5DVKA

Fc design 7.7 b chain homodimer t366v/k409i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA01
1JHTA 1NCAL 4GG6E 2V2TA 2HWZH 4UINL 5F89B 4EDXA 3QRGL 4HKBB 5D70H 3QP3A 1YECL 3L3KB 2G75B 2WBJB 1UH4A 1QPPA 5GGRY 1TTUA 4BH8A 1J87A 4KHTH 5D7IB 1YY8A 3REWA 4MD0B 2MJWA 1OLLA 3T1WA 3IJYB 4LCCC 4HS6B 5DZOA 3GMMB 3LCYA 2D7QA 4P23A 1CFSB 4Y4FC 2P45B 3ALWA 3U36B 2YK1L 1NEUA 4OD2A 3TNNB 5T1MB 5TDOA 3GK8L 1Q9WA 5F1IA 5IFAH 3BQUB 4LSTL 4G42B 3D6GA 4OD2B 1Y6MR 1WBZB 3WFZA 1NPUA 3B4NA 4P23B 1KTRL 3O9WD 3X11A 2J8UB 3EYOB 4XAKE 3KS0H 3HPJA 3VXOA 4BK5A 4GG6A 2AJUL 1LO5B 4WRLA 4K3HA 4HK3J 2H2PC 2R4RL 2OP4H 5ICYB 3L3HA 1LEKA 5ICZA 4JR9H 3D25B 3CJJA 1CF8L 3QA3B 5GSRA 3GIZH 3RWIB 4AK1A 1WWAX 5LJYH 1MCSA 4PTTA 5F3HB 2AEPL 5E6IA 4JFXB 2ARJA 5CSZB 2Z91A 1HN1A 3RVXD 3QCTL 2VQTA 1CFVH 2NY3D 1DR9A 4MA8L 2YXMA 3K0WA 4LPWA 1B9ZA 2JCCF 2XA8H 5ALCH 1IAII 5HHQA 4KRPB 2P46B 4NOFA 3RUGA 5EU5A 1XGTB 5CP7A 1HEZA 4IRJA 5CEYA 3UTSE 3LKPB 3H42L 4M3KB 2ID5A 3DX8B 4WWID 3TZVB 3SGEH 2YN3A 4YC2B 3B3IA 1SYVB 1R5IB 1FBIL 4IDLA 3S4SA 4KKCC 1QBMH 1A6WH 3GMNA 2VE6A 3ARWA 3O4OC 1QSEE 2V5TA 2BVOA 4PP1D 3HMXH 1XH3B 4ELMA 3GMQB 5GIRA 4N0YL 1ZWIB 5SX4I 4L4JA 1WZLA 1CDGA 2Y4SA 2QSVA 4N9GA 1UWEL 3LDBB 3NIDE 2DLGA 3K1KC 3R1GH 4PJAB 2QBWA 3INUH 1Q72L 4XMKL 1HINH 2XN9A 1ACYH 4F3FA 1OPGH 2DTSA 4GMSH 3I3DA 3HAEG 2R2HB 4KK6C 5GJSL 3KDMA 1EHLH 4ZS7H 4OCLC 4AEEA 3X13A 1KSRA 4KTDL 4WW2F 4OCRH 2ZKHL 1VKXB 5ESAA 1OSPH 1M7IA 4TUJB 2YA1A 1J8HB 3L3OB 1IT9H 3E0GA 3VXSB 4YEEA 4AIZB 1TJIH 3LH2H 5IW6B 3TFKD 1U0QA 1BOGB 5C07B 4PLJD 4WCYH 4JZNA 3SO5A 1CT8A 4E42A 5KS9A 1EEQA 2OI9C 4F37K 2GJ6A 5E70A 4NQVB 1VACB 1NCTA 3UBXB 4K8RD 3WD5L 3IDXH 1DP0A 5CSGA 3C5JB 2FL5B 2CQVA 3PQYB 2J7LA 4P5TA 5DA4A 3SPVA 1ERNA 2FL5A 1B4JH 1FE8H 2CDEA 5HHPB 4R97B 1FV1A 1FDLH 5C0IB 4HIIB 3KWWB 2QQLH 4YBLC 4HKJA 3PDGA 2Q6WB 5KOVC 3RVXC 3FN0L 4LARL 4UBDC 4QRPE 3V0WL 5E5UB 5D6CB 3ZDXF 1IAKA 3WO3B 3DX7B 2XZZA 4JB9L 4MHHG 5SX5H 2ZUYA 5D6CA 3QFDA 5IW3A 2O61A 1TQCC 4KAQH 1FNEA 3ARUA 1DLFH 3JV6A 1D5MA 4DN4L 2EE6A 3IXTB 3IDNA 4JQIL 5HHPA 5L2KE 3ARGC 4IRJD 2Q8AH 5EO1A 1AHWC 2IF7A 3GSQB 4QTIL 4LEXL 4EXPX 4PB9H 4F7TA 1NMCC 5DJYB 5D1ZC 3JWOH 5ID1A 1QP1A 4IS6A 4OZGE 5FYKE 4KRPC 1BFSA 4PV9A 4GKZB 5DO2D 2X4OA 1C08A 4I2XE 5D7KE 5EZIL 2X5PA 1KJ2L 5IESH 3QXAA 1KTLB 4HS8L 4L4VB 5D6DC 5AG8A 1ZA6A 2ZCHL 4PR5B 2XKSA 4JG1H 3W9EA 2X4TB 5DXWA 4G8GB 3FQWB 4Q74A 4WW1B 1BQHB 2VE6B 3MLYH 4XBEL 2ZCLH 3MUHL 2XXMB 1VFBA 4P2QA 3CU1A 1RJYB 2EYRB 2VDLH 1QLFA 1EVTC 2VZOA 1QR1B 3FJTA 2J88H 3HN3A 4JFZL 1VHPA 4Z0XA 2W92A 4U0QB 1XGTA 4PJBE 5IHZA 5LBSH 3VGGA 1BFVL 1CD1B 1LMKA 2FGZA 3MLTB 4M7LL 1XMWA 1F4AA 3QUZC 1D5BA 3BRFA 5L9DL 2VDQH 3O6LH 4XWGL 1JGUL 2HT3D 3WL9A 5IQ9B 4AM0A 2ITDB 4NO0A 2ZCKH 1IFHH 4D0DA 3OKMB 4WTZG 2VLKD 1GC1C 3C8KB 2QQKH 3QIUA 5AEAA 4ODTL 1CLYL 3ULSB 3GHBL 1ZHNB 3C5ZB 5E95B 5INDB 3MLVL 5F96H 1NBVH 3U0TA 3CFJB 5I8CB 1RUQL 3WL9B 3UPAA 2R0WH 5JHLL 2BSTB 3BP5A 3D39E 2F74A 4AT6A 3OAZK 3GRWL 4LLAA 2IAMA 2X7LB 1I7ZA 3AS1A 4NC1E 1I8KB 5JO5B 1Q1JL 3S34H 3MREA 5DMGC 4PJXE 4XBPA 1KNOA 3KYNB 5I75C 3TEUA 4OV6F 4TQEH 1QLFB 4W6YB 3QPXH 3DYOA 4HUMB 5F1SA 4EUPA 4GRLB 2YPKB 4PJBA 1LO2H 4HIEB 5DUBA 4KPHL 4DOHB 1RJCA 3FQNA 2VR5A 5T1MA 1BQHA 4KZEH 5A43C 1RZJC 4KDVA 1KPVB 4OLVL 4YBHA 1RJZA 2VB5A 5F7UA 2ZG3A 1S9KC 4G7YH 3MJ9L 4XNUH 1G6RA 2GIYA 4L8SB 4R4ND 2YPVL 2BXZA 3BX7C 4NPYA 1R0AL 3OR6B 1CXEA 1YNTA 3QI9D 1G9NC 5F8RC 3QIUC 5TQ0H 1S7UB 5E56A 4M6NL 1YDPA 2D7NA 1F11A 1HHJA 4OLUH 2WP3T 2UZXB 4LFHD 4EDWH 4JFEA 3SGDH 3QUKA 4IHOB 2FZ3A 4L3EA 2P8LB 4POZD 5TDPB 1FYTE 3EBAA 3EDFA 1KCUH 3CZFA 1NGXB 5FA4B 4K3GA 2JELH 1BP3B 1KN2H 4XZUB 4Y4KC 5H35B 5IVXA 2G2RA 2R9HD 1VA9A 2E9IA 4Y4HC 1WWCA 3REWB 3TF7C 2OR9L 1UKSA 3RIAK 1I4FB 1FSKC 3OGCA 4RGNC 4U2ZA 1CGWA 1KB9J 1F3JB 3D0LB 5I73B 4PJIB 5KSBE 4P4KC 4HEPG 4DJMA 4G8FA 5JW3L 4NHUA 1HILA 1NQBA 1ZHLB 2V2TB 2APXA 4HV8B 5GS1B 2ATKB 5DDHA 4DEPB 4JQVC 1L7TL 1BVZA 3HLAB 4L9LC 3O2VL 5FV1L 3RJDA 1JWSB 4TSAH 3MQIA 1KG0A 5ERWA 2EE3A 1UADC 3VMOA 3DIFB 3V52H 4X6CE 2FJGA 1XGPA 5EUOE 2A73B 3IKCB 2X4RA 1EJOL 2DQEL 5HHVL 1JRHI 2VLKA 1AHWA 5ADPL 5BMFL 3DO7A 4ZTPH 3MZTA 4JM2F 4MA1B 2R0KH 1MRFL 1XF3A 4RFNB 3BH9A 4AEIL 1JP5A 1CYGA 2JK5A 3R0NA 2C1OA 2IAMD 4Q6YA 1FJ1A 2KKQA 4RAUA 4XMLH 4U1GC 5C08E 5D96B 4BUGA 1FFOB 2F53E 4H1LB 2GAZA 3TBVB 4HH9A 1NC2B 4JG0H 1OAYH 1KB5B 3W0WB 5CGYD 1AHWB 3B8SA 2FB4H 4HWEH 4MB3A 4GXUN 2N7AA 1INEL 2Y25A 1DQJB 1F4YL 3F58L 4M61B 2E9WA 3JWOL 3WXWH 3NABH 5IWLC 4LKCA 2CXGA 3HTLX 3IU4H 3V95A 1JWSA 2DLTA 4BZ2H 5C3TA 1T0MA 3L5JA 5E5MA 3S3SA 1UM6L 4I13B 4KJWC 3HAEH 1BAFL 2ESVE 2XWTA 5AZ2L 4Y19B 3ZO0A 1INDL 3QI9A 3WFBH 1ZTXH 1QRNA 5L88H 3NPSB 4NM8L 4CNIA 3H7BB 1KBGL 4NP4H 2H3NA 1LE5B 3EO0B 3RBSA 4JFED 2I9TB 5GPRA 5MEOB 4QHLB 5BXFB 5EO0A 9CGTA 1YPZF 4GW5A 2FO4B 1HI6B 1YEEL 1N26A 5HHOB 5B4MC 1YQVH 1BJ1H 4WJ5A 3QXTA 4MDIB 4PJFF 3DVGB 2VR9A 1OP5H 3ULUL 2ZCKL 1S5IH 3U7YL 1NGWA 5EZLA 1FZOA 1A4JA 5C9JB 3P40A 4I9WD 2J6EL 1P7QB 1Y0LA 4WFEE 1BJ1J 3ARDA 5FCUH 4AENB 4ZAKC 1NAKL 1JJUA 4XC1H 3L3GB 4G8GD 5FIEA 1QNZH 4EI5D 1TQBC 1GL4B 1R6VA 1KJVB 1T04B 3PP4L 3RA7L 4JFQA 2GTZA 4XGZA 5FYJE 5IEHA 4Y1AD 4Z5RB 2Q20A 2VUYA 3HHRB 4WW2B 3FQRA 3WJLC 1YEGL 4D9QE 4NQDE 2MWCA 5IBLC 1JPGB 3RWHA 1YN6A 2QQQA 3FT3B 5GGUB 3RVUC 3HUJF 1IC7L 2P49B 4MMXC 3MGOB 2X1WL 3ARFC 1S7QB 5SWQB 5J9PA 3BP7B 2NNAB 1CU4L 4NNPL 1CD9B 2WBJA 4DTGH 1RULL 2LAGB 3GEWB 5I17B 4QXWA 3MOBH 2WINA 3NACH 4KJQC 5T3XD 2YC1B 5GJTL 1NFIA 4KY1H 5TQ0L 4BYHA 2HJLB 5E6IC 4L4VE 2GKIA 3WLWC 1GGBH 4ZTOL 3CUPA 5E8NA 4OLUL 1J1PH 3T3MF 3AXLA 5I1GL 3AB0B 4G43A 3ZE0F 4HCRA 5AYUL 2IJ0C 5HD8D 5DVNA 3SO3C 3BOVA 3QO1B 1DVFB 5ISZD 4UNTA 1PLGH 2D7TL 3ULVE 4HCRH 2WQRA 1BEYL 1I9IH 1ZHKB 3C8HA 4O2FA 2R0ZH 1DBKH 3QEQE 5TE7H 3U30B 1DN2A 3SDDB 2DTMH 1PY9A 4JM2B 3MJ7A 4XTRD 1BECA 2IADA 1QRND 1MJ7H 4LSDA 3NZHL 3QDMA 3B2VH 4N90D 2DKUA 1NAML 3F8UB 3WYRA 4M5ZL 1KIRB 4EKXA 1F45A 4PRHE 5F71A 3V8OA 4RMWA 5IB5A 5IGXL 5J8OA 2EDLA 4MJ6B 1QFWH 3KYAA 4PRHD 1NDMA 3VD5A 2BRRH 1C5CH 2MNUA 2X4OB 2JJTA 1CD0A 3JBG7 4LSUH 1MF2H 3ALPA 2VLJD 4HGWB 4JY5H 4F9LC 4YGVA 4ZNEA 3T4AB 2CH8A 3N9GH 2BVQA 5LVEA 5AD0A 3BN3B 4N68A 1AD9B 2Z4QA 1MCEA 3QUZD 3ZE0E 2OL3B 2UUDK 3IF1A 3QJHB 4Y5VB 3CDCA 1BZQK 1I3GL 1G9EA 4RQQB 5GZNC 5CZXD 4G9DB 4X4XA 4OZIA 1CICD 1FNEB 4XMLL 3LEYL 2NY7L 3MLUL 3RFZC 3NPSC 3QJHA 3ILPB 2B1AL 2YZ8A 2QR0A 2Z4QB 2M26A 4HWEL 5C0CA 2C7UB 1HSBB 5I6XC 5JOPE 3T4AA 3KPOB 5HDOA 3IVKA 3CX5J 4N0CD 4I3SH 2VYRE 1DQDL 1RFDH 3ABZA 3AS3A 5C7XH 3C08H 1N6QL 3DMMD 3MMEA 3PP3H 5F7EL 1OAQL 2V5MA 3K46A 3PQYA 4MJ6A 5I73C 2PNDA 2BVEA 3HE7D 4FTVD 1I3UA 1WZ1L 4KRPD 4EI5B 4NKMA 3ZHDA 4LLUA 1MUJB 5IMLA 3V5HB 4LPXA 5DD1H 3QJFA 4MNGA 2P8MB 4Y5VA 5EIVA 1ZTXL 4H88H 4M9PA 2NY3B 4JZNB 4V1DD 5BW7C 3WUWB 3M45A 4O9HH 2VR4A 3CLEH 1SY6A 2GJZA 3FTGB 4YHKL 1L9MA 3MV9E 3NFSL 4JN2A 1SYSA 5IB1B 3X14A 1MWAH 1M7DA 1BQLL 4L8BA 1DQLH 4NIKB 5ESAB 3RRQA 2B5IC 4KJQD 4E5XA 1IM3A 3HNSL 2IMNA 3IFOB 4RFOH 4V2CB 3CK0L 4GO6B 3GI9L 4YHPB 3OR7B 1N2RA 3U6RA 1YC7A 4QRTA 5HVHB 4YHLH 1CIDA 1FNGA 5I1KL 5DWUH 3RHWF 3R8QA 1BOGA 4LF3B 2AEQH 1HHHA 1OP3K 2W91A 3DUHA 3QEUB 1AO7D 2A6IB 4PRHA 43CAA 3WV0A 5FO7B 1GGUA 3SDYL 1RUMH 1TVHB 1ORSB 3RPIA 1WCBA 2D31B 1A5FL 2VLJA 2YWYA 1H8SA 3FMGH 3AXLB 1PD6A 2H9GA 3FQRB 5ABDE 1N8ZB 4LCCA 4OJFH 2E6PA 2PKDA 4U0RB 4X6FB 4JKWA 1SY6H 2ZSWA 3WO4B 4W6WB 4FZEL 3WFEH 3LMJL 3UZVB 4NJ9L 3QWOB 5J3HD 3RZCB 2IH3B 2WW8A 4WU5A 4GKNA 2E27L 1RZJH 4LNVA 3F7VA 4RFEA 4K23H 4F57L 4Y89A 1L9NA 1MFAH 1TJGH 2B0SH 3FRPA 4Z8FH 1NLDL 3NCEB 3CLFL 5CIPH 2ADFH 2VNCA 3MRNB 3GDBA 1GRWA 1XR8A 1AKJD 5C0GA 3SDXF 3LKQA 5DQ9B 2PO6B 1M7XA 2IALB 2I07A 4TTDD 2D4FA 2XA8L 3PWNA 3QNYB 2H8PB 3QUYB 4PB0L 1F4WL 1BEYH 1QR4A 2Z92B 4P5MA 3LQMA 2ZUSA 4YDVA 4PJXF 1VGKA 1DBAL 2IBGA 1UJTA 1AGDB 4FTVA 1A02N 2DOCA 2NXYD 2YKLL 4XVUC 3ROOA 3OJDB 4JREC 5BVJA 4J6RL 3MV7A 2RAMA 2F5BH 3O4LD 5DJ6A 3IGAB 3H9HA 5FYKU 1S8DA 5C0GB 5DQDL 1A6WL 1MSPA 5CZKA 4LSVH 3GSNB 2HJFA 2JJUA 4APQC 2F58H 4Y19A 3I6LD 4HPOH 4JQXC 3SBWA 1IKNC 1IC5H 4DQOH 3U1SL 5IGXH 3SE4C 1OTSD 3VFPA 4BH8B 5EORL 2OK0H 4MAYA 2BRRL 3NCJL 1HQ4A 2NY4D 3LV3A 4GKNB 2IH3A 3VG9B 3DV6B 2F54E 5D1XB 2GY7B 4P9HH 4KROB 4ODUB 3TJHD 4LGPB 2EYTB 2BSRB 1U3HD 2DLIA 5E9DA 4N8VG 1Q9WB 4CNIB 2AERT 3E3QE 5D1XD 1EFXA 4OTXH 2ZKHH 2D31A 4JFYA 1F5WA 3U9PH 4QTHA 3LQAL 2BDNL 3BYTA 1IGTB 4YAQB 4LVOB 5DYOB 2VL5A 1KXQE 3KJ4B 5IP4A 5EBGA 3QAZC 4M7KH 4RAHA 2HKFL 2CDFA 4QO1A 1D5ZA 3L3KA 5ACZA 4LHJB 2Q7NA 3NFNB 1NMBH 5FYJU 3JWDH 1XIWD 1N3NB 3DXAB 4NQCD 4GBXB 4WWKD 4O2EB 2YD3A 4LOUD 5D2NA 5IK3A 2FR4A 4MVBC 3I9GL 4MXWH 4PV8B 3VWKB 1AC0A 3RX8A 5DUMH 4A6YL 2D9QB 3BKJH 4HH9B 5F7EH 4S1QL 2UUDH 2EDFA 3IFOA 4XVSL 3QHFL 2X4UA 3O6ML 2ICWI 1IGMH 4MXQD 1EAJA 4ZS6D 4X5WB 4YR6A 1GC1H 4H88L 1RZ7H 3BFOA 3VI4E 3ULUF 1OAXH 2FX7H 1H3TA 1OTUC 1FVCA 5JW4M 3BDYL 1EAPA 3S3JA 2Q76B 4LKXB 5J12B 3VFOA 1JGEB 1UZ8A 3I6KA 3VMNA 1KLGA 4ZUSA 1CQKA 1IGTA 3HKFA 5ELIA 1R3HB 1FRGL 1T1WA 4OZGF 5DDHB 5DK3A 3RWEB 5I1DA 1ZKAA 3SO3B 4IDJL 4WI3A 3VCLA 4U31A 3NFNA 1D5XB 3CFEA 4UT6H 3CCHA 4Z95L 4NPYB 1RV6X 5HPMA 3OKDB 5DJDA 2FH6A 4HS8H 1H3XA 5J6GA 5AWNL 1F6FB 4HHAA 4PGCB 3K8MA 1MI5E 3P4OB 4MAYD 2DWDB 4HIHB 1JTOA 4ONGL 5F70A 4EOWL 3CC5B 1Z9MA 1E6OL 3FMGL 3VE0B 2VH5H 4BKLA 1MFEH 3QR2A 1U3HA 5E9DD 1YMMB 5IBLD 4KI5F 5D1XA 4FZEH 3V5DB 4XXCC 3CDGA 1MCPL 4Y5XA 1DCLA 5F9AC 4ODBD 4ZUUA 1DDHB 4K23L 4OD1H 3QQ3A 3P4NB 4OGXH 3QUXB 3H0TA 2V5SA 4YPJA 1CXFA 1MLBB 3B83A 5TJWK 3HI6H 3UTQB 1XIWC 3GMOA 4DKFH 3GSNA 1F4XH 1LHZA 3GBLA 4NNXA 4OCXH 2QQKL 2BNQD 1JNJA 5IHUH 3DSNA 3MLVH 5F96L 5T1KB 4QRSA 4WWKA 3G5YA 1QHPA 1A3RL 4RGMB 1N0LA 3ZTJH 3VRLE 1NL0H 1F97A 3HZMB 1RZGA 3EFFA 2DQHH 5IBUB 1WC7B 5F6HI 3SDCD 1G7JA 2FIKA 4F7CB 5IMOB 1QA9B 2MHAB 2VLMD 5D1XC 4FFWC 4XPAH 1NBZB 4NZRH 4Z77A 3T0EA 1MJ8L 4K7FB 4V1DE 4YPGA 3QPXL 1U8NB 5ITBL 1HNGA 4HS3A 2ZUQB 4JPKH 1JYVA 1W0VB 4HW6A 5E2JA 2Z9TA 4JRWA 1TVBA 3U4BL 4MAUH 4I3RH 2XTJE 1MCOH 1I7UA 4LASL 4MJ2A 4OLVH 3T0XA 1OTSC 5I8EB 5EOTA 1ZT7A 1T6WA 3PDOB 3QDJD 3L1OL 4G7YL 5T5NF 2MOVA 5JXEC 2W0LA 2KBGA 3MLTA 4M3JA 2IANB 1UT9A 5DT1H 4HAFA 4QY8B 5E2TL 4YDJB 2ARJQ 3S35X 3S7GA 3I6GB 3VW3H 1T5XB 2LVEA 2A6KA 3STZA 4P2RA 1ZLWH 3RI5K 3H3KA 5EO1B 3MCG1 2LQRA 2ERJC 2ZP0T 3PJSA 5I1EH 1WFNA 1TVHA 3O6FA 3VFVB 3S97C 1CXLA 4PJDF 2BDNH 2AV7B 1A6AB 4F80A 4I4WA 4ENEC 5DF0A 1WV7T 2ICEB 1WC7A 3QDME 5C6WH 3EOTL 1AGFA 2GJZB 3QFJD 2DWEB 1PW3A 1I8IB 1U8OA 1C08B 5TDNA 2BZDA 1NMBL 4QNPF 1I3RA 1X5GA 3BE1H 4M4PA 4HDIB 4DGVL 1A3LH 3SOBH 5E94B 5IMLB 3TVMD 1KC5H 2NMSA 3BPNC 4ELME 2NTFB 4NRZA 3BKJL 2HFFA 2FLRT 4JZOA 3B9VA 4CADA 3DVGA 3GMRA 5FO9B 4P5TB 3O2VH 3MR9A 3QUYD 1MCWW 2HKHH 5F93C 3IVKB 1EGJL 4QRUB 1HHKB 4HMDA 4NN5C 4XCFH 3Q5YA 2EIZB 3HFMH 3FTGA 3G5VA 3NH7L 4JJHA 4NDMB 4N1HB 2BNQA 2EXYD 2EO1A 2A9ML 4JO2L 3D69B 5LXGH 1E4XL 1QTYT 4HUVA 4X4XB 3BMWA 3K8LA 4OZIB 2GT9B 4R2GD 3D2UD 2DJ4A 2FJHB 3P4OA 3EOAA 4TVPE 1MNUH 3W82A 2DKMA 5C0RH 5FUCC 3SKOB 1NFDE 3TN0A 3RUGE 1V3MA 3AU1B 1NLBL 4N8VB 3CVHA 5J3HC 4ODHL 3P73B 1NCAH 3UCRA 3L3DB 1JBJA 4UOW1 4KH2A 2HWZL 4PJ8C 5KS9B 4IIQA 5BZWA 2CMRH 1W8OA 2FD6L 4LCIL 4OGAC 3V6OA 4G6ML 2Y1VA 1A6ZA 3QUXC 3QI9C 4MNGE 1LDSA 1D9KC 3SN6N 5J56B 3VD3A 4PGEA 4JANA 3L3OA 3T8XA 4M6MH 4Y4KA 5EA0L 2YRPA 1N7ML 3RU8L 4XCNB 4CVZB 3DVNB 2M8XA 3LEVH 1KEGL 2WBWB 3GSNL 5D7JA 2FWOB 5I0DA 5KANG 3ETBF 4LVHC 2E9BA 5D7LE 4WFFD 2R2EA 5D8JH 3GGWA 1NGYB 5GGVY 3HE6D 1SVCP 1FG9C 4HQQH 4PRPA 5C86A 4O2FB 5EU5B 3QIWB 5C0BB 4W68A 3WFDL 4S1SL 3D85B 1X9QA 5F21B 2CSPA 4OZGA 5C09A 3DV4A 1A7OH 2FLBT 3FQTB 1WBXA 5FUZH 4BQ6A 5K59E 1ZWIA 5CJ8A 5BZWB 3QFJA 1S5HB 1OWWA 4H25A 3U7YH 2DD8L 3C8DA 3EDJA 3ILQD 4P5TC 5LGJA 1YEDB 3MLSH 2DLFL 3P9MB 3L3DA 4N5ED 2XN9E 2AJXH 4NZJA 3L3IB 2O5YL 3CPLB 1JF1B 4EN3C 4OUOA 1N0XL 3TVMA 4AJ0A 2NR6C 1P1ZA 2L7JA 3ZDYE 3C6SB 2FX8L 4YHOL 5IW1B 3Q48A 3HI5H 5D7LA 3DHJA 2P7TB 2ED7A 1KCSL 5ACMA 1EEZB 4RA3A 4Y0GA 1X3DA 1AD0B 4P46D 4D0BA 4OM0L 3RWHB 3T0VA 4HJ0D 2WUCH 3SE8H 3MXVL 1IGYB 1MFBH 4XNQA 1IC4H 4P5KA 4M00A 4HG4K 4F7EB 5E8DH 1XF4B 4Q6IC 1I9JH 4PBWD 1IC7H 3E6HB 4MGXA 4QRUA 1A47A 1N4XL 5CD5D 2I60L 2VXTL 1R3IH 4LU5H 1LK2A 3JTSB 4R4FL 1H0DA 3LV3B 1HQ4B 1S7WB 3A6CL 3CFIC 4NNPH 4UZGA 4DGYH 1I7TB 1LEKB 4ZO7A 1D5IH 1S7WA 5IOPA 3R0MA 4XMKH 4KY1L 3TN0D 1CBVH 3FO1B 2W59A 3MRIA 5E99L 3GMLA 4GMSL 4XTRC 2Z31D 1NGWB 3E6HA 5CKAA 4JKPL 2GUOB 5GJSH 4S1RH 3RTQA 4P5KB 3KLSA 3NGBC 4XB8A 2R1XA 1EHLL 1NCWH 3P9WB 2W1NA 3TNNA 2ITCB 2LTQB 4ZNCD 1NGZB 5ACLA 3K3QA 3OX8B 3OJDA 4WI5A 2FBOJ 4JCLA 3IS0X 5EO0B 4NSKB 3WLBA 3WN5A 1I7ZB 3HMWL 3UPCA 3RGHA 1TJIL 2X4NB 4O00A 5J7CC 5D2LE 3P2TA 1DN0A 5DHYA 1EZVX 4KXZI 5DRZA 3SCMD 4OZFB 3F5WA 4PBXA 2PXYB 5D7JD 2ESVB 1OAZL 2V2XA 4DGVH 3MRNA 1OW0C 4NUGL 1Z2KA 5HPOA 1ZHNA 1MCWM 3MRGA 1EEUA 5MEQA 3LPWA 4NZUL 4CU7A 1EZVY 1JVKA 3M07A 1N5YH 4HF5L 1T66D 1IKNA 1JPFA 2XWJA 4PRPD 4M1CD 1E6JH 4ETQA 3O2WH 2EXWC 3S88H 4XMPH 3F12A 1HI6A 1CD1A 5FYKD 4J1UB 1N64L 4POUB 3NA4A 4W4NA 5BXFA 1AO7E 4Z0XB 3MO1A 4WI8A 3HFML 5C08B 5IJVA 2VZUA 3QQ9D 1CFNA 4BELD 3UO1L 1DBBL 4HWZA 1CTOA 1O0VA 1MH5A 4TNWK 1UXWA 5E7BA 4X6DE 1XIWB 5GRXG 1UGNA 1HHGA 1GVIA 3DUSA 5HDLA 3I84A 3MJ9A 3W9EB 3PNWA 3OHXB 3QSKB 4GSDL 4HX1A 5D7LD 5JQHC 3MLUH 25C8L 3FHAA 1MNUL 4KJPC 5I1AA 4OD3H 1VFAA 4P23D 1U95B 5FCSH 2XICA 2FX9L 2VDPL 2MCPL 5AUMB 3MV8A 3PGCA 5J13B 3PGFH 1DQJA 2WUBH 1JZ3A 2X4QB 5JPMB 3PWVB 5FYLH 2QADC 2H26B 4G6MH 1FFOA 1BGXH 4Y88A 1EBAA 1UM4L 4L9LB 2VAJA 2P42B 1SEQH 4OF5A 2I27N 3FT2B 1I8LA 3L5XH 5AAWA 5EBLB 3CXHK 1YMMA 2PR4H 1FZKA 1KJMB 3QUML 4M7ZB 3GSNH 3T3PE 1ZEAL 4KUCD 4LRIA 1LP9E 2XNAB 3D0LA 1F3JA 1TETH 2Z31A 3ARQA 4OSUH 4JZJC 3UYPA 1RVFL 4NDMA 5DJAA 3T77A 3RTQD 5KSVB 1XGPB 2J88L 3TESA 1XR9B 3DIFA 3GSUB 5H35A 4N0UA 4PGCA 4XPBH 1IGFL 5F7KC 1MWAL 4Y8AA 4RX4D 1J12A 5E24E 5IG7B 2F53A 4JPWL 2COQA 1F2QA 5KVDL 3KXFA 2YD1A 2YRLA 2DI9A 4UT7H 3C5JA 3TJHC 1RUKL 2Z93B 2NTFA 4H8WH 5I1DB 3MRHB 4NZTL 4KDWA 3BAEL 3MRMB 3GJFB 4XPGH 5D2LA 2Z93A 2BNRE 1IMHC 2JIXA 1EUUA 1J0IA 3SDXA 3CSYB 1YNKL 2UWEE 3V7AE 1YEHH 4JRXE 3DMMC 4IRSA 3MJ6A 4KTYA 1OD7A 1CLCA 2ADIA 4U4BA 4FXKB 5GGSA 4UI2A 1P7HL 4G7VH 2IMMA 1JGEA 2YD9A 1B88A 4D3CH 4FABL 4K94H 2VXSL 5ETUB 3VA2C 1EIBA 2P5WD 4TYUA 3TBYB 4R4BA 4YHYB 3GB7A 3SE8L 3JV4B 2DM4A 1DEEA 1FNFA 1QLRB 4PRNB 3PE9A 5CJQH 1FZKB 4KZEL 2XOTA 2BVQB 5CAYB 5CHNA 1DLHB 5DLML 5IB3A 3KHQA 5CZXC 3BXNA 1J10A 1WAAE 3ARVA 5TF1H 5A2LH 2DBLL 1AI1H 3MJ9H 4X6DA 4Z7OE 3O11B 4K3JL 3DRQB 2WQ8A 5D9SA 4LRNL 4RGNB 1XGRB 5JPMA 3H2WA 1DL7H 2B0SL 1UM5L 4U1MA 4OF6A 4HIXH 5EU7E 1BX2A 3TBTB 4NHCL 4OI7A 4JFHE 1G0XA 3QBTB 4RGOL 5CEXA 1F90H 1TNNA 1UYWL 4ZO6A 3MV8D 5I1AB 4RAVA 2GJ6D 1B2WL 4CUCA 1ES0A 1OQXA 3HC4H 4WU7B 2YHGA 4X5XB 5E08H 3GHEH 3B3IB 4KQ3L 1FG2A 3TZVA 4ZUVA 5DD6A 2X7LA 4R7NB 4IRJB 5JO5A 3ARBC 1Z9OA 3MRFB 3MUY1 2XZAL 1UEMA 1FORH 4FFVC 1JNNL 3OKNA 1G7IA 1J8HE 4FQ2L 1DE4A 5JXAH 2A6JB 3Q1SL 1QEWA 1CI5A 4OLYH 2R1YB 2K7QA 3C5ZA 4GUPB 2DQGH 1PJ9A 3SKUD 1FYHB 2B4CL 2CDGA 5TE4H 4RDQF 3KPSB 4R3SA 1LO3H 4NKQB 1CZ8L 4ZFOA 4HUNB 2DQTL 2ZNXA 2YD8A 1PZ5A 4MLIA 4RX4A 3S88L 3QXWA 3TIDB 4PV9B 1J5OH 3MRBA 1JPTL 4Y5XB 5J4MA 5CCKL 4PJGF 2X44D 5SWQA 3FB6B 3MOQA 2V7NA 3LN4B 1Z0MA 3OPZL 1UXSB 3BIKA 4ZTPL 2JIXD 5KVEH 3JV4A 2HMID 3IFNH 1FO0B 3RWDA 2QEJA 2NY6D 4NCDA 5TDOB 4LSSH 4Z5RA 3HE7B 3BD5A 3IXTA 3WS6C 2VDKL 4HIHA 2ZSVA 2VXQL 4KU1A 4AL8H 4ZFOL 4IMKC 1TXKA 1IQDA 1NGZA 3VFGL 4IRSD 3IDIB 4OFVA 5KSUB 1NUDA 3LVEA 4RGMC 3MRQA 4PY7A 2P5WA 3HPLB 3U0PA 1TIUA 4HKBA 3QDGB 1QACA 1F4YH 2VL4A 5HYSB 3PGFL 3R8BB 4QHNB 5CWSB 1ZANL 5HGBA 2FEEI 3GSWB 3IXAA 2IQ9L 1DUZB 5IG7A 1UM4H 1LVEA 5ENWA 3QULB 2HVJB 4RCAA 3MNVA 4F33B 5DMGD 1I8LC 5DVKA 3EYVB 5HJ3B 2BNQE 2F54D 1R24B 1GOGA 3QUMH 2OQJA 2VXVL 1G9NL 4GRMB 3GK8H 1A9BB 1IAKB 2FATL 1CWVA 1KBGH 4NP4L 2DBJA 3EYSH 2JTDA 1KTKE 4TUOB 1JGDB 4OQTH 2R1WA 3EJJX 2FBJH 5DRXB 5L2KA 5L6YH 1WBYB 3D1MC 5FO7A 3DLQR 3H9YA 1H5BA 1DEDA 3TO4B 3KLAA 4LGSB 1M7IB 1K4CB 3TZVD 1A0QL 1JZ6A 5I9QB 3E2HB 4YQXH 1MCHA 2DQFA 1OL0A 1Q0XL 3UBXA 2AEPH 3OR7A 2OZ4A 4ALAH 1RY7B 3O2DA 1GZPA 1CT8B 2DRUA 5T3XE 2FCBA 4PG9A 5I18L 1QSZA 3MSPA 3WXVL 3EYFB 1UKQA 2VZVA 3EOBB 3LS4H 2CGRL 4ZD3L 2QHRH 1NGYA 2GYSA 3V6ZB 3PL6D 7FABL 4EOWH 1NMAH 1JMZA 3LEXB 4UDTB 1V3LA 3C5SA 2VH5L 4PJEE 1R24A 1ZXQA 4OF3A 4S10A 4L3ED 4X8XA 3RVTC 3RVVC 2DQIH 3HG1D 3U4AA 3VXNA 5K9JL 5FFLA 2WWMC 4HC1A 2GY5A 5I15H 2CRIA 1N59B 1FAIH 1A6VL 1WTGT 1UFUA 1I1RA 1F42A 1Z3GH 5JPNA 4HXBL 4Y2DB 3FOMA 1F90L 2VLRD 4R8WL 2ED9A 1J1PL 4M62H 4MA8H 3HNVL 1A7PL 4HK0A 4YXKL 4OCRL 2AGJL 2VDML 3RKDD 1LP9B 2VC2H 3VI3F 2P4AB 4HJJL 4QHKI 3RGVB 4M02A 3OX8A 4EVNA 3DX9A 3ARPA 3UP1A 1LEGA 3OKLB 3X3GH 2D9CA 5IM7A 1F00I 4AG4H 3G5VB 4KMTL 5JXAL 2FDBP 3RTQB 2XZCL 3PABA 1NAMB 2UV3A 4KDTC 4Y4HD 3CNKA 4XPHL 4LLYB 4PJ5D 3VGAB 3G5XA 4EQ2A 2H41A 1CG9A 5L2KD 3FB5B 3WD5H 2G9HA 3OAZH 1NANH 3GSVB 5K33A 3TYFA 3L95B 4PTUB 3IDMA 4PJCB 3O6KL 4KKCD 4LLQA 5EC2B 4BFIB 2BOCA 2GK0B 2BVYA 4JY5L 1F8TH 2WIIA 4X6FA 3O2DH 2J3SA 2C4FU 4FTVE 3FOLA 3BQUC 4NUJB 5DJXB 5IEKA 3VFMA 1HWHB 2K3TA 1JK8B 3V4VL 1DSFL 3PWLB 4Q7DA 3T2QA 4CU6A 2R2CA 3BPNB 1IQWH 3MZGB 5EU3A 1Q38A 5C6PB 5IEKB 1ORQA 3HAEA 3L7FA 4CN1A 3BP5B 2R4SH 1P1ZB 3PL6A 4LF3A 3U7AA 4CN6A 3BVNA 1BBDL 3BUYB 1X5LA 5EUOF 2P5EA 1OAUL 4KKLC 4JY6A 5D1QD 4ZAKB 2XACC 3BZEA 2YC1A 2D7OA 4OCWH 1UQSA 3IDMB 2XZQH 1IEAB 2E7MA 2E7LC 1KIPA 5E00A 1T6VN 5CMAA 5DRNA 5BO1H 5EU3B 3FB5A 4YBQD 2H1PL 2E5EA 3EIFA 3O45A 4XP1L 5FA3A 3S5LB 1FZMA 1P2CB 2X1OA 2B1HL 4HGKC 2ZCLL 3GFUA 1V5JA 5BOZG 5BRZE 3CH1B 2MQ0A 4EQ3A 2VLRA 2FEDC 4YPGB 2WIIB 4XGZB 4LSRH 4OQTL 4ERSH 2EC9T 3ARDD 5DMIH 5A2FA 5E03A 1J1XH 3OSKA 1ND0B 1NFKA 1S3KL 1S78D 4G8GA 4LLUB 1K3ZA 2X4TA 1T7WA 4EI5A 3WS3B 4Z7QF 4JKKA 5FYJL 3VWKD 4HK0B 1NBYA 4G5ZH 4KVNL 2G9HB 5H37H 4MQ7A 1KFAL 4Y1AA 2ZG1A 1BQUA 4LIQH 2BY0A 3GJFA 4C83B 2DS4A 1J8KA 5J1AB 4HFUL 4XB7A 2E9JA 5A40E 5IROA 2WANA 3BPOC 5LCVH 4Y4HA 3QHZH 4O2CB 3OXRA 3LSOB 4MDIA 4PJ5A 3D39A 3FFDB 4PJ9D 2ARWA 1JYWA 5J57B 5T1DL 1D9KB 4U1KB 1K6QL 3P77B 4P46C 3U9UB 5AYQA 4ACPA 1RK1B 2VLRE 1ZGLP 3MX0A 3WJJC 2WBJD 5IROC 4ZFGH 2G60H 1OCWL 2DQJH 3VJ6B 3LRGA 4RMTA 1UH3A 5C8JA 4ZO8A 3UBXI 4X7CC 1XCQA 4M8QB 5ITFA 3CSGA 2UYLB 3QXVA 5JW4R 2XKNB 2ICWA 1RK0A 3BHBA 1G9MH 4JZJB 1RUPH 2R23B 1A1MB 5EO9B 4O02L 3RDTC 4GRWE 3FFCB 3KR3L 2IFFL 4XPFL 1N59A 1JRHL 3BN9D 4ODSH 3ZTNL 3QDJE 4LKCB 3KPMB 2CLZB 1I1AB 1CDCA 5AUMA 3MLSL 3GHBH 4L1DA 4MQ7B 2Z0BA 2RHEA 5T3ZH 5D1QA 4FQIL 1VPOH 1CGTA 1NC4B 3RGVD 5JHLH 1A7PH 1HDMB 3MNZB 4RAUB 4UV4L 4XAWH 1Z0NA 3FL7A 4FNLL 3C2AL 4K8RC 5HI5C 1AR2A 4IBLT 5DURD 1XF3B 3N85L 4DEPC 4TUOA 1I1AC 3HA0A 2DMKA 5CJOL 4YFLF 4DCQA 5IJVB 1ZVSA 2DIBA 4LDOB 3IKKA 5DQDH 4PIRF 2VQUA 1KIQB 1YEIH 4XPHH 2W0PA 3EFDH 3QUZA 1N4XH 1TJHH 5ERWB 3FT4A 4NRYB 4E0RA 3SQBA 2OTUA 4QY8A 2ZJSL 4ZS6C 4YDLC 1O7VA 4J3SA 3EO9H 3NCJH 1JZ7A 1OB1B 1IZKA 3T0EC 2KQMA 2XTJB 1XH3A 3Q6GL 4DVRH 1T1ZA 3BO8A 1FP5A 2W9EL 4KGJA 2E6QA 5C0CD 3F5WB 4KVCL 1YN6B 3FT3A 2Y23A 5SWZE 2AJSL 4XH2A 1K3IA 5KZCD 1BM3L 2VXUH 1I1YB 4OTXL 5KSUA 4UB0L 3WN5B 3U9PL 3D39D 5L8JB 3ES6A 4PJ9C 3V0VB 3VWJD 5L0QB 1KN2L 2UZYB 3HE7A 1CICB 3FCTB 5JQ6H 1LGVA 3EFFB 3NBNA 1RZGB 2V5RA 3L3GA 2P47B 3LY6A 4H0GA 3EW3B 2NY0B 3FO2B 4XX1G 1MLCB 4P59H 3UMTA 4FFYL 4LDLB 1BBDH 3IXAB 1RURL 1YDPB 4U6HA 4V1DA 3I6LE 3L9RB 4MJIE 5I71C 2Z91B 2FEEL 3LOWA 1X7QB 1VADA 3KYMA 4QF1B 4OKDA 1EX0A 2P24A 1MLBA 3L6FA 2EH7L 5L0QC 3RVTD 1E6JL 1H0DB 3B5HA 3IDIA 3KNBA 5JOPD 1P6AB 2Q3ZA 3DYPA 1KPVA 2Y5EA 3O6MH 3HPJB 1LO4L 3SKJH 4XP1H 4V1DB 3G08A 5HHVH 3EO0A 2C1PB 2NR6D 3FO2A 4G42A 4OI8A 1QFUL 1DQQB 1IC1A 3P9LB 5IHBA 3CXDH 4Z7UB 4GQPH 5FOJA 3ULUC 4J3OC 4N5UA 1YEEH 3TVMB 4G5ZL 1H3PL 5TPWL 2FB4L 2VSDA 1QKZL 3ARTA 5HGAA 4F37F 2Y6SC 3BRDA 2YD4A 3LAFA 1INEH 1X4XA 4Y4FD 5IMMA 1UJ3A 3QPQD 1IL1B 3HR6A 3FRUA 5IKCB 3R4DA 1WBXB 3WNOA 3DV4B 1U41A 5FXCH 1A7RL 3CFCL 5IBTL 3D48R 1LD9A 3D85A 4IOIB 4GW4B 1OGAE 4P57B 4JAMA 2IQAA 5AWNH 4JFFB 5AZ2H 1FJ1B 5HHME 3V4UL 3BXNB 1INDH 4JFHD 3VH8A 2IG2L 1XF5B 4TSBH 5J89A 3WNNA 2H9GB 1VGEL 4OSUL 2RB8A 1FCGA 1T20B 1YEGH 2FWOA 3BGMB 4BSJA 4YDKL 5LGKA 3HI1B 4X7TA 3BZ4A 1EO8L 4FQHA 2X4RB 1WK0A 4WW1A 1AKJA 4HBCH 2FJGB 3EDDA 4JANB 1RUPL 3OKKA 1XT5A 1JHLH 4U2YA 3LKOB 5K9OB 1HHHB 1CU4H 4KK9C 3WKNA 4NWTH 2ZUTA 4KRNA 3TO2B 3UTSD 1RULH 2HTKD 4ODSL 3MRCB 3LHPH 1EGJA 3B6SA 3MTRA 3MV7D 4QHMA 3RNQA 1ZT4B 4YK4B 4HG4J 1S7XB 1YZZA 5CGMA 4XPGL 3O0RL 1LNUA 1Q9LA 5FM5O 1CFVL 5C08D 4B7IA 2EXWD 5D72L 4M6OL 2X1XR 5ANMB 2YBRB 1KJ3H 3BYYA 1BBJA 4ODWB 4RIRB 1A1MA 4RMSA 1W8NA 5A3IC 1A1NB 1P6FA 1MRCH 4ONFL 4NZRL 4DUVA 1NBQA 4Y2DC 1B3JA 2HFEB 4D9RE 4PGBB 1NKRA 1FC1A 3NZHH 1AGBB 4L3CA 4PREA 5IFHL 2B5IB 4FS0A 3RWGB 1KCLA 1EFXD 4JO1L 2ZJSH 3TWCH 1TLKA 4A2MA 4O4YH 2OTWA 4ZSOE 4U3CA 4K71B 2H26A 4PRBB 1QFOA 3RJQB 2F15A 1BJMA 5JHDE 4WFHD 4O2CA 1UM5H 2WP3O 4QHNA 4LSUL 2C3WA 5HYSA 5KZCB 1RJZB 1ACYL 5FGBA 4R7DA 2AKRB 3UJJH 3VW3L 5GHWH 5DMKB 4Y1AB 4Y4FA 4I9WE 4AH2A 2GITA 1S8DB 2BY3A 2XNAA 1ZGLB 2NY1B 3C60C 1I85A 3O3DA 5DJZB 5HYQB 1WICA 1V3JA 2HG5A 5GRUH 1A9EA 4MXQC 4TUJA 2H2SC 3MREB 4HWNA 1IZJA 3BSZH 4HMEA 1DQML 1D9KA 3LEYH 1P7QD 5C0AD 4MWFA 5I8KH 6FABH 3THML 4P59L 3VG9C 1CFNB 5EDXA 5C0AE 1PBYA 3EO1B 3O45B 3QIUB 3ULSA 2B4CH 3C8KA 3BIBX 4WWKC 4D0DB 1DQDH 3Q6FB 4FQQA 4MB4A 5KN5A 4PGDA 5TFSL 4PRDA 4N0FA 4C55A 4QT5B 2EH7H 3T4YB 3CAFA 5E00B 1MWAB 1HKLH 4PRDB 3GMQA 2EZ0C 2C3VA 2A83B 1MF2L 5C6TL 2H32A 2VLLB 4GJTB 2J4WL 1J88A 3V0WH 1X5KA 4KQ4L 3MJ7B 3CH1A 1RJYA 2EYRA 2DJUA 4HWBA 4JKMA 5DRZB 2WK2A 3L7FB 1U8NA 2A9MH 1RPQA 3NZ8A 5C0JB 4YHKH 5J1TC 2Y72A 5FB8A 2OBGA 2VXQH 2VISB 3FQWA 3DECA 2ZUUA 4QXGL 4LP4A 4JQIH 5C0DB 2ITCA 4QXTA 4M7JH 3ARGB 3HNSH 2N1KA 1H3PH 5TPWH 5L2JB 1E4KC 3DUUA 1YC8A 4JDZA 4ODHH 3SGJC 2GW5A 2AEWA 3MODH 4LLWA 3MJGX 3MGAA 4LSPL 2P5EB 4PY8J 4I3SL 4OB5L 2DKSA 1A7RH 5IBTH 1E4XI 3TNMA 1OAQH 5IESL 1U93B 4QGYA 2Z35B 1REIA 2AEQL 1DVFC 4Z76A 2P43B 3IDNB 4AEHL 1WQVT 2HG5B 4OV5A 3SDYH 2NY0C 5DD1L 3HUJB 3LEVL 4NRXB 1L6XA 1GGYA 3ZYIA 1XGQB 1I8MB 3EYSL 4F9PA 1CLZL 4R96A 4HBCL 3GMMA 4S1DC 4HQQL 2GK0A 2VLJE 2GI7A 2XFXA 3WHXB 3IAQA 3QISA 3WKML 15C8L 1DQLL 5MP6L 4K55A 3SDCA 5DJDB 5E1HB 1M71B 4NWTL 5BQ7A 2PN5A 3F7RA 5FO8B 3W39A 2AXGB 1PY4A 3GI9H 3ROLB 2EO9A 4WW2C 4LLYA 2AJXL 1CR9H 1KELL 2D03L 3HUJE 4DVBA 3ARED 3ECBA 2YUZA 2YUXA 5TH2A 2CUMA 3BP4A 3M1BA 1U92B 4JKLA 1E27A 3IJHA 4I18C 1VFUA 3QDJA 3OKKB 3GJEB 3REVB 1XR9A 5KTEH 5IJKC 2J5LC 2Z8RA 1HHIA 5F3BB 1MQKL 3P4MB 1NMAL 3IDGB 3VXQB 1MFBL 2X10A 3U48A 3TH2T 3F62A 3CPLA 3FOMB 4XP6H 2O5ZH 4P2RD 1O5DT 5CBAB 1MEXL 3QPQC 2HT2C 5T33L 1F4HA 4ENED 3RKDC 4I0PA 5CGTA 1U8MB 4FZ8H 1AE6L 4KC3B 1OSZB 4JO1H 3O6FD 4O4YL 3ZKXC 3QZWG 3IJSB 2YPVH 3VWJB 3DVIA 2X4QA 3ARRA 5IB5B 3SE9L 1QSVA 3TH4T 3G6JB 4LCYA 1V8HA 4WV1B 3UC0L 3ULUD 5LKNA 3A6BH 4NKIH 1I1CA 2BNUA 5TGBA 1JZ2A 3TJEL 1NGQL 1NC2A 1KOAA 3TN0B 1PQZB 4G80B 4PB0H 3VFRA 2LAAA 3HC3L 3QDGE 4G6JL 4GMTL 1BWWA 2HAZA 1DBAH 4HLZH 3KPSE 1HHGB 2VN7A 4J8RB 3LD8C 4KKNA 4UTAL 1MH5B 4OCSH 5ILTL 1DQQA 1DVFA 2XQBL 4HXAH 4LLDB 4J3VA 4IMLB 4E41B 2ATPB 2YMXH 4R0LB 4ELKB 1YMME 1WIOA 4ONHA 3O3AB 4H5SB 3EYVA 5HJ3A 5CILH 4JFEE 4YXLH 5KG9A 4RISH 3ROLA 1HXYA 3M17A 1J05A 4DQOL 3HLAA 3G5ZA 3WJLA 3MR9B 2WM0A 3O9WC 4HJGA 4S1QH 2DMCA 1T03L 5GS0D 1NC4D 4Z7UA 3QDGA 4NQDB 1EXUA 4MMZC 5BV7H 2DQEH 2A2QT 4KQ4H 5ADPH 3MRQB 5DJ6B 5I16A 3CFKB 3LKRB 4PLKC 3RX7A 1S7TA 3AREA 4EIZC 3W0WE 1U8IB 4FQCL 1AGFB 3UAJC 1MRFH 3TZVC 1M1SA 3V4VH 5I1IH 1IQDB 3D5OF 5ESVB 3IDUA 4OM1H 4NZDA 2ZSVB 4N0UE 5TDPA 3OB0K 3LB6D 2NZ9C 2EDKA 4Y4KD 4Y16A 4JG0L 1I9RH 4MD4A 2DB8A 2DAVA 2OXGA 4P3WA 3MODL 4ZXBD 5C9JA 4YFDB 5E94A 3BO8B 4UINH 4U6HB 2YA2A 4JPIA 4PJDE 5DUML 3MLWL 3QRGH 1GAFH 2BNRA 1MHCA 2HT4C 2XZQL 3UZEA 3V6BR 3HE6A 3WHE1 1R3LB 4WFGE 5KANI 1RZKC 4I0PD 5LWYL 1AY1H 4L29B 4APQB 5BO1L 1SEQL 3M17B 1D6EB 4XVSH 4WVRA 4EN3A 5EZOH 2W9DL 5C09D 3V0VA 4KI1A 3OXSB 4JVWA 4TRPH 4ONGH 5FUOH 1GC1L 3WFBL 4GXVH 3V2AR 4UILH 3QXDB 1DE4B 2VERN 4RWYL 4OGYH 4CGTA 4UDUA 4YZFF 5F7FA 2A6KB 5EOCJ 3RPIB 1EXUB 4NQDA 1EERB 2BRQA 3NIFE 4P3DB 2VLME 4X80H 5KAQG 1FPTH 4OGAD 1IGFH 2GJJA 3QEHA 1F13A 3OKEA 4YHNB 1U8QA 3TBSB 3UXFA 1AJ7L 5FYJH 5HSFA 1RSFA 1YEFH 3MRRA 4WTZA 4EBQL 2OR8A 5I8CA 1J05B 4ZFOB 3V9FA 5CP3H 2OTUB 1DVFD 5ISZB 3FT4B 5FHBL 1BFOB 1WFUA 2CKBB 2D03H 2J6EH 4I1NB 5JHDB 1MHHB 5EU6E 3QUXA 1JCKA 3CMGA 4NC0B 1G7IB 5F1OB 3RZCC 4WUKH 1KEMH 1KTDB 2R0LH 3NAAL 5FF6B 2G60L 3A6OA 5FYKH 1A9EB 5JOFB 2BK8A 4IJ3B 1EHAA 3BT2H 4NFCA 5CHNB 1ZHBB 2CLVB 1ULVA 1CDHA 1KXVC 1UKTA 3QDGD 4ZAKD 3TN0C 2O26U 2HT4D 3W2DH 4WENB 1N5AA 3DVNA 3RP1A 4KKBC 5CD3B 4MAUL 1QVOB 4XCEB 1JGVL 3IYLW 5DK2B 5EN2A 2BERA 5KSAB 1RZ8A 1XEDA 4NKMB 4YBLB 4LASH 2GHWB 4X5LA 2OYPA 1KIUA 2IFFH 4KI5D 4P48A 1AI1L 3IJHB 2IPKB 3NN8B 3RY4A 1JHKL 5CJXA 4PRBA 1BWMA 3V5KA 4IIQB 3BPCA 3I2CL 5BCAA 1JGLH 2I9LA 4WTWA 1NFDB 4KK5D 4ZSOB 5DTFB 4U7SA 3CIQA 3SCMA 5F7HA 3U79A 4NKIL 2R15A 4KUZL 3GSQA 5FYLE 3VXTB 4ZXBA 4MVBD 3MLXL 4L3AA 4ZQKA 3D0VA 3EKCA 5FYLD 2ZG2A 2JCCA 5ICXA 3KYKH 2Y6SD 2FJFB 3MNWB 1AGCA 2Q8BL 3HC3H 4TULL 1CL7I 4PJDA 3HR5B 5B8CB 3GSUA 3V7MA 4PJDB 5TE7L 3O41A 5DJCB 4R97C 2O61B 5KOMC 5T1KD 3QIBA 2AABH 5ICXB 5I1CH 2K7PA 1AD9A 4GG8B 5I8OH 3DYMA 1GGIL 4MJ5A 1FZMB 5D2LB 5JUEL 1IM9A 3TCLA 1TJHL 2PF6A 5ALBL 1S7XA 4A6YA 5JXED 1K8DB 1X5FA 1HOCB 1ZT4A 5DS8B 1OARL 2AJ3A 5HDQL 3WUZA 4XC3L 4TPRH 3NIGF 1F3DJ 5T5FL 4IEFB 4UQ3A 5C2UB 2HN7B 4FXGB 2GJ6B 1FDLL 3Q6GH 4DVRL 3CDFA 5DJ8B 5E7FA 5D2LF 2ZOKA 4Y2OA 4XCFL 4L9DA 3N9GL 5SV4A 3C9NB 1MIMH 4FMFA 3FQNB 4KMLB 3IFNL 3U46B 3TM6A 1I7RB 1I75A 2CK0H 3QUXD 3VXSA 3ALXA 4MZ3A 4OV5B 2YZ1A 2VOTA 3AS0A 3CFDB 3ULVH 4HKXA 3QH3B 4WI9A 4AT6B 3EOTH 3T0AA 1V7ML 1ZLVH 1UXWB 5D5ME 2XWBA 3PHOB 1UEYA 1C5DA 1V7NH 1YMMD 3MC0A 1UQSB 1E4JA 3CFJA 1M4KA 4ZAKA 3CFBA 3S96B 2EC9U 3GBML 4WUUB 3T65B 3C08L 3F12B 4AY0A 2CDFB 4KTEL 1EHNA 3HAEB 1DBML 4LVNB 3T4YA 4QXTB 5F7MC 4QT5A 5GIRB 3QDHA 1OF2A 3KXFE 1WZ1H 2EDNA 1U6AL 1CG9B 4JG1L 3G5XB 5EZOL 5IHZB 2F53D 2YPLD 4PJXA 3S36L 3RU8H 4OF0A 3KXFD 5IR1B 1KEGH 3AMKA 2VXVH 1SBSH 4XCCH 2NW3A 4D9LL 4POZC 1SYVA 3IGAA 4OGYL 4XVJH 4X9IA 1DN0B 5JZ7C 4HULB 3CXDL 2IH1A 2Q7YA 4H1LH 3AMLA 1T5WA 3SE3C 1FPTL 1ZOXA 4U6XA 3PGDA 3C09C 3DETC 4NQEE 1JV5B 5CUSL 1BFVH 2Y36H 3QCUH 1ZA6B 3MACH 1BOYA 1JPFB 4ZPTA 5T1KA 1XR8B 4LLVB 3QIBD 2GUOA 3NPZB 1P4BL 3CVHH 3G6DH 4GKZA 1J0JA 4Y5YB 5GS0L 1IFHL 2UWEF 5B38A 1X4ZA 3VG0L 3MRIB 3BZFA 4BK4A 2GSGB 3FONA 4P2CG 4OLXL 5DJYA 1PKQA 3L9RA 3MOAH 4YHLL 5MI0C 1EH9A 3N1QC 2FD6H 4LCIH 5DWUL 1J11A 3L7EA 1ZLWK 5JXEA 4GH7B 1PG7H 2AQ2A 2ERJB 5IFJB 3EZJB 4EVNB 1FVEA 1UWGH 3S5LG 2FX8H 2VIRB 1UB6A 4JFPA 2EYSA 3KPRD 1KPRA 3PL6C 4CJ1A 3V4UH 3LPFA 2EKJA 2NTSP 4V2BA 5DVLA 5LAXB 3NAAH 1Q1JH 32C2A 1G7HB 1OTUD 2QHRL 1KCSH 3PWUB 2Z92A 2R69H 4L3CB 4CJ0A 2PO6A 4G8GE 4YHZH 3LKQB 1LK3H 1T80A 1XF2A 2RBLA 2OJEB 4CMMB 2VABB 4J3XA 1MHEA 5FGCB 5EPMA 3PIQB 4XNZB 4K7PX 1SEBB 3SKMA 4HZLA 1HCVA 4PJGB 4LPYA 1T1ZB 5D7LB 1TPXB 2VXTH 4QNPE 3OKDA 1P84J 2DN7A 1ZSDA 4PJ8A 5D7IE 3W81A 3IAGC 4XNMB 3QWOA 1TVDA 2DD8H 3I2CH 5KSAC 1N2RB 1FH5H 3P9MA 2CIKB 5FDWA 1KIQA 2LU7A 2IC2A 4R8WH 3DGCR 3C5ZD 1MAMH 4QYOA 4EDWL 3HNVH 3PHOA 2GAZB 4G8EB 3AUVA 4QGTA 2HP4A 3EGSA 2AGJH 3U82B 1LEIA 2Q8BH 4FHBD 1K9TA 4X7SL 3QIWA 5C0BA 3KLAB 3I6KB 3VFOB 3B9KC 1FZJB 1FCCA 1HSAA 8FABA 2BCKA 4N0RA 4OM0H 2CLRA 4TSCL 3BIAX 5IQ7L 2BVUA 2PYFB 5I8OL 1H8NA 4CVUA 1PDKA 1YY9C 1G9MC 1FNGB 3WIIH 2BNUB 4YWGH 2AJYH 2KL6A 1NCBL 5C1MB 3UTPE 1IAIM 2I60H 4NO5B 2MQ3A 2NX5D 4JGMA 3TWCL 3RZCD 5HDQH 2HLFC 3ZYJA 3N1GC 5DMYA 1BVLA 1G1CA 4TSAL 1II4E 3GSWA 3O6KH 2FR4B 2VDNH 1H5BB 5CWSA 5I1JH 4P9HL 4FG6C 4WNQA 4JKPH 5JR1H 3FFCE 5HGAB 2AVGA 5D7SH 4QHUA 3SY0B 5D1QC 1KULA 4CVWA 2P1YA 5KSBA 3O3BA 1I1FA 5FKPA 5FA4A 5I9QC 4CW1A 1NDGA 4GW4A 3U9UA 4PJ7B 3PDDA 2JJSC 1MFDL 2R4SL 2BSRA 2F54A 1IJ9A 4GLRI 2DQUL 3L7EB 3U30C 2FX9H 3LSOA 3QIBC 1SM3H 3ARZA 2MCPH 3SKNB 2N4IA 3F58H 4MA3A 4Q9RL 1QYGL 3SGDI 2HTKC 3K2MC 4OKVA 1F58L 5CKGA 2Q3AA 5E9DE 4HUUB 3ISWA 5FOBB 4FQ1H 3DETD 3QQ4B 1N5YL 1UWXH 4KTEH 3MBXL 1HKLL 5BQ7B 2HYMA 3CX5K 3L3HB 3W9DA 1UWXK 2H1PH 1N64H 4P4RB 1IGML 1UZ6E 4PJ8D 5A3ID 5IVZB 5JIPA 4M43H 5DEFA 5GRJL 3DSFL 1WAAA 5A16B 5FM4A 5C2BH 1I8IA 5A2JH 3BGFC 3BQUA 2C1PA 4XVJL 4R90H 2PYED 5F88B 4HKZA 4ERSL 1I9EA 4J7RA 3U36A 2CR6A 2AJVL 4NM4H 4L8DB 4TOYL 2OR7A 5DD6B 3TPKA 1KTDA 3QIWD 5C0BD 5D93C 1J0ZA 2K1MA 5GISL 3ULVD 25C8H 4EUPG 1FRGH 4GW1B 1ZLUK 4FP8L 3N1FC 2G75A 4J12A 1P4BH 5JTWA 1BD2E 3MUGA 4XNZC 3BW9B 1BX2B 3TBTA 1NEZB 3WSQH 2WUBL 4C4KT 1DANT 2R1YA 4OB5H 1OB1A 2QSTA 4KJWD 4NQTA 2EDHA 3AM8A 3RL1A 2ORBH 1NAKH 3UTZA 2NX5A 3DNKA 3NIDF 1U8HA 3HG1A 1T0PB 4PBVC 4MCYA 3C6LC 3QEHB 4U1NB 1TQCB 3DTXB 2AV7A 3QUZB 4PJ9B 4KHXH 1UB5A 3NTCH 3VD7A 5IB4A 2W65A 5IT2L 1CE6A 1I7RA 1AXSA 1CGYA 4IMKA 1ZVSB 1E6OH 4NNYB 5CEZH 1MFEL 3RVWC 2QSQA 5IEHB 3ZKND 4Z77B 1TTGA 5IMOA 4F7CA 1C7SA 2QQNL 4MCYB 4QWWD 4XPFH 1KPUB 3UTZB 4NQSB 4IRJC 2NLJB 4OGXL 3H9SE 2NNAA 4UT7L 4PGDB 5J9PB 1DL7L 4E0RB 1I7UB 5DI8B 1E4KA 2CIIB 3B9AA 4WDIB 4UNVA 3MBEB 4HBQA 2EDOA 4K8RL 4Y16B 1YNKH 4GW1A 1G0YR 5E08L 4LVHB 4XAWL 1WZKA 1HYSD 3CDGB 4XP9L 3C2AH 3O41B 1UH2A 4MQXC 3WFHB 3WIFA 5EOCL 2F19L 4D3CL 5HI3D 1JYNA 4ZUTA 4L1HA 4QOKE 4OF8A 1ED3B 3IT8D 4OZHB 3AREB 1JNNH 4LHUB 3WUWA 3CSBA 2L0DA 4FQ2H 5D1QB 1FBIH 2AJZA 2GITB 2RQ8A 3Q1SH 4XPTH 3QJFB 4MNGB 1TFHA 2ESVD 4U7KA 4P3CH 3H9SA 3BQUD 4G6KH 2X70B 2PYEA 1BIIB 2DDQL 1R3JA 2FYYA 4UV7L 4KI5C 2EH8L 1GIGL 1JPST 2K9UA 4G6AC 2XPGA 3V5KB 2E7CA 4K3EH 3MMEB 3DHMA 4XI5D 5C0NC 3D39B 2OTWB 5D2NC 5HHOA 1JTTA 1U3ZA 4O51A 1JPTH 1NMCB 1JFQL 1H3UA 1HH9B 4F9LA 1JWMA 5JW4Q 1JNLH 2E7HA 3HC0A 3QG6B 4PJIF 1S9WA 3WNLA 2UVFA 2P5ED 2QR0B 3VXPB 3W0WA 1K8IA 1C12B 3LEXA 4KTDH 3ZKQD 5C8JB 1BQHG 1WFTA 3KPRB 1ZHBA 2CLVA 4UB0H 1OSPL 2FSEA 5KVGH 2VDKH 2VITA 4HC1H 3OJMB 5I66B 1OAKL 3WIFB 1FGNL 1FN4B 4UTAH 4RNRA 4UAOC 3IF1B 3I75A 1BBJB 1T0MB 3MV01 3QNXB 5D6DA 1G7PA 1H9VA 2XQBH 4Z18A 5BW7A 2AQ3A 3WDHA 4B5EA 4CMHC 4R26H 2DL2A 3AAZA 4PG9B 4UIKH 5DEGA 3VFUA 3BE1L 2NY6C 2IBZX 3QO0A 2W9LA 2XN9B 5BS0A 1IILE 2GSIB 5D1ZA 3BI9X 2CIIA 4WDIA 2HRLA 3UEZA 1NGPL 3KYOA 4QRRD 4J1UA 3G6JF 4LP5A 3SE4A 3RNQB 1JF6A 4LAQL 3OKYA 5TQ2L 1ZLVK 3VRLF 4IRZL 3DARA 3LQAC 3MRCA 4N9GB 4WI4A 1ITCA 3OG4B 1KXTB 1XCTA 2PCPB 2XWJB 3TBSA 3H3PL 1FE8L 3TA3B 4YE4H 3LKOA 2VAAA 2HKHL 4ZUSB 4PV8A 3VWKA 1LO4H 2QQLL 4ZOBA 4M43L 2NXZB 1FFRA 4FQHB 1KB9K 2VLRB 1R5IA 5DVOA 4PJBF 2FATH 2YPLB 5J13C 3CLEL 1M05A 3UTTA 4KZDL 4M93C 4LHQB 1JF5A 4KAQL 1E4XH 1YY9D 1HEZB 5I1IL 2H6PB 4PJ9A 1CDUA 4I0PC 2X4UB 3S6CA 1BQLH 4B41A 3GM0A 4XRCA 2HVKA 4RFOL 2VDOH 3ARBB 1QKZH 5DD3H 3UX9B 4PB9L 2NY1D 1A7NH 4KFZC 2LV4A 1CL7L 4QEGA 3WSQL 3BW9A 3LS5L 4KRMB 2BX5A 3RWFB 4PTUA 2JKXA 2BHZA 2X9WA 1S78C 5DHYB 3G9AB 1G6RB 3VFPB 5T5NG 1CGXA 4HJ0C 3VFWB 1EO5A 3I50H 3HZYA 1OVZA 3Q3GB 2ZUQC 1MREL 4HZLB 4PJGA 4M6ML 2ICCA 5F7NC 1CE1L 3VU2A 1J1OL 3WEXB 1ZLUH 7FABH 3VFMB 1PFCA 4GXVL 5EPMB 1HQRB 2YS4A 1G9NH 1PSKL 5ID0A 5DK0B 1HCFX 5DUBB 1CDJA 5E4IA 1IE5A 5GXBB 4PJBB 3O3UN 2YPKA 5A16A 3DX9B 4ODUA 5HDBF 3W0WD 1EO8H 3FB6A 3F7YB 4BZ1L 3GMLB 3ROOB 4X80L 3RGVA 1U36A 5DUPH 1KJ2A 3DGGA 2QQNH 3HZYB 4CKVX 3E8UH 4Y1AE 4ISVB 3KNBB 1TZGL 4X4ZA 4MNQE 3RIFF 4Q97A 1IGIH 2DQCH 1A7BA 4Q0XL 3MJ8B 4YDLB 3BKCH 2DLFH 4Y5YA 5FHBH 1YEDA 1BZ9B 2O5YH 4U1HA 2JB5H 3NFPA 5D93B 3TV3L 1SJHA 4PYGA 3BEWA 3OBAA 5D1ZD 1ACZA 1A22B 4EEEA 4URTB 4XAKD 1JZ8A 4GRLA 4WUKL 4D0BB 4FQXB 1G6RH 4Z7NE 4YXHL 4U6XB 1EEZA 4FTVB 3LKNB 1EPFA 2NYYC 1IEHA 3X12A 5EOCH 4EZMA 1WT5A 5D2NE 4I48A 2Q86B 5C0JA 4TQEL 3NZ8B 1A1OB 3PWNB 2RGSA 2ICES 1GHFL 5CLTA 1B4RA 2BSTA 4U6VL 1OLZA 3NIFF 3C5SB 5C92A 2O5XH 1IC4L 3W2DL 5E6YA 2VRAA 4XPTL 2AQ1A 1LQSR 3L3IA 4DGIH 3MV9B 4WHDA 2DDQH 2XQYK 3UTTD 2F58L 5IIEB 1ZVHA 5JMOC 4ZG1A 3FQTA 1K4DA 3VWJA 1AC6A 1EHXA 3F7VB 5EORH 5KN5B 2PUQT 1OP5K 4X6DB 4WO4B 3RVUD 4F58H 5C71A 5BS0B 1JGLL 4M1GL 5ID1B 1S9YA 4YHPA 4NC1C 1DLHA 4XVTH 5FGRA 3RWCB 2A1WH 4XT1C 4OZFH 2V6HA 4Q6IA 4K7PH 4EI5C 5GSVA 4JFFD 4H8WC 3EDEA 1UZ6F 4XWOD 1RQ5A 3TO4C 2LU3A 3MPCA 3QEUA 3R06B 4PLNC 3UPRB 1NJ9A 4IRSB 4UAOB 3WIHL 1S7VB 2MFNA 3QFDB 3DWTA 3VXRB 3QXAB 4HT1H 1EEYA 2APBA 3ZMRA 2HKFH 1U92A 4JDVB 5F7LB 3GO1L 2VLKB 3V79C 4GRWB 4QCIA 3RPKA 4UIKL 3ZL4H 2JJTC 5JUEH 3GSOA 1OAUH 1DJSA 2UWEA 2EEBA 1KG0B 4NZUH 3U2SA 3MRHA 3MNVB 4IOFD 4FFZL 2NXYB 2AS5M 5IUSA 4I77H 1I85C 1RZFH 5INCA 4DW2H 1KACB 3O2WL 5SWSD 1WITA 3H3PH 4GFTB 1IEBA 4M03A 3RY6A 4X6EB 5C6TH 4CDGC 4GRWH 2VZ3A 1MCFA 4PJIA 1RHFA 3X3FL 4S0TD 2AK1L 5CBEA 5BMFH 2IPUK 1DBBH 5GRWA 1BFTA 5JA8B 3FAXA 1RD6A 1YEJH 5K9KB 1HNFA 1FYTA 2ICEA 3V5HA 1ROWA 3HUJA 3RL2B 1HHKA 3PWUA 4TNWF 43C9A 5EBLA 5AG9A 4LBEA 3OL2A 1A6AA 1CD8A 1S3KH 3D85D 2E3VA 2R8SL 2JJWA 3ZDZF 3NA9L 1M6OA 2G5BA 5GS2D 2I25N 1TZHB 5H94A 1FO0A 3HZKA 5IFJA 1WSST 5E8EB 1Q9KB 4JLRB 1IKFH 1UXSA 2NPLX 4FN0A 1VB9A 3U2SB 2R2HA 5EUOA 3BH8A 3GMPB 3I6GA 2UWEB 1UCBL 1YNTB 3EOYG 1JUFB 3DXAE 1YECH 4S2SB 3RVWD 1MPAH 1F6AB 1KYOJ 2W0FB 2NLJA 5J11C 1T0NB 1YJDH 3FO9B 4KHTL 5I19H 4HSQA 1UM6H 3H7LA 3IRZA 1U6AH 5C0DA 1ZT7B 5F1KC 1JV5A 3OHXA 3UTSA 4U6TA 4P2YA 1CLOH 5I1HL 3RDTB 2DQJL 2YEZB 5DHVB 1TVBB 1YJDC 5IFAL 3VI3E 2W65B 2VWEE 1RVFH 4KKBD 1AXTL 4XP4L 5C08A 3KYNA 3VH8B 3DTXA 3T0EB 5B39A 5CEYB 4OQTA 1J1XL 2AAVA 4JFFA 1BLNB 3TPUA 5MI0B 5HHQB 3CD4A 3OAYH 2R4RH 5L8LB 1LD9B 4IOIA 2DI7A 3HZMA 4R2GB 4FQLH 4WU7A 4X5XA 3UDWA 4JR9L 1PZ5B 4NWUH 3PUCA 3MFGB 4WI6A 4Z7NF 1IGIL 4N0FB 3VDAA 4P4KD 2P5WE 1R5VB 3VD9A 1GGCL 1JZ4A 3VDCA 3UTPD 2AXHA 1SJXA 3GMOB 1L7IL 1P9MC 2VWEC 3SGKA 3ESVF 1RU9L 1XGRA 3P4NA 4YHNA 5F9WC 2CRYA 2FNBA 2E8YA 1G6RL 1S9XA 4GG6B 3DGGB 3KAAA 4R7NA 1W0YT 3C87A 4FABH 5C0CE 4GKOA 5ITBH 3O3DB 3JXAA 2FECL 1ES0B 4NKOA 1LK3L 4BH7B 4K3DL 1URLA 2J2ZA 1IAIL 2AW2A 4NFBA 1I1AD 1AP2A 5HHXL 4M5YL 4YHYC 4XP6L 1BZ9A 3AC0A 2GJ6E 3MFFB 3F65A 5T33H 3EFDL 4OGZA 4OI9A 1MCBA 5KVFH 2ADIB 2PO6C 2W07A 4BJLA 1FYTD 3H0TB 3P11H 5AZEH 4IOFC 1GH7A 2OCFD 4AIXA 5ICZB 1YYMH 4NO2A 2XTJC 2PTUA 3AFLA 3NACL 1D9KD 3WN5C 2XTLA 4IS6B 3RWFA 4ORGA 1P7QA 5C0AA 3EYOA 4A6YB 4PREB 3TA3C 1QLRA 4PRNA 4XVTL 5M94B 3BPLB 1MAML 4YX2H 1KLUA 2UZIH 5E8EA 1TZHA 1FLTX 1NDGB 1LEGB 1JPSL 3OKLA 3QIBB 4JFQB 1KENH 1W72L 4ZMAT 3ARFD 2APVA 4HPYH 1T04A 5LG1A 1T2QH 2H6PA 3SDAA 4DFHA 4Q9QL 4OZIF 2D7MA 3U4EB 2EDRA 4M93B 1SMOA 1MCRA 2IGFL 1HH6B 1G1YA 3DPBA 2DTML 4CRPA 4LMQE 2KZWA 3MCKB 3GO1H 2DM7A 1RIHL 5F89A 3B2VL 3KWWA 2HT3C 2DQGL 1NFDF 5JIHA 1NCBH 4XXDA 5TE4L 4ZSOA 4YXLL 4RRPA 1R5WA 4WJ5B 3IFPB 5B8CC 1QSEB 1A2YB 1QFWL 2PW1B 5MEPB 4DKDC 5E2WL 4G9FB 4JRYB 4RFNC 2IPKA 2VTFA 3NN8A 3PWVA 1R3KA 4KUCF 4D9QD 1JMXA 1Y6KR 35C8L 4OFYA 4PRPB 3VDBA 4TUKH 4X4ME 5E2VH 5IBUG 4L4TB 1NANI 3UJIH 3GGWB 4X7FC 3OPZH 3BZDA 4QXUL 1GXEA 5GS3A 4Y8DC 4U3XA 4Z0BH 1MAJA 2E7BA 4UDTA 3VRJB 3QNXA 1JTPA 3MXWH 4JO2H 1SJEB 4MYWB 4LCUB 2AK4B 1GPOH 2DI8A 5F1NA 1X5JA 4CVZA 5A2IH 2VITB 3T09A 4DN4H 2R8SH 5F1NB 3VXME 2ICWJ 4PGEB 3ZKNC 1VKXA 1AQDB 3DBXA 2BFVH 5JQ6L 2NY3C 3JTTA 5EU6B 4OZHE 2Q8AL 3J7HA 3KDMB 3SEPA 4HWZB 3EYFA 5DFVC 5FM8A 5LQBH 3QCVH 1ZMYA 2DQUH 3EJZD 5DC0A 5JMRA 1BD2A 1MHHA 4GS7C 4FMKA 4JE4B 5DR5L 4F3FB 4LCYB 4Q9RH 1HH9A 1RJLA 1UCBH 5EB9A 3ARGD 3MLWH 1RFDL 4WO4A 4O51B 3D9AL 5E6ZA 1R3KB 4P9ML 3C6LD 2NX5E 1QFPA 1VFAB 4O5LH 5LWYH 5C07E 1KJ2H 4ZOCA 1I3VA 1QSEA 3MBXH 1U8QB 2WLYA 4ELMB 2BVOB 3JV0A 2W0KA 3SDDC 2EDDA 3SKJL 2IG2H 1RK0B 4QWWC 5EUKB 1SJEA 4QOKD 4U1IB 1JI2A 3G04B 3OGCB 4WHCA 3T04D 1A1OA 1SMAA 3OB8A 1VEOA 2AJVH 2XT1B 32C2B 4JEGB 4H20H 3KPLB 2EYSB 4N8CL 1P69B 1UCTA 3SGKC 2YOCA 4P5MB 1JHLL 4W70A 1D6EA 4B7LA 4WEUD 3QULA 3SDAD 4TVPH 1TCMA 3BKML 3IFPA 3HB3D 5EBMB 1SJHB 1NCDH 2AEIT 3RBGA 3CK0H 4CU8A 1IAMA 5GS1A 2DIJA 2PYEB 4ALAL 5T1LD 5B38B 1HILB 3FO1A 3PWPB 2JF1A 4YGAB 2PXYA 4HDIA 5GSRB 3GSXB 3CFCH 1MLCA 1P4IH 1MJUL 3UTOA 5IVOA 2P5EE 2OX5A 3F7QA 1ED3A 3MV7B 1KJ3L 4G3YL 4WFHE 1KJ2B 3FHQA 1X6NA 2J8OA 4K2UH 4O58L 1WUNT 3DJ9A 3F7YA 4R96B 1QBBA 3SGEI 3KPRE 4TSBL 3C09B 2I07B 2I5YL 1UC6A 3OB0H 1E4WL 1A64A 2FZ3B 4L3EB 1CTNA 4MCZB 4BH7A 3KLHD 1HHJB 5E8DL 1NC2D 3WFEL 3MA7A 2LE9A 3I02A 3IJYA 2EECA 4DOHE 4Z7VB 2O93L 3GJFK 1OF2B 5CMAB 5JLZB 1XGUB 5AZEL 4DGYL 4GQ9H 2JLLA 4F57H 4CN4A 2AI0H 1D7FA 2RFXA 1R0AH 3LHPL 5FYJD 1HXYB 2YD6A 5DZNA 3JSSA 5GQBA 4Y5YC 4LVNC 4JHAH 1BD2D 2APFA 3STLA 1P4LB 3MUGB 4LMQI 3P0YL 4XHQA 5GHWL 2WLZA 4KUZH 3BWUC 4NO0B 2Q1EA 4MLSA 1NUNB 1OM3H 4I2XB 2UZIL 4WY7H 3MRDB 2XV6B 4OZGB 2RJMA 1U8LA 3C6LA 5KW9L 4HS3B 1AD0A 4X99B 1M7DB 1KNOB 4XP9H 1QSED 3X14B 2F5AH 3CGTA 4JHWH 43CAB 1T2QL 4L8DA 4M48H 3LQZB 3MV8E 1S9XB 5I0ZA 3BSZL 1A14L 2IGFH 3T0WA 3U46A 3FZUC 4HEME 3PV6B 4LRIC 3RNKA 4AG4L 5IV2A 1NC4A 1GGIH 2MSPA 3MGTA 3P0GB 3ARXA 3VXRE 2H32B 4NUGH 3GSRB 1A6PA 5IVZA 2J1KA 4JM2D 4PJCA 3G6JA 4UOW0 4XNXL 5L7XH 5KBNC 3TYFB 3SCMC 5BJTA 4B53A 3QWRA 5C09B 1T0NA 1RZIA 4XC3H 3O11A 4YH6A 2OK0L 3VI4F 2EZ0D 4BA8A 3TT3L 1XZ0B 3VGDA 3T0DA 4D8PB 4OKVB 1U8JA 4Y16D 3V52L 4L5FH 4K9EC 5J06A 1JNLL 1YUHA 4HWBL 3KVQA 3O2DL 5T1LA 1HXMA 3AU1A 5EZJA 4WV1C 4Z0BL 4M8QA 5ITFB 1FL3A 2FH8A 5DHVA 3W11C 1ZVYA 4PJ7A 2HFGL 5EWIH 2BNRD 1FLRL 3GKWH 4RMVA 2DWDA 1RHHA 3REVA 1AQKL 1IQWL 1FYTB 3QDJB 1JYXA 2BMKA 4HHAB 2MKWA 3BMVA 4EN3D 1FL3B 2GFBA 1CFBA 5I8KL 1U2HA 4XBGB 1PYWB 4S2SA 3QQ4A 3JWDL 1EO7A 4KMQA 4HIJB 1MCLA 4UOJA 3K4AA 5DR5H 3IDYB 4J4PC 1J7VR 4ETYA 4F7PA 5I1LB 3ZSTA 1NGPH 3BPCB 4P46B 3IU4L 3QYCA 2AXGA 4NQDD 1PKQE 4QRPD 2UY6A 4CDHA 4XBGA 1Q9KA 4IRZH 1TCRB 5H94B 3N1PC 3S35L 4UUJB 4YE4L 4M1DL 3ORJA 2C3GA 4RGNE 5FKPB 2KQNA 1MRDL 3QDMB 1RZKH 5L88L 4D9LH 4X9GA 3GUTB 4LHUA 2VO5A 4YEFA 1HXMB 5EZJB 4ODVL 2PTVA 1T1YB 1YUHB 8FABB 1KJMA 5DJ0A 3E2HC 5JIKA 3LN9A 4N8CH 3U83A 3OJVC 2VDRL 4GG6F 15C8H 1WJ3A 4F2MA 2HH0L 2ZPKH 3FB7A 1YNLH 1VCAA 1GYAA 1FFPB 1Y18B 1H15A 3O6FC 3VGHA 3VFNB 3ULUH 1BF2A 5GS0H 1A7NL 2CIKA 3WCYA 4JN1H 1ZK9A 3MV8B 5LCVL 2X40A 2BY1A 3B6SB 3MOAL 4KV5E 4IDJH 5FDYA 5HY9B 2P8PA 4RDQG 1QHOA 3K74B 2ZWLT 2GQHA 1KPUA 4XC1L 4YDIL 1HSAB 4G3YH 3PDOA 1OTTC 2ADGB 4I4WB 3GRWA 4NKDB 5KTEL 5LGHL 3LZFL 4NBZB 1MQKH 1ZHKA 3SJVA 2UVEA 2AK4E 2OZ4H 2I5YH 1Z9SA 3LRHA 1C5BL 4YK4C 2PW2A 1H3GA 2PTTB 5M95B 4GRMA 3RWCA 2YD5A 1CLZH 1T5XA 3MLZH 4HD9A 3ARBD 4H1LG 4BSWA 1YN7A 3KPQB 1NFIB 1KJVA 4FZ8L 2FIKB 4O02H 3WKMH 5TF1L 1J9CT 1HZHL 5I74C 3VGEA 1JRHH 2YXFA 1TZGH 2EKSB 3GNML 2R56H 5F9JB 5H2BA 3TVMC 3MROA 4LRNH 4ETQB 3FRPG 3DURB 4KK6D 1A4KA 2CKBL 4YHML 5HHMB 5F6HJ 4U1HB 1S7QA 4R2GC 3KPPB 4U1JB 4DKFL 1F4XL 5EZLB 2XI9A 4KI5E 5IHUL 1CR9L 3AB0C 4RGOH 2JB5L 2P5WB 3GM8A 2LVCA 1IM9D 4YIQA 3TJEH 3K80A 4WW2A 3U7WH 4NN6C 1T66C 2AXFB 2DQHL 5EU7C 2DJSA 4I48B 2Q86A 5GS0C 4G6FB 1LO5A 4G6JH 4PG2A 1NSNH 5ESVA 5LAXA 1T5WB 4JFOA 1HIMH 2IH1B 2Q7YB 1A14H 1HYRC 3N85H 4WI7A 2XZAH 3QZWA 1S9VB 4NGHH 4RSVA 4QRRB 5CIPA 5CJOH 4AMKH 5I16B 4W81A 4PGJA 5IQ7H 3VE0A 2Y06L 1T89A 3B2UC 2BVTA 5ID0B 1MJ7L 5ESQA 1Y0LB 1QBML 4OLYL 4DGIL 5CINL 1B0GA 3W5NA 1CXKA 2XYCA 3TIDA 4PTTB 5BVPL 2XWTB 3VXSD 5GGQL 3EJZC 3RVVD 5J6GB 4UU9A 1F3RB 1DDHA 3GIVA 4U6YB 2MCG1 4TVPD 1QFHA 5GGVH 2X09A 4LQFH 3RWEA 2Z31C 3UC0H 3X11B 3QDAA 1T03H 4ELKA 3RWGA 2I9TA 1P5VA 5JR1L 5BV7L 1AGBA 3X17A 1KGCE 4F7EA 2QV2A 1EK3A 2OLDA 1PZUB 3I85A 5F1IB 4ZS7L 1Z9LA 2PTTA 3CC5A 3JTTB 1KGCD 3DBXB 1DFBL 3KJ6L 1PG7W 3ES6B 1A1NA 3VFGH 1S7SB 3WDJA 1DZBA 2A6IA 2DL9A 4XVUD 5J12C 3FQUB 1M05B 2YPLA 1P84K 1T1XA 3U0WH 1MQ8A 1PEWA 3ZE2F 3IETB 5KSAD 2YMXL 4OFDA 1GCFA 4L4TA 1A3LL 4AZ8A 4P2RE 3OAUL 3D3VD 4MXVE 1WFOA 1JHTB 5KJRH 4FFZH 3QIWC 4H25B 1CS6A 1CFQB 4I5BA 1N6QH 2X4PB 3K1DA 2XY1A 1MFCH 4C58B 1CFQA 2AXJA 3S35H 1K2DB 1OSZA 1A21A 1LILA 1HOCA 3O3EB 1ETZB 1EGJH 3LRSB 3ZKXB 3BH9B 3SDCC 4N5EC 1MRDH 1WBYA 1IVLA 4LARH 5I2IA 5L2KB 1JN6B 2UY7A 3PP3K 3VRJA 5C2BL 3GB7B 5JA9A 2CLRB 3MCKA 4XHJD 1G7PB 2JJSA 3GUTA 4ODVH 2BCKB 2OMBA 1J18A 5L6YL 2P8MA 3O8XD 3ULUE 1GSMA 2BSED 2WMPA 3O3EA 1GZQA 2IANE 3CMOH 1N6UA 3KPRA 2L4OA 1A2YA 1YEFL 4P2QE 3IFLH 3EYQC 3QQ9C 3VXMB 4QTIH 4X4YA 3VMPA 1S9WB 3KYOB 1F11B 3ZKMC 4E9LA 2PO6D 1IL1A 1T4KB 1XGYL 1ZHLA 3TCLB 2C26A 1GAFL 2CMRL 3IETA 2CUHA 1MPAL 1SHMA 1YPZE 1S7RB 1ZSDB 2ORBL 4NO2B 2D4DA 2SEBA 4RBPK 3SKOA 4JHBA 5I19L 4TNVK 4OT1H 2G2RB 5IB2B 1G7MA 4MAYC 2V9QA 5E8PA 3LS4L 3HR5A 1N7MH 5LGHH 3NVQA 4KHXL 1CLOL 4ZXBC 3BT2L 1B0GB 3MNWA 3MBEC 1UVQA 3MLYL 1EFXB 3SQOH 2VABA 3D69A 3H9HB 5CEZL 4OIIH 4WHYH 3HC0B 1AXTH 4FRWA 1FL6B 5HYFA 4KWUA 1BJ8A 2BC4A 3LIZL 3QNZA 2IAMB 4FQJH 3BISA 3WFDH 5I76A 2LABA 4M7LH 3UTTE 3ZE1F 4AQ1B 2R56L 1KCVH 5DQ9A 5I15L 2VJXA 1JGUH 4X9HA 5FUZL 1AO7B 5DQJB 4K7PY 2WV3A 4WUUE 4PD4J 1PKQB 4YHMH 4ODXA 4HXBH 4YFEA 2EEDA 2ADFL 5DK2A 5KSAA 3OKMA 1NBVL 4L4T