4NRXB 3MJ6A 3IFPA 3MRBA 3QA3B 4HQQH 2QL1A 3VXUB 3QH3A 4OCMC 1HKFA 4PJHF 1L9MA 4JZJB 4AH2A 5M94B 2YWZA 3QDJB 4HKXB 2YD2A 3MLWL 2J4WL 5SWQB 4D94A 3TVMD 1MHEA 1O7VA 4I18C 4D0CB 1OTTC 1T03L 1RZFH 5SV4A 1KCKA 1CFNB 5CSZB 2HTKC 4OZIB 5ANMA 3MGTA 2AABH 2W60A 3DECA 5BRZE 2A6DA 1IM9A 1R5IA 1CIDA 3VD3A 5IVXB 2DQHH 4I3SH 5EO0A 4PRIB 4NC2B 4KHXL 1DQJB 1NLBH 2P42B 4FXGB 5HJ3A 3WD5L 3OJDB 3MRMB 43CAA 3QI9A 5EA0L 1OTTD 4KQ4L 4NRYA 1TNMA 5EZLA 3AREC 1CLOH 5MEQA 2HTKD 1U41A 2AQ3A 5A2LH 1D6EA 5GSVB 3FB5B 3P9WB 4X99A 2D7PA 2IBZX 3GFUA 3K7UA 2A6KA 2XRAH 4U6HB 2EE2A 2P5WA 2DQTH 1G7LB 1QZ1A 4JFHD 3HLAA 4P59L 5DR5L 4UT9H 4GKOA 4OF6A 5C2UB 1KEML 1JL8A 4N5UA 3KLHC 4OSUH 5C7XL 1I9IL 2H32H 1NCCL 1ACYH 2XWBA 3ARED 4L3CB 1A21A 3OJ2C 5JIPA 2CO7B 4AM0A 3FO9B 4P46C 1V5JA 3W0WB 3HI6L 3UJIH 4HHAA 3O81A 3S9DB 3KYOA 4ERSL 5J9PB 1RZJH 1ZLUK 5FYJU 3LCYA 4PJXE 3QZWB 4Z7NE 1JGVL 5IIEA 4N0UB 3QPXL 1Q94A 3KLHD 1Y0LB 3RGVC 1H3XA 1T6WA 2H45A 4JO2H 5DWUL 1LWRA 2A73A 4PV8B 2QSCH 2EDYA 3QNYB 4P46D 4HUUA 1OVZA 4F7EA 1J5OH 3G5VA 5E8EB 3U30C 3MUGB 3VD4A 4ZTPH 4NQDE 5TE7L 5C3LD 5JQHC 3EOTL 3FRPG 3LN5A 3T2NL 3ESUF 3S34H 4R96B 1H8SA 3O41A 4I8DA 4OFYA 5A3IC 5GRJL 3TYGH 4HW6A 1HKLH 4NO2B 1BX2A 4HGMA 4I2XE 5DJ6B 3RGVD 3FO2B 3RWCB 2NLJB 4JRYD 5FYLD 1H15B 5I1AB 2RGSA 4YZFE 3BZDA 1HQRA 3VWJB 1A6TB 3VRJA 2WINB 5AAMA 3UYPA 5AG8A 1FYTA 3MV8E 3BWUC 4E5XB 2ZUSA 5KSUA 1ED3A 2UWEB 5JW4M 1FC1A 4XNUL 4NRZA 5J56B 5A3ID 5B38G 1FG2A 1OCWH 1T66C 3BE1H 1UT9A 2XG5A 3KPMA 3ZYOA 1QNZL 3QJFA 4MNGE 3WFDL 5HD8D 2BMKB 4LVHB 4UOW0 2ZOLA 3MXVH 3VFOB 2PW1A 4HULB 4X4ZA 4IRJC 5GS1B 2MSPA 1V3LA 4DN4L 2WBWB 3A6OA 4GBXC 1KJ3H 1D7FA 5F9OH 3V4UH 5HYEA 3RWEA 1DQLH 1M1SA 2OZ4H 1T66D 2CKBA 2W0KA 3VJ6B 1X6NA 3REWA 3G08A 4DUVA 2C4FT 1T80A 3OX8B 5KOMC 4O4YL 3U4EB 3TN0A 4YHYC 4IRSA 4KRLB 5EIIB 2DYPD 4MJ5A 5D7IA 5EU7C 4P2RA 1X7QB 3U4BL 4YHMH 4IRJD 2AJUH 5IV2B 1CE1H 5KS9B 1TNNA 2VO5A 2IFGA 1KIUA 3VXRA 3S98A 4RA3A 1NFKA 4PBXA 4F3FB 4I18B 2C3XA 5ICXA 1MRFH 2JCCA 3BPOC 4JRWA 3MA9H 4Z7WB 4G3YL 4V2BA 4TOYH 4XPTH 4W68A 3MSPA 4PGZA 5GPRA 4HFWB 1R3JA 2O5YL 3GJFB 3OGCB 3EYSL 5KZCD 3C8KA 5ERWA 3E6HB 2B1AL 2VITA 3GSWA 3BT2L 2B4CC 1AGEB 5EOQH 3IGAB 3GSVB 2OL3A 1KPRA 2GT9A 3QCTL 3OR6B 5HDBF 1MRDL 3BIKA 3ZTNL 1B0WA 1A9EB 2MJWA 1H5BA 2PR4H 5I1LB 2Q8AH 4P0DA 1N4XL 3AREB 5FKAB 2PUQT 4HH9B 1ZLWK 3O3BB 4IS6A 1YPZA 4GOSA 3LSOA 1CICB 5FA4B 4ZUSB 4YHLL 3F7PC 1HI6B 1UVQB 5C0AE 2B39A 2DRUA 3HG1E 3ZDZE 1T1YB 3QEHB 1GXEA 3D39A 4N0FA 3BZFA 3KPOB 4UI2A 5DQJA 2VXTH 4Y19E 4MQ7B 4QRSA 2VIRB 4YNYB 5E1AB 1J05B 4PYGA 1A4KB 5HYQA 4HCRH 1QVOA 4P46B 4OBSA 4AG4L 5F97E 3QIWA 4Y2OA 4KV5E 2Z35B 4G80B 4ZO8A 2CMRL 1GC1C 3D48R 4TNWF 3QB7C 5FO8B 3S5LB 3VA6A 3JVGA 5E8NB 1MFBL 1ZKAA 2EIZB 4D2NA 1OSZB 4YBLC 3P0YL 5GGQL 3RGVB 1BFVL 4YIQA 1OGTB 3L3HA 1WFTA 4G8EB 4QXUL 4IOIA 1K5NB 1TMCB 2AKRA 4DVRL 5I75C 3LS5L 1Q72L 5JW4Q 5C0BD 2OSLB 3O4OC 4WV1C 3ARFA 3U30B 2CGRL 1NAMA 4FQ1H 1BVZA 4RAUA 1P84J 1T4KA 2AJ3A 4YHNA 5GGSA 4M3KB 5MEPB 5ESQA 4EN3C 4ALAH 4LCUA 5EZIL 1T89C 1MRCH 1YJDH 3B9KA 5C2BL 1XAUA 4F58H 4JGJA 1A3LL 5D5ME 4WU7A 4ELME 1LNUB 3W9DB 1BECA 1I8IB 5IWLA 2VUOA 3PP4L 1EA9C 3VXSE 1ZLVK 1OP3H 4NT6B 1GJIA 3S36L 4Z7VE 2OTUB 5FHAH 4EN3D 3QIBA 2D7NA 4H5SB 5IQ9A 4BH8B 1S7QB 3R0NA 5JIHA 1U36A 1G7MA 1OL0A 1AY1L 1ZA3B 3O8XA 1CFQB 4PJBE 4XVTL 1BZ7A 2DF3A 2GAZA 4YHPB 4HSQA 2DYPB 1EXUA 4LCIL 3LHPH 3WN5A 1S5IL 3DMMC 3UYRH 1QFOA 2R8SH 2LVCA 1C1EH 2R2HA 4IRJB 1A6ZB 4Q0XH 1MCPL 1QFUH 3IXAB 2WLZA 3CDGA 1CT8A 4OB5H 4GBXB 2R4SH 4S1RH 2MKLC 3L5HA 4GAYB 1P4BL 1F8TH 4KRNA 4NGHL 1MCDA 1K9TA 3U9UB 2VDPH 3ZL4H 4OZGA 4ZDHB 1YQVL 3FB8A 4X4XB 4YHYB 2BX5A 4H1LB 1KENH 4MXWH 1W72A 1MY5A 4Q7DA 1BJMA 1J1OH 5KZCB 1D9KD 3DMMD 4IDJL 2YRLA 1P7QD 3OR7A 3MRGA 5EOCL 2V2XA 2DQUL 3QFJE 2AEQL 2W1NA 1GAFH 2P8LA 4LSSL 4L8CB 1NCBL 3LKNA 1F97A 2NX5A 4NO5A 1JPGA 4GMSL 2ZG1A 1EIBA 3TBSA 3LQAH 3BPOB 1JTOA 5FYJE 4DEPC 3LS4L 4CJ1A 1F4WH 3B43A 5K59E 5EU3A 2P24B 3RNQA 3V6FA 1FZOB 4ZD3L 1A6UL 3IVKA 3CX2A 3B83A 3UBXB 5TJWK 1U8QA 1KTDB 1UG9A 1ZHNB 3QWRA 3OHXB 1FH5H 2HRLA 5FXCH 3OMZA 4TVPE 1ROWA 3K0WA 4DGYL 2MNUA 3WLWC 4OJFL 4LASH 2FX8L 4L9LB 4PJHE 5K33A 3VDCA 5GRZA 2AXGB 5T1MA 3KPSA 5JW3H 3C8HA 2VOTA 3ULUL 1HXMB 1HHGA 2EDFA 5LXGL 5BRZD 1PX4A 4XPAL 3VFGH 3KNBB 1H3TA 2Q6WA 1FL6A 1CS6A 1OAYL 2XOTA 3RZCC 2CIKB 3EJYC 3O3DB 2IPTL 3LN4B 4NZTH 2N7BA 1RAMA 1DBML 2VLRB 1BZ9B 2IPKA 1FLTX 1WWWX 4MLIA 3NA9H 3V7AG 4IOSD 5FA3A 3WIFA 5T3ZH 3WLWD 5DRWB 5JXEA 3NAAL 5CJQH 1YEGL 1RVFH 1VGKA 4WUUE 3B6SB 4HWZB 2FHBA 4MA1C 2VDNH 4L9DA 2AW2A 5C0BB 1CGUA 2EDHA 1BJ1H 3LKQA 4PRNA 3RWDB 3BJ91 3I9GL 3EJYD 3B4NA 3RZCD 4YEFA 5KJRH 1PZUB 1KCVL 2XICA 5KSAD 5HHXL 2YK1L 3Q6GL 2WW8A 4ZNEA 3NFSL 4YBLB 1KCRH 2W9EH 3MRKB 2IMMA 3FT3B 2DTMH 3IJSB 1KIQA 2NY3C 2DAVA 2XY1A 3TT3L 3F65A 5I75B 3VFRA 2PYEA 4X7TB 4OI8A 3THML 3O11B 4WV1B 2PW2A 1NC2D 2OTWA 2AEWA 4EN3B 3U2SB 4LLYA 5C8JB 1TFHA 2OYPA 3BH9B 4MCZB 1IKFH 5HDOA 2OR8A 2YD8A 3B3IA 2V17L 3VXME 4HH8A 1K2DA 4WIQA 5F1NA 4NQDD 4P57B 1LGVA 3QDMA 4XBEH 4LGPB 1YY8A 3DV6B 1IT9L 4G42B 1JWSA 3JV6A 3U0TA 1UJTA 3BPCB 4IOFC 5K9KB 5GHWH 4PP2B 5CZVL 5E6IC 2DM3A 2Z31B 5CP3A 5IOPB 3FTGA 4GKNA 1SMOA 1YNKH 3FT4B 4R0LC 2PF6A 5CBEB 1WIOA 1QR1A 2BERA 4QGYA 3PWUB 2ZZUT 4IJ3C 1OPGH 3PWJA 5HYFA 1Q9KB 3DMMB 1P7QB 3I6LE 5GZND 4PUBH 1XGQA 3P9LB 4BH7A 4IOFD 4DQOH 5JORA 2VXUH 4DKAA 5E6ID 4Y1AE 3PGCA 4PJ7B 3NCYP 1OP5K 3CLFL 3SQOH 3TBTB 2LAAA 1CXHA 1AGDB 5E2JA 5BJTA 3W2DH 3WUWA 2FB4L 3DURB 4M9OA 2YPKB 2VRAA 2DQDL 2VISA 5GGRB 2OCFD 1CG9B 1T2QH 3MYJB 2BZDA 3I2CH 1DUZA 3HTLX 2BY3A 3JWNC 3RWFB 1FVCA 4EQ2A 1YECH 5C0GB 4QHKJ 1RV6X 1T7XA 2H26A 2I60H 2XN9E 4ODSH 4R8WH 2IALB 2NY5L 4Y4HA 2B2XH 1NCAH 5CS7A 4M7LL 1CL7H 3SE4A 4P9ML 4DEPB 5GJTH 4G9DB 4AQOA 4TTGA 5ETUA 3U0WL 3HFML 1P4IH 3GDBA 1IAIM 4M3JA 5DS8A 2BOBA 3MQIA 1REIA 3X3GL 1CBVH 2A0LD 5E2WH 5D2NC 4JEGB 4GKZB 1OB1A 5IHLB 1XGRB 4Q9RL 3STLA 2AS5M 4H26B 1KTKE 4LSUL 2E7MA 2OQJB 1UWXH 3U83A 3FFDB 1K8DA 1P53A 2ITDB 2O5XL 1IQDA 2YEZA 5C0ND 3VXTB 5M95B 3KPPB 4JPKL 4WGWB 1S7XA 2EDTA 2VZSA 1P4LB 1Q0XL 3RZCB 3AFLA 3MLRH 4JHAH 4M6OL 1JNJA 3F58H 3GIVA 2R9HC 5E8OA 2V6HA 3QEQB 1A1MB 4MGXA 3GSOA 3SDYL 4LSPL 1JFQH 4TSAL 4D3CH 1S7UB 3ARBC 4FZEH 1LE5B 3SKJH 4CVXA 2V2WA 2X9XA 3K8MA 4ELKA 5KVMC 1ONQA 5EWIH 5D6CB 3VH8B 1U3HC 4MA1B 3ZT5A 2X4PA 5HDBE 5J1AB 4MA8H 4M1DH 1BQHB 4LCYA 1IQWH 4OTXL 1GZPB 3O2VL 4PJXB 1VFBA 5IJKC 1PLGL 1NC2B 3WLBB 4XNQB 2QQNL 1JGLH 5ILTL 1HILA 5MEOB 5JOPD 2D3VA 4L1DA 4Y19D 4FQXA 1BVLB 1Z6JT 2HVKB 1XH3B 3KDMA 5LAXA 1F45A 1JGDB 1ZHLB 3ARBD 1YEFL 4O58L 3MRFA 2DBLH 1ZXQA 2GJ6B 5AUMA 4MX7B 4C55A 1AE6L 4LCWE 4U1JA 1MQKL 2NY3B 4ZO6A 5ID0B 3RL1A 5FGRA 5GS0L 1U3HD 2CRIA 5DUPH 4D9LL 5LQBL 1M7IA 1MIMH 4JFEA 3PHSA 2BY2A 1KJ2B 4LAJH 1EMTH 4OCYL 1AQKL 5HVFB 2C1PB 5ESAA 3G6DH 1RUKL 4YHZH 4M8VA 3ZYIA 4RNRB 4UOJA 4XPHH 1NEZB 4O51A 3CZFB 3DJ9A 3PWLA 3NBNA 2DQFA 3BKMH 2D7TL 2F53E 3L95B 4WI5A 3VWKD 3SKUD 1XEDA 4Z95L 2AXHA 5T5FL 2W9DL 5E0QA 5I1DB 2EDQA 5EH1A 3WSQL 4K07A 1UM5L 1DQDL 4H20L 4X4MA 1U8IB 4UQ2B 5E6IB 1L7IH 1BEYH 1A7NH 5CP7B 4KI1A 3WNKA 1V3KA 4MNGB 2NY2C 2ITCA 4R0LB 4JQVC 3T1FA 5A2FA 3D9AL 1A7OL 4UDTB 5C0FB 1MH5A 4H1LG 3T77B 5B8CC 4IJ3B 4X6DF 2OP4L 4B5EA 1FNHA 2JKXA 3PHQB 4WW1B 3O3EB 4HXAL 1KYOK 1RUQL 1TENA 1CFVL 1HDMA 3U1SH 1N5AA 2X4TA 4LPTA 3WFCH 4NDMB 4XX1G 1JHKH 3F6LA 2NY2D 4BUHA 2XNAA 4KKNA 4LFHD 5CLTA 2YUXA 4JANA 3UBXI 3TO4A 1M4KA 2PO6A 3PGDB 1SBSH 3UDWA 2CKBH 4UAOC 2R0WL 1YYML 1QQDA 4AIOA 3ILQD 3PL6C 4UT7L 3ZTJG 1NMBL 4WO4D 3D3VE 1G1YA 2CLVB 4G7VH 3S37X 5J6HB 3SBWA 3UTSA 3DV4B 3W82A 4KZEH 1T1ZB 1IFHL 3MREA 4XBGB 1UXWB 2GYSA 2ATKB 4ODXB 3MUHL 2VDLL 4RIRB 2FCBA 4P3CH 4X6CF 4PP1C 5CINH 4DN3L 4BKLA 3OKKA 1BGXL 1G7IB 1S8DA 3EYUH 2W65A 2D4FA 5D2NB 2DI7A 5TDOA 4OLXH 5FYJD 1RI8A 3FQRA 2DI8A 5INDB 5F7EH 2CRYA 3RWJB 3LDBC 2XKSA 2P49B 4HS6B 3U7WL 1JF1A 2NTFB 5F88A 3H7BB 3W9EB 5C86A 2KUTA 2F5AH 3MRPB 3OKOB 4HUWB 3SO5A 2OL3H 3VGAC 3FQNB 3CIQA 4PP1D 5CJXA 4HLJA 4OLVL 4JO3L 4HJGB 4TVPD 4YHIB 1RJYB 4HIXL 2OJEB 4KMTH 4Y19B 5B39A 1S7VA 3ARBB 1EH9A 3CFDA 5HI5C 4MSWB 3DETC 4W6YB 3W11C 3HRZA 4OV5A 1OM3H 4MB4A 1NGPH 5IW6A 5T5NF 1BAFH 2F8VA 4L8DB 3RWIB 1U3HB 2R0KL 3SDXB 4LSQH 3REVA 4O2CA 2R0LH 4M00A 3V5KB 2H3NA 2ARJQ 4P2OA 1RJZB 3V0VB 2EO9A 1T22A 1HH6A 4GRWB 4TSCH 5IBTL 4HD9A 3N85H 4Y5XC 4MS8C 4GG6B 5EBLA 4WUUD 5HI5D 1QBBA 3DETD 2J5LC 1GL4B 4BK5A 4MDIB 2IAMC 1VPOH 4I5BA 2X40A 4NP4L 1BVKA 5TDNB 1DSFH 3TIEB 1U3YA 3OZ9L 1BOYA 2A74A 2F54A 3C5SA 2BY0A 2PYFB 1TCRA 2BVUA 4OGAC 3B2VL 1FVDA 3T3MF 1JGEB 1Y6MR 5DYOA 1NAMH 5I1EH 3PDOA 4PRDB 1E6OL 2KQMA 2IAMD 1GGIL 1BJ8A 4C4KO 5HTSA 2R29L 5ICZB 1OD9A 1PBYA 5MENA 4U1LA 4AIZB 1KTLB 4XMKH 1ZS8A 2H8PA 4HIHA 3HCVA 4PJBB 2NY2B 3WFBH 4OGAD 2F5BH 3C6SA 1MREH 2MTPA 1YEDB 1F13A 2VL5B 1BBJA 5DMJB 1FO0H 5B8CB 4YPGA 1OAXL 3OJVC 2LV4A 1NL0L 2VWEE 3VD5A 1QFPA 3RQ3A 2WWMC 5FGCE 1PZ5B 3CFJB 1F6AB 1FE8L 4QHNB 5ACLA 4Z7UB 4C59B 5C1MB 1IMHC 1NGZB 2GQHA 3O6MH 3NZHH 4PRAA 4OUUB 2BJMH 4X7DC 3RIAF 1VSCA 3DYMA 3G5ZA 4W4OA 1CR9L 1CK0H 2Z92B 5FUCC 1UZ8A 3E2HC 4RRPG 4KY1H 4ZOAA 4PRPA 4LP5A 4K9EL 2YBRB 1EEQA 3OKMA 3QHFH 2WWMD 4LSRH 5GRVL 2I9LB 2X9YA 4UAOB 4Y1AD 3WDHA 4HG4K 1B4RA 1FNFA 3PL6B 4LRIC 3QUKA 4M61A 1QYGL 1W72H 1E28A 2C5DC 4PGBB 1XGTA 4X6FB 2X89D 1RPQA 1SJXA 2EH8L 2CIIB 3OKNB 1KN4L 3DUSB 3KPRA 2R56H 1EHXA 1B0GB 5HHOE 3TO2A 3L3GB 3IF1A 3IDNB 3C87A 1GHFL 5SX5H 2XN9D 1VGEH 2CDGA 3LIZL 1RIUH 5ADPL 2BSRA 4PJHB 3UTZB 2AJSH 2BNUB 2EYSA 4ETQB 5FYKE 5H2BB 1A3QA 1TVDA 5KVDH 3LDBB 4N8CH 2X4NB 4JFPA 4O9HL 1AGBB 3GSNB 3QO1A 1HSAA 3K80A 2A1WH 3D18A 3BMVA 3VGAB 1OW0C 4L8SC 4CADA 5AYUH 1ND0A 3JWDL 2R4RL 4EI5D 5DD1L 2QADC 1DEEA 2P5ED 1YEJH 2CD0A 2WUCL 2FD6L 3DX6B 2DLIA 4U1MA 1S7RA 1AI1L 2WSKA 3GBMH 1U8JA 3OQ3B 3PNWA 1FSKC 3Q6FB 1B9ZA 2X6MA 4Y7MA 3MMEA 5FAAA 5DMIL 2HVJA 1U91A 1OGAA 4KTYA 4A6YB 1QBLH 4WUUB 2FBJL 3ROOA 3GBNH 1OD7A 5HDQH 2AEIT 5DGQA 1YEKL 1FVEA 5ITBH 2P8MA 4XCFL 5EFIB 4WI2A 1DUYB 1IAOA 4PJEA 4NQEA 1HH9B 3BUYB 5ISZB 3ILPB 4RA0C 4Y5XB 5DJAB 1W0WA 4HX1B 1DBBH 4WNQA 2AERT 2J5LB 4KK9C 4LQFH 3I6KB 5T3XH 3KPLB 5SWZB 4NKDA 2IAMB 5BO1H 2XPGB 4LQ1A 4L4JA 5MERA 5JOFB 1A7PL 1GIGL 1LMKA 1G9EA 1CFTB 3UPCA 1TJIH 3OB8A 3AS3A 4HV8A 4JFZL 4BQ9A 3PWPA 1HK6A 5HHNA 4LCWD 2X4UB 4WI6A 3MRDA 3BP4A 5DJDB 4KK9D 1KULA 1RZGA 3C9NB 2E27H 4ZO7A 4YO0B 3QUMB 2QHRH 3I75B 5F7KC 1HSBB 1TZHB 5SWSD 4PREA 1AO7B 4OZ4B 1GC1L 4FG6C 3Q5YA 4Z8FH 2H9GB 1FDLL 4LEOB 4YXKH 3R4DA 1VCAA 5HXMA 5GJSH 3KLAA 4JY4A 3TPUB 1PQZA 3ISWA 2XKNB 1X6LA 2FGZA 4NZJA 1LP9F 4LHUD 1KSRA 4CW1A 1A6VH 1RZKC 2HMIC 3JV5A 2R2EA 1D6VL 3QCUL 1F3DH 5TH2A 4NHUB 1R3IH 4R4NC 4E0RB 1ES0A 4FG6D 4QEGA 3BSZL 3NPSC 5DGRA 1P69B 4WFFE 5EC1B 4B50A 2HJKA 4Y4FA 1R24A 2R69H 2X4QA 3SGJA 3GHBH 4WU5A 1XGUB 4PGDB 1SQ2N 1T0NA 3MCKB 4ONFH 4LNRB 1QPPA 4GS7C 4CU7A 3E2HB 5D72H 3IFLH 4WEBH 4BM7A 5K9JL 4ODWB 4KUCF 2A9ML 3QAZC 2HMID 3BDBA 5E5UB 1Y6KR 4R4ND 1K6QH 4P5KB 1HYSC 1WZ1L 4Z76A 5ALBL 5TE4L 1QOKA 3TH4T 4HKBA 3SKNA 4PB0H 2XN9B 4HDIB 5FCSH 4UNVA 3MV01 4K8RH 5DSCA 3MLZH 2XQYK 4X9GA 4X6DE 1UB6A 1CTOA 2NZ9C 5DD3H 1N5YH 1OP3K 4FTVE 3FOLB 1INEL 2FWOA 4FQJL 2QBWA 4M9PA 4QO1A 4NNXB 4NUJB 1Q9LB 3HPLB 5C0IB 1HYSD 1ZGLA 4DKEL 1RJLB 2WUBH 4ZPVB 5J3HD 3D3VD 4M02A 3Q5TA 4ZFOL 2P5EB 2FHFA 4QHUB 4XB7A 1JRHL 1AJ7H 1XF2A 3I3BA 5E5MB 1AP2A 2HRPH 2NZ9D 1WC7A 1IILE 1U0QA 1YEIL 4ODTL 3M17B 1KPVB 5FO7A 4F8TA 32C2B 2NY7L 4R3SA 4XGZA 5CJ8A 4ONGL 1E27B 3FRPA 4L8SB 2YPLA 3DPBA 3DXAD 2WLYA 4HWEL 3LEYL 4XC3L 4R26H 2QADB 4RDQF 2CLZB 5C09E 1L7TH 3MLSL 1FSKB 1LO5A 4GRLA 2HKHL 4OGZA 2GTZB 2WK2A 2EE3A 1VADB 3D0VA 3C6LB 4J8RB 4X6CE 4DGVL 1KB5B 3RJQB 1FZJB 5KN5A 4V2CB 1MPAL 4V1DA 5IVZA 3VFVB 2YR3A 5FECB 2PNDA 5DUBA 2P5WD 1OSPH 2ARWA 3V95A 1MCQA 3DGCR 1FLRL 5D2LA 1AD0A 1WFNA 1ETZA 4POYA 3IS1X 4KJPC 5LVEA 3H9YA 2Y5TA 3AUVA 4HT1H 4RZCB 4LCWB 3AU1B 4HJJL 3GUTB 1F3JA 3OXRA 5F71A 3RDTC 5J89A 4K2UH 3IU3B 3MZGB 5GIRB 2GK0B 4XP6H 5E1HB 1CU4L 1K8IB 2GSGA 1MEXH 4PG9A 3QWOA 1OOAA 4CNIA 3BP6B 2VE6B 2VYRE 4LRNL 4I0CC 5FUOL 4MD5B 5SWSB 1LE9B 3UTTD 2AJVL 5IM7A 3HAEB 4KJPD 4LVOC 3KVQA 2NY6C 2JB6A 4D8PA 1M6OA 5CD3A 2X09A 3QIUA 4BZ2H 2DIBA 3KJ6L 1MHPH 3RDTD 3L1OL 2IBZY 5I16A 1BFTA 3P3YA 4LHUB 4ZQKB 2WBJC 1URLA 1E4WL 2P43B 4HUNB 4NIKB 5DD5H 3RBSA 4UQ3B 1FYHB 4PJFA 5L8JB 4N1EA 1JZ4A 1BF2A 3UTQA 4X5XA 5JPNA 2NY6D 1FFNB 2VZ1A 4K7PX 4RFOH 4ODUB 2X70B 3FN0L 1JCKA 2V5TA 4WY7H 3N1GC 3EYOA 3PWNB 3RTQA 1DBAL 4WI7A 1PGRB 3BKCH 2WBJD 3NACH 3EJJX 1PSKH 4ZOBA 1LEIA 4M5ZH 2DQEH 4NWUH 3ZKMC 3CVIH 1NBZA 3GEWB 1RY7B 5I18L 5TQ2H 1WJ3A 5D8JH 3OV6A 5HPMB 3T3ME 3NPSB 1D5MB 2VAAB 4HGKC 3S88H 1S5HA 4IHOA 3STZA 4RX4A 4XCEB 3MRBB 3OPZL 3MRJA 3ARYA 3HC3L 4PRBB 2D9CA 3DUUB 4M6NH 5F9JB 3ZMRA 2ICWA 1C08A 4GS7B 3W39A 1IC4L 4JM2A 4AH2B 1YEHL 3HZMA 1FFPA 2KH2B 3QAZB 3CFKB 4W6WB 1NBYB 3ZKMD 3DSFH 5J1SC 3KYMA 3VXQA 2C3WA 4QOKA 1QRNA 1FGVL 4WVRA 1ZLSH 4BA8A 4CGTA 4OCRL 1KUMA 2J2ZA 4K55A 3H9SA 3ULVH 4LU5L 4P2RD 12E8H 2DDQL 5E9DA 2FX9L 5EBGA 4QRRE 4F15C 1R5IB 5EO0B 4LDOB 3QXWA 1DBKH 1TZGH 3DXAB 4QCIB 5C07A 1YN7B 5D9SB 4PY8I 5AZ2L 4MCYB 4M62H 1H5BC 1BD2A 1MF2L 3D87B 3E8UH 2Y7QB 5IMMA 4NRYB 5JQ6L 1KCSH 1SEBB 4P23A 2VDRL 3BP5B 4YDVB 3VFMA 3GRWH 1XF4A 3MLVH 3RFZC 1D6EB 3SJVA 1BQSA 2D2OA 5F89B 2YUWA 1S7SA 3LRHA 3WJJC 1EAJA 4G7YL 2B8OT 2P5WB 5HHOD 4HK0B 3TF7C 3GSUA 3HLAB 4S1QL 5EUOA 3E3QE 3OKDB 1IL1A 1WIUA 3UPRA 4G6ML 2XTJC 5FYKD 3TJEL 4MJ6B 4HZLA 3FO0L 2XWBB 5KVGL 3MLWH 5KAQF 2HFGL 4JO1L 3EOAB 2VKXA 43C9B 3QIWC 1YMME 3T2PA 1U58A 1VACB 2Y25A 4LLMA 4ZSOA 5GS3A 3ZT6A 5ABDE 3KYOB 4YAQA 4JHWL 2R2CA 1WLHA 3JVGC 3EO0B 3DVIA 1Z3GL 5EIVA 2JK5A 3UTTB 4HWUA 5EU6E 1Q94B 2XTJD 3FN9A 4NRXA 4JFOB 4G9FE 3VXUA 3VFPB 3SDDC 3RDTB 4HUUB 5D7SH 4F7EB 2NXZC 3TGXA 3WD5H 5CKGA 2FEEI 3H42L 1G6RH 3QDJA 4HKXA 4CUCA 2YS4A 5EA0H 5SWQA 4KQ4H 1UWGL 5DRNB 3VFSB 5CGTA 2O93L 1UWXK 5C0CD 4LVOB 1BX2B 3R8QA 1ODAA 3WFZA 2NY6B 1WWCA 1X44A 5CSZA 1J0JA 4YJZL 2PTUA 3SDDD 3V5DB 4JFDA 5L7XL 4P59H 2NXZD 4YHKL 4U6XB 1KEMH 1BIHA 3EAKA 4PRIA 2WBJB 5C7XH 1QA9B 1FYTB 1DQJA 4FXGA 1NCCH 3RKPA 1KG0A 1JMXA 4RMWA 3MRMA 2XKUA 4Y5YC 1WICA 2X05A 4UOW1 1JBJA 2VL4A 3KPMB 3QJFB 5EC2B 3CD4A 3O4LE 3L3IB 4TSBL 1MHCA 5EO1A 4EOWH 4ERSH 1A8JH 1J88A 1BQUA 4XPGL 2XZAL 3U0PB 2Y06H 1G7LA 4C56E 1BHGA 3N1PC 3AC0A 3GKWL 5DWUH 3H9HB 3M1BB 2ZKHH 1J8HE 5BVPH 3OBAA 3BGMB 1EGJL 3FZUC 4QTHA 1YDPA 3REWB 4N90D 3BDYL 1X3DA 3A67L 4HIIB 5E7FA 1U8HB 1R3KB 4BSJA 5F72S 5TE7H 3EOTH 3FO9A 3T2NH 4XRCB 3W0WA 1G9MC 1OP9A 5D7IB 4KHTL 1TPXC 4P2RB 4Y8AA 5GRJH 4YLQT 4OCNC 1EDQA 2W0PA 5J9PA 3QZWA 1IAMA 4WFFD 1MWAL 1Y0LA 3FZUD 3NPZB 5ICXB 4NOBA 4KJQC 5B3JF 1CVSC 5IG7A 1U42A 1LP9E 4PV8A 3QNYA 4HLZH 2ESVE 1R3JB 4JN2A 4XNUH 2BFVL 3QDAA 3BEWB 3MUGA 5EZOL 4XBPB 4RQQA 3P77A 4F15B 5A2JH 1BWMA 5HHOB 1QNZH 1UACL 3WFDH 3SGKA 3KPTA 3PV7A 2GT9B 4LPYA 3DGGA 2YN5A 1KYOJ 4NKQB 3BIKB 1JI1A 3PQYA 1RD6A 5DJ6A 3FO2A 4JKKA 1H5BB 3GMRB 2NLJA 4KJQD 4YHOH 1OF2B 5FGSA 5I1AA 5I19L 4OZHA 3MOQA 4DN4H 1J7VR 1CFSA 2X1PA 4IS6B 4Q9CA 4LMQE 1F11B 1PFCA 2EXYC 4K3GA 1TTUA 1AR2A 1PDKA 5DC0A 1A6TA 5H8DA 1HWHB 2WINA 4E5XA 2UWEA 4RGNE 3WIIH 4O4YH 4ZUWA 1TLKA 1UYWL 3PV6A 4KROC 2K3TA 3DYPA 3KPQB 2GUOB 4N0FB 3BZFB 5DQJB 2XTJB 3ZE0F 1KT2A 4QRSB 5FYJL 2BMKA 5JXEC 1OAZL 3BYTA 2UUDH 5HYQB 2Q7YB 3VFOA 1WWAX 1ERNA 2APBA 3QIWB 4UZGA 2K7PA 5GS1A 5HY9A 1TVHB 4HXBL 3UP1A 1KJVB 5B3NA 3WEXB 1A0QL 4WFGE 1VEMA 2FJHB 4D0DB 4TVPL 3TVMA 4KROD 4N1CA 1G0XA 1WCBA 2O5YH 5C0CB 2IH1A 3EYSH 3PWVB 4NN5C 3U4EA 4YIQB 4ZYKA 3L3HB 3LRGA 4IOIB 5HGHB 3SDDB 5GRUL 4WW2A 1X7QA 3GSNL 3QCTH 3SQBA 2NXZB 5KS9A 4MJID 4LHUG 2I9TA 2IADA 3HHRB 2JCCF 1NAMB 4GRMB 1AIFB 4Y2DD 1T4KB 4J7RA 5C9JA 4YHNB 4OV6F 3OB0H 4F3FA 1BMGA 2W92A 4I18A 1OY3B 5J6GB 5BXFB 4URTB 5GGTA 4HFWA 4ACPA 3ZDYF 4A6YL 1JGUL 4YHLH 3GJFA 1G84A 2XQBL 1AGEA 3GSVA