5DVKA

Fc design 7.7 b chain homodimer t366v/k409i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSILTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvkA01
3ARDB 3P9LA 5I1IL 2DMKA 4LSVL 4ODSH 1U41A 5IB3B 2JELH 4EI5D 2WINB 15C8L 4O51A 5IEHA 4E41E 4OZIE 3SGJA 43C9A 3G9AB 3VFUB 3THMH 4PBXA 5KJRL 5ID0A 1INQA 3OKMB 4X6CB 1P7HL 2D31A 5FYKH 4XNXL 5JOEA 3KPNA 1HYSD 4Z95L 3ROOB 3ZLQC 1NFDE 3MBEB 4L4JA 4JJHA 2J6EH 1HINL 1RV6X 2R2EA 3TWCL 4MJIA 4NO0B 2P7TA 3VJ6A 3VXSE 4ODTH 4FTVA 4P2OB 4I3SL 3MUJA 4NFDA 3DVIA 3O3AB 3BIBX 3CFJB 3K4ZA 8FABB 2E27H 2F8VA 2CO6B 1RJYA 5FM5M 3I84A 2VWEC 3OXSA 4LSTL 1CXKA 4CW1B 4XTRD 2X4TA 2APBA 5GS3A 2JB5H 5MEOA 1F6AA 12E8H 2Y07L 1BF2A 1RU9H 4EDXB 4R4BB 4L1DA 4ELME 2R9HC 3GMOA 2D0GA 2G75A 4FFZH 2NTFB 1N3NA 3V0WL 1A7QL 1NBVL 3GBLA 3QZWA 4QRTA 4HULB 3VRLE 1T7VA 3E6FA 4JFDA 5FYJH 3VFGH 5HYJD 3UMTA 5FA3A 2HJFA 1H8NA 3OAYH 4FN0A 4H26A 5E2JA 3T4AA 1PQZB 3MYJA 3BIAX 5B3NA 1OB1A 5EUOE 4XP5H 3L9RA 1S8DA 1M4KA 3TJHC 2RAMA 1CF8L 1FYTA 4D9LL 2GKIA 3MRFA 4PV9B 3NIDE 1YMMA 4YDIL 4E42A 5KTEL 1I7ZB 3QUZA 2VMFA 5HHOE 1D9KC 4G6JH 1L0YA 3KXFD 1RIVL 3GHEH 3LRHA 2EIDA 3QDGB 3F7YB 2KZ1B 1U8KA 1VERA 4N0YL 4RGOH 1H0DB 4G9FD 3ZE1F 5T3ZH 1CGVA 4ONHB 3V6ZA 1DEEA 3IKKA 3QDJE 4P2QE 3I9GL 3OX8A 4Z7OF 1NGYA 3DO7A 3L3DB 3DGCR 4KPHL 5FXCH 5T5NG 3B9VA 3LV3B 2WBKA 1MCPH 3MV11 1YN7B 4XP9L 4XPFL 3ZKNC 1MRDH 1D5ZB 4H5SB 4XBEH 3SCMB 3SEPA 1KIUA 3S5LG 4LHQB 3SKNB 2OI9B 1RMFH 5C0DA 2EEDA 4NGHL 2JJSC 3UYPA 3NA4A 3DX7A 2OCFD 4YK4C 3EO0A 5DJ2B 1Y0LA 2CD0A 2FEEI 4F7EB 1IVLA 4RMUA 3LS4H 3EJZD 5ICYA 2Z4QB 3JWOH 3TIDA 5TE4L 5IG7B 5DYOA 1CCZA 1MJ8L 3GSXB 5EUKB 1X5YA 5IV2B 4ZS6C 4X7DC 3W9DB 4HHAA 4NHUA 4LRNH 1AJ7L 1DQDL 2WQ8A 2LABA 2ZUQC 2VDQH 3UC0H 4K3EL 2P5WD 2VLRB 4OCLC 4GAGL 3CC5B 1MCIA 5HGHB 2VDRL 2DKSA 1FCGA 1KB5B 1FFRA 5IQ9B 1KJVB 2F74A 4K2UL 2BK8A 1NCCH 5KANI 3MGAA 4PPTA 3TVMD 5L2JB 2ARJB 4S0TD 1AKJD 4WY7L 1IAIL 5CSBA 4DVRH 2XY2A 4OGZA 4PP2A 4KI5D 5C71A 5LG1A 3QHTC 2CKBB 1AHWA 3O3BA 3ARUA 3UTSA 2BNRB 1QVOA 1QFWI 2HT2C 4BFEA 3QHZL 3PABB 2VAJA 3A67H 4JZJC 2CIKA 1KYOJ 5HI5C 4UUJB 1UACH 1H9VA 4JFEE 3C60D 3GSRB 1N5YL 4LEOA 5DHVA 5EO0A 1VESA 3ZDZF 1KUMA 1IGIL 4HXAL 4PJ8B 4PJFB 4S1RH 1I3GH 3I6LE 1H5BA 3LKRB 4NRZA 4N8VG 4N5UA 1N64L 3BO8B 1XF1A 4RNRA 1NC2A 4JFOA 3PQYB 4KKBC 3TBYA 1CGTA 3DIFB 3QUKB 2R0WL 2X4SA 1J18A 3T3PE 2IAND 3A0OA 4C54A 3D0LA 5DD6B 3QUYC 1IT9H 4O58L 4IIQC 3QXUA 1BFVH 1VGKB 4NQCD 5DVOA 3ABZA 4PJ5D 1XAUA 1UB6B 3P40A 2J8UA 3P77B 3PWPE 1LO0L 5HYJB 4ENED 1T7XA 4EDWH 5FYLH 1FPTL 5J9PA 1DFBH 4XVJH 1OTTD 4HJ0D 1JPTH 3C5SA 1CL7L 5CIPB 5AZEH 2ESVD 1QLRA 2IJ0C 2OM5A 3F5WA 5SX4I 4Z76B 2HMIC 1Q1JL 2V5YA 5IHZA 1IRAY 1U92B 1D6VH 2XXCB 3D6GA 1OAUL 3F7VB 1MI5B 3VE0A 2GFBA 4C56D 4JGMA 4GQ9L 5I73B 3MUZ1 3KLAA 3FFDA 3QULA 1D5IH 1RIUL 1AXTL 4FXKB 3D69B 4CRPA 1TTUA 2ZOKB 4QHUA 4G9FB 1TCRA 3LY6A 4Z7UE 3MJ8A 2Z93A 3T65B 4YR6A 1EEYB 2Y6SD 2VKWA 3CXDL 3V2AR 5IBLD 2ZUUA 2EDFA 3G5ZA 3EDKA 3NPSB 4UB0L 3U7WH 5DC0A 5HY9A 5L88L 2VO5A 5E7FA 4OKVB 1WGOA 2X6MA 4KJQD 2V2XB 1C5CL 1LK2B 1CE6B 3PWLB 3PWUB 4LNRA 1L6ZA 1NUFA 3IDNB 3OG4B 3UZVB 3CCHA 3NAAH 1ZV5A 3NN8A 1WF5A 2NXYC 3MR9A 2VXVL 3KNBA 3I6GB 3L5HA 2I26N 1IGTA 4M8VA 3L7EA 3LQAC 1I3UA 3FO2A 4MD4B 3UTZB 4POZC 1UCBH 4RMRA 4FQCL 1R3LB 1RHHB 3HNTH 4OLVL 5MHSE 2LQRA 2LVEA 4NQDE 4U3HA 4LASH 1NC4D 1FZJA 2X1XR 4ZOEA 5JLZB 2MCG1 2WUBH 4YZFE 2JJTC 1C12B 1ULVA 3MV7E 4HC1A 3Q1SH 3RKPA 1AGFB 3FT4A 1E4KC 3U2SA 2OJZL 5J06A 5EBWB 4H8WL 4J4PA 3O6LH 4Z7VF 4JO2H 4NCC1 5F7EH 3OHXA 4GAJH 3GSUB 2QSCH 2FR4A 2UYLB 1SEBB 4MDIB 3CH1B 5D6DC 5F7MC 3T1WA 1NCTA 4P9HC 1X3DA 4JDVA 1UWEH 1YNKL 5CSGA 5DFVC 4YHKL 5B3JE 3MA7A 3RPIB 5DEGA 2E7MA 4M62H 3IF1A 4XNZC 4ZAKC 4ZOBA 3TNMB 3C60B 3P0VL 3VD5A 5IIEA 1ZT7B 3KDMB 4EIZC 3RZCD 1AR2A 2ZUTA 5BMFL 1FH5L 4GT7A 4Y5VB 1UKTA 5ANMB 5J3HC 3SDYH 1K8IA 4JZNB 4MXWH 5F72S 4NRYA 1OF2A 2EYTA 3EYFB 2RFXA 1A4JA 1KB9K 4LF3B 3E8UH 1B6DA 5I74B 4WUKH 3MLWL 4WW2A 1EERB 1JZ4A 5DEFB 4JQIL 4MSWB 1PGRB 3QISA 5IF0B 3W39A 4OZFA 2BHZA 3CFDB 1G7QB 2KKQA 2B1AL 4K8RC 4LPXA 2VDPH 3KG5A 4TSAL 3BMVA 4ZQKB 4NQCB 3P0YL 4Y5YB 5M7QA 2Y25A 1MCRA 3ME0A 1MCEA 1ETZB 2AQ1A 3X12A 2O5YL 2EKSA 5GJTH 2KPNA 5DMGD 1KTDB 2RQ8A 5LCVL 2XRAL 3VG9C 3DECA 4TUOB 3LQZB 4CAGA 3A6BH 2RCSH 5EU3B 3RX5A 1GIGL 3FFCA 1QSEE 3VXUE 1HH6A 4XVTH 2QQLH 2V5MA 4XI5D 3VFUA 4M43H 2IEPA 2M8XA 3BWAA 1MCJA 4KK9C 1W8NA 4X6CA 1IAII 2ICEA 4MHHG 1T7ZA 1A7NH 3F6LA 3ROOA 3MBEA 4IRSD 4FQ1L 4XBPB 5CP7B 4BZ2L 5E2UH 5SWSD 2F5AL 3WIIL 5FO8B 1QBML 2NX5E 2DI7A 2VDKH 4JRYA 4NO0A 4TUKL 5AUMB 4LVNC 5HYEA 4ZUUB 5MEQA 4CADB 4KVNL 1JL8A 1S5IH 5I66B 5C08A 2CXKA 2BNUA 5F21B 4Q6YA 3T0EB 2ITDB 1PVHA 1YEFL 4MJ5B 2QJDA 3O3AA 5C09A 5HHMB 1H3WM 8FABA 4JFQA 5ESQB 2YZ8A 1SEQL 1BX2B 4I18B 1LWRA 3L3KA 5C0AE 3U7YL 5CUSH 1AY1L 4KJWC 4N8PA 3OF6D 4X0KB 5I6XB 3UZQA 4GMTL 4EDXA 5HYFA 1KIQA 4R4BA 1K6QL 4K3JL 3U30C 3DURA 1IM3B 2AKRA 4KKCC 4YHML 1UC6A 4NN5B 2X1PA 4LCWD 4N0UE 1P5UA 4MWFB 3ARTA 2YEZA 1A7BA 5F9OL 2Y4SA 3TN0B 5H37G 3RTQB 3FL7A 3QEUB 4I4WA 3PP4L 4FFYL 3BSZL 2W91A 1KEMH 1PBYA 4OV5B 5SWQB 1NC4B 2Y36L 1SVZA 4PS4H 1S9VB 4WRLA 4IMLA 4HAFA 3FT2A 3EYUH 3X3GH 4A2LA 1A6UH 2CLZA 1CL7I 3AXLA 4HG4J 2MHAB 4Y5XB 5TPWL 4KTDL 4IOFD 3QJFA 3LRGA 1T1YB 4LIQL 3CAFA 1U8JB 4O9HH 2DS4A 4PLKC 3L3DA 3AMKA 3JV4A 2FBOJ 1WEJH 3ARBA 2Z31A 2W1NA 1YN7A 3TCLA 3UTTB 1J0JA 1D5ZA 3M45A 4H5SA 5L6YH 3TYGL 4LCUB 5D1ZD 3SKNA 3D87B 3VFVB 4ZODA 3CJJA 1ZA6B 4W6WB 1ZHNB 1NEUA 2ZCLH 3CSPA 2D7QA 5J11C 1UXSB 4HS8H 5DJYB 1CGSH 4U1NB 3PHOA 4NSKA 4J7RA 3AVEA 4LAQL 3GNMH 2Z4QA 3HB3C 1KLUB 2VZ1A 1I9RH 5TF1L 4XVUD 1YY9C 4Y4KC 4L4VD 5CILH 1LE5B 5EUKA 5ERWB 4PRPA 4G3YL 5I16B 4MQ7B 1NLDL 3X14B 3MREB 4S1DC 4Z78A 1X5AA 4IRZL 5D7SL 1LD9B 1LVEA 5ACMA 5HHPA 2DWDB 1NJ9B 1Q72L 1XF5B 2VLRA 3CNKA 4U1KA 5C0BE 5HGHA 3VGBA 5LXGL 5E2TH 4ODUB 3S4SG 1G7LB 3GMQB 4LAJH 4R2GB 5EO9B 4D9RD 4CU8A 5E9DD 1FHGA 3GSNA 4GG6F 3ULUH 1NDMB 4GUPB 2ARJA 1J7VR 3J7HA 4C4KO 3QIUB 3REWB 5D71L 2WK2A 5DO2C 1LEGB 4KK6D 4Z7VB 5IEKA 5DMIH 3IFLL 4WHYG 3ULVE 3KLHD 1OAYL 1DBBL 5EO1A 3DLQR 4P2RE 2HRPH 4J1UB 2VOTA 1TFHA 4R4FH 3CZJA 2NY2D 1RZ8A 1XFPA 2NY6C 1MCOH 1RZKL 3ZT7A 4UUJA 1NMCC 1FGNH 4LSSL 2HH0H 3RDTB 4JM2F 3GI8H 4EBQH 2W92A 4IRSB 2EC9T 2UZXB 5SWSB 1DCLA 3AS3A 1QLFB 1JGDA 4PJFA 2CSPA 5I1CH 1U8HB 2C26A 2UVFA 4OBRA 5FYKD 5T3ZL 3RY6C 2YSSA 1D6EA 3QWRD 2N7BA 3LKRA 1GRWA 1FO0B 3I75A 4KQ3L 1FFOB 4D0BB 3B5TA 1NBQA 5JO5B 3QFDB 1KLGB 3BO8A 1EVTC 4NQUA 2DMBA 3MLSH 3QEQA 1A1OB 2B2XH 5T5FH 2WWKO 3EYSH 1Z0MA 3MRNB 2GK2A 5DURB 4FNLL 2X7LB 5I8CA 3DIFA 2YKLH 1RJLB 4TVPE 3QUKA 5AG9A 3BESR 4B53A 3ZHLA 5FDWB 1KSRA 1MFEL 4FTVE 3SQBA 5IFHH 3D3VB 1M7IA 2FX7L 5D93C 1VGKA 4HZLB 2ZOLB 3WUWG 1FJ1B 1A8JH 2RHEA 4X6EB 3TCXA 1WBZB 4FZEH 4ZUWB 4I2XA 2PO6D 3UDWA 3O8XD 1CICB 3DX9A 3DBXB 3ZE0E 5ALCH 4NQED 3QIBD 3FZUD 3ARGD 3BT2L 4BUGA 4MLSA 4FFWC 1FE8H 4JFDE 5DZLA 3B5HA 2YUWA 5BS0B 3ZTNH 2P47B 1A9BB 2FNBA 3UJIL 3ULVC 1IAOA 3WDHA 4P5TB 1E4XH 3WXWL 4TTGA 2IPKB 1F4YH 2H8PA 1CFQA 3D18B 4N90D 3WUWB 3O3EB 1WBYB 4FXKA 1OAZL 3MLZH 3EFDH 2FDBP 2VLJA 4YHLL 1FYTE 4UT7L 5I1AA 5C07E 4WDIB 1NL0L 1A7PL 3KYAA 1OSZA 4WWKC 1EHNA 5A3ID 4EVNA 1IGJB 3TJEH 1P7QA 4DVBB 4YDVA 5F44A 5LBSH 4PUBH 5D1QB 4D9QE 4HFWB 3V5HB 2DIBA 3X11A 2GAZB 2VIRA 5INCB 4EXKA 3NA9H 1LK2A 5EFIB 2DQJL 3QAZB 2NY4D 5TDNA 2DM2A 2W38A 3IDNA 4YUEL 3VW3H 1WAAE 3CVHL 2R4SH 1JGEA 3K8LA 3CFIC 1I3GL 2UUDK 4CVXA 4JFPA 5FO9B 3ZYIA 4ZTOH 1WWAX 1FVCB 5T1DH 2X5PA 3AAZA 3U4AA 1QNZL 4ODHH 1N0XL 4L4VB 4BSJA 4L8CA 1G6VK 1BM3H 1FORL 3ZYZA 1AO7D 1R3LA 4UILL 1Y6NR 1S7WA 1NGZB 5IWLA 3VU2A 1PSKH 3DSNA 3LKOA 4PJXB 3T77A 3S3JA 3HCVA 4XNYL 3TO4C 1C12A 1PY9A 3ARFB 2J88H 1BFVL 3MSPA 2SEBB 5GGTH 5KVDH 5CGYD 3PV6B 2AK1H 1SM3L 1KJ3H 4JKWA 1OQOA 1CTNA 1DN0A 3OG6B 3U4EA 5DJ8A 5EBWA 4JCLA 1H8OA 3MNZB 3QRGH 4JB9H 2W9DH 1FDLH 2UV3A 1KJ2L 4HD9A 4XVJL 2OL3H 2AEQH 4FQXC 2MPAL 3RWCB 3SGEI 2XIDA 3GSUA 3SO3C 4QOKA 3SJVD 3MCLH 4WIQA 1BFOA 1SEBA 4MDIA 3BPOB 4TULH 1NDGB 5EWIH 2CLVB 2XZQL 4L3CB 1D6VL 2D7NA 4JFZH 2X4NB 3WFZA 5I1LB 2F5BL 2AVGA 3B9DA 4NQXB 4RISH 4QRPB 4KWUA 4YE4H 4CJ1A 3PHSA 1D5IL 4MQXC 4V2BA 3ARZA 4FFVD 1K2DB 3D25B 3UPCA 3UTSE 2VRAA 1E27B 2R2CA 4PY7A 1X6NA 1QSFD 3U46B 2XYCA 1INDH 3EYFA 3DGGA 4L9DA 4KV5E 2VDOL 4XCCL 5GGQL 2H2SC 4PJHA 3AS2A 4BSWB 5H8DA 2DKMA 5DD5H 5IVXE 4Z5RB 3U7WL 2VQ1B 3K8KA 4W4OC 3HAEA 3LS5H 2DJUA 5I15H 1JHLH 2J8OA 3IJHB 3RHWF 2BCKA 4S2SB 1G7QA 3MODL 1Q94B 4ZQKA 3D85B 4Y5YA 1J9CT 1QFPA 3AMLA 4FZ8L 1XCTA 3HE7C 2IBGA 1YN6B 4Z7WB 1OAXH 2MCPL 3G04A 4P0DA 2YPVH 1BMGA 4QXUH 1KTDA 3IAGC 4TUOA 5B4MD 2IADB 3ARGB 4G6AD 5EU3A 4Y88A 4OZ4A 4OF0A 5M95B 1CIUA 1TIUA 1G1CA 5KVFH 1FSKC 4M7KH 5GGSY 4NP4L 4JREC 2XN9B 4DK6A 1IM9D 2I9TB 3QG7H 2MOVA 4OD3L 1KGCE 1AP2A 3LN9A 2EDHA 3T09A 5FO8A 5JIPA 1AHWC 4JM2B 1YNLL 1W72H 3ARYA 2X9YA 1GJIA 5D2NB 1F4WL 4GAJL 3L3GB 1C5BL 4P46D 2ATKB 3T2QA 3DPBA 5F7LB 1VCAA 4UZGA 4YBQD 3GMMB 3MRBA 1K4DB 2ITDA 3BN3B 4MJ5A 3SGKA 3TBVB 4EI6B 2DLIA 3TLRA 5JOFB 1AQDB 4JY5H 1B6UA 3O6ML 3RUGA 2XFXB 3SDAD 3UJTH 3VD4A 5CD3B 4GOSA 5ICXB 1H5BC 1ODAA 1EXUB 3S97C 1KIRB 4QRUA 5DT1L 2CDEA 2Q86B 3ZE2F 3C8HA 5FOBA 1BQLL 4B41A 3U4BL 4HS6A 4KUZH 4HZAA 4ALAH 4ZXBC 5DMYA 4RGND 2XICA 3O4LA 2FYYA 1AE6L 1MY5A 3TN0A 2OQJB 3QUXC 4HMEA 2F19L 1OTUC 1P1ZB 4P23B 7CGTA 4PGCB 2Y7QA 3EDEA 4JKLA 2BRRH 2IGFH 4OLYH 5HVFB 1B2WH 4RQQB 4OV5A 1Z0NA 2NYYD 2GTWB 1QTYT 2DQUL 4KTEH 5E8EB 4YLQT 5F7NC 2EDDA 3KJ4B 1UQSB 4G8EB 5KOVC 3GJFK 3LCYA 1HWHB 4LL9A 5IP4A 2MHAA 1JJUA 1YQVH 3RU8H 4Y5XA 4JO4H 1YDPA 5JQ6L 5KSBB 5D96C 3S9DB 4PJCA 1S9YB 3IKCB 3QH3B 5INDB 3ARQA 4ZO7A 2V9TA 5MP6H 4YAQA 3SJVB 3EOYG 2Z0BA 4N5ED 4P3DA 2EIZB 3MXVH 4MA3B 4YHPA 3HFML 2CGRL 1NLBL 4KAQH 3PIQA 5CGTA 5JHDB 1NGQL 3BRGC 2QSVA 3VFVA 3MCG1 2E6QA 1ZHNA 1GGYA 5FOJA 1WLHA 1X5JA 4R97C 5E2UL 2FO4B 2V7HB 3RY4A 2ZSVA 2B0SL 1QSFB 2VLME 5BO1H 1F6LL 1NGPL 5DJYA 3LKQB 3MNWB 5AZ2H 3CVHB 3MRRA 1BD2D 4OCMC 4XCNA 4XPGL 1LE5A 6FABH 5ERWA 3ES6B 1GZQB 4MQ7A 4LSPH 5IM7A 3I2CL 3I6KA 3D39A 1KPRB 2A83A 4UT6H 4OZHA 3MREA 3KPLB 4PJ7A 1UJTA 4LHUA 2WBJC 3UTOA 5FA4B 5HPMA 2HKFL 4K71C 1XF5A 4ODUA 4OI7A 2GCYA 1G7LA 3UX9B 4BFGA 1UM6L 1J8HD 2KUTA 5HDQH 4I0PB 3B2VL 3RGVD 5EZJB 4Y16D 2DLTA 5E94A 2FATL 4V1DA 1A6WH 1M1SA 4PLJC 1NDMA 3UTPE 4GUPA 4JO3L 2UWEF 2X1OA 3P11H 4XAKD 4XHQA 3U0WH 3C6LC 3P9WB 3QIUA 3REWA 1GHFL 2L0DA 3C5ZD 1KNOB 2BZDA 1QRNE 5F88A 1IC1A 4R9HA 5J89A 3H9SE 1J1PH 3HZVB 4HMCA 3BX7C 5F6IC 1PX3A 4HIIB 1T03L 3B2UC 3FB8B 5IMOA 2FJHB 1IC5L 4XNUH 35C8H 3MUY1 3V0VB 2CJUH 1ACZA 3RDTA 4WV1B 3LPGA 2XQBH 3QFJB 1FIGH 3R0NA 4Y4FC 3QWOA 3BN9D 4UTBL 1E6JH 1EGJL 4KY1H 5FUOL 5GZOC 4P4RB 1EBPA 1MCQA 4QXWA 5HVGB 4DW2H 4D0BA 4X6CE 1JV5B 1RUQH 1KLGA 1DSFH 1G7JB 1PAMA 3IGAB 3DROB 4L8BB 2HA1A 3OPZH 3LOWA 4XP6L 1CFSB 4Y19E 2X7LA 4I8DA 4JY6B 1FFPB 3QCUL 3PWJB 5FDWA 3P4LA 3DUUB 1XIWD 4RA3A 3FOLB 4JKPH 2UUDH 2XA8H 1DQJA 1Z6JT 4XPBL 1UJ3B 3VXMD 3IXAB 5FHAL 2CLRB 2ZOLA 3MRMB 1FJ1A 3MGTA 4X6EA 1WBZA 1LEKB 1AFVH 2P43B 4RGNB 5ISZD 4YXKH 2LAAA 3CDYA 4ZUWA 5IBTH 1DVFC 3NFNB 2X4QB 3DBXA 5EZOH 4YQXH 3WNLA 2ZCHH 5CILL 4RX4A 4G9DB 4H1LH 1TZHB 2V9RA 1ZK9A 5ECJE 1N5AA 3MUHL 1NCUA 2Z8SA 1U8NA 5CAYB 3BMWA 2ZG1A 1N6QH 4EUPG 4HXBH 3VWJB 1A9BA 1TJGH 2APWA 1IGCL 2IPKA 4KI1A 4LRIA 3D18A 5H94A 5LAXB 4F7MB 3RRQA 1G9EA 1WBYA 3L5IA 1MHEB 1UZ6E 1G7IA 3S36H 3JV6A 3ARDC 4XC1H 1U3YA 1YEDA 2BVQA 2NXZD 4WDIA 4M7ZB 1X7QA 3FO1A 3L5WB 3OAUL 5EC1B 3ULUF 4PRID 1N6UA 1JMXA 4RMVA 1MCSA 1DLHB 4KRPB 1RAMA 3QDGE 4PGJA 3D9AH 5GS0H 1S7TA 4AT6B 3MBEC 3QXAB 1YUHB 2GAZA 3QWQB 5ENWB 2FSEA 3ZKMC 3UPRB 1MCOL 4OCYL 4ZS7H 5INCA 1FGNL 3NIFE 3DMMD 2HH0L 2L7UA 3GHBL 1FAIH 4OKDA 2CIIB 5EFIA 4LSRH 3HZYB 3GI8L 4P2OC 2VZTA 4U33A 1TQBB 1HXYB 4KHTL 5FO9A 1KIPB 2YD1A 3BE1L 2IAMB 2CR6A 1XGPB 4JHZA 4LOUD 4NKOB 1CQKA 4K7FB 4DAGL 1GC1H 3TNNB 1AR1D 1P4IL 3MZGB 4P48A 3MRCB 1ERNA 4PRNB 3INUH 4L4TB 5IFHL 4PJXA 1VADB 5F7HA 1DANU 5FDYA 3GGWB 5I8KL 3OTTA 3ARFA 2ERJB 3SOBH 2BC4B 1FGVL 1C1EH 2SEBA 2IALB 1RUKH 4M1DL 1J8HB 2OBGA 1KN4L 2ADGB 3KYKH 4Y16B 5HHNA 3B9KB 4PJBF 1DZBA 3U9PL 1R0AL 2ZSWB 1YEEH 2QSTA 3DX8A 5D5MF 3RWCA 4W4NA 4GLRI 4BKLB 2BVTA 2PYEB 1BJ1H 1ZVHA 3P4NA 1X4YA 4OI8A 4PRHB 5L8JB 1FE8L 4NNXB 3UEZA 1RZJL 4LKXA 4KKLD 2X4NA 2ZPKL 4O2EA 3L7FB 2AS5M 1X5ZA 4LCYA 1HXMB 3WMSA 3TBSB 4OD1L 1MIMH 4YEFA 3G08B 4X7CC 1K2DA 4YNYA 1SBSL 5EPMB 1BAFL 2BNRE 4P57B 3RAJH 3EIFA 3HNSH 4NZJA 1J10A 2NR6D 4Z0BL 4XZUA 3BP4B 3U46A 4KMTH 4LPYA 3QUMH 2WNGA 1LO4L 1Q38A 5K59E 3SCMC 5CWSB 4BSWA 2GYSA 4XC3L 2OI9C 1HHKB 1T2QL 1ZKAA 1EMTH 2CK2A 1WVZA 1HKLL 2VQ1A 1EHXA 4JQVA 4ZFFA 4LSDA 3NIGF 3QNZA 2WWMC 2R15A 2EDEA 4X4YB 1XIWB 4S2SA 1Q94A 1RK0B 1IL1B 2NY5H 3PQYE 5ALBH 5DUML 5DRZB 1F3JB 1NAKL 1KF9B 4NUJB 3C5JA 3SGDH 3VXOB 4DTGH 4Z7WA 5E95B 4ZTOL 2D2OA 3KYMA 1I3RB 3RY5A 5DQJA 2W0FB 5TE7H 3V4PL 3SDCB 3VXPB 5HHQB 2W59A 4MJ6B 4ZOCA 1RUML 3HPLB 2CDGA 1ZXQA 4WEMB 1OAQH 3NCJH 2P5ED 2UWEB 3IU3B 5TQ0H 4WUUA 5HYJE 1PLGH 3VFNB 3ECBB 2XN9A 3GJFH 4RMSA 2I9TA 5I1EH 2J88L 4FQHA 1QUNA 2AXHA 3C6SB 2K9UA 1JZ2A 4M7LL 5B39G 1PG7X 4DFHA 4OQ1A 1MI5E 5IGXH 4LEXL 4PIRF 2AEQL 2V7NA 4FQQA 1EO8L 5IW1B 2IBZX 1DDHB 1ACYH 1GZPA 1T0MA 2AXJA 1EFQA 1CDHA 1E6OH 1FYHB 3DHMA 2NZ9D 2R23A 1OCWH 3HZKA 4G9FE 3WS3B 3TYFB 1G0YR 4PJ8C 2HFFA 4MXVE 5FYJU 4TOYL 3T0XA 3UO1H 5CD3A 2R2HA 5ICXA 5EOCH 3U1SL 1AD9A 2P1YA 4OB5L 3RNQA 4JVUA 1KEGL 3RWJB 2YA0A 5SX5H 1TENA 4M1GH 1V7ML 2R0ZH 4DFIA 3O6KH 4DCQB 1UVQA 3CLFL 4NZTH 4DN3L 1XGYL 3WFEL 5HGAA 3GKWH 3B4NA 4YXHH 2VAAB 5GSRA 3PNWA 2OQJA 2A0LC 4G6KL 5DRWB 3K81A 4AJ0A 3MRKB 1P1ZA 4UTAL 4U1SB 5ACLA 2AERT 4GXUM 4F7TB 4ESKA 2QHRL 1BQHG 5D7KD 3K1DA 5DSCA 3S3PA 2DL9A 5E8EA 4R7NA 1NFDF 5DDHB 1UA6L 4OFYA 5BQ7A 1A6AB 3HI5H 3RFZC 2XI9A 4Z6AT 5KSBA 2WIIB 4PLOB 1MJ7H 4AIXA 1DLFL 4QXUL 2P5WE 2DJ4A 4OJFL 3MROA 3IKCA 3QH3A 5INDA 1I75A 4JRXA 2B39A 4X7EC 4UDUA 1ND0B 1S7SA 4X80H 1F5WA 4O02L 5I73C 4HJGB 4KJPC 2YPLB 2FBJL 4CNIA 1CYGA 5DD3H 1T0PB 4MA3A 4BQ9A 5H35A 5IB5B 1IGYB 5JHDA 3L1OL 5J8OA 2Z35A 2E9WA 2EYSB 3KS0J 1LE9A 3ZE1E 5CEXB 4M5ZL 2R9HD 5CCKH 2HFTA 3DOSA 2V7HA 4JG0H 1SVCP 3HLAB 4Z7OE 2ZP0T 1W72L 4U6VL 1QLEH 1FP5A 2OZ4L 1T0NA 3LKQA 3NPSC 3C9NA 1FIEA 3IVKB 3CVHA 3KYOB 5DZNA 4OCSH 4U7KA 1Q9LB 4NJ9H 2AJ3B 3TJHD 4NWTL 1B0GB 1IJ9A 2CRZA 5ANME 1NCDH 3DRTB 1KPRA 1JNHB 3VGDA 4NBYB 3MCKB 2EEAA 1I1AB 4E41D 4DKEH 1D9KD 4KK8C 1B88A 4PB0L 2PW2B 2WM0A 4IDLA 3GRWL 1CXEA 4JDZA 3UJJH 4LVEA 3U6RB 1JMZA 4HIXH 3VWKB 1VPOL 1MQKL 5EZJA 1TVHB 5IFAL 4GS7B 3NGBB 5I30H 1D5MB 2Q20A 1A7OL 4X6DA 4QRRA 4G8GA 5IWLC 1P6FA 1R5VB 3KPRB 2Z92B 2GW5A 2UY6A 4PJBB 4NQCE 4UNTA 1KNOA 5DD0H 5IT2L 1B2WL 3PGFH 4FABH 4G7VL 1KJ2A 3ZKND 3HZVA 3AM8C 5A2IH 1JHKL 5KSAB 5GJSL 4HIIA 1ZLSL 3FB8A 2ADJA 4U1JB 5F1SA 1L7IH 2FJHA 1CQYA 3OR7A 3NFSH 4N9GA 1JYVA 3QJHB 1HN1A 4KROB 3PDGA 4O2CA 1GGCL 3WFDH 3ULSA 4P2YA 5EOTB 3TBWB 4MZ2A 3RBSA 4OFDA 3N1QC 2LU4A 3QFJA 5KSVB 4EXPX 2V2WA 3LEXB 5LGHH 4P4RA 3T2NH 2A6DB 4OSUL 1JV5A 4P59L 3HC0B 4PRDA 3IGAA 1CI5A 3DROA 4L8BA 2AJZA 3C60C 1MFDH 3MXVL 4J3UA 4YH6A 4ZS6D 3VI4E 5BVJB 2PETA 4MNQD 5KZCD 2C3HA 2D0HA 4KAQL 3ZDZE 4Y5VC 3PWJA 2X4RA 4X99B 5CINH 3DUUA 1I9JH 1MY7A 3T0EE 5BJTB 3H0TB 5HHME 2VERN 3DJ9A 5HHOD 3LHPH 1UJ3A 4XRCA 5D9SB 5I74C 1KCSH 2CLRA 5C0IB 4AM0B 4OCXL 4JKMA 2YOCA 1CFTA 1A6ZA 3SE4A 1LDPH 1HK6A 3H2WA 4MHHI 1TJIL 1X5XA 4DUVA 3SDXB 1YEKH 3BJLA 5KOMC 3GDBA 4P2QD 2HT2D 4APQA 3FN0H 2Q8BH 3DRQB 4Y5YC 2ZJSH 4I3RH 4X7TA 3RWEB 1I9IL 1GYAA 4OT1L 5HI5D 1U3HB 1WCQA 2MJWA 4N0RA 1IILE 1OARL 4M6OL 1XZ0B 5LAXA 2CUMA 4F7MA 4X4XB 5J13B 5DD1L 2WSKA 1MHEA 1VEMA 5GS2D 2LV4A 5DZOA 1DBAL 3M07A 1SHMA 2C7UA 1AXIB 5I2IB 1A6WL 2YN5A 2ZKHL 4ZPVB 3CPLB 1FBIH 3L5WA 3P11L 4M03A 4ZO6A 3U0WL 5BCAA 2LTQB 4KKBD 2AAVA 1PZ5B 1DLHA 4MS8C 4LU5H 4I9WE 1GPOH 3H9HA 1OM3L 1HI6A 4XVSH 3T3PF 2OL3B 5DJCB 5D1XB 1G9ML 4D8PB 4JHAL 5C2BH 2AJVL 5HHVH 2CIIA 1JWUA 1H3VA 2VITB 4WU5B 2XQBL 1EZVY 3T0EC 3SE8H 1V7NH 4RRPG 4GO6B 1WZ1L 1HXYA 1H3XA 4JZOA 1A3RL 3UTTE 4WO4B 3O9WB 5L2KA 3ZKQD 5L7XL 1KIPA 4I18C 4P5MB 3U0TB 4WEBH 1IGFH 2IAMA 2IMNA 3VH8B 1YEHL 5FF6B 4M6NH 5C0JB 1XGPA 3BH8B 4TNVK 5I6XC 2DICA 2WWKT 4NKOA 1A7RH 1XF3A 3TNNA 3L6FA 4HMDA 1FZOB 2ORBH 3CZFB 3S37H 1T6VN 4NRXB 4PRNA 4L4TA 4HIEA 3QQ4B 4NYLB 1VADA 4NN5C 4BZ1H 5KS9A 1INEL 5FKPA 3GGWA 4F8QA 3REVA 1I4FB 4QHKJ 2BC4A 4JFED 2YXFA 4X6FB 3R8QA 3TN0C 2IALA 4HT1H 2RIKA 2AJXH 3RTQC 3EW3B 1K8DB 1OSPH 3HI6L 2B4CH 3FQRA 2ADGA 3RVUD 4BQCA 1R3HB 4P4KB 5DHVH 3B9KA 3I6LD 1OW0C 4HFUH 1NBYA 3WJJA 1IEAB 4LCCA 1IFHL 2PYEA 3WS6A 4JPVH 5DMKB 4Q9QL 3QEHB 4PRHA 3DYPA 4PTUB 4FA8A 5DJ0B 2BNQD 2VL4A 1NMAH 4OF8A 1OD9A 1RSFA 4HUUB 4Y5XC 2V9QA 3PL6D 3TV3H 3MRPB 4WJ5A 2ZWLT 1MQ8A 5D7LB 1HXMA 4K7PX 3SE3A 1G6RL 3MRLA 3TBSA 5IVOA 5DWUL 3G08A 4Z7VE 1H8SA 5CSZB 1RJZA 3HC3L 3AU1B 3G6JA 5EU6B 1U3JA 1RVFH 3NCFB 1T6WA 1GCFA 4F58H 2D9QB 5F96L 5GHWH 4KVCH 4POZD 1VA9A 4QRSB 1W72B 2NY1B 4UV4L 4U6HA 5C0GA 4YBLB 1MAML 5SWSE 3P30L 4MNQB 4JLRB 1IQWH 4UU9A 1ED3B 1SY6L 25C8L 1GGIL 3QCVH 4ZFGH 4LLMA 5E7BA 2HTKC 2FECL 2IBZY 5EZIH 4NKMA 1JUFB 5FCSH 5HYQB 1RK0A 3BHBB 1IL1A 4MA8L 4XWGL 2C4FU 5C0FB 5DRZA 5I17A 2FEDD 4BELD 2DLFL 5B38B 2G9HB 2R8SL 2YRLA 1RZ7L 1I3RA 3KYNA 1KFAH 4HKBB 3D3VE 2VC2H 2JJWA 2W0FA 3OKEA 3SDCA 4L5FH 3VXPA 5GGUB 3HPLA 4ONOA 5F7DB 4XCYB 1JNJA 5IUSA 3FHQA 5DFVD 4YIQA 3WSQH 2VZVA 4LCWE 5LWYL 1RZFH 4R2GC 4ZAKD 1NCAL 3N0PB 1NUGA 4WVRA 2DRUA 1IC4H 5I9QB 5C0ND 3O2VL 1HHGB 5E8NB 4UV7H 2M26A 4CUCA 5J3HD 1TVDA 3QIUC 5SWZB 4WWID 1RD6A 5BV7L 3ESUF 1S7VA 1P6AB 3V8CA 4BFBD 5BS0E 1GL4B 1HNFA 1R24B 5E99L 2EDKA 3C87A 4XP1H 4Y2OA 4XI5C 2FD6H 3IFNH 3KXFA 4JM4L 2WUCL 4Q0XL 4QXTB 2ZNXA 4D0CB 5IW1A 1Q8MA 4IOIA 2HVJB 1EGJA 2DBJA 4MCZB 5T3XL 3RDTC 5IQ7H 1S78C 1GVIA 1JNLL 2XWBA 4IRSC 3P73B 3TYFA 4BFIA 4GRMA 4K8RD 1ZWIB 1ZLUK 4R3SB 4FQJL 1MREH 5DVNA 1DQQA 1F97A 3ARED 3RWJA 3VDCA 3X13A 2OP4H 3MV7D 4OUUB 4DCQA 3Q6FB 3VFTB 4O2FB 5JXAL 1FRGH 4WI5A 1NEZG 2AABL 2UVEA 1YY8B 2DDQH 2VAAA 4HC1H 3SPVB 1YMHB 4GRLA 1J0IA 5DRWA 5BOPA 2DM7A 4JY4B 3MRKA 3SKUD 4U1SA 4F7TA 5GISH 3WHE0 5F9DC 1RUPL 3HE6A 4IS6A 4YWGL 3OZ9H 2YWYA 1CD1B 1F90H 3A6CL 4KK9D 3BUYB 1UM5H 5GZNC 2XQYK 1U6AL 4L4VE 1CICC 4KKAC 5BXFB 3O0RH 3ALXA 3BP5A 4OIIH 1F4XH 1NEZB 1T7WA 1U42A 3N1GC 4PY8J 3CUPB 4MVBD 2KQNA 3HC4L 4KZDL 4D94A 1H3PH 2WIIA 4PJXE 2P8PA 3HG1B 4XCFH 5DTFB 2I9LB 1KC5L 4AEFA 1BVZA 4TN9A 4P5TC 4DWHA 1ND0A 3KHQA 3OQ3B 3NOIA 5TQ0L 4KHXL 2X09A 5EBGA 4X7SH 1HCVA 1UADC 2BNQB 5FFLA 5IB5A 2YZ1A 1IGYA 5JR1H 3FQWB 4YPJA 3PL6B 2EYSA 3BEVB 1KELH 5CEXA 1QPPA 1IKFH 1G7MB 2AV7B 4BH7B 3RWIA 1MFAL 1QHPA 4KMLB 2VLLB 2N7AA 1N8ZB 4KKCD 4OZFH 4N0CD 4LIQE 4P3CH 3BEWB 1YJDL 3HLAA 1A6VL 5D1QC 1N26A 4RWHA 4IDJH 3NMEA 4QRPE 1CBVL 3KYOA 2FHFA 3MRQB 4RIRB 1Q9LA 3BD4A 3QQ9C 1E6OL 1B0GA 2A6IA 1X5FA 4YPGB 1XH3B 3QAZC 1JNHA 1EEZB 4Z7NE 1YYLH 5FYKE 1QSED 3MCKA 3VXUD 4NT6B 3KPTA 3MRHB 4G80A 2VDNH 4IMKA 5JA9A 3S34L 5D6CB 1W0WA 3BQUD 4M1GL 4BJLA 3U6RA 2R0ZL 5C2UB 3PGDA 2IANA 2MQ3A 3M17A 4OZGA 2GJ6B 3MRGB 4YXHL 1D5MA 4ZD3L 4OM0H 3R06B 1F45A 3KPRA 2GEEA 2Z92A 4PJ5A 5D2LF 1OLLA 3D2UB 1S7QB 2DJSA 3FO0L 3ARFC 5C7XL 1CLZL 3LKNA 3FCTB 5KSAA 3P4OB 2EDBA 4H1LB 2Y06L 5C0AD 4U1JA 1NMBH 1BZ9B 1C5DB 2YD5A 3VGEA 2D03H 3QJHA 1ZGLM 3VFRA 5FYJE 3KVQA 2ED8A 3JUYA 1O0VA 4PREB 2PXYA 4BQ8A 3KPSB 3OKOA 1G1YA 4DKAA 4PG2A 5GGSA 1CGYA 4C56A 4X98B 1MNUH 3BPOC 3Q2CA 2I5YH 1MJ7L 1WSST 4MNHB 3HB3D 1T1WB 1HCFX 3GUTB 1YY9D 3MV8B 4N90E 4Y4KD 3HC0A 3JWDH 2H6PB 4LDEB 1HEZB 3ARPA 1TTGA 4I48A 5BVJA 4LMQI 1GOHA 4S1DD 1PDKA 3H8NA 1FNSL 3VG0H 5D2NE 2IFFL 4X99A 4L3AA 1Q9WB 2NPLX 3OSKA 1YEGH 1DQLL 3AREB 3VXRA 5T3ZE 4CVZB 5D9SA 4TSBH 5C0IA 4JG0L 4AM0A 3MLTB 5GXBB 1MCLA 3NFPB 5EORL 3QO1B 1JPSL 2BVPB 2FECI 1WT5C 2FH8A 4Z7QF 1PJ9A 2AJYL 5E1AB 3SDXA 2AK4D 4PJIB 4UQ2B 4PRAB 1AGDA 4K94L 1N4XH 1KXQE 5JIKA 2NY6D 4JVPA 1MF2H 1U3HA 5F9AC 1XF2A 4FRWA 3RL1B 1XZ0A 2WZPD 3AUVA 4X4XA 5IB4B 1Q0YL 4G7YL 3ARGC 3TT1H 4X4ME 3BW9B 5J0BA 5GS1A 3V95A 1QKZL 1Y18A 1FNLA 1I8IB 3PGCA 1CXIA 3F65A 2EYRB 2ID5A 4I77L 2W9EH 4AIOA 4PR5A 2ICWJ 4NO3B 1OD7A 1PKQA 2A6KB 1RULL 4KJYB 2EH7L 4KZEH 4ETQA 3RI5F 5DJCA 5DLMH 5EH1A 5KSBE 1CLCA 4PD4K 4D8PA 2FWOA 4JM2C 1JTOA 3SJVE 1MLCB 5D2NC 3WFDL 5C0BD 3C09B 4WU5A 3MV9B 3LN4A 3FN9A 1N7MH 2NW2B 2PCPB 3FTGB 3O9WA 4WO4A 4K7PY 5JHDE 1SMAA 3RZCA 1MCWM 1JGLL 5HDBF 5FF6A 3PJSB 1AD0B 3I85A 2AEPL 3BH8A 1I8LC 4NZRL 3PUCA 1O7SA 3GSNH 3LKPB 3QUMB 3HZMA 1MRCL 1Y6MR 3GBNH 1QSFE 4QHLA 1FZOA 3RKDD 4DGIL 1A9EB 1QFWH 3CZFA 3ULVD 4NUGL 4NRXA 2DQIL 4YDKL 4ZFZB 1AIFA 3CK0L 5B8CA 1C08B 3QQ4A 3EYOA 4RCAA 5CJXA 4HCRL 4MJ4A 5DI8B 3V5KB 4HUNB 3NZ8A 4X6FA 1LHZA 3BQUB 3QQ3B 4XP4L 4XPHL 1K8DA 3ZHDA 4P23C 4U4BA 3MXWL 5E4IA 1R3HA 4P4KA 2FL5B 5KN5B 4M1CC 3JWOC 4XMLH 4R0LA 4HUMB 1JF5A 5F97E 4BSVB 2DQHH 5LVEA 3HR5B 3DXAB 4C55A 5DMKA 3HUJA 1WUNT 1KENH 2Q8BL 4CN6A 2HJLB 3KJ4C 3H3PL 4I3RL 4PTUA 1CZ8H 3FB6B 4NQVB 4HUUA 4HK3J 4YXLH 3FKUS 3MRPA 2H9GA 4FTVD 3RIAK 4OLWH 2DQEL 4HPOH 4LNVA 4FXGB 4GXUN 2GT9B 1A5FH 4QGTA 1I85C 5CSZA 5FYLE 4F57L 5KVEL 3GJFB 3AU1A 3NTCL 2E7BA 5EU6A 4FP8H 2QR0B 4OCRL 3LD8B 1S9XB 3BDYH 3C8DA 4KU1A 2R4RH 1RK1A 4KK5D 4QT5A 4F37K 1TDQA 5ADPH 1W72A 1LGVA 3S88H 1CG9B 2ZCKL 2OZ4A 3QFJE 4K9EL 4FFVC 1JIBA 4LQFH 5SX4H 1Q0XL 4NPYB 3RJQB 4JFDD 3RIFK 1FNHA 3TO4D 1IGML 1QQDA 3Q3GB 1JUFA 3LPWA 1GGUA 2GITB 1DUYB 1MEXL 1WFNA 2ZG3A 5I1IH 1FL5A 4LSVH 3NCEB 4WTZA 1LMKA 4FXLA 1P2CA 5B38A 1FYTD 1IGFL 15C8H 4OM1L 3GRWA 3MA9L 3CMOL 2VYRE 4URTB 3QUZD 2AK4B 3KPPB 3HR6A 4F3FA 5CZVL 1OGAB 4GG8B 4XNXH 5F7DA 4Z95H 5EU5B 3UROR 5D2LB 4RGNE 4D9QD 4ORGB 1I1CA 4W81A 3TWCH 4I0PC 4MQXD 4MAYB 1BEYL 3LRSA 5A1AA 3O6FB 5E8NA 1HHGA 1GAFL 4NDMA 4PYHA 1OSPL 5B4MC 4I3SH 5DFTA 5SWZA 2B4CL 4G6AC 3FQTA 3H7BB 3MGOB 1R5IA 1R24A 4FHBD 4XGZB 2FX9H 2H2SD 4QO1A 5CFHA 5E08L 2DM3A 4QXTA 4D0CA 2Y07H 1MCFA 2HVJA 3BZFB 3ETBF 1YA5A 1PEWA 4WV1C 5I19H 3GMLB 3V0AC 3V0WH 1A7QH 1NBVH 3P73A 4Y1AB 1U95B 5AYUL 4PJEB 5EG6C 5DJ6B 4UOW1 3QT2A 1QEWB 4UIMA 5E6ZA 2Z8VC 4J2XA 5C9JA 3HE7D 4ONGL 1MH5B 5F9JB 2DQDL 4TVSa 3QIWB 4OUUA 4WI3A 3VFTA 2ITCB 2LE9A 2YHGA 5IBUG 1CF8H 2HKHL 4D9LH 4EJ1C 5GHWL 3SPVA 1AQKL 1YMHA 4YDIH 1T1XA 1ZT4B 1ONQA 1I8KA 2J8UF 2XKSA 4CGTA 2P49B 5MERA 1JN6A 2WLYA 1QYGL 1IARB 4JVWA 3CFBA 1K4CA 3V4UL 1UJ3C 4R7DB 5AAMA 1EA9C 4JGUA 1KTKE 4N0YH 4NNYB 3ZE2E 1NUDA 4RGNC 3O81A 3BUYA 2CRMA 3ARXA 3ZSSA 1VFMA 5BXFA 2BOBA 3I9GH 4ZMAT 3MOAL 3UTSD 1SYVB 1WZKA 1TNNA 3CUPA 2FJFB 4PJAA 4O51B 5IEHB 4U7SA 4Y89A 5FM8A 5LGJA 2NLJA 4KMQA 2VC2L 3ET9F 1BOGB 3VRIB 4XP9H 4XPFH 4L5FL 5DTFA 3VWJC 2I9LA 4AIZB 5IB2B 3ALWA 4AYFA 2D31B 1J8HE 4LSQH 3MFFB 5DS8A 3V6FA 3GIZH 2Y1VA 2R2EB 4MJIB 2XTJB 5DFWH 3FQWA 4YJZL 4HEME 3WYRA 3QZWG 4M7ZC 3ARRA 3DVFA 5IK3A 1VFBA 2AV7A 4UV7L 4I0CC 5AYQA 5TE4H 2PYEE 4BH7A 3HAEH 1NC2D 4PRHE 3BD5A 3LQMA 1N8ZA 4ZXBD 1MJ8H 5K9JL 1FN4A 4KRPC 1RJYB 3OXSB 3WIHL 3WFCH 1I7TA 1DQDH 2X4TB 1OTUD 4K3EH 2KL6A 3UYOD 4RIRA 4NOFA 4GAGH 5AWNL 4YPGA 3QWRA 1XH3A 5CZXC 4AQ1B 1N3NB 1EEZA 2OR9L 3MLXL 1TQBC 1J1XH 4U1LA 5EA0L 5DQDL 3BOVA 4K2UH 2BXZA 1MREL 5FA3B 4J6RL 2HJFB 4H26B 3MLRH 5CS7A 1JZ7A 3MYJB 2IAMC 4WY7H 1IAIH 3ZDXF 2OP4L 1A02N 4R8WL 4ODVH 5DJAA 1RUAH 1S8DB 3L9RB 4F15B 3QHZH 1YPZB 3MRFB 1WIPA 4JO1L 1YMMB 1CFVL 5CEZL 3QUZB 4YX2L 3D2UA 3UBXG 1N5YH 2Z91A 5CBEB 2ERJC 2PO6A 2Q1EA 4P5KB 2NMSA 1IGIH 1U8KB 3QIBA 1P4LB 4Y16C 1CT8B 4G5ZL 1BZ9A 5EBMA 4PREA 1N64H 3OX8B 4OIIL 1NGYB 3DO7B 2UWEE 1F4XL 3VFMB 3KPSA 4HKZB 5C6WH 5FKAB 3BYYA 4JHWL 4X98A 1G6RA 1FFNA 3M8OL 3OL2A 1T1WA 1MWAL 1FAKT 1VACA 4HBCL 2EE3A 3RWFA 4H0HB 4O58H 1F02I 4AG4L 4N68A 5C0DB 2AQ3A 1OY3B 2FIRT 1AGEA 2OK0L 2WBJD 2X05A 2Y72A 3EO0B 3J8F7 1LO0H 4JFFB 5MENB 5ICYB 3TIDB 5IESL 1FPTH 4WW2F 3LEVL 3NZHL 3JSSA 4OQTL 4R90L 4JANA 4P3CL 1CL7H 1FZKB 1MAJA 3U0PA 1DBJL 1ZTXL 2AP2A 1Q1JH 1A3LL 4NHUB 4PLJD 3LPFA 3QO1A 4WGVB 4QNPF 3HMXL 1OAUH 2A74B 5E70A 4K7PL 1U36A 4RZCB 1MIEL 4GQ9H 1XIWC 5LJYH 1BFTA 1RIUH 4PJIA 1AXTH 1A6PA 1KCLA 3BGAA 1HQ4A 4PRAA 5JW5B 3QA3B 3B2UD 4S1QL 3EYQC 5E2VL 2IMMA 2F74B 4IM8A 4MB3A 2VDNL 4J4PD 2DQGL 1HH9B 5A2FA 4PP2B 4FG6D 3SDCC 4Y4FD 3P4MA 5I8EA 3CXDH 5DA4A 5HDOA 3BW9A 5GZOD 4CBPA 4UB0H 3MLYL 2X4OA 2VLMD 5L88H 4R26H 2CIKB 3WLBB 4UBDC 2HT3C 1C5CH 4LEOB 2MFNA 5DHVB 4YFDB 5EO0B 4CMHB 5L8KB 3B9AA 2AV1A 2VXVH 1TQCB 5ID1B 1MLCA 2OTUA 1JF6A 4RNRB 3SY0B 2YPLE 3MV9A 4JFOB 3ULUE 1MCCA 4G42A 4FQCH 1AC0A 2I5YL 3O2WL 2J4WH 4NWUH 3PJSA 3W5NA 3D0LB 3UTPD 4MJ2A 4AENB 2R56L 1LDSA 1T1ZB 2W0PA 4GMSH 1QRND 3H9SD 2J8UB 3VG0L 3ZL4L 1KYOK 2OJZH 5DJXA 4H8WH 1YEGL 1HWGB 4HQQL 5FUZL 5J9PB 2NY0B 3O2DH 1DR9A 4Z77B 4NFBA 5IR1A 3C5SB 3ARDD 2E7LA 1BJ8A 5TF0A 4ZSOA 4BQBA 3EOAA 3F5WB 2FL5A 5KN5A 1KCVL 1IZJA 4TNVF 2A73B 1YNKH 2ED9A 3VE0B 4YHKH 2BX5A 3CX2A 2XNAB 3BFOA 3P0VH 1GSMA 2P8LA 4JFXA 3T04D 2F54B 2IPUK 2HJLA 3MBED 4RFOL 4XPAL 3WHXB 5BMFH 3ZKMD 1ES0B 3NIFF 2BY0A 3NCCB 4JRYD 4NO0D 1I8MA 3BH9A 4X5LA 3KPRE 3MJ8B 2Z93B 2G5BA 4P2OD 4YR6B 4FXGA 2O5XH 4PJBE 3C2AL 4KDTA 3IB4A 1CVRA 3GJFA 3VA2C 3L5XL 3TZVB 5E6YA 3MLWH 2QR0A 2FJGB 1CFBA 3G5ZB 1IM9A 3B43A 5HY9B 3ULUC 1R3JA 1HHJA 1S9XA 3MLPA 3TF7C 3ROLB 4JQIH 2HN7A 3LB6C 4M6MH 4LLVB 4LNRB 4HAGA 2B1AH 3GFUA 4TSAH 2HP4A 2Z8WC 4HGKC 1OLZA 3P0YH 3CCHB 1U2CA 4NPYA 5E6IB 4P46A 3VMOA 4NZDA 2NR6C 3MR9B 4ZDHB 3KNBB 3SDDA 5LKNA 1IGTB 3L7EB 5LCVH 3U48A 3FO2B 2GITA 4LLYB 3VGAB 2EXYC 1NAML 1DUYA 5HI3D 4QWWC 3WNMA 1EEUA 4LGRB 1GIGH 2QSQA 1FZJB 1I1AC 1T2JA 2IPUG 2A77L 4NQSA 3KPPA 4J8RB 4GG8A 3AGVA 4IMKC 4Z9KB 4G6MH 1YQ2A 1L7TL 4OGAC 3TBTA 4BZ2H 4FQ1H 4YFLI 5AG8A 2A2QT 1MCDA 2F5AH 3WIIH 2BVOA 1QBMH 3VWKC 2C3GA 3MOQA 2FLBT 4PY8I 4TUKH 4PJGA 1YNTA 4GS7C 3NGBC 4HK3N 4MAYA 3SDXE 3CSBA 3O41A 1GGBL 3O6FA 1OQXA 1ZE3C 4M3KB 3LH2L 1YEFH 3FONB 4TTDD 4A6YL 5BZWA 1SEQH 4JDVB 3WEXB 3ELAT 4UAOB 3U7YH 1LO3L 3ZKXB 3SCMD 3QI9B 1AY1H 4XGZA 5KSAC 4EN3B 1SMOA 4GMTH 4PJFF 3DWTA 3H9ZA 3VRJA 2CPCA 4KROC 3OJVC 5I1KL 3G6DL 4QYOA 3GMLA 2WWMD 4L1HA 1J87A 2DWEB 4UOJA 4RSVA 3O11A 3OR6A 4K23L 5LGKA 4NRYB 4YHMH 1U95A 2EYTB 2RFXB 1A4JB 4PJEA 4TQEL 1J86A 4H88L 5DJ6A 5F9OH 4Q9BA 1QFOA 2APFA 3PP4H 3GSOA 1MH5A 5SV3A 4FP8L 3QIWA 4FFYH 1P9MC 3BSZH 5BW7C 4WW2B 4OGXL 2H3NB 1MOEA 2Y36H 3LQAL 3RZWA 3W39B 4OZFB 3EDFA 5DK2A 3SGEH 2VLRD 5TDOA 3IJSA 2PF6A 2DIAA 3DX6A 1T83A 5DA0B 3MLUL 1C8PA 2W0LA 4NIKB 3X12B 5TPWH 4KTDH 4HUXA 1T3FB 1DBKL 5JW4Q 5JPMB 4HK0B 5J56B 3S96B 2X1WL 2BXYA 3MNVA 3CIQA 4ZFOL 1H3UA 3FFCB 1SYVA 2BNRD 4HF5L 1HH6B 2FJFA 2PTTA 3VRIA 1BOGA 1RZIA 3QCTL 3TYGH 1U3HC 3BWAB 5JHLL 4AIZA 5IB2A 2IF7A 1BVKA 2ICEB 3GI9L 1JFQL 5E1HB 3RGVA 2E8YA 4GJTB 4ZUVB 2BY1A 3MFFA 3BZDA 5J13C 4MXVF 3B8YA 1I9EA 4X9GA 4PJ8D 3VGFA 4JRYB 1CD9B 5JNYA 5MEQB 4PGDB 3VFWB 3PWVA 4LAQH 5C08B 2BNUB 5TF1H 2V2TA 5D7JB 2O61A 3KR3H 3BPLB 5C09B 2LTQC 2VR4A 2X1QA 3PQYD 4JFQB 3RWHB 4G3YH 2AJUH 3HS0B 3L3KB 1NLDH 1LNUB 2RR3A 2A0LD 2FX9L 5D7LE 5D1XC 4IRZH 2J7LA 5D7SH 3FT3A 5DXWA 5J1SC 1Q72H 3KPMB 4XB8A 5LXGH 1KIQB 4J12A 3G5VA 5EU6E 2VXQL 5I19L 1CXLA 3WJLA 3DURB 1QP1A 4DOHB 2AKRB 3T2PA 5C0CA 3WLWC 3OKKA 3PXHA 3O9WC 4K8RL 4WO4C 2YEZB 5DMJB 2O93L 4I4WB 5D71H 4AL8L 1WTLA 3SBWA 4MNQE 3B3IB 3IFLH 4ORZC 5HI4C 1EFXA 4HCRA 1M6OB 1OAYH 1DBBH 1YPZA 2YRPA 4Y8AA 4RA0C 4YHNB 2CKNA 1MI5D 4IMLB 2CRYA 2VXTL 1RZKH 2BP3A 3VXMA 3OGCA 3FT2B 4KJPD 4LSSH 4Q9CA 2CLZB 2R2BA 5CBEA 3AXLB 4P5KA 1A6TB 5C1MB 3MZTA 3OWEA 1TPXB 5FAAA 3QJFB 3KPOB 1P4LA 5IJVA 5J6HA 1CT8A 4P4KC 1V3LA 4KQ3H 1FVEB 3FQUA 4X9HA 1A14L 3OBAA 1K3ZA 2LU3A 4P2CG 1MAKA 4CMMA 5JUEL 1WFTA 3WE6A 3VFMA 2PYFB 4HKZA 2ICWI 4LVOB 5FKAA 1IKNA 2H1PL 3JV4B 4DGVL 3GJEA 3ARBB 1XF4B 2Z31B 4FNLH 2XWJA 3TCLB 3ZYJA 1MFEH 4XX1E 3EHBC 4GW5B 1Q9OA 2VISB 2Y5EA 3JTTB 2FX7H 5GSVB 4HV8A 1FNAA 2VXSL 4LSQL 5SWZE 2J3SA 3GIZL 3BAEH 1MLBB 4YC2B 1BBJA 4U0RB 1FC2D 1TZGL 5TE6L 4PJHF 3PHOB 4JFFA 1ZLVK 1F13A 1M05B 4KK8D 4NSKB 5TFSL 5MENA 5ITFB 3ZTJG 3QXTA 1NPUA 5KBNC 4HG4K 1WWWX 3BT2H 4PRPB 1FZKA 2NY1C 1LP9F 4YBLC 5KSUB 3WFCL 4Z78B 3UJIH 2A74A 5HHPB 4RZCA 5E00B 3WXWH 2DOCA 4U1KB 3GSQB 3U7AA 1S5HB 5IVZB 5JW5A 1OAZH 3SQOL 4BK5A 3QA3A 3EKCA 1J1XL 4PRBB 4YHLH 2I60L 2YS4A 4UT7H 2PKDA 3GSNB 1NL0H 1A7PH 5D72L 3MLRL 5F1IB 1HH9A 3O3DA 2F8OA 3E2HB 4JDTL 5I8OL 2G2RB 3Q0HA 4ODVL 5IEKB 1RUAL 2PN5A 1J0YA 5EO1B 3VFPA 3N06B 1IAKB 4BH8A 1RZ8B 1YYML 5CJ8A 1CGXA 1T4KA 3PDDA 3VI4F 3WLBA 2UZIL 5I71B 5I9QC 2DTML 2DQJH 3ZDYF 4UT9H 4UQ3A 1LO2L 4YUEH 1HDMB 3TM6A 1T21A 3CVHH 1F8TL 3BKYL 4RAUA 3RNKA 1JGDB 1DN2A 4LVHB 3HG1E 2YSSB 1D6EB 4LFHD 3I75B 5ID1A 3SY0A 1QNZH 1UH4A 3QEQB 3RUGF 1N0XH 3KHOA 4FQLL 1FORH 4QLRA 2BNQE 4UILH 4OLZH 5I8CB 2VZUA 4AEHL 5JW4N 1DBML 1M7IB 1B4RA 4AENA 1ZSDB 4XNYH 4AH2B 1T1ZA 5F8RC 4C59B 8CGTA 3I3EA 1SM3H 3CDFA 3MRDB 1OPGL 2GJJA 2B8OT 4I2XB 1WCBA 3D0VA 3DX9B 2CDFA 1KJ2H 2MPAH 4Z77A 3WV0A 4I13B 3S98A 4MNGA 3T0BA 2XZQH 3FRPG 2A73A 4GQPH 1RPQA 2XZAL 2F5BH 1IAOB 4KGLA 4MS8D 4BYHA 1HHIA 4F9PC 2XNAA 2H8PB 1CFQB 2DYPB 2IQ9L 2ZNWA 4MX7A 5E56A 2A9NH 2AW2A 4J3VA 1F58L 2F54A 2D7MA 2OXGA 3C8KA 4PJCF 2CUIA 2VLJB 3WHXA 1ES0A 4PG9A 2CMRL 3NPZB 2GJ6E 5I1AB 1NCWL 3RVUC 1KN2L 3V6OA 1OSZB 2WQRA 2VDOH 5IROC 4XCCH 4EVNB 1JPGA 5GGQH 1P7QB 3WN5B 3T0ED 4YDVB 1PG7W 4JJ5B 4L29B 4M4PA 5HHMD 3VCLB 4F7PB 1FZMA 3S35X 3TZVA 1JRHL 2PR4L 2FJGA 3BP6B 3X3FL 4O00A 3RVVC 2K7QA 4R26L 3ROLA 5ETUA 3X11B 1F3DJ 2VIRB 3W0WB 1I1FA 3CFCL 4LLVA 3MODH 3PL6C 1MJJB 1HZHL 1G84A 5EU7E 3KPSE 5TDNB 3WIHA 3QDMB 4DZBA 4FZ8H 1JGEB 5E6IA 4CVXB 1S3KL 2EO1A 2EC9U 2AGJL 4GBXA 4JFPB 3EO1B 4ZDHA 2MCPH 2QEJA 5BRZA 3MV8E 4LMQE 3TN0D 1CK0L 3AAZB 2L7JA 4O5LH 3RTQD 4LLYA 4FQ2L 4OZHF 5I1JL 3B8SA 4L8CB 4G8IA 4PJ7F 4I0KA 1S7WB 4IOSD 4F37F 2J4WL 3BPCA 2N1KA 4NWUL 1XGUA 3LKOB 4NP4H 3T77B 3MJ9L 3HCVB 5DEZA 4OD3H 1KV3A 1P4BL 4J8RA 2OR7A 2HWZL 4I9WD 4GMSL 1G7HB 5JXEA 1DN0B 2FEDC 2HLFC 5D70H 1CDYA 1WITA 3U4EB 3ULVL 5DJ8B 1EIBA 1YNLH 1JPST 5C6TL 1URLA 1F4WH 3O2DL 1C5BH 1WWCA 4LFHG 4QOKB 4PJIE 5ABDE 3FONA 1BFOB 3FOMB 4AEEA 2JKXA 5D4QA 3P0GB 3WEXA 3O6MH 3UTTD 3QI9A 1NBZA 4EN3A 5IW6A 4NN6B 4X83A 3IYLW 4G8FB 4JN1H 4HWEL 5E4EB 1WC7B 3OB0K 1IQDA 4LGSB 5C0NC 3MPCA 1MWAA 5DT1H 2D4DA 5IFJA 2YUZA 4PY7B 2DWEA 2HTKD 1QOKA 1BQLH 5EU7C 3U4BH 2GSGB 4TVPL 3DGGB 5CD5C 1AE6H 2O5XL 5I1HL 4Y2DB 4PJHB 2F19H 4KXZI 1M71A 1T89A 5FUCE 3QHFL 4H0IA 3AY4A 1GOGA 2JK5B 3HAEB 2D9CA 2H3NA 1WV7T 4OQTA 5HYSB 1FVDA 4M6ML 2DQUH 3PV7A 4M7JL 4O4YL 2BCKB 1LP9B 3FO9B 1ZVSB 3PF2A 2OXHA 3MV9E 4NZUL 4GLRH 2VQUA 3AREC 5GS0C 3HMXA 1XCTB 3SE9L 3K3QA 2EDRA 1TJHL 3N85L 4HIHA 4R2GD 3L3JA 3V7MA 1T3FA 3G04B 1LEIB 5JQ6H 5HD8C 1J88A 1ZT1B 2H26A 5IMLB 5JPMA 4HK0A 3QIUD 5BVPL 3S96A 4OZ4B 5FHBL 4XCEB 1ZLWK 4G6FD 5JZ7C 5GGRB 3R4DA 4OZIA 3BZEA 1JZ8A 1CD0A 3HFMH 2CGRH 4YO0B 1NLBH 2VN4A 4RRPA 3WKMH 1VEOA 2DI9A 1NGQH 3DARA 4LSUL 1G9NL 1E28B 1GC1C 1AP2B 2DQCL 3RDTD 1OGTA 1S78D 4ZUVA 4G6ML 1KT2B 2F53B 5T1LB 4PJ9B 4TNWF 1TVBA 5IHBA 4ZUSB 3VXSA 2B0SH 1NGPH 1KOAA 4MVBC 3QSKB 1BFSA 4PGDA 3VFWA 1F6FB 3DXAE 5E2WL 3MRBB 5D7JA 5BOZG 5GRYA 4HWZA 4XPGH 5CJOL 3RWHA 2WLZA 2K3TA 3HS0A 3I2CH 5DURD 1V05A 3RVXC 2D7TL 2DTSA 5FUCC 2XACC 3RUGB 1LNUA 2JJSA 3BPNB 2LFGA 3D3VD 5GGVY 2HKFH 4ELMA 3ZYOA 3KPMA 2VZSA 1OWWA 4QRUB 4U2YA 2VXUL 2VR5A 2CDEB 3EZ8A 3C09C 1XGTA 1UM6H 5FOBB 4HS6B 3B2VH 2OLDA 4N0CC 2RJMA 3O4LB 5GZND 2FYYB 2YWZA 2FATH 1K3IA 3TH4T 1CICD 4KKAD 4FQPA 4JO3H 1HOCA 5EUOA 3IFPA 3WL9B 1GHFH 2Y7QB 2GY5A 3IRPX 4ODWA 4PJXF 1NUNB 3B3IA 1IEBA 2P24B 1G0XA 2APTA 1M6OA 5BS0D 4YHNA 1T03H 4P5TD 1IC5H 4NM4L 2XV6B 4PTTB 4XBGA 2IG2H 1A0QL 1UENA 1A6TA 3BQUC 2E7LC 3KPOA 1YDPB 3L95B 4UTBH 5FUOH 1EGJH 3JV5A 3QDJA 4YFEA 4PJCB 2NY5C 2ICWA 1FVEA 2AK4E 4YAQB 1EHLL 1OGAE 1BJMA 4OTXL 4XH2B 4P3DB 4JZJA 5I1GL 3M1BB 2PYFA 5D1QD 5D2LE 2JB6A 1DUZB 4XP6H 4YHPB 1NFKA 1XF4A 1W8OA 3PIQB 3QCUH 5K9QI 1CLOH 3EJJX 4GW5A 2VISA 3QQ9D 3JTTA 5GSVA 3X17A 4Z7NF 4XPBH 1MLBA 5FHAH 1JRHI 2ZSVB 1M05A 2EE6A 5FB8A 5ITFA 1QBAA 3LD8C 3VDAA 3MRRB 3KR3L 4XCNB 3T0AA 5E03A 1X4XA 4GW4B 1IBGL 2GIYA 2AJUL 3QYCA 2EDXA 4U6TA 5IM7B 3I6KB 3QUYA 3D39B 2A83B 5ILTL 4OZHB 4Y1AE 5KSUA 4PJ7B 4POUB 1NAMA 4LHUB 4PJEE 1IGCH 4LBEB 3WNPA 5HPMB 5E00A 3OGOE 4J23A 7FABL 3GSQA 3D48R 3ARFD 3A6OA 4Z7WF 4M48L 4X8JB 2GCYB 1S5HA 1SJHB 3O45A 5IVZA 4Z8FL 1QO3B 4PRBA 4ZTPL 5EOQH 5E94B 4OFVA 1UFUA 4V1DB 5EU4A 5F1IA 1MPAL 3JVGC 3OAUH 1WZLA 4PGBB 3U9UA 2G2RA 3DVGB 4Z7QE 5F88B 4GRWH 4M6AA 4G6FB 5KW9L 1ZA3A 2VJXA 4QXGL 4ZUTB 1IAKA 1EO5A 2NY3B 4JFEA 4WCYL 4NM8L 5IMOB 3DV4B 1WK0A 4OCYH 4QRPD 1P7KA 4Y4HB 3LDBB 4UINL 4LHJB 2OJEA 3GHBH 4MAYC 1XEDA 3O6FC 1HDMA 1KG0A 3STLA 4KC3B 3QWOB 4MAUL 3N1FC 2D7OA 4KHTH 4OF6A 3LZFH 5GRUL 3V4VL 5T33L 3BE1H 1MHHA 4HLJA 5FEBA 4DKFH 4KQ4L 2ED7A 4OF7A 1BECA 4DAGH 2KDGA 4WI4A 1P4IH 4MJIE 1X5GA 2XTJE 4AZ8A 4YDLB 1VKXB 4RFNB 2FB4H 2JIXB 5CJQH 1ZSDA 4NKIL 4AH2A 5I8KH 3D85D 1DQJB 4L3EB 1FGVH 1K5NA 2PTUA 3BAEL 5J12B 1ZGLA 2R0LL 3PWPA 3SKJL 1U8QA 3CDCA 1QZ1A 5GRVK 4M1DH 3MGTB 2FLRT 2MMXA 3EZJB 1KN4H 3WXVL 4WNQA 3MRDA 1S7UB 2QADB 2PW1B 3QIWC 2Y5TB 3KLSA 4JG1L 2XZZA 3U9PH 1R0AH 2NW3A 5EZLA 4YHIA 1HYRC 1H3TA 5J1AB 3E0GA 2COQA 5FYJD 2OR8A 4PB9L 1BVLA 1Z9MA 4GKZA 5HDBE 4ZYKA 3VI3F 1D5XA 1N5AB 1U8NB 2JJTA 5F7FA 3QNXA 1RZJH 3RKDC 1QA9B 1FG2A 2ZPKH 4C83A 1QBLL 5TDPB 2XN9D 4OLUL 2KBGA 5H94B 4OD1H 2DYPA 4GKOA 1FV1B 4S1SL 1JGUL 5KSBF 1SBSH 1G7IB 1BAFH 3DSFL 3JV6B 1YPZE 1LO5A 4Z0BH 4Z7UA 1YEDB 2BVQB 4JM2D 2HG5A 1UT9A 1X7QB 1YMME 4RWYL 5CEYA 3FO1B 3CLEL 2HFGL 3SGJC 1LO4H 3WN5A 3QBTB 3IU4L 4JFYA 4U6YB 4JR9L 4L29A 4JJ5A 3VCLA 4F7PA 5T3ZD 4U49A 4XC3H 3BP6A 2X4UA 1T2QH 4JAMA 1S7TB 1IC7L 1HKLH 3IS0X 2FSEB 5FM4A 1JVKA 1AI1L 3W0WA 2ARJQ 2XTJC 3PDOB 3WCYA 1MJJA 5EN2A 4UT9L 5DUMH 3QDMA 5I18H 1NAKH 3QXDB 4R96B 4M8QA 5HBBA 2XZCL 1ZMYA 1OAKL 3EO1A 5JPNA 3RWGA 4OBSA 5D7IB 2OTWB 3UBXI 3VGGA 1JNNL 3V4PH 2XT1B 3L3OA 4P23D 4KK5C 1RUMH 4NQDA 4OLZL 4M1CD 2BVEA 4JFFE 5MENE 3C08L 3SO5A 1PKOA 1PYWB 3OAYK 4MMZC 1CDCA 1G7HA 4U05A 4X6DF 4M7LH 2YUVA 3BUTA 3SBWC 4B50A 5HHNB 5DGRA 3CFEB 4F15C 5H37H 4LEXH 3DX8B 1N0LA 2GTZA 1EO8H 3I50L 4JPKL 3FOMA 3P4NB 3QUZC 2ENSA 2YD2A 1NANI 3MACL 4WFFD 4MB4A 1AGBA 1MELA 3MRJB 3TT3L 4LKXB 4O2EB 2Q6WA 2C1PB 4OLXL 1LK3L 5JHDD 4LCYB 4TOYH 2Q3ZA 1PEZA 1EK3A 3U1SH 4G8FA 2A9NL 4OB5H 5ADOL 2WMPA 1KEGH 1WC7A 4YNYB 2EDJA 4AMKL 4JFHE 1MFCL 4XZUB 1TCMA 1V7MH 3EUUA 3L3HA 1ZHLB 2GSGA 5FO7B 1UB5A 3CLFH 4DN3H 1XGYH 4Q9RL 4RFEA 3WFEH 3EGSB 4Y2DA 4HUKB 4G6KH 1T5XB 5B22A 5F3HA 3BDXA 5GRZA 4UTAH 1BGXL 3V7AE 2QHRH 4ZFFB 2JK5A 3QNZB 3P3YA 5C0EB 5HYSA 1MHCA 4DN4L 1LP9A 3FO9A 2VE6A 3UP1A 5E24E 2OTPA 4ZO8A 4NBZB 1ZVSA 4K9EC 5GGVL 1UA6H 5E8PB 2I07B 4MDJA 4I0PD 3T3MF 3C5JB 4NC1E 5H2BA 4MD5B 5HSFA 5MI0B 5EB9A 3KYMB 2ADIA 1RURL 1LEIA 1U8LA 5DQJB 4QRRD 1HQRB 1EJOH 1DLFH 4OJFH 1ZT1A 4O5LL 5IMLA 2NNAB 1WWBX 4MGXA 1QSEA 2CDGB 4O02H 4XCEA 5FYLD 2ZUVA 4L8DA 2C5DC 2J8UE 2FBJH 5GGRA 4WUUB 5EULV 3MBXL 2EDOA 4YO0A 4E5XA 2JLLA 5CZKA 1GXEA 1JF1B 3L1OH 1E28A 4LLQA 3GSWB 4M5ZH 4FQHB 1OT1A 1FNEB 1Z3GL 1KT2A 2F53A 5T1LA 4PJ9A 2NX5A 3QFJD 3W2DL 4ZUSA 1DL7L 5D70L 2XY1A 4E9LA 3EOTL 1CWVA 5ICZA 5TH2A 4U6VH 5J4MA 2OZ4H 4AEIL 1BREA 1TZIB 5HGDB 2V7NB 5F89B 4FQQB 4U3XA 1T66D 5F7YC 2B4CC 2F54E 1GZPB 3FMGL 1T0MB 5C0AA 2VDML 4NWTH 2A6JB 5I76A 4CMHC 2R23B 1MFNA 3HZKB 2HFFB 5L9DL 2R2HB 1AD9B 3O4OB 4JN1L 3LN5A 1TQCC 1T20A 3K2MC 3RNQB 5IMKA 4PB0H 4U2ZA 3GRWH 3DNKA 3VFSA 4CDGC 5EIVA 1UVQB 1VPOH 1MQKH 5IFAH 1V3JA 2DIJA 2V6HA 5HGAB 2DBLL 1FL3A 4NC1C 1A7OH 5GSRB 3PNWB 3PG2A 1EVUA 4TRPH 3IJYB 1EAPA 3WL9A 5T5NF 3TIEA 4FMFA 2P24A 5KS9F 5ACZB 5IT2H 4G7VH 1J5OL 1JHKH 4GW1B 3VWJD 5GJSH 1ZLSH 5DSCB 2X10A 4M9OA 5F3BB 3QEGL 2W07A 4R7NB 1JYWA 4PTTA 5BQ7B 1GGCH 1KCKA 2NY0C 4MA7H 3BIKA 3IDJA 1KB5L 3ZDXE 4LARH 3RWDB 4PGEB 3L95A 1KXTB 3MROB 4OSUH 2C3VA 4JRXB 4OFKA 4JPIA 3QR2A 4P59H 4UDUB 4XWOC 1S7SB 4OCNC 4XH2A 3UCRA 4F80A 4KRPD 3M1BA 1SJXA 2CKBL 4CNIB 1DUZA 5FV1L 4H20L 5KVMC 1T80A 5H35B 4HW6A 3WKML 3OV6A 1G7PB 2Z35B 4MYWB 3G6JF 4MD0B 1LE9B 2E5EA 6CGTA 3RY6A 5CZXD 4LLDA 5L0QB 4MCYA 5HJ3A 3KLDA 3PXJA 4WTXA 4S11A 3TZVC 4OCXH 2C4XA 5IHLB 1T0NB 5ESAB 2X4PB 3JUZA 3C9NB 4X4ZA 2IAMD 3GB7B 4IRJB 3RHWK 3GO1L 1TJIH 4GW4A 1A4KA 1A2YA 5C8JB 1OWRM 1P69B 2F9BT 3HN3A 1H3GA 3V52H 1DTUA 1MCWW 1I9IH 3MC0A 4L4TD 4OT1H 5E6IC 5C0BA 1C16A 3HHRB 3QG6A 4LBEA 5CJBA 2YMXL 1OARH 4M6OH 2H2PC 2J5LB 4X8JA 5GRJH 1WQVT 4JDZB 5DD1H 1SJHA 2AXFA 4OF3A 3VGAC 1U8OB 5DK0A 3EJYD 3MJ9A 1QO3A 5CMAA 1DBAH 3B9KD 4OIBA 2ZKHH 4X6DB 4QRRB 1EUTA 1ZANL 4G8GB 1VGEL 4PGBA 1CS6A 4QNPE 1CN4A 4OFPA 1MHPL 3DVGA 2PYED 3MTRA 1OM3H 4P2RA 4PRHD 1FL6A 4QEGA 1KJ2B 3O2DA 4AK1A 3JXAA 5JXEC 4ZUTA 2NY7L 2ADJB 1G9MH 2VH5L 5F8QC 3OR7B 3DV4A 1VFAA 1JWMA 3F8UB 4N9GB 4Y4HA 4JHAH 2AJVH 3GK8L 4J4PC 4O2CB 1J0HA 3FAWA 3EDJA 1A1MB 2IG2L 3ULSB 4YHOL 4WWKA 1BZ7B 4ERSH 3FFCE 3DUSA 2W9LA 4FG6C 2V2WB 1WZ1H 1A3RH 5L7XH 4UAOC 2EEBA 3BXNB 5E8DL 1YEHH 4NJAL 3ZKXC 3BRDA 3QI9C 4PRDB 3TP4A 4EN3C 2AJZB 4Y19B 3WDIA 3K2UL 1NCBL 3E3QE 5DUPH 2WBWB 4JRYE 5KVGL 1QR1A 1A22B 2X4RB 1CLOL 5DC9B 3N9GH 1VKXA 2XA3A 5C08E 2JIXA 2MQ0A 1ORQA 1INEH 5C09E 4HWBL 5JDJA 4L3EA 4DQOL 4XRCB 3EYQD 3HI6H 3ALPA 1T89C 1S7UA 1CXHA 2PW1A 5FK9A 3AY4C 1CFTB 2Y5TA 1A6ZB 4WW2C 5K9OB 3T4YA 1JGVL 4WFGE 1ZEAL 3SDCD 3ILQD 3MFGB 5J1AA 1HILA 4K3DL 1IFHH 4APQB 3BD3A 2W60B 4Q9QH 4DOHE 3TO4A 4RBPK 4X7TB 1B9ZA 1QA9A 2CK0H 5TDPA 4UBDD 2HT3D 5CBAB 1U93A 1U58B 1G6RH 1TETL 1FV1A 5DWUH 1IZKA 1J05A 5DHYA 1MVUB 3BKJL 3D5OF 3HC3H 3KJ6L 4FQXA 5C07A 1R3IL 3MOBL 1UM4H 4HDIB 3LSOA 2C7UB 5EOQL 3RL2A 1F4AA 2VDLL 1YECL 2FHCA 5HHXH 2E6JA 1RZGB 5F96H 1DE4A 5DGQA 3FB7B 4U6YA 4DUWA 1RIHL 2IBBA 4NKQB 3H9HB 1XCQB 1HI6B 3Q48A 4UV4H 5I1DA 4KI5F 4GRWF 1F2QA 1MAMH 3TA3B 3P30H 3UTQB 4F8TA 1SY6H 25C8H 1GGIH 2FIKB 3E3QC 3OXRB 2VLKB 3PDOA 2EC8A 1JK8B 3DO3A 4GAYA 1JWUB 1WAAA 1S7RB 4MA8H 4XWGH 2APVA 5D7JC 3BPLC 3QXDA 4R96A 3S8WA 3LMJL 3UBXA 4JZOB 2DLFH 5L2KB 4QTHB 3LZFL 2GHWB 2R8SH 4ODXB 2AQ2A 1RZ7H 1QSZA 4F2MB 5D7IA 5T1KB 1OTSC 2OTWA 4GRLD 4DKFL 4W4OA 4CVUA 2E8ZA 3MO1B 1XF3B 3B6SA 3L6FB 5CKGA 3HE6D 1HIML 3LEYL 5LWYH 4HIEB 3JWDC 2FB4L 1NCAH 3HE7A 5CJQL 5KS9B 5FKPB 3H42L 4RMTA 1PYWA 2Q76B 3REVB 3O2VH 4PRPE 4X9IA 4OZGF 3S5LB 3LIZL 3FQRB 5EC2A 1M7DB 4XPTH 5HGBA 1K9TA 3RA7H 5BV7H 2XG4A 5HI3C 1B4JL 2BSSA 4U7MA 4LKCB 3CFEA 2FCBA 2VLRE 1BLNA 5E99H 1NBYB 2QQKL 4LCCB 4JM4H 2WUCH 4Q0XH 3GM0A 4M93B 1UH3A 1ZHBA 4OAWB 2YPLD 4XAWH 3ULUD 5T3XH 3QPXH 3MRJA 1UZ8A 3LB6D 1J1OL 1JNLH 4WFEE 2YRZA 2C1PA 1TPXC 2J1KA 3CSYB 4JCMA 4WJ5B 4E0RA 3MRLB 4FQJH 4HBQA 4EI5B 3GMRA 4RMWA 3NCYP 1X5IA 1RJZB 3L3IB 3HNVH 1UXWB 2XKNB 3G6JB 1BWMA 1CDGA 1ZHLA 2YR3A 5FO7A 4LVOC 4TTDC 5JXAH 3ARBC 4KDWA 3PHQB 2AABH 2Z31C 3EGSA 2P45B 5AAWA 2EXYD 2R0KL 2XG5A 3WKNA 2VUOA 1T5XA 4QWWD 5IVXA 2A9ML 3T0VA 5DJDA 4U6HB 3CVIL 5C0GB 1B0RA 1RUPH 4PJFE 4YWGH 2HLAB 4IJ3B 4UU9B 4PP1C 5C0EA 1I1AD 4YC2C 4LLMB 3A6CH 3HKFA 4U0RC 3Q6GH 4NKMB 3IRZA 4ZXBA 3QEQE 1U6AH 5JORB 1PW3A 4OGAD 4F9LA 5I17B 1QSVA 3NACL 5E8PA 5I18L 1B0WA 2EH8L 2I07A 3VWKD 1FLTX 1QG3A 2UY7A 3QUXA 4MD5A 3SDXF 4NQTA 1U8PB 3KYNB 2VSDA 3HC4H 4KZDH 3VMPA 5FCUL 5MEPA 3T1FA 1HQRA 3BJ91 3KPRD 3OKEB 2NNAA 3DV6A 1KC5H 1F00I 4N8VB 1KACB 4KHXH 4M02A 2J2ZA 4YIQB 4I2XE 4HUWA 4M9PA 5KSAD 1MFBL 2BSRB 2JF1A 5JW4R 1JF1A 2QV2A 3F58L 4BK4A 4HKXA 4KROD 3GSWA 4GKNA 1MFAH 2PXYD 5AD0A 1FNEA 3E2HC 1VHPA 3GSVA 2YK1L 4QF1B 4NO2A 2HJKA 1S7VB 1F42A 1YJDH 3KAAA 1A6VH 1W0VA 2AI0L 5A16A 1TZIA 1CBVH 5HGDA 5F89A 4MZ3A 1NSNL 1OHQA 3KXFB 2DB8A 4IOIB 1JZ3A 2VLJE 5I71C 4EOWL 2A6JA 3CDGA 3FQXB 4AQOA 5HVHB 2XWBB 4BFIB 4GRMB 4HUVA 2ICES 4LVHC 2VL5B 1DQQB 4FMKA 3QPQC 3VXRD 4MXQC 2P42B 2FRGP 2R69L 3S34H 3X13B 3CX5J 1VEPA 3H7LA 3MLVL 5FGCB 5CP3A 1EX0A 2EDNA 3WD5L 5HXMA 1KBGL 3W0WE 3EYVA 3AS1A 4ZD3H 4GRLB 2FZ3A 2VB5A 2BJML 4U6XA 4U1IA 5D8JH 3TO2B 3IJYA 2WBJA 4DZ8B 3QDME 4WFHE 3FO0H 3HE6B 4IS6B 5ACZA 5C7XH 1CLZH 4D0DA 2YPKA 1UKSA 4GW1A 3K46A 2BDNL 1U3HD 2OS7A 2Y06H 3WFBH 5F3BA 4U0QB 1MJUL 3MQIA 4M3JA 3UDWC 4LLAA 2YD7A 4MQSB 5IOPA 3JV0A 1UKQA 5F1NB 1CR9L 3KS0H 3BP5B 1FFQA 2D3VA 4DKDC 1BP3B 1KTLA 2QQNL 3C6LA 1YEIH 5LQBL 1WICA 1HNGA 2P5WB 2ATPA 3RWDA 4PGEA 4XNQA 5C0RL 4HS3B 1EJOL 2P8PB 5J6GB 3HUJF 2R1WB 3HRZA 4RAVB 3BP7B 4DGYH 4NO5B 4WI6A 2MSPA 3FB5B 1DQTA 5E5UB 1SJEA 2RBLA 3TVMB 4Z0XA 4EUPH 2P8MB 4HH9B 5D1XD 1AKJB 5ESVA 1FNSH 3RVTC 2X89A 5EIIA 1U8MA 2VR9A 2IFFH 4GRWB 4Y4FA 1AGCA 1G7PA 2EDTA 4MD0A 4QOKE 2AJSL 1DQLH 3RWIB 1T2XA 3L5JA 3WN5C 1CVSC 2F58L 3WLWD 3CFKB 3E6HA 1UWGL 4WO4D 3O9WD 5ESAA 5EORH 4LCIL 2X4PA 1JPSH 3UYRL 3TPUB 4S0SD 3GB7A 4B7LA 4U1HA 1FO0L 4IRJA 2AJYH 3BKCH 4RMQA 4OCWL 1CE1L 5HI4D 2ZG2A 5C8JA 3R1GL 1NGWB 4XMPL 2A6IB 3OJDB 3WIFA 4GSDL 4K94H 5DUBA 1KJMB 3U36A 1OP9A 4X6BB 1CU4L 4AY0A 4G80B 2L4OA 2QLVB 4HPYL 4X8XA 5T1MA 5DR5L 4TPRL