5DVKA

Fc design 7.7 b chain homodimer t366v/k409i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA01
4NO3A 4X9IA 3REWA 5ID0B 1XCTB 4XVSH 4ONGH 3ULSB 5EU4A 5MERA 5HVHB 4MB4A 2RCSL 3EO0B 2BFVH 3WHXA 1H0DB 4MQTB 2C4FU 4RFEA 1T20B 1VFOA 3FB5B 4MXQC 4DEPB 3TF7C 4OIIH 2E7CA 1LO2L 2Z0BA 4OLWH 5DHXB 4JKPH 5SWZD 2GFBB 5BQ7A 4OGXL 4XX1E 3C5ZB 4MAYA 4PRHD 1BBDH 3KPOB 1S9YA 2Q87A 5A43C 1FNGB 1JGUL 4MA7L 4K3JL 4BSWB 1NEZB 2R0LH 3VXME 4NC1E 4NGHH 4UT7H 3S4SB 4OZIB 4U3HA 5HSFA 4NM8H 4JN1L 1QKZL 3TLRA 3MJ6A 3ESVF 5E2WL 4HUXA 4RMUA 2G60L 4OLXL 4TNVF 4P2QA 3CX5J 1G0DA 4JQIL 4HQQH 4JGJA 5ICXA 2YPLE 3QDMB 5IQ7H 1MSPA 3IJSB 1BJ1H 2A1WL 5INCA 2QSCH 3FQUB 5DHVA 1EVTC 4GRWB 4MQ7A 1R3LB 5GRYA 1M7IB 4FZEL 4ZUWB 15C8H 2AXFB 4AM0A 4N0RA 5L2KE 1T04B 2WIIA 3UTOA 5H37H 3TZVA 2VN7A 3BKCL 4AH2A 1LMKA 4GW4B 3H6JA 4LGPB 3ULVL 3C09C 1XGQB 4MD5A 4U2YA 4PJEA 4NNYA 4APQC 5DFTA 3DV4B 3GSVB 4XMKL 5CLTA 5CP3A 1T21A 3MV9A 5D7LA 5MEND 2BZDA 3P4MB 2EYSA 5IF0A 2GUOB 1EGJH 1NGWB 3VWKB 3FTGA 2ESVE 2PTTA 3ZTJG 5DUMH 5EDXA 1U8HB 3PG2A 3DRQB 1HH6A 3BT2L 3SDDD 2LU7A 3KYNA 4U1JA 3UAJD 2BVPB 1CLYL 5J3HD 4JY4A 4NM4H 2G75B 5D6DC 2EIBA 4YR6B 2Q6WA 1IQWL 3U4EA 1J12A 4MMZC 4NPYB 4R4BB 3ZKXC 4F7CB 4CW1A 4M62H 3PQYB 2EDTA 3SKUD 3I02A 5C0DA 4PGBB 3K8MA 4HG4J 5CJOL 4Z76B 2XFXB 2AK4A 1ZHBB 4OFYD 4M93C 1U3JA 4PRPD 5DI8A 1RZJH 1J1PH 3RIFF 3NZ8A 2CDEA 4WUUE 2F8XC 5H35B 2P5WE 3O9WB 2JJTA 3MV7B 1TETH 2VE6B 3QXAA 1KT2A 4NRYA 3V7AG 4UDUB 4YE4L 2HRPL 4M5ZH 4BZ2H 2DWDB 4ZYKB 4MXVE 4K55A 4WIQA 1MCDA 1ZSDA 5HGBA 5F1NB 4CUCA 2EIZB 3NCCB 5D2NC 3TNNB 1ADQL 3SGKA 1NFIA 1U2HA 3HG1A 4LP4A 1HHKB 5GSRB 5I9QB 4JR9H 3BAEH 5IP4A 2HG5A 2P5ED 5E4IA 3STZB 1IEAB 1RZ8A 2M1KA 5DMKB 3EW3B 1AD0B 4W6YB 2QLVB 3ARXA 3TCXA 1JGDB 5CFHA 1F4WL 1UM4L 5D8JL 4H20L 2APFA 4F7MB 4I13B 5EC1A 2LVCA 1LEKB 4XP6H 1EFXA 1MRCL 1A9EB 1P6AB 2V5TA 2XYCA 4PJXB 4ODVH 3VH8B 2E6PA 3VFSA 2DQJL 4P59L 5JMRA 1AGBA 5INDA 4GUPB 5I1GL 2C1OB 4JRYA 3GIVA 5HGHB 3IDJA 3H42H 4ODSL 5IVZA 1K5NB 2VKXA 3UX9B 4P4KD 3V6ZB 3QEGH 3FO0L 3V0WL 3RVXD 2ZCLL 4JM2B 1FGVH 1NLDH 3LIZL 4NQEB 4BZ1L 4Y4FC 4XTRC 1LP9F 3LH2H 4J6RL 5CEZH 5I66B 1M4KA 1P7KA 3O6KH 5IBUB 1N8ZA 3FO9B 1EH9A 1S7WB 5BW7A 5K9JH 1IC7L 1AQKH 5IHLB 2GYSA 3L5XH 4X98A 2IADA 4WO4D 1KJVB 1R24B 1M7DB 4KK6C 3MLSL 4KUCD 1CXIA 1FO0L 4LSPH 1VSCA 1UWGH 2P42B 4IOFC 1PFCA 2VSCA 1I1FB 1BLNB 4CVWA 1YEKH 1MLBA 3OKEA 1H9VA 3KLHC 4JKKA 1LO4L 1WZMA 3QDMD 5KZCB 1S7TB 3DYPA 3RKPA 1ZGLB 4WEBL 3GSWB 5HHOB 5DDHB 1I9IH 3DNKA 4X6EB 4DOHE 5C0JA 3O3EA 4U1NB 2YEZA 5E56A 5FOBB 3IKCA 4LPVA 3VMOA 3HZYA 1J86A 3IDXH 3SO5A 1KG0B 2NY5C 4HK3N 4LCYA 4M6OH 1IGCH 1T0PB 3ARSA 2CR6A 4K7FB 3AVEA 4HWBH 4JFXA 3A67L 1BD2A 3ZSTA 3LKPA 5EBLB 2VQTA 1D7FA 1UA6L 4JM2F 3LMJL 1TVBB 2H9GB 5JIIA 5F7YC 2X1XR 4QRUA 2FX9L 3EDEA 3L3JB 4UTBL 2Z91B 4GKZB 2FBJH 4IHOA 5FUCC 5A1AA 1MF2L 1SBSH 5KSBA 4NBYB 4HSQA 1EAPA 4PIRF 5I76A 4XTRD 5HY9A 4NYLA 1G9NH 1IJ9A 3PE9A 2Z92A 3ZHLA 4ENED 5C6WH 3HC4H 4KMLB 4M6OL 4HMCA 4DKEL 1INEH 1F2QA 1MPAH 1YEGL 4M1DH 4LRNH 2VISB 3UTPE 5F71A 1KEML 1OTUD 3MRQB 5EULV 5T1MA 4XBPA 5C0IA 2DJUA 2VXUL 3HZKA 5GRJH 3C5ZD 3V9FA 4O00A 4PJBF 3BPLB 1I8LC 3QUYC 1BD2E 3HZMA 4NHUB 4XCNA 2D3VA 2XN9A 5J89A 5T3ZL 5HHXH 1BZ9B 2WINB 4NO0B 5CJ8A 5I1LB 1FNLA 4LHUG 1ETZB 1TQBC 4P2OA 5AUMA 4U1LA 4V2BA 3S37X 4DZ8A 3GEWB 2WIIB 2FJFB 3BWUC 1HWHB 4M7JH 5DSCA 3QDJA 3O2DA 3V4UH 5DURB 4XC1L 3CFDB 3CFEA 1R5VA 2VXTH 1TCRA 2B1AL 2UYLB 2HLFC 5F96H 4DGIH 5TF0A 4QEGA 1I7ZA 1CBVH 1S7SB 3DVGA 3P0GB 4MCYA 1K4DB 4F57L 1R6VA 1QLRA 5FKAB 1AY1H 5E4EC 5FHAL 3ARPA 2KQNA 4KXZI 4Y19B 4UUJA 1LNUB 3LN5B 2WUBL 1KELL 3QWOB 4C83B 4TUKL 3UC0H 4KQ3H 3SE9H 1F4WH 4KK9D 1YEEL 3I9GL 2Z8VC 4WJ5A 3BRGC 1AI1H 3QQ9D 3SGEH 3ZYOA 3G6JE 4P2CG 1C5BH 4TVPL 2W9LA 4G8FB 4IMLB 3G6AA 4OD2B 5E9DD 1OSPH 2ADGA 3I50L 4C54A 5IJVB 4OZHF 2R8SH 1BFTA 1J18A 2BSRB 3DSNA 3MUY1 5C09A 2APWA 3PP4L 4ZAKB 2YD8A 1SJHB 5F3BB 2BSTA 1ZHBA 5FUZH 1PG7L 5J1AB 4DCQA 5J6GB 5DJ2B 4DKFL 5CEYA 3FO1A 4PRDB 3UPAA 2YD3A 3L5IA 3PGCB 3BQUC 2PNDA 4JFOB 1QSFE 5JHLL 2LE9A 3JV5A 3KJ4C 3DXAB 4PJ7F 5HDBE 2X4QA 3O81A 1IAOB 1DBAH 3NCJL 1H8OA 5CZVH 4UQ2B 4FXKA 4P0DA 3V0VA 2DDQH 2LAAA 4HT1L 1KCSL 1DLHB 1N59B 2R69H 1XGTB 2NYYD 4XAKD 5EO9B 2JJSC 1Q0YH 3QFDA 5E7BA 3RIAK 3R8QA 2EO9A 3WUWG 3IAGC 3MODH 1AXTL 2NW2A 4H25B 3PV6A 4XZUB 3DRQA 3TO4C 3BZEA 5EZLA 1LO0L 2K1MA 1KXVC 2FGWH 3GKZA 2BOBA 4DK3A 5D2NB 3QXWA 1L0QA 3OR7B 3KS0H 4EKXA 5IKCB 4MJ5A 4PJIB 1ZEAH 1KPVA 1PJ9A 2QEJA 4JFEB 2D31B 5A16B 3V6FB 5GS0L 3NFNA 2PYEB 1QHPA 2AQ2A 3PQYA 4LARH 4NUJA 5FM5O 4WI2A 4F2MB 4P9MH 1INQA 3C2AH 4FQHA 4WFGE 4QTHB 4CN6A 3OAZH 2C3VB 4CDHA 3UTTB 2FX7L 4ELME 2KZ1B 3MA9L 1RURL 3BIAX 5FYLE 4HJGB 5JUEL 1P7KB 3BJ91 3O8XA 1MHEB 1HKLL 4LLQA 3RWDA 3MLZL 4PJBB 4BSJA 5DK0B 4X6CB 1RUPL 1CLZH 4OD1L 3D2UB 3WSQL 3SDCB 3DO7A 5D1QA 3PWPD 2RAMA 3N1GC 4MJ6B 5HVWA 1K4CA 1CLOL 3W82A 4OLVL 3LQAL 2XZZA 4IOIB 5C0GA 3PWNA 1HHKA 2R1WB 3SOBL 2IPKB 4BK4A 4EZMA 3SDYH 4TVPE 1DN0A 2NXZD 1HHGB 4L9DA 4HX1A 5D2LE 2OS7A 2AI0H 1VGEL 3B5GA 1IZJA 4PLKD 3VMNA 4LSTH 5E03A 3QCUL 2AJVH 4HWEH 3VXMA 4PLJD 2R0WL 4OM1L 3LKSA 3VRJA 2F74B 3CZFB 5CHNB 4QHNA 3HC3H 1JYXA 3T1WA 1K9TA 5F44A 4GRWF 1QBBA 2QHRL 4HXAL 3GMPB 1TZHA 2ZUQB 3BPOC 4KZEH 4B7LA 2IFFH 2DKMA 4QWWC 4D8PB 5MEQA 1UA6H 1U8MA 5T5NG 1E4WL 1ZVSB 2BCKA 2HAZA 5EUKA 1TVBA 2H9GA 1EPFA 3HI6L 1IARB 4JPVH 1G84A 3ETBF 1A7PH 4O2EB 1AKJD 2MPAL 4PRAB 2PYFB 5F9JA 1KACB 1INEL 2WBJB 4U4BA 2HFGH 1NAMA 1JZ4A 3OJ2C 2HVJA 1MHPL 4BKLB 2P8PB 3GRWH 3RFZC 3GRWL 4UBDD 3O3BB 4NYLB 1XCQA 3MROA 5MEPA 2JE8A 5IM7B 5HHNB 3IDMA 5B38G 4RGNB 5FECB 1YEIL 1YMME 1YPZB 1D9KD 2FH8A 1ODAA 1A47A 2NY4C 5IG7B 4XNXL 4JLRA 2VH5L 1YMMB 3QIUA 3MV8B 3TN0D 3OMZA 1A7QL 4I4WA 5KS9A 2B5IC 3OBAA 5DJAB 3RWEA 1V3KA 5J8OA 1GOGA 4XMLL 5AG8A 2YKLH 1B0GA 5BV7C 3HZYB 2M8XA 1AGEB 4YXKH 4OJFH 2N7AA 1KJ2L 2XN9B 4PG2A 2WINA 1AKJB 1CR9H 4FQXA 1A21A 2VIRA 3U7WH 3HUJE 1C5DB 2EH8H 1KIPB 1JGLL 4XPAH 5EU5B 4P2OB 4JFXB 5D7JC 2EO1A 3S96B 4A6YH 3MUGA 3QEGL 4XB8A 5E6IA 2CR3A 3W5MA 2ZSVB 3BSZH 3QXDA 2DTSA 4YXLL 4KKBD 5D7IE 1JPSH 1NPUA 5DMGC 5ANMA 3IT8D 1PYWA 2W65B 1U3ZA 4PJ7A 2FATL 4YDKH 4Q9BA 5DHYA 5FKAA 5C0NC 1N6QL 1F2XK 1UACH 4GW5B 5KJRL 1CFNB 2MMXA 1I1AB 4LASH 3QZWA 4H20H 1GIGH 5HVFB 2V7HB 3RNQA 2Q8BH 5FYLL 3UTZB 1JE6A 2G75A 2YK1H 3QCTL 3OGOE 5GRWA 1RAMA 1TJHL 3C5JB 4OZIE 5DK2A 4G9DB 3RDTD 3QG6A 1G7HA 3S3JA 4I48B 4I2XB 3MFGB 3CX5K 4JFFB 3ZKND 4RAHA 3SDCD 4C56A 3QUMA 5J4MA 3ZE0F 3GMQA 3IU4L 4LLDB 1YDPB 4CNIA 2DQCL 3VXSA 5K9KB 2H41A 3X13B 1R5VB 4PTTA 3GK8H 4QRSB 5HTSA 4NNXA 3HC0A 1ES0B 3WSQH 1CD8A 3MJ9H 4UQ2A 2I27N 3QO1B 3LEYH 4P2QD 2R1XA 4QT5A 4DKAA 1K4DA 3GBML 4X6DE 3CXHJ 4HKJA 1XMWA 4PJHF 5E8DL 1MH5B 4M9OA 3RKDC 3KPPB 4ORZC 4UINH 4QCIA 2FO4A 1YA5A 4LFHG 4UQ3B 3DBXB 5DJYB 3VXOB 4NSKB 3UJJL 4IRZH 1YN7A 2Q7YA 1PSKL 1LK3H 4FXLA 4X9HA 4JKLA 5E9DE 3ZLQC 4OV5B 5F9DC 3SKJL 1GC1C 3QULB 1BQSA 5IJKC 5GGSY 4XI5D 3GMRB 2KH2B 1F02I 2R0WH 4PG2C 2IG2L 3VXNA 2VXVL 4BFGA 2F53A 2PYEA 5LWYH 1TFHA 1JHTB 2MKWA 3F6IA 5D2NE 5EU4B 4TN9A 2BSTB 4Z8FL 4J12A 4JQVA 1YMHB 4U1IB 2A77L 5I9QC 1X5XA 5F7UA 2R8SL 3HE6A 3TYGH 1N5YL 1OM3H 5KVFL 1D9KA 1MCFA 3KYMA 3WNPA 1A7NH 4MB5A 3OXRA 1JCKA 1DUYB 2VL5B 1GPOL 4MX7B 1MNUL 2AK1L 3ARTA 3WS6A 4MXWH 5ABDE 4F9LC 4MSWB 3MV7E 1DLHA 1YMMD 3GMOA 2Y07H 3L3HB 3OKNA 3O0RL 1G7QA 3KPRB 5D1ZB 4KHTH 2GT9B 4P57B 4HBQA 4N0CC 3NPSB 4JDTL 4IS6A 4PP2A 4R7DA 4IOIA 2WV3A 1UWXK 5T3XE 5GGVY 3TH2T 4N0UB 3BPCB 2AJXL 2IALA 3WUZA 2DICA 3PHOB 2EE6A 1MLBB 1UGNA 3LKNB 1QSEB 5C0BD 4JZJA 5IK3B 5INCB 4MJ5B 4HPOH 3IFLH 3ZKQD 4EN3B 3LSOA 1G7IA 1W2KT 4X6EA 1YNTB 3W2DH 2P46B 4ELMF 2KBGA 1PEZA 1OAZH 3EFFB 5F9WB 2N1KA 2NTSP 3D1MC 5IHBA 3KNBB 1S78C 1MRDH 3ULVE 1YC7A 4O58L 4H26A 2PO6D 5H37G 3BIBX 3PP3K 5I1EH 2R9HC 5EWIL 3THMH 3OKLB 4PRPE 1J0ZA 1IC1A 5DJ0A 1VERA 3P9MB 4IIQA 3UYRH 4EIZC 3U0TA 5JQHC 3HRZB 4KRMB 5ENWA 4Q6IB 2CLZA 1KUMA 3V4PL 3KYNB 4ESKA 1A6AA 1KJ2H 1QEWB 4EI5B 2V5SA 1T1YB 2NLJA 5J12B 3QWQB 5CZXC 3ZKSD 3SDAA 2Y23A 2IFFL 3EYFA 5I2IA 4N0YH 1CI5A 4AIZA 1MIML 1JPGA 4XP5L 2D0GA 1RZKL 2NY1C 1QRKA 5DJXB 1Y0LA 3LEXB 4XNQB 1XAUA 2ARJQ 2PN5A 4HWBA 3H3PL 5J11B 2PYED 4I5BB 4HIXH 3MRCA 1G6RA 1N2RB 2AI0L 3RY5A 4GSDL 4NWTH 2AVGA 1EUUA 1Z5LA 3NBNA 4YAQA 2ICWJ 1JRHH 3RI5F 1J05B 1QO3B 2VLJA 3QA3B 4H1LG 2WZPD 4PS4L 1YJDC 2XA3A 2FWOA 3S35H 1GVIA 1HIMH 3VFOB 4KKAC 2ITDA 3WCYA 4KTYA 1QRNE 3OXSA 4M4RA 5E1AB 1C16A 1B90A 5JW3H 2IAND 2Y5EA 3SKNA 1QLFA 3QH3B 4J1UB 4Y19A 1RY7B 4OFIA 4Z6AT 3SN6N 4NNPL 1ZK9A 4LLMB 1IGTB 3C60C 1U0QA 4K94L 1MAJA 3RHWK 4F33B 1LE9A 4GUPA 3ZYJA 2EE9A 3UTZA 3MXWH 5IFJA 1JPTH 4FTVA 3BPNC 2DQJH 1OF2B 4HIEB 3C5JA 4M6NL 3P9WB 3LRSB 5F1KC 1OD7A 2D0HA 2JLLA 2XPGB 4OBRA 3X11B 5ERWA 2V5YA 3B9VA 1JN6B 1NGXA 2F8OA 2HT4C 3H7LA 1T0NA 3V5HB 2PR4L 2LTQB 3IRZA 4NZRL 3PWLB 4G8GA 4KVNH 2BMKA 3S4SG 4TQEH 2ICES 3GMMB 3WEXB 4IRJB 3V7AE 3BEVB 3GSXA 4EN3C 4YIQA 4PRHA 4OLUL 3K2UH 2AP2A 1X3DA 4XGZB 1QSFA 3FQRA 3LKQA 5ALCL 4K9EL 3EO1B 4WW1B 3SBWA 1FC1A 4ZPTB 4JRWA 4FQ2L 1H15A 5FA4A 1B0WA 1LDSA 1XF4B 1I9JH 3EO9L 1HOCA 2GEEA 3NPSC 3RIFK 1A6VH 3LV3A 3BOVA 4U1NA 3T3ME 4HDIA 3WLWD 1D3CA 3QDJD 3H42L 2WW8A 4FFWD 4LLYB 2RFXB 4J2XA 3MCG1 1WEJH 4ELKA 4JRXA 4WNQB 1EEYA 3RRQA 4K7FA 3OF6A 2FYYA 4YDLB 3QUMH 3Q6FA 3LKPB 4TSBH 4JFZH 3TV3L 5J7CC 3F7QA 2ED7A 4FXGA 2R69L 3OAYH 1TZIB 1FLTX 4JRXD 3MTRA 2I5YH 2V2WA 2ZZUT 3FB8A 1N4XH 2OK0H 3JWOC 5J3HC 1YY8A 1IM3B 3T0VA 2V9QA 1FC2D 4PFEA 2ZJSH 2NYYC 5BO1L 1CFVL 2ZSWA 3EYOA 4XVUD 5CS7A 3SCMB 3VG9C 4Z7OE 5I8EA 2BVOB 1ZS8A 1KSRA 4IRZL 5EOQH 2XKUA 2DQEH 1CFSB 5E70A 3DSFH 3ROLA 3DETD 1LK2A 3DX9A 4XAWH 2H6PB 5HBBA 1X4YA 4MSWA 4WI4A 1ITBB 2VXTL 4CRPA 4LRIA 3DPBA 2OTPA 1UM5L 1R3HB 5DUML 1G7QB 3DI2B 3DV6A 1EGJA 4F7TA 3PWVB 1BP3B 4GAJH 1MH5A 3MRJB 3OKYA 2CRZA 3CU1A 5C08B 3BMWA 1CU4H 4OV6F 3T0EA 2C7UB 3KXFE 5CD3A 1UKQA 4MDIA 5HDLA 3WFBH 7CGTA 1TVHA 1XR9B 3QG7H 5FYKD 4NO0A 1CGYA 1NGPL 3WJJA 1QUNA 2YD5A 2Z31A 2AV7A 3W0WD 3J7HA 1U58B 4U1SA 4GAGL 3QXVA 3HS0B 1S8DA 5TQ2H 4DZ8B 1GYAA 4GRWH 5EN2B 3LS4L 5GS3A 3TBYA 5IHZA 1QG3A 3CFDA 3PWPA 4EIGB 4FTVD 4JO3H 5EA0H 1OQOA 4QRRE 4OF5A 3NPZB 4UT7L 4DKEH 3PABB 3VXRA 2F8VA 4G80A 1W0WA 4Y5YA 5B8CC 1WVZA 2XG4A 4QRTB 4YBQC 2D9QB 2FCBA 1QACA 2YWYA 3EFDH 4JO4L 2AXHA 3DGGA 5F3HA 5TDPB 5IVXB 4NIKB 5EUKB 5C07D 1IM9D 4IRSD 4PJGE 3VXRD 3BUYA 1WISA 3CAFA 1V7MH 3C6LB 4OGZA 5C0CE 3R1GL 1JZ7A 4EI5A 1MFNA 1ZT7A 3MR9A 3NH7H 1Q94B 4Z7QF 3ESUF 3MCKA 1GPOH 4L8CA 2V5RA 1OWRM 1N64L 2X4PB 1LO2H 5TJWK 2JJSA 4ZG1A 1T5XA 1JF1B 1YEDB 3GBMH 2HFFA 5IG7A 3VRIB 1H0DA 1TXKA 4RFEB 4BUHA 5K9OB 2X4SA 3FMGL 3D3VA 4X5XA 2WQRA 3WD5L 1EZVY 4FA8A 4ZFOL 1QBMH 3IXAB 2AS5M 3SQBA 5A2IH 5EOTB 3MSPA 4HKXB 4U3CA 3U46A 1Y6NR 3EFFA 5CILL 2IAMD 1NC4A 3C9NB 4R26L 3OKDB 2X4RA 1P1ZB 3H3KA 5AG9A 1OARL 3KHOA 2BNRA 1KIPA 1EV2E 3JTTA 2BC4B 5DVKA 3TJEL 3KWWA 3D39B 5ADOH 3I6KB 4ETQB 3WFCH 1XCTA 4LEXH 5CINH 3MNZA 4N8VG 2Y7QB 3QI9B 5CEZD 1K8IA 2C3HA 2DM2A 4Q6IA 1I3GL 3BZEB 1JP5A 4Y2DC 5C0AB 3T2NH 5JOPD 1IC7H 4N90E 1FYTA 2XZCL 5GRUH 2V2TB 1CXFA 5T3XD 5EWIH 3THML 3BUTA 2CIKA 4U1MB 4PRIE 4ZSOB 4M3JA 3DROA 5A16A 1REIA 1LEGA 1CFNA 1FAIH 1AO7B 3DURB 1G9EA 4POUB 1C12A 4MNQE 4DOHB 3WFEL 4JDZA 1KTDB 4ORGB 1OGAD 3BD4A 2NNAB 1O7VA 1OAUH 1RVFL 1XGUB 4HIEA 3KLHD 4H8WH 3FTGB 3QQNA 1AR1D 2B1HH 5E9DA 3BH8B 2X4UB 2UV3A 5C0AD 1OT2A 1R3LA 1V8HA 2SEBA 5IJKA 3DO7B 3A6CL 5E1HB 1ZANH 2X42A 4R2GB 4JANB 5LVEA 4ODWB 5CBEA 1KB5B 4RBPH 5BJTA 5TPWH 5D7IB 2VQ1B 2VC2H 4JZJC 1J0HA 3RGVC 4RGND 2ORBH 2R9HD 3CFCH 1WC7B 5I30L 2PO6C 5I1GH 3MLRL 2VWEE 4JQVC 2AV1B 3AU1A 2AK1H 1JI2A 1KLFA 1WGOA 2YUVA 1WBZA 4PJAF 1PEWA 1DFBL 5EB9A 3L3KA 4LHUB 4NCC1 3IKKA 1P84K 1WAAF 3DTXA 5JOFA 2R29L 4ODBD 2HH0L 4QHNB 1IGJA 1RU9H 5GRVL 1A9BB 4M7ZB 2VSDA 1Z9MA 2IPTL 3BXNA 4AEIL 2OQJB 3IF1A 3FRPA 1O5DT 4FQJL 5ALBL 4Z7OF 3V4VH 4DN4H 4JFHE 1YNLH 1A5FL 2AW2A 4OCWH 1QQDA 2DLIA 4KRLB 3RWIA 2F53E 2FBJL 5FHBL 5GGVL 4CJ1A 3ARFC 1ZA3B 2ADJB 1DANT 1QR1B 3ZDXF 3PWLA 4WHTA 5HVGB 4F7EA 4NRXB 3SE3A 3VFWA 2VMFA 5EZJB 4ZXBB 4MVBD 5IB5A 4D0DB 3KPRD 1D5MA 5C92A 4Z7UF 1IQDB 3GSRB 4G6KH 3LAFA 1NFDA 3QQ9C 4R90H 1NSNL 4M7KL 5FGCE 2OTWA 2NX5E 4K9EC 4OUOA 2BVYA 5KVDH 2OJZH 3MFFA 1I3VA 5HGBB 4XPGH 1NC2B 4PBVC 4R4FH 1NL0L 4U2ZA 4Y0GA 1UWEH 2WWKT 4UIKL 3F12A 3UTQA 1FZMB 2PKDA 4GRLC 5T5FH 4P2QE 1S5HB 4JM2D 4WI5A 2YPVH 2LABA 5EG6C 4FABH 1TVHB 4ZO6A 2HTLD 2R0ZH 4UU9B 4WW2B 3CIQA 3AUVA 4XVJH 4NKOA 2Z31B 4ZUVB 4UT9L 2HWZH 5C08D 4O2FA 4JY6A 4U6VH 4NBXB 4FXGB 5IHZB 4ZXBD 3IGAA 3DUUB 3V0AC 4JHWL 2F15A 1TPXB 4J3VA 4X7SL 4TNWF 4ZAKC 3V4PH 4WWID 4L5FL 3EYVB 2GK0A 4FP8H 4JFHD 5ELIA 4HS8H 1X6LA 5I71B 3EFDL 4JO4H 2ZUVA 1N6QH 3O6LL 5IMMB 2XZQL 1FNFA 4OB5L 3DLQR 1YPZF 4KRPC 3MRRA 5D6DA 2XTLA 4HF5L 1CT8A 4H0HB 2J5LB 4Y5YC 5DFVC 3STLB 1NCAL 5CSBA 3MOAH 4UT6H 5L8KB 2A1WH 3ORJA 4OCXL 5SWSE 3BVNB 3O2VH 3LKOB 1VB9A 1T5WB 3SGEI 5HHVL 4N0UE 2YR3A 3ZYIA 3BIKB 3IDYB 3UJIL 5HYJA 3MCKB 4XNUL 5HXMA 3EYFB 3ULVC 1U93A 4UIMA 5ISZE 5C9KA 1JNNL 1FGNH 2HFFB 2R2HA 4G42A 3WXVH 2EDWA 1B0RA 1WICA 1RQ5A 3UO1L 3QIUC 3SGJA 2VDQL 3TH3T 4MMXC 3IAPA 2CJUH 1HHHA 4M00A 1MJUL 1ED3A 3HAEG 2B0SL 1G1CA 3FFCD 1X5ZA 4MB3A 5DRWA 1BQHB 4LCIL 4PJXE 3BN3B 2H3NA 3KYOB 2X4RB 4UV4H 1P1ZA 3CCHA 4GMSL 1ZLSL 3ARED 3M1BB 4X6CE 4PJ9C 5AYQA 4U0RB 3FFCA 2OBGA 4C58B 3KWWB 5JIKA 2BJML 3SGDI 3MV9B 5D7LB 3MODL 1NCTA 1FBIL 4XPBL 3I50H 1MJ8L 4KK9C 5E8NB 2DLEA 4U6YA 5D71H 2A9MH 3IJHA 4P5KA 4G6FB 4OFYA 5EU7E 4X9GA 2FX8H 4ZPVB 4E0RB 4RAVB 4XPTH 2DB8A 2EYTB 4Y1AD 1HDMB 3AY4C 5E5MB 3X3GH 2XA8H 1A22B 5GGSB 4FFVD 3B3IA 2EC9T 2Z92B 4JQXA 4IM8A 1ZOXA 4M93B 2AJ3A 3QEQD 3X12A 2Y36H 4HCRL 2Y72A 2RHEA 3QUKB 5EOCL 1AHWC 2H32A 5IMKA 3MLXH 4MHHI 3Q3GB 1PSKH 4NCDA 3I02B 3RJDA 3GM8A 3QIWB 3WNKA 3OKKB 1PAMA 3ARGA 4DKFH 4PRNB 2AEQL 4Q9RL 4WUKH 4OF6A 3B9EA 1HE7A 1FRGL 2Q3AA 3LOWA 1H3GA 3CH1A 4YHLL 1ACZA 3VGAB 3U46B 3WNLA 3KYMB 3RAJL 3IFOB 3TBTB 3B6SB 2YPLA 3IDXL 3LEYL 1JGVH 1BREA 1F3RB 1F5WA 4J4PD 1G7PA 35C8H 5IQ9A 4XNZC 1MHCB 2GJ6A 4BQBA 4QGYA 3B9KB 2VZ1A 1GOHA 1CD0A 1HSAA 3HMWL 1WAAE 4PP2B 3AXLA 4R7DB 4NFCA 3B9AA 4JM4L 4M6NH 4ONHB 2D4DA 2IALB 5GGTL 2EEDA 4KKBC 3MRLB 4YHIB 3CVIL 1A3RL 2O5YL 1UH4A 3F5WA 2AV1A 5JW4R 1BFSA 1TTUA 2F58L 4L4TB 3W0WA 2CDGB 5FCUH 3LN5A 1G9NL 3W11C 4PY8J 4PJXA 2X4QB 1G0YR 3H7BB 2JCCB 1H3UA 4IOFD 4HIJA 4P3WA 2EKSB 5JXEA 5F1IA 3ARYA 5F1SA 1J8HE 1EO8L 1SY6H 1KGCD 2CH8A 4S1DD 2P45B 3MACL 2ADGB 3TPUA 3TO4A 3O6FC 2VZTA 3T4YA 2OL3H 4O2CA 3VJ6A 5C09B 1MCLA 4OLWL 4CL7A 3SHSA 4NO0D 3P73B 4O51B 3OX8A 1R3JB 1NBYA 1T20A 2JIXB 4G8GE 4Q0XH 5GGTH 3RGVB 5D1XA 3RWFA 5FYJE 1T1XA 5D2LA 3IVKA 2IH3B 2M2DA 1EHNA 4H8WC 5I8EB 2VQ1A 1DUZB 3DRTB 1FIGH 1VFMA 3C60B 4L8BB 4HMEA 1W0VB 2HN7B 5IVOA 3GNML 3QRGH 1LQSR 4FXKB 3JWDC 4P49A 3S9DB 3EZJB 1R3KB 1RIHL 4JJHA 4NWTL 4YX2L 4QOKD 3KJ6L 1SYSA 3Q1SH 3G5YB 4GKNB 5IFAH 3MRPA 4YGVB 4XMLH 4M02A 2HKFL 5J06A 2NW2B 5LGHL 4ISVA 4HFUL 5I75B 4XP5H 1U8LA 2DQFA 3MRBA 2CRYA 1A9BA 2XQBH 1CVRA 1U92A 4OCLC 5ILTL 3X14B 1T80A 3QDME 1JPFB 4WW2A 3WIHL 5C1MB 1F4YL 3ZE2E 1OSPL 5M7QA 2P44B 4JQXC 3TBYB 1J1PL 3UTSD 3EYUH 1LE5B 3SJVE 1OT1A 3VFNB 3P11L 3SJVB 4KZDL 1SJVA 4NT6A 4N5EC 1UQSB 4K23H 1CFQA 4I18B 1J10A 2J8UE 4NNYB 4Y5XC 1MAMH 3RWHA 5EIIB 2XWTB 3FB6B 2C5DC 1BVLB 5I76B 3FFDA 1KJMB 3ELAT 1BOYA 4MJ2A 3S34H 5TFSH 1L9MA 4F15B 1CS6A 4L29B 4P46B 2YBRA 4M8QA 1ZVHA 4LCIH 3IS0X 4N90D 4KGJA 3O6ML 3HE7D 4DGVL 1W72L 1DQJB 3T3MF 4X4YA 5JUEH 2FD6H 4N0CD 3INUH 4L8CB 3FONA 4OAWB 2EE3A 2J4WH 2L4OA 4L4VB 5IIEA 5CJBA 4AL8H 3O6MH 4HX1B 4O2EA 2ZCLH 1HQ4B 2VABB 4PTUA 1QSFD 4GXVL 3A6BL 2HRPH 2VZOA 4M5ZL 4MXQD 1T1WB 1XF5A 5FV2A 1GGCL 2Q20A 3DVNA 5E6ZA 1Q8MA 4ZAKD 4RQQB 1KXTB 1KCLA 3UTSB 1P2CB 2VDRL 2HTKD 4BFBD 2H2SC 4Y4KB 2F74A 3ZDYE 2GJJA 3CH8A 5D72L 3OG4B 4Q9CA 3QUYD 3VE0A 1A6ZB 3U0PA 3OKDA 2A77H 3ALWA 1IE5A 1OPGH 1BFOA 2CGRH 4U49A 4QOKA 2R39A 2FGWL 3O3AA 4OLZL 1MHHB 3MRDB 4Z8FH 1ND0A 3BRDA 5ICYA 4PG9B 1ZHNB 3HNVH 2EKJA 1S7SA 1AXTH 2PW2B 4WV1C 3I6KA 4ETQA 3EDFA 4XPFL 3MJ8A 4AMKL 2Y7QA 4NO2B 3X3FH 2O5ZL 2P8LB 2W1NA 1SEBA 3I75A 5F7HA 5JHDB 2I25N 3JTSA 3L95B 4M4PA 5IVXE 3AM8A 3KR3H 4L3CB 4UTBH 4G7YH 3ZYZA 4ZTOH 4K3JH 2WBJA 1JVKA 5GGVH 1OP5H 2R4RH 4LSUH 4OZHA 2ESVD 2R2BB 2IG2H 4LNVA 4LARL 4ZOEA 3TM6A 1NC4D 3TT3L 3MROB 5CKAA 2IANA 1ADQA 2B4CL 2RJMA 3SY0B 4EI5D 2A83B 4EJ1C 3E3QC 2HYMA 5BMFH 2AEWA 1AGBB 4YH6A 1KTDA 2OTUB 4UNUA 3O4LE 1X5FA 3MJ9L 1L6XA 2NZIA 4FOMA 5C07A 5T5FL 1I4FB 4LK4A 3CDGB 4X5WB 2ICEB 3O4LB 1CICB 1L7IL 4LNRA 2G5BB 2X1PA 1NGYA 2NPLX 1ZHLB 2E7LC 1BQHA 3HI1B 3TFKD 5D9SB 5HI5C 3DXAA 5F9OL 2WQ8A 4E9LA 4XNYL 3TBSB 5DUPL 1N6VA 3MV01 4Z7VB 3JWOH 3MRNB 1U36A 2MWCA 3DV6B 1KJVA 2BNQA 3JSSA 4YJZL 2E6JA 4RISH 1IAIH 3V6OC 3A0OA 3P4LA 1RULL 5IB4B 4KJPD 1C08B 5D2LF 3RBGA 2IPUG 2RGSA 1PKQA 3KPNA 1LO3H 5D2NA 4ZSOE 4WTXA 2B1HL 3RAJH 4JE4B 4PJFE 5KSUA 1I75A 3RVTD 3HMXL 2M26A 1U58A 4IDJH 4LF3A 1VEOA 2G5RA 1ZANL 2A0LD 1J0JA 1S3KL 4RMTA 1TJIL 4GW4A 1X5HA 2P8MA 2MQCA 4OIBA 4AEIH 2JCCA 3IKCB 3U4BH 3MRGB 4OIIL 2GI7A 3DV4A 1LVEA 1L7TH 4I18C 5CMAB 5F1IB 1QLEL 4EBQL 2J7LA 1BZ7A 5A3ID 3T0ED 4GRMB 4NRZB 3JV4A 1YJDL 2B2XH 3IFOA 3QXTA 3SGKC 3JZ7A 2VLKE 4YHKL 1MCOH 4AK1A 1CFTB 2HKHH 5L2KD 2HFEB 3S88L 2VJXA 5JDSB 1QR1A 5C09D 4FN0A 2Q6WB 1Q0XL 3RGVA 4IHOB 4F7EB 2BVUA 2ZCHL 3H9HA 4YEFA 4LAQH 2X7LA 1T22B 4FZ8L 4WY7H 3OKOA 3VRLE 4AEHL 1UYWL 1R5IB 5FYKU 1RK0B 4F37F 5DD6A 2UZIL 5DA4A 2DIBA 2OTWB 4KAQH 1OAYH 3PV7A 3KYKH 1OARH 4HXAH 4KKAD 4MNHA 5EZIL 1NJ9B 4YHZH 3NFSH 5T1MB 2RBLA 4ZTPL 4TTDC 3LMJH 1XH3B 1B4JL 2CO7B 2VLRA 1VHPA 1WFNA 3KLAB 2C1PB 3MLVL 3VXMB 1GZPA 4PGCA 1KBGH 2FNBA 2ZP0T 4FQQA 3WD5H 3UO1H 3T4AA 5L0QB 2WUCH 4JFQB 1FNSH 3KPSD 4LSQH 3U9PH 4ZNEA 4PJDB 2DQDL 3VXQA 3WFEH 4J3TA 2GT9A 2ZUXA 4H1LA 4I2XE 1YN6B 4G43A 5GS1C 3DUSB 1PY4A 5LXGL 4OFPA 5TF1L 5JNYA 3O6FA 5F70A 4YWGH 2AJUH 3OPZL 1JHKH 2YRLA 1CLYH 2NW3A 4PUBL 5EU6E 1CQYA 5BZWA 2XY1A 5L88L 1R3JA 1XZ0B 5F6IB 1CFQB 1YMHA 1RZIA 1YYLL 4OFDA 4EN3A 3QI9D 4W68A 2P5EB 5CP7A 2ADIA 5AEAA 1F00I 3AROA 3K4AA 5SX4I 4C4KO 5BRZA 4KI5E 3TT1L 3RX5A 1BVZA 4HS3B 5TE6H 3U0WH 3WXWL 1CWVA 1UVQA 5GGUA 4G7YL 2YBRB 5AWNH 2A9NL 5DQDL 3WXVL 1CGSH 4PGEB 4Z78A 2O61B 5I6XC 5D1XD 2PXYB 4R26H 3CXDL 4JDZB 5I17A 3MRPB 2QSVA 3IU3A 3ARDC 4IS6B 1RIVH 2DQUH 4MA8H 4RRPA 3ARDA 3P9MA 1IGYB 4HXBH 4KHXL 5EC2B 2BSRA 5KS9F 2P5WD 4X0KA 1LO4H 1OP9A 4X98B 2DLHA 4W4NA 3T0EE 2DD8H 3RA7H 1SEQH 5B22A 5J1AA 1II4E 1NQBA 5TE7H 2PXYC 3TZVC 3L9RB 1P69B 1KB9K 3JXAA 5AZ2H 4MJIB 3QSKB 4WRLA 5I8OH 3ZSSA 4ZFFB 2WIMA 4EI5C 1UXSA 2Y25A 3CXDH 4Y19D 2VLMD 1BFOB 3DWTA 1FO0A 1BIIA 1QP1A 3RVWD 4F9PA 3WXWH 1PYWB 1A3QA 3MRDA 3G5VB 2MCPL 1FG2A 4QXUH 2DQEL 1N59A 1MI5E 3O3DB 4CU7A 5GS1A 2WM0A 5GGRB 4BFEA 1UM5H 1JZ8A 4OT1L 3I75B 1I3RA 1RUAH 3BP7A 2IBZX 4RRPG 5T5NF 3QZWB 3LRHA 4ZFZA 1W8OA 5F88B 3G5ZB 4P5TA 2AEQH 5E99L 1JYNA 1KTLA 2CKBL 4NDMA 5T1LB 3ZL4H 3FAWA 3V8CA 4G6JL 4RMQA 4HCRH 2K7QA 4Q2ZB 4TNWK 5K9QI 2NQCA 2J6EA 3QUKA 4HEPG 2V2XA 4JHZA 4NQVB 4NUJB 2H2SD 2FHFA 2G2RA 1ORQB 4PRNA 5IB1B 2UZXB 4U6XB 2EC9U 3QDGD 1JZ2A 1JNLL 4NQDA 1KN4H 4N8CL 4LLDA 1YDPA 3U30C 3NIGF 1DLFH 4L1DA 4ZTPH 1PW3A 2X09A 1JUFB 3VE0B 3PDOA 2F54A 3VFVA 5JIPA 1GHFL 1CK0L 4LLQB 5I30H 5DK0A 2ADFH 2XQBL 4LEOB 4OSUL 2FIKA 2F54D 4MAYC 3U4EB 3RL1B 4U1HA 2VDPH 1MREH 5IROC 4UZGA 2WWMC 2Q3ZA 3KXFA 3TN0A 1BAFH 2EE2A 4NO2A 3QIUD 5BVPL 1C7SA 5C3LD 3KPPA 5ERWB 1FZMA 5A40E 1JNLH 1P5VA 3F7VA 2DBJA 2WMPA 4S1SL 3OJDA 5L2KA 4UU9A 3E6HA 5C0EA 4JFZL 3TV3H 4HV8B 1E4XL 1EERB 4RMRA 3CFEB 4AYFA 4BYHA 3Q0HA 5J6HB 4LLMA 4HZLA 1B4RA 1GGUA 4XWGL 1OP3K 3C6SA 4DW2L 2PW1B 5I71C 1CGTA 3RNKA 2EDLA 1FLRH 1IAII 4HUUA 2XV6B 4U1GC 5KZCD 4IMKA 3D2UD 4YPGA 1A6TB 3V6BR 5I0ZA 3MRHA 1QSVA 2UY7A 1J11A 4Y16D 1I7RB 4OLXH 3RDTC 3VJ6B 1ZHLA 3QWOA 2O26U 3ZDZF 2BCKB 3M45A 4ZFGH 1EIBA 4L5FH 1HKFA 2GTWA 1EHLL 3S5LB 3EAKA 5HJ3A 5GJTL 2A6JB 1I85A 3L3HA 3OKNB 1RHHA 4R8WL 2BNQB 4Z77B 3QEQB 3BEVA 3GSXB 1SYVB 3TA3D 5B38B 4HMDA 5DJCB 4PJHE 3QDAA 1DEEA 2QQKH 3T8XB 5GZOD 1PKQE 3G6DL 1YY8B 3HKFA 3SDXB 2E9IA 2IANE 3PHOA 2X9XA 2ZUQC 4WW1A 4PBWD 1S7RA 3FO1B 1WJ3A 3AFLA 4JM2A 1RUKL 1XF4A 4JVPA 5GSVA 5CUSH 3VDCA 1DVFB 2W59A 1XH3A 1HXYB 3O11A 2G60H 4MAYB 4XPAL 1P7HL 4YHNA 2P24B 3EOBA 4CU8A 1WFOA 4M6ML 4KPHH 4OZIA 1UXWB 1ORSB 4GG6A 5AWNL 1OB1B 3CUPA 3VFUA 1WF5A 4RFNB 1M6OA 3Q6FB 4LEXL 3RHWF 1EVUA 4FQLH 4I1NB 4FQLL 2VB5A 3O6FB 3NAAL 2EDQA 3ARZA 4YHZL 2Q1EA 5JW3L 4XVTL 2E7HA 1JZ5A 2NW3B 5EOCJ 2NY1D 4Y4FD 3FQUA 3QJFB 4UOW0 3TWCH 3QHTC 5A2FA 4IIQC 4U1SB 3V6FA 5ANME 1VADB 2E9BA 2BDNH 5CP7B 1ZLWH 1IZKA 32C2B 4D0CA 5ESVA 5M95B 1CL7I 3ZKMD 1T89A 2FGZA 1RJCA 2BVQB 3TEUA 1LK2B 3DX9B 1I1AA 2F5BH 4BSWA 5CBAB 3QIWA 1FNSL 4LLWA 4QRTA 3MUZ1 3PWVA 2XWJB 3IU3B 2NY3B 5IVXA 1IAMA 4G9DA 1CD9B 4HJGA 5EZOL 1YZZA 1I8IB 2YMXL 4L4VA 3RWJB 1X5KA 4PJBA 3DMMD 4WWKD 4K71B 1I3UA 1GGCH 4N1HB 5SX4H 4FFZL 4X0KB 2GSIB 2YPLB 1RUAL 1GGYA 4NZTH 3N85H 4XH2B 3PWUB 3VDAA 1HKLH 3O6FD 1TTGA 1J05A 1QO3A 4WI9A 3WHE0 5FKPA 1JYWA 1AXIB 1OSZB 1T7WA 1RURH 3D85A 5CEZL 5SWSD 4IDJL 4P46C 1BVKA 1E6JH 5C0RL 5K9OA 3VFOA 1MVUB 5JO5B 2AK4B 4LMQE 3C2AL 1D5ZB 1NGQH 4G5ZH 4OF8A 3MRQA 4WGWB 3VFMA 1Q9KA 1NBVL 3OB0K 3QUZD 4YHOL 3DXAE 4QKXB 5I1EL 5LQBH 3P3YA 1A7NL 4KTDH 2GTZA 4W6XB 4MDJA 1ZEAL 5F6HJ 4MD4A 4PGEA 5EIVA 4ZOAA 1PQZB 5C7XH 3VFTB 4K3GA 5F9OH 3FCTB 3IS1X 5D71L 5HDQL 5C0CD 5IESL 4OV5A 1IL1A 4ZS7H 2V2XB 2XNAB 4K7PL 1N7MH 1CGSL 3WUWB 4HBCL 3NZHL 2EIEA 1F4XL 1T0NB 3OX8B 4YUEL 2MQ3A 3HNSH 1UH2A 2QQQA 3JWNC 3U36B 2NTFA 3L3GB 4O02L 1VPOH 2JB6A 5JOEA 4K3DH 4ODTH 1GJIA 5JLZB 2HWZL 4JREC 2NY0B 1IC5H 3PL6C 3QNYA 5IGXL 2D7PA 4BH7A 2XG5A 2OP4L 1F45A 4MX7A 3S37L 1I1YB 5IW1A 2OX5A 1MVFA 3TVMD 4TNVK 1MFBL 3BI9X 5IT2L 4YWGL 1XGUA 3OJVC 1LILA 3QHFH 5DT1H 3DX8A 2WAHA 5FYKE 2IF7A 2ARJA 3BP6B 4LVNB 2DLTA 4PJBE 4PJGF 4KV5F 1FPTH 4U6HA 3FT4A 2K9UA 3LV3B 3HFML 4FZEH 4I0KA 4CKVX 3QQ4A 3BO8B 3JWDH 5F89A 5CJOH 1C5DA 1HYSD 2DOCA 1XIWD 4NQUA 4Y2OA 5IGXH 4ODWA 2D0FA 1FFNA 4OUUB 3S96A 2YD1A 4YFDB 1WBYB 3WS3B 1VPOL 2NY6C 1LK3L 4PJ9D 5HGAB 3FOMA 5DTFA 1T03L 2ILLA 4FNLH 2YK1L 3QCTH 4JN1H 2Q86A 1T1ZB 3CVHL 1HI6B 1JMZA 5DQDH 2DWEA 3V6OE 2H2PC 3BH9B 1JGUH 5DHYB 1UB6A 3ZE1F 4R97C 4WDIB 2AABL 4M7JL 5DGQA 1BVLA 4H25A 3HZVA 3FFDB 4NOFA 5EFIA 2ITCA 2FECI 3O3EB 3D87B 1JJUA 4YDKL 1KIQB 4IIQB 5TE7L 4PJ8A 1RK1A 3MJ7B 3MLTB 2DKUA 2OQJA 3SE4C 3CMGA 3G04B 4PPTA 5EPMB 3RL1A 4HJJL 4NZUH 1K3ZA 4YHYB 1I9RL 4QHUA 1J1XH 1R5IA 3UROR 4RWYH 1QFWL 1UKTA 2NY4B 1CXLA 1DEEB 1WTLA 5JOPE 2Z35B 4HHAA 4JDVB 4U1KA 2OZ4L 5DJ8A 5DD3L 1VDGA 4PTUB 5CEZE 1LEIA 1TVDA 1SMAA 4G6KL 3SDDC 4HV8A 1EAPB 1Z0NA 3L3KB 4LHUA 1TQCB 3X13A 3GO1H 4MNQB 2D7OA 4NQDE 1JRHI 3V2AR 1JGLH 1IQDA 2EC8A 3GSRA 3GSNH 3MRCB 4X6CA 1DQLH 1S9VB 4OZFG 3ULUF 3TVMA 3E6FA 1D5XA 4YBHA 5L88H 3ARFB 3OGCA 4GG6B 4YEEA 4HKJB 2IAMB 1EAJA 3QUXD 5KJRH 2YXMA 1CCZA 1ZHNA 4JPIB 5A2KH 5FM8A 1I1CA 5KVMC 2IPKA 2DIJA 5TDPA 4OZGE 4NHUA 1MQKL 1KCVL 4Y1AA 4G8IB 3F8UB 1UENA 5C0CA 2OR7A 3AB0B 4JAMB 4IJ3C 3IXTB 1Z3GH 5I15H 2P5EA 4KI1A 4J3UA 5ICZB 2NY4D 5JMOC 1E4KC 1L7IH 2NCMA 3BW9B 1ZT7B 4PJ5B 1VKXB 32C2A 3LCYA 5CUSL 4D0DA 1E4KA 3M17B 4JPWL 5E8EB 3BE1L 3CFKB 1DVFD 1AIFB 3OAZK 1IILE 5BMFL 4I8DA 3HUJF 3MLRH 4X4XA 4XP1H 3GUTB 2MFNA 3L7EB 1JK8A 2MHAA 1NCDL 3CDCA 5ADOL 5ESAB 5DQ9B 3VD7A 1DUYA 2NY7H 2VL5A 4LNRB 3QZWG 2X4NB 1F4AA 5I1HL 1CT8B 4LLAA 5CKGA 1W8NA 1SY6L 3QIBD 4Q58C 4P2RB 3HAEH 5F8QC 3X11A 2R0KH 3TESA 1AQKL 5CWSA 4JO1L 4HGKC 1BECA 1IVLA 4QXWA 5I1LA 3PWUA 4CAGA 1U8IB 2IH1A 2EDFA 1ERNA 2BC4A 3O3BA 4JFFE 5I8KL 1FN4A 2E27H 3CPLB 3EOYG 5HYJD 1G9MH 3ES6A 2BNUB 3KPSE 3SGJC 4KHTL 4PB9H 4A6YB 2NY6B 3JWOL 1MUJB 5F93C 2O5YH 1C08A 1C7TA 4PJFF 1YMMA 3VG0H 3ZT6A 5EO1B 3LKQB 1NBZA 5FM5M 2HKHL 4Y89A 4PLKC 4XNYH 5CJXA 5GISL 4KVCH 5MEOB 2CIKB 4U31A 5T1KD 5L6YH 4LF3B 4MLSA 4J7RA 1QPXA 4YBLB 3LQZA 4X99A 3VGBA 5I16B 3WDHA 4B5EA 3G5ZA 4B53A 3NN8A 5FO9B 4IDLA 3S97C 1R5WA 4YC2B 5HHQB 3PXHA 1NC2D 4QF1B 4BELD 1S3KH 2XTJC 4C55A 4GAJL 3BD3A 1NCCH 4H88H 3DMMA 4WWKA 5E8NA 1BF8A 5IJVA 1QFPA 2VR9A 2ZSVA 3QXDB 4K7PY 3U0TB 5BS0D 3PV6B 4XZUA 3ZT5A 2X1OA 5I18H 4WHDA 4S11A 1IM3A 4BQ8A 3CVHB 2ADFL 5DUPH 5IBUG 4HK0B 2EECA 5CZXD 5K59E 4WHCA 3MLXL 3VFGL 3SOBH 4F8TA 5BS0A 3LS4H 2DQIH 3CZJA 4BK5A 1KIRB 3TP4A 2F54B 3Q3GA 3W0WE 4LPXA 4NO5B 4W4OA 4S1SH 4X4ME 3MLZH 4GRLA 2YHGA 4ZOBA 4CMMB 4EI6B 5IMOB 3D69A 2C4FT 4U1HB 2MSPA 4HUNB 3QB7C 2EH7L 5IMLB 4S1QL 1FJ1B 5HYSG 5ICXB 3VCLA 2XTJE 1NCWL 3QFJB 2VITB 3F7VB 4POYA 1URLA 5EZLB 5M94B 1KCUL 2J3SA 1MEXH 1Z5LB 1NMBL 3QQ4B 1NCBL 3R1GH 3SDCA 5C0BB 4E0RA 1A3LH 3GMQB 5I18L 1B6UA 3D25A 3A6OA 3FCTA 2YZ1A 1GXEA 3ROOB 3UYPA 3VXSB 1OLLA 5K9KA 5ISZB 2D31A 1CE6A 4X5LA 4H0GA 5DO2D 1KTKE 3Q2CA 4XMKH 5DJDA 1A3LL 3DX6B 2DYPB 3BQUD 1QQDB 3LQMA 3SO3C 3ARGB 2FEEI 3SKNB 4FQHB 3ARBB 4P23D 4DWHA 4KMTL 4QRRB 2VLJD 4DAGL 4OQTA 3UPRA 2DS4A 3WNNA 3C5ZC 1DCLA 4TQEL 3EJZD 4Y5VA 5FHAH 3ZTNL 4BH7B 2YPLD 5KN5A 3HLAB 4K71C 4PJ5D 3DARA 3O2VL 4X83A 3UAJC 1BQHG 1NFDB 1JHLL 4FQ1L 3L3OB 1EBPA 3OZ9L 1AGDB 2D03H 4CMHB 3G04A 3QULA 5C0RH 4Z77A 1KNOA 2D2OA 5DEFA 4G8EA 1E0OB 3P9LA 1QFWM 3WN5A 3LD8B 3K74B 3U6RA 4RAUA 4TUOA 2LU3A 1G7LA 4K07A 3U7WL 3Q5TA 2VDQH 4HK3J 1D5IH 5K33A 2I60H 3MZTA 5TE4L 1T1XB 1MCQA 5D2LB 3D3VB 4L8DB 2VZSA 2HFTA 4IRJA 4NQCE 4JFYB 1E27B 1KGCE 3B9KC 4XCCH 1A7QH 1ZHKA 5FO8B 5HDBF 5CCKH 5I73C 4WU7B 4YHNB 4XP1L 4XNZB 4NZTL 1FCCA 1UJ3A 4IRJD 3MUHL 1D5XB 1AXSA 1JV5B 2B7DT 3GMPA 2BNRB 12E8H 4ONGL 4WDIA 4M7LH 4QLRA 2ZG2A 3MRFA 3IJYB 2ZG1A 4PLNC 1FQ9C 4JEGB 5EFIB 2EDXA 3D39E 1BFVL 2V9TA 1LO5A 3I2CH 3BP7B 4WTZA 4ZS6D 1QFOA 2JJTC 2R23A 2IQAA 1P4IL 3QEQE 1HEZA 1LP9A 3P11H 4WI3A 5LWYL 1FORL 2MCG1 3BIKA 4EEEA 5KOVC 3W81A 2Z93A 5HHNA 1YYLH 4PRIA 3VWKD 3MLWH 4QHKI 2FIRT 4MNGB 3UZEA 3MX0A 1V7NH 4OKVB 1XIWB 4AQ1B 2YMXH 5BRZE 5T3ZE 1UYWH 1HHHB 4JHBA 3PHQA 2OZ4A 4FQJH 4LGSB 1U8LB 2OR9L 1I1AC 2IPTH 4X6FB 5KSBF 4UNTA 5D7SL 3BDXA 3ARFA 2V7HA 5JW4Q 3I2CL 4MQXC 1IGIH 3QEHA 3MRMB 3K4ZA 1F58H 1I9IL 3C6LC 4OGAD 5FYJH 4JM4H 3OKMB 5DK2B 4LLUA 1P53A 5LBSH 3MLVH 4J23A 5I1DA 2J88L 4OLVH 3LPGA 2NY2C 3VFNA 2C7UA 1SVCP 3ABZA 1RMFL 4XCFL 5TH2B 1ZMYA 2OYPA 3GZKA 5ANMB 4Y4HC 3SE8L 5EIIA 2AJZB 1U6AL 5J13C 4ERSH 3E3QE 1YEFL 1HDMA 1DBJH 3WDIA 1YNLL 5HYFA 3IFLL 4HPOL 3VD5A 1S7UA 3IFPB 3VXSD 3LQZB 4XT1C 5DYOB 1F11A 1A7BA 1T7VA 2CK0L 2BOCB 1T4KB 1EHLH 4HIIB 1IGJB 3GFUA 4NUGH 1FLRL 1GGIH 1PQZA 4NJAH 4U05A 3B4NA 3P2TA 3RNQB 2YD6A 5JW4M 1RZFL 4EDWH 4M5YL 4QF1A 4ONOA 5ESAA 2GY7B 4LOUC 3VGGA 4GRLD 3KG5A 2NY2B 4GAGH 5DUBA 5TQ2L 3MREA 4O58H 1BQUA 3O0RH 2EDYA 1MIEL 2Y07L 1RVFH 4XP9H 1DBML 1LD9B 3RTQB 3REVA 4GOSA 4HK0A 3QYCA 5IBTH 1IFHH 4HF5H 2VDLL 2R2BA 1ZXQA 4WHTB 4HJ0D 3N0PB 1UEYA 4NPYA 1UZ6E 2J6EH 3HMXH 2NXYC 4I3RH 4ZO7A 4Y16B 1H3VA 1CXKA 2AK4E 5SX5H 4K8RD 3PGDA 5C6PB 3SCMD 2YSSB 1BOGA 4YO0A 4PJ7E 2OTUA 3QUXC 5EO1A 1T7XA 2E9WA 2O5XL 4LBEA 1FSKC 1CDHA 4NN5C 3BMVA 3HCVA 4N0YL 5IB2A 2ZNXA 5LAXA 3LRGA 2A73B 2ARJB 3BP6A 1NC2A 5IW3A 1NDMA 2J8UB 3TN0C 2RQ8A 3O45A 4IMKC 2HLAB 5EBMB 2OLDA 2GCYB 4L4TD 4WEMB 1D6VL 1P5UA 5IB3B 2ESVB 1NCBH 1KN2H 4FNLL 3QXAB 1DQQB 4LMQI 5TDOA 2QV2A 1R5WB 2KKQA 3GMOB 5H2BB 5HHQA 2JJVA 1T83C 5KG9A 4KTEL 2Q8AL 3AB0C 1CD1A 1YQVL 3CGTA 4NKOB 2R2EA 3UYRL 3IFNH 3K0WA 5EU3A 3DMMB 4WWKB 3HUJA 4O2FB 1NFDF 1GGTA 3MYJA 3EHBD 3BWAB 1MHPH 3LZFH 3O4OB 1MCHA 1QYGH 4C59B 2Z8RA 2AEPL 4PJIE 1NANH 4RDQG 1NANI 4TUKH 4NN5B 5E6YA 4U1IA 1FE8H 2B4CH 4NP4L 4D94A 1NGYB 2F19L 1EFXB 4TPRL 1EHXA 1IQWH 2ITCB 2HJLA 4DGYL 2CO6B 5I1KL 4C83A 3OXRB 5ESVB 5D96B 4PJ8B 2VDKH 3F58H 3O2DL 3FN0H 3MLTA 3FN0L 5ALCH 2DQHL 2FBOJ 3PIQA 5CBAA 2BHUA 1FYTD 3L3OA 4NC0B 2IBZY 2WNGA 3IETA 3BEWA 2UWEE 3K2UL 2J4WL 3V7MA 1FIEA 4AMKH 2OI9C 3VWJB 3GIZH 2VITA 3I6LE 1CFTA 4FG6C 1G6VK 3BPCA 4HHAB 3VI3E 3FKUS 1QTYT 1UM6H 3MLYH 4PR5B 4ACPA 5HGGS 4QRPA 3RA7L 1I7TA 3B2VH 4OGYL 3QJHA 3LZFL 1GCFA 2OSLB 5E8OA 5IV2A 3ECBB 2WUBH 2X7LB 1T3FB 3ULUH 1S9WB 5GISH 4P3CL 5D6CA 1NUNB 5HVHC 1N0XL 3KPOA 1I9RH 2AXGB 4OZFH 5E2TH 4F58L 4DQOL 5JQ6H 5L8JB 1NFKA 1MVUA 1A0QL 1X5LA 2R1YA 3D3VE 4DUVA 2AJYL 2W38A 3OGCB 3FZUD 2A9NH 1JV5A 1AQDA 1XT5A 2E7MA 1MFEL 5I74B 1Q38A 2FR4B 4WTWA 5EBWA 5L2JB 5DLML 1N0LA 2GTZB 2YS4A 5KN5B 1FFQA 2D7QA 4JFQA 1EJ6A 2J8HA 4J3XA 5JA8B 1Q9WA 2ZUUA 3SQOH 3VXMD 4X7DC 4ZPVA 1FVCA 4N0FB 4F3FA 4PJ9A 1WIUA 1JHKL 5EUOB 1FYHB 1KOAA 3WKML 4G8EB 5J56B 1G0XA 3D3VD 3EJYD 4NCC2 1AIFA 3SPVA 1IGML 5C0ND 2XNAA 1N26A 3IDNB 3H9SA 4YX2H 2HVKA 3FB5A 4N8PA 3SBWC 2X1WL 1KPRA 4HQQL 5HYQB 4OI7A 1CDYA 5GGQL 3D9AL 1U8PA 3HE7B 4UIKH 3DGGB 2A6KB 5I8KH 1XF1A 1YPZE 3TGXA 2A6IB 2XZAH 1GL4B 4PGCB 4BSVA 3C5SB 1FNGA 3RWDB 1FZOB 1MI5A 1RZKH 1WFTA 1UVQB 2FL5B 4RGOL 4D9RD 4MNGE 3QISA 5EZIH 3EKCA 3RGHA 1RPQA 2JTDA 3D18A 5D1XC 2Z31D 3BP4B 1YEKL 3RZCB 2FHBA 5J12C 1P7QB 3S7GA 2EDDA 3QEHB 3RVUD 2FSEA 3K80A 4WENB 1A6WH 2P7TA 5C6TL 1S5IH 4ERSL 4DN4L 2WSKA 4PJCB 3L7FA 2VL4A 2ZCHH 5DR5L 5DXWA 4P4RB 3JTSB 3L95A 1NBZB 1GGBH 1JF6A 3VXUB 1RJLA 2I24N 2UZIH 3EJZC 2FJGB 3R06A 2HT2C 2AJZA 1JWMA 2I5YL 1A5FH 1FFRA 4PRBB 1KB5L 2FJFA 5DSCB 3CC5B 3D0VB 1WBYA 1RUKH 4OM0L 3QDGE 2ZOLB 4X7CC 2O61A 4OD3H 1WT5A 4MAUL 5D7JD 3S88H 2OR9H 1LE9B 4ZO8A 1DE4A 5L8LB 4KQ4L 2GK2A 4XWGH 1NAKH 1W72B 3BKYH 4CVXB 1XF2A 3AGVA 4GW1B 5KSAA 1WZ1H 2EYSB 5I1CH 2ATPA 4KJWD 4A6YL 5EC2A 1WTGT 5H8DA 1UB5B 2EH8L 3CVHA 2FJHB 3P73A 1FP5A 2V2TA 5IEHA 4KWUA 3T0WA 4ZOCA 2YOCA 2YUXA 3KPMB 5EC1B 3MRNA 3MBXH 1FYTE 3GMMA 1T2XA 3WFCL 4K8RH 1MJ7H 1CXEA 1DBJL 4NN7C 4P4KB 2GJZB 2AK4D 3BPLC 3RUGF 1I8MB 2D03L 2DQHH 5DJ8B 3WNMA 4DZBA 3N85L 1JL8A 1MCOL 3G5VA 5T3ZH 2QJDA 3OF6D 4UV7H 5LAXB 4C4KT 1F6AB 2CIIA 1MRCH 3PXJA 4XB7A 3BDYL 2VLKD 4X6DA 4BM7A 4R9HA 3O9WA 1WZ1L 2GCYA 5LKNA 4DAGH 3MV7A 2FB4H 2IC2A 4FTVE 4NRYB 3QIWD 1KEMH 2EDEA 4GSDH 3X14A 3P0YL 4PJ8C 3GIZL 4ZNEE 3BGFC 2GAZB 5GS2H 1BEYH 2H1PL 5C8JB 2FYYB 3EYSL 5LJYH 4WI6A 1XF3B 3GB7B 3QIBC 1RZ8B 5DMKA 2CKBH 2DDQL 3OJDB 3TWCL 3OKEB 3RPKA 2BOBB 4PJ7B 3MUJA 5C0EB 4R4ND 5GRXG 1WBZB 3H9YA 1DP0A 4TTDD 4XVTH 2OL3A 4KY1L 2J5LC 4I77H 3FB6A 3GKWL 5C0FB 3HAEA 1BQLL 5KSVA 4XPFH 3LDBB 1ITCA 1MFEH 1CFSA 2W0KA 4BJLA 2UVFA 2GW5A 3PP4H 3KR3L 3L6FA 3OQ3B 1WCBA 4QYOB 3RDTB 2A73A 3IF1B 1E4JA 1JK8B 3L7EA 4U7MA 4X4YB 5I66A 4QO1A 4KMTH 3HPJB 3IAQA 3ULUL 3FOLA 4OCNC 5GZOC 4R6UA 1MHEA 1SEQL 2DD8L 3SE9L 3G9AB 3K1KC 1V7NL 5CD3B 4P2RA 3MMEA 5F8RC 5TDOB 3MGAA 3QJHB 4GAYB 5CWSB 1SM3H 1KELH 3ARWA 1RUPH 4OD1H 4R0LA 3MLWL 1IGMH 4OKDA 5D72H 4LQ1A 1FVEA 1HZHH 3JUYA 4HH8A 2VDNH 4I0PC 3TA3A 5IB5B 3D0LA 1TCMA 1N3NB 5EU6A 1YUHA 3HE6C 1HHGA 2HJKA 1S7RB 2NR6D 3GDBA 2R1XB 4PJ8D 3F5WB 4ODUA 4X8XA 5IOPB 2DQTH 4XAWL 4LPYA 1J88A 5GSVB 4PLJC 1YEHH 4ZUSA 4OZFA 5EBWB 5C3TA 4QXUL 3TJHD 2N7BA 4N9GB 5GS0H 3M8OH 3Q6GH 4KJQD 1V5JA 2YUZA 4JN2A 3IDGB 5FFLA 2EKSA 4KJWC 4LU5L 2VLME 2YN3A 5D7JB 5HJ3B 1BZ9A 4FFZH 4G9FB 1IKFL 2ED8A 4LCYB 1YN7B 4ODSH 5E5UB 4Z0XB 2Q7YB 3VFUB 3C6LA 5TFSL 2XRAH 1N0XH 3QEQA 4JY6B 3TO4B 4Q9QH 2BSED 4OTXL 5GIRB 1BWMA 3H8NA 4L9LB 1PBYA 2DAVA 2DTML 3RWGA 1JNHB 4GJTB 3ARGD 5E2UL 5E2WH 2IEPA 1MLCB 5BV7B 3E0GA 3PNWA 2OJEB 3FT2A 3MCLL 4WEUD 1I7TB 2R0KL 3U79A 3B9DA 5EUOE 5GGTA 2PYFA 4I3SL 1OY3B 4LSRL 5IV2B 4WUUB 1VADA 3LS5H 4RMVA 4LHQB 3B2UD 3K46A 5B4MC 4JRYD 3BZFB 2AJXH 4M61A 3BJLA 1A6VL 2DYPD 3MRRB 4U6VL 2G5BA 4XCYB 3O9WC 43CAB 5I8CA 5IM7A 2OMBA 4JDTH 2A74B 2VXSH 3FQTB 4P9HL 1DQML 1TJGL 4P2YA 3PUCA 3D18B 4HULB 3MRMA 4NKIL 4NO5A 1SQ2N 3G5YA 4GKNA 3TBSA 3OTTA 4JZNB 4R7NB 1B6DA 5MP6L 1FG2B 2YA0A 4MQSB 3D39A 3O3DA 5FM4A 4ALAH 2H1PH 5DFWH 5HYEA 5IFAL 3HG1D 4R4FL 5GGRA 4WCYL 3KXFD 4ZD3L 3UP1A 2BSSA 4FRWA 4XPHL 4GG8A 3I9GH 4HLZG 2AEPH 5DD5H 5DWUH 1AKJA 1ETZA 2JCCF 4JFDD 4C56E 3H9ZA 5C0AE 2OK0L 3AREA 2APTA 3MOQA 4ALAL 3EYQD 4KROB 3UC0L 3P4OA 1G7JA 4GMTH 3BDYH 4YHML 3AS2A 1BVKB 4Q2ZA 1CYGA 3VXUD 4ZSOA 3QRFM 3NVQA 1CE6B 3LPFA 1LEGB 5D7IA 1VENA 1VFBB 2NXZB 4NKIH 4LKCB 4HC1A 1L0YA 1IAOA 3Q48A 3PL6D 2ZOLA 1BJ1J 5FUOH 2QSQA 5HI4D 4PJCF 4JRYE 4CBPA 4YNYB 3G9VA 3GSNL 4QRRA 1B4JH 3G5XB 3B43A 3H2WA 4AEHH 3E8UL 1I8IA 4D9QE 4GW5A 3HMXA 3BN9D 4MXVF 1YEFH 5JORB 1Q0XH 2RB8A 2V7NB 1OAYL 3V5KB 1TQBB 1CN4A 4ODXB 3TH4T 4TULH 1P7QA 4JY5L 1GIGL 5HPOA 5CSZA 3ZDYF 2FIKB 4XBGB 2SEBB 1RJZA 5DJ6A 3B5TA 3G6AB 1KJ2B 4RWYL 3HG1E 4XP4L 4CJ0A 1A6UH 2H32H 1WITA 4OAWA 5AAWA 1PKOA 5IWLC 5GXBB 3T1FB 3OZ9H 3WUWA 2FDBP 5DD0H 2GJZA 1K8DA 1L7TL 2NXYB 3EOAB 4OD3L 4G6FD 5CEYB 3GI8L 3BYTA 3R06B 5I6XB 5E24E 4XXDA 4CNIB 1CDIA 3VFWB 2XKNB 4Z0BH 8CGTA 2HLAA 5EBMA 2CUIA 1QA9A 2AABH 1RJYA 1UCBL 3GHEH 2C1PA 4ETYA 1OTSD 2NMSA 4GFTB 1D5MB 5ADPL 1M71B 4KK6D 2I60L 1RZ7H 1JWSB 4S1DC 4CMHC 4R4NC 4HH9A 3TJHC 2EYRB 3T4AB 2F9BT 1INDL 1DQQA 3S6CA 2VQUA 2XQYG 3VXQB 1Q72H 5DS8B 4E5XB 1FDLL 4W81A 1HZHL 3STBA 3KLDA 5F72S 3PWNB 1FGVL 1NLDL 3LIZH 3NGBC 2XTJD 2XXMB 4GBXB 3EUUA 4KQ4H 5DJYA 5F89B 3ARGC 4LKXB 3C8KA 4PJIA 2MQ0A 3U9UA 2EXYD 4ZQKB 5JXEC 4JPWH 5DMJB 1FBIH 2XWBB 1RZJL 5B38A 1AR2A 2E27L 4EDXA 1ZLWK 2Z4QA 4OZ4A 3H0TA 5JHDD 5MENB 1HI6A 5GGUB 4GMSH 3BX7C 1T2QL 5KS9E 3N50A 4P46D 4UDTB 3RDTA 3BZ4B 4MZ2A 5SV3A 3MNWA 1B2WH 5CINL 4POZD 4WHYG 4X6DB 4BFIA 3VWJA 1CE1L 1D9KB 3FQWB 1Y18B 4X6DF 5D5ME 4AEEA 1KIQA 3QXUA 4AIOA 1RK1B 4LQFL 5H94B 4QRPB 3WE6A 4MJ6A 1NUFA 5F9JB 4K7PH 4QRPE 1V3JA 3KPSA 3WFZA 5C0GB 5B21A 2R1WA 3C60A 3H9SE 4AT6A 3HNVL 2AXGA 3CFIC 3FOMB 4JFDA 5GGQH 5CAYB 3EGSA 3QAZB 3RBSA 1UXSB 3FO0H 4BZ1H 1U3YA 1ZTXL 1BIIB 1DDHA 3ZTJH 2GK0B 3FB7A 3RGVD 4WW2C 3MXVL 1YJDH 1WZKA 3LN9A 3P0VH 4HWUA 2HMIC 3RWEB 2VDRH 5KSVB 4PJDF 3VRJB 3QHFL 1F4HA 4YDIL 3S5LG 1HN1A 3B8YA 1IKFH 1S78D 3QFJE 5FO7A 4LLYA 2QHRH 3MGTA 1FVCB 4IEFB 4H5SA 5AYUL 3BHBB 4GBXC 4XXCA 5FK9B 1J8KA 1RIUH 1EA9C 4PB0H 4K3DL 3MBXL 1CDUA 5D93C 4LHUD 1DSFH 3OKLA 4YHYC 2BERA 2X9WA 5C0CB 2HFEA 1YECL 1U93B 4NT6B 4UIMB 1CXHA 2HVKB 3DVFA 2JK5A 3UJJH 2JELH 4MA7H 2CDFB 4U6XA 4Y16C 1NMBH 4Z7WA 3DSFL 4YXHH 4RAVA 2O93L 1KIUA 2P8PA 4XVUC 5B39G 4BH8B 2Y4SA 1A2YA 1CG9A 2DBLH 3C5SA 3F7YB 1U95A 2C26A 3BISA 3N1QC 4XPGL 1EHAA 2H6PA 4CDGC 3PGFH 1G1YA 4LRNL 1BOGB 4K23L 3CX2A 4LP5A 1MCWW 1NCAH 1ROWA 1NFDE 1QZ1A 1DQJA 2IAMA 3VFMB 4TRPL 5L9DH 3HC4L 4I4WB 4AY0A 5LXGH 3D6GA 1CICD 4YFLF 2IPUK 3RWCB 4AENB 3FL7A 1NL0H 4P23C 3KXFB 1GC1H 2OM5A 4M7LT 4MD4B 3N9GH 4TSAH 1Q9LA 1KBGL 1BBDL 1MHCA 1RZGB 4NFBA 1EO7A 3EJJX 1HQRA 3CPLA 3SKMA 2BHYA 5E5MA 1Z2KA 5GIRA 1ZE3C 3G08A 1G7JB 3AREC 4D0BA 4NQCB 1P4LA 3M17A 3K81A 3FRUB 2DF3A 1IGFH 5T3XH 3U4AA 2HT3D 4LKCA 3BWAA 4NQXB 5KANG 5GHWL 4D3CH 2VRAA 4KAQL 1C16B 4G80B 4HUUB 3T0BA 3GSVA 3RY6A 5ADPH 2YXFA 4M61B 2NXZC 3MJ8B 2NTFB 2GFBA 3L3GA 1EFQA 25C8H 5ALBH 3RZWA 2DQGH 3KJ6H 3QNYB 4ZUTB 4UQ3A 1BX2B 4UTAL 4LSVL 5FO9A 1KFAH 4LFHD 2GTWB 4GG6F 4GQ9H 1CGWA 4JY4B 1MQKH 3E2HC 1U8IA 3NCJH 3G6DH 1QFWH 1Q94A 4F9LA 4I48A 2VDML 3SY0A 1MCWM 4HJJH 1OTUC 1PY9A 4NZUL 3VFGH 1XGYL 1ZKAA 3FT4B 5HYJE 3GI9H 3CLFH 1TPXC 1NCUA 4QHKJ 2LU4A 1H3PL 1WSST 4HW6A 4O51A 1I4FA 5DI8B 1BIHA 5D1XB 4NNPH 1ZV5A 2BMKB 4Z7UB 1UCBH 1KENL 3UZQA 4LAQL 4PJAE 4TTGA 3Q5OA 3QUYA 3NIFE 2X70A 4N8VA 5I1AB 1NC4B 4APQD 2FECL 4E42A 1JYVA 1INDH 3FQRB 4WUKL 3GMLA 2P24A 3EOBB 4M48L 2PR4H 3N1FC 5CIPA 1C5CH 4YNYA 5BRZD 4XBEL 3BH9A 3BDBA 3UDWC 5FF6A 3S36X 2HTLC 1XGRB 3MNZB 4L3ED 1EEQA 3GHBL 3HZVB 4KJQC 3GI8H 1RV6X 2DM3A 1Z3GL 5I15L 4Y1AE 4NQSA 1FYTB 3WKNA 3FO2A 4PB9L 4YR6A 2W0LA 5BV7H 2WWKO 1FHGA 1U2CA 5IW6A 3IVKB 2E5EA 2F53B 2XWBA 2FX7H 1YNTA 1JNJA 3DX6A 2EDHA 3C8HA 3PP3H 4EQ2A 4XRCB 4PY7B 2X10A 1FRGH 4TOYL 2WLYA 4TULL 2Y9RT 4NFDA 1TETL 1HH9B 2P1YA 4QYOA 1K5NA 5B39B 4GKSA 4F80A 4LLWB 5HYQA 1AR1C 2IQ9L 1EK3A 3HE7A 1FJ1A 1PG7X 4GH7B 4PD4K 3FQWA 1M71A 2APBA 4LLVB 3ZKXB 2X89D 1LDPH 4I3SH 4LSRH 3T0AA 5A2JH 3VW3H 5H94A 1A14L 1IGIL 1FCGA 4PRPA 4M9PA 2D7NA 2K3TA 5BZDA 1N5AA 2W60B 4BQ9A 1MAKA 1TZGL 1WWAX 4JANA 5DEFB 3LKRA 2XN9D 1KB5A 4WTZG 1JTTA 5FV1L 5GSRA 3ILQC 4RWHA 3D9AH 1TMCB 4XPTL 1OAKH 7FABH 4PY8I 4P2OD 3T0EB 2HFGL 1FV1A 3LEVH 1AGFB 3OR6B 4P4RA 5IUSA 4Q74A 2IWGA 4QRQA 3ARBA 3EDDA 4XNMA 1QNZL 5DJZA 2VXSL 4I18A 1JIBA 2XQYK 1A4JA 1S7TA 3NIFF 4ZUSB 2VLRB 4IJ3B 1HCVA 1MREL 1DBBL 3ZE1E 3BW9A 1GRWA 2PTUA 3RL2A 4Y4KA 1NEUA 4A2LA 2YWZA 3PWPB 1MCRA 1CK0H 5ECJE 2ZOKA 1YECH 1BM3L 2IMNA 5DC4B 5FDWA 4YAQB 4ZS7L 5F1OB 4QY8B 5IEKA 3IJYA 4CVXA 3RUGE 5E2UH 5K93A 2XZAL 1X44A 3QA3A 1UFUA 1X5JA 2IBGA 3REWB 5ID0A 1C5BL 3U6RB 1LO5B 3RWIB 5BCAA 4HUWA 5MERB 5B8CA 1YY9D 2P8LA 5HHMB 5JHDA 4FFVC 2R0ZL 5C08E 5I0DA 4JKMA 4ZUUA 5BZWB 1UB5A 2VZVA 1F13A 3TCLA 1JZ6A 3TBWB 1TQCC 3PGFL 2CKBB 1FL3B 2ZG3A 3T2PA 2AJSL 5SWZA 4LVOB 5EZJA 1MWAB 2DBLL 3W2DL 5T1DH 3O6LH 1FN4B 1S9YB 2XRAL 3VD9A 3VXSE 5DT1L 4OCRH 4AIZB 3MOAL 4K94C 4UT6L 2B1AH 2ZWLT 4RNRA 4PJXF 2FZ3A 2X4SB 1I9EA 1MI5D 5AZEH 2VDKL 1BBJA 3F58L 4OLYL 1QSZA 3UDWA 3IXAA 3HPLA 3UJTH 4XHJC 4P4KC 3UTQB 3ZDXE 4GKOA 5JDJA 3HZMB 9CGTA 4JKWA 5FO7B 1PG7H 4NWUH 4FQ1H 2NY6D 5T1KB 5ITBH 4KK8C 4LSDA 5EOQL 5A3IC 2HJFB 2GSGB 3MLPA 1RZGA 3HI5H 3SDAD 1DBKL 4MJIA 5EBLA 1VACB 1FFNB 3QDJB 1VFBA 1XF3A 3WS3A 1YQVH 3L1OH 2OJZL 4UAOB 4XWOD 4U0QB 4QRPD 1DL7H 2YPVL 4KZDH 2DN7A 3VI4F 4LCCC 4AQOA 4IRJC 3IDYC 4PJEE 5MI0C 1WFUA 2I9TB 1H15B 5FA4B 3BAEL 1FPTL 2GUOA 1CICA 1NGWA 1CZ8L 3GKWH 3HB3D 4PRID 4X6BB 3U30B 3VWKA 2CXKA 1AO7A 3DURA 1IGTA 3BGAA 5KSAD 1EFXD 4ZFZB 5HI3C 1YNKL 3MRGA 3VI4E 1CFBA 4LVNC 3BVNA 1Q1JH 5T33L 1WCBB 3HZKB 3D69B 3LRSA 5HYSB 3MGOB 1KYOJ 4Y5XA 1VFAA 3ZHKA 1MCPH 4GRMA 4NRZA 1WT5C 1Q72L 4NQVA 2CJUL 2V2WB 3FB8B 3D39D 5F7NC 4PUBH 4U1KB 2C3XA 4OF7A 2X2YA 3ZT7A 1K6QH 5GGRY 3SKMB 1NLBH 4TSBL 2XKNA 4H8WL 2MKLC 3GJEB 5JPMB 4MWFA 2QQLL 4GLRH 1AI1L 4KRPB 4QHLB 3D0LB 5CJQH 2DYPA 2H3NB 3RPIB 3SGDH 2BNRD 4UDUA 2P43B 2YPKA 4L4TE 4P23A 4YQXL 1UG9A 5DMIL 4FQIH 3QDGA 1D6VH 1R3HA 5KAQG 3OSKA 4KI5C 1NDMB 1HNFA 1RFDL 3QQ3A 3UPRB 1AD9A 4MD0B 3MREB 5DK3A 1I9JL 4U6YB 3ISWA 3PDDA 3A6CH 3RI5K 4U1GB 4M1GH 1ZGLM 1ZLUH 4G8IA 4KJYB 2RFXA 3NOIA 1I1RA 3TO2B 3OR7A 1OTTC 5GZND 2R0LL 4YDJA 4RFOH 4PGDA 1YN6A 5GRZA 5TQ0H 3HUJB 1PDKA 4HUVB 3UBXA 1IM9B 1FVDA 3P4NB 2J88H 3BKJL 4KVCL 2FO1A 4PJ5E 4NZDA 5FA3A 4OSUH 3CFKA 4YQXH 2VXUH 5DD6B 3CVIH 3UBXG 1KXQE 5IBTL 5MENA 5F3BA 1CIUA 3HE6D 4LCWE 1INQB 1J5OL 2KL6A 4K3EL 1CGVA 5D7SH 2KPNA 2AQ3A 5CJQL 1FFPA 3PABA 3VXRB 1J8HD 1KCRL 4UBDC 1TTFA 2VDMH 1I7RA 3BZDA 3JBG7 5LGKA 1G9ML 3VXRE 2XICA 1KN4L 1J0IA 8FABA 3U82B 3UCRA 5FO8A 3ULVF 5GRUL 2NZ9C 5IW1B 1IKNC 3O8XC 2UUDK 3CD4A 2A38A 1MWAH 1EUTA 4R96A 5HHPA 2FX9H 5LCVH 5DMGD 3VWJC 3P40A 1EXUA 1I1FA 5IVNA 3ARDD 1DN0B 1GGBL 3QR2A 4KI5D 3SE8H 2NY5H 3UYOD 4JFDE 4C56D 4NQSB 4YHIA 4FQCH 1OAXL 4FQCL 3R0NA 4QRQB 1DDHB 5HI4C 1T3FA 2XACC 2CDGA 1GC1L 3KPLB 4RGMB 3MV8E 3JVGC 4YHMH 1T83A 2APVA 3QNXB 3QNZB 1QSED 3WHE1 3CZFA 1MWAL 4Y4KC 2JJWA 1XGQA 5HGDA 5EA0L 4EN3D 1OWWA 3CUPB 3NN8B 4GKSB 4MNGA 4RX4D 5FGCB 2PXYA 2WUCL 2VLRE 4JB9L 3KVQA 4WFGD 1CTNA 3SDYL 3ZKNC 4YHKH 4HIXL 6CGTA 2DQIL 5CGMA 3ILPB 5IMMA 3O8XB 5JPNB 2PTTB 1UCTA 2I9LA 2VO5A 5DD1H 2VR4A 2V7NA 4PRAA 4PP1C 5GJSH 2IMMA 2W0PA 4Y2DD 2JB5H 2QQKL 5FOJA 1RJZB 5DJ6B 2XZQH 4U1MA 3MA7B 4OLYH 3QCUH 3VGAC 1QBLH 3SPVB 1M05A 3HB3C 4FZ8H 1P84J 1UZ8A 1YEDA 3GJFH 2V9RA 3MLUH 1QRNA 4M03A 2C3WA 3H9SB 5C0DB 3PQYE 2R1YB 1F6LL 3HE7C 1KPRB 3U0WL 1CTOA 3EOTH 1A64A 3FQXA 2VAJA 2FR4A 4Y19E 4M8VA 3TNMB 1K2DB 3UJIH 3VMPA 3RL2B 4UT9H 1VESA 2FL5A 3QUZB 4PV9B 1DR9A 2AJYH 2BOCA 1UM4H 4HAFA 2X44D 3K8KA 2FSEB 3F7RA 4FQXD 3FRPG 3T2QA 5EU5A 3G08B 1U8MB 5JHDE 2W07A 4D0BB 1LE5A 4P5MA 3DX7B 2OCFD 3D85D 5BJTB 4HS6A 2QR0B 3QG7L 2WBWB 1KCSH 4U0RC 3OL2A 1RUQH 4NM4L 3TBWA 3B83A 3MOBH 3DJ9A 3LHPL 2V6HA 3DHMA 3T2NL 2FJGA 1MEXL 2QADC 4LSSH 5KSBE 5IWLA 1PVHA 2EDKA 5JA9A 4JFPA 1QLRB 4JR9L 1MWAA 4PRBA 1V3MA 5I1KH 2J1KA 1VKXA 1KJMA 3BD5A 2GY5A 5MEPB 2YZ8A 4MZ3A 1W72H 5FIEA 4YBLC 1T0MB 4Z95L 2CLRB 4EDXB 4K3HA 3VA2C 3O41B 3OB8A 1A1NB 3H0TB 3OKKA 5L0QC 3WBDA 4ORGA 2ATKA 1UT9A 4MXWL 3BE1H 3DXAD 5DVOA 5KSAB 1CF8H 3HCVB 5IB2B 1CDJA 2O5ZH 1B2WL 5F7KC 3MNWB 3ZO0A 1IBGL 1IBGH 1R0AH 1F42A 3T77A 5BV7L 5TDNB 5IBLD 3LN4B 4JCMA 1HQ4A 4RAUB 3FO9A 1WEJL 5J57B 2W9DL 4HT1H 1NSNH 3QUMB 2GSGA 2A6JA 2FEDD 2JB6B 3QCVL 1U8KB 4JG1H 5JLZA 4F37K 2D4FA 4PV8A 4L3EA 3QUYB 2YA1A 4IRSC 3GBLA 3T8XA 1NAML 4PTTB 4QRSA 1MOEA 1Z9LA 1VEMA 4MS8D 1BLNA 2EDOA 2P5WB 2R4RL 5ITBL 1GGIL 5D7KD 1J87A 4K9EH 3VGHA 3UTTE 3KPTA 5IR1A 4ELMB 3MRLA 3ULUD 4PG9A 4KI5F 4QT5B 2PETA 1AO7E 3RVUC 1CDBA 5E8DH 3EO9H 4RFNC 3MRFB 3GSOB 3MBED 5D1ZC 5FB8A 4Q97A 2QQNH 5C0JB 4HFWB 1OCWH 2E3VA 2WWMD 4IRSA 5I1JH 3U1SL 4TYUA 1EJOL 5EO0B 4OLZH 4Z9KB 1UXWA 1OP5K 4NSKA 3TO2A 1FIGL 2ICCA 1U8QA 4OUUA 3BGMA 1VFAB 4XVSL 4BUGA 3CLEL 2V17H 4QNPF 4P4KA 2B4CC 5T1DL 3WS6C 4KVN