5DVMA

Fc design 20.8.37 b chain homodimer e357d/s364r/y407a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVRLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dvmA01
1CL7L 4DCQB 2VIRB 4LK4A 1A7QH 4S2SB 1CZ8L 4I8DA 3RVWD 1G9EA 1YN6A 3CFDB 1LO3H 4GAGH 1N2RB 4WV1B 4KQ3H 4MXVF 3VFWB 4YBQD 5FA3A 1WFTA 2APFA 1J8HB 4MQ7B 3IFNH 3CVHL 3T0BA 2VKXA 5A16B 1URLA 4S1QL 1IL1B 4OFYD 1BF2A 4K3JL 3GNMH 1IC4H 3LQAL 5F93C 2GTZB 3EOTL 1U42A 5HGHB 3VFOB 3FQXA 1G9MC 3A6BH 1CLOL 4OZFH 4FQPA 1DZBA 4X8XA 3VXMB 1QSED 1MIML 4M5YH 2NY3B 3SGDH 3RVTD 5SWSE 1HDMB 5K9JL 4P2RB 3MA9H 3VXSB 3DETC 3UC0H 5ACZA 3ILPB 2F58L 3JWOL 4R8WH 3RU8L 4LP5A 2FHBA 1DQMH 2J8UE 4ZTPL 2J8HA 1M71A 4RDQF 4OIIH 4P9HL 3Q1SL 5H35B 3PWPA 3MR9B 1CDIA 5SV3A 5GRYA 4JFEE 2YA2A 1MFAL 1NCNA 3VFTB 3QB7C 4LHUB 2A9NH 3BP6A 3TF7C 5E2UH 4Z0BL 3VA2C 3PDGA 4RFEB 4D9RE 5IBUB 5E5MB 4OV5B 1GOHA 1PVHA 2RCSH 4ZOCA 5BS0E 1EO8L 3QQ3B 4UMGA 4UZGA 5LBSH 4AEHH 1G7IA 4POUB 4ZYKA 4M00A 1AR1D 1KEGH 5TGBA 4ERSH 1JWSA 2PYEE 1KPUA 1OSPL 4M48H 4I0PB 5DMIL 1NDGA 4WFHD 4CADB 4KH2A 1VHPA 5L6YL 4HG4J 5TDNA 3U2SA 1FNGA 1CT8A 3ULUH 4HJGA 4JANA 2VDOH 4HGKC 1ZVHA 1FPTH 4X6CA 5EUKB 1KCUL 4TVPE 1P53A 5J1AB 3QRFM 1GGBL 1MLCB 3TO4A 5KSAB 5GXBB 4L3CA 4NQUA 2FECI 1IAIM 3SJVE 4JJ5B 2Y06H 3PWVB 3PGFH 5B21A 1BMGA 4UV4H 3U0TB 1HSBB 1BZ9A 3G08A 4PRID 5CEZD 3O9WC 2QQLL 4XNYH 4BZ2H 3MNZB 5SX5K 1IC7L 3RWFA 4LQFL 3S96B 2UVEA 5KSBF 3MUY1 4M7ZB 3FRPG 3T77A 4LHUG 2IFFH 2NNAB 2WINA 2FYYB 3GFUA 3D25A 1ZV5A 5J3HD 1HHKB 1KTDA 5IBTL 3X11B 5BVPH 4JPIB 1IGTB 3MV8D 2P4AB 4ZO7A 1AXSA 4PTTB 2XG4A 1NPUA 4WI2A 4S0SD 5DUPL 5E94B 2PO6C 1MUJB 2V2WB 3KDMA 5D7JD 3GBMH 2IAMA 4PJHF 5GGVH 4QHLA 3V6ZA 4WW1B 4FQLL 4FZ8H 5HY9B 3F7VA 3MYJB 5CBEB 5CD5D 1NH6A 2FHFA 2VXSL 5T1KD 1JFQH 2ADIB 4ZPVA 4UINL 3SKNA 5HXMA 3UROR 3RVUD 1S5HB 4P2QA 3QQ9D 3K4ZA 1L7IH 1EUUA 1IAII 1MHCB 5SWQB 1UJ3B 4PD4J 1G7JB 1F58L 2YUZA 3DV6A 2FSEB 3HS0B 4WV1C 5FHBH 3P11L 4RGNC 4NNPH 5HHXL 2IANB 2OZ4H 1U58B 4MB4A 4LNVA 4W4OA 1MQKH 2VDLH 5DYOA 2VDNL 5DRWA 4CU8A 4IM8A 1NBVH 1N5YH 3HPLB 4PGDA 4ZOBA 5IW1B 3VWJD 1HWHB 2XWJB 1U8QB 4ZUVB 4L4TA 32C2A 1M6OB 1PLGH 1J8HE 2B20A 3CDCA 3HG1D 3T4AA 5DJDB 5EU5B 5J0BA 1QSFD 1AKJB 4CDHA 2ZCKH 1CG9B 1OB1B 1QRND 1SYSB 1FLRL 5JW4Q 3DX6A 1WQVT 2FZ3B 4KRPC 3ULVD 3TWCL 4ODSH 1DFBL 1RUML 1TJHL 3DIFB 4ZFZA 2XQYK 2VAJA 4JQIL 1CTOA 4G9FE 5EFIB 3WLWD 2KBGA 4WTZA 5T1MB 4P4KD 1EMTH 5LAXB 3IB4A 3VXME 5GZOC 3U0WL 2GSIA 4JJHA 1I3VA 2ZUQB 2EEBA 1IZKA 3PGCA 3UO1H 1PQZB 1IKFL 4P2RE 3K80A 2YD7A 1CU4L 3QEGH 5ANMA 4NZUL 4WO4B 4QGYA 1I8KB 2I5YL 1KUMA 3OB0K 3RY4A 1XF3B 5JORB 1Y18A 5I16A 3EUUA 4HUUA 1FNFA 3IYLW 2XTJE 3RY6C 3CMOH 3ZYOA 5FHAL 1BLNB 4N0FB 4XZUA 1MY5A 3TBYB 3SDAC 5T1LA 4K7FB 1JN6B 2IQ9L 1Q9LA 3QDMB 1AC6A 1NLDL 4TUOA 3U1SL 4BZ1L 5I1KH 4JAMB 1B4RA 1AI1H 2D7QA 1OPGL 4JRYD 3SDDD 4C56A 1X5AA 2CK2A 3ZE2F 4I77H 2B2XH 2FIKB 2YA0A 3WIHL 2XFXA 4L4VA 4U3CA 4NN6B 1JPSL 3MROA 1D5BA 1IFHL 4YK4B 4X83A 4Z0XA 4XBGA 2AJYH 1DQDH 4P2OA 4QYOA 1EH9A 3Q0HA 4JZJB 3H7BB 4PJ5A 5HYEA 4X7SH 3LPFA 3NMEA 2LABA 2R2HA 2EYTB 4M9PA 5J1SC 1B4JL 1YN7B 5B39A 2JTDA 4YFEA 4OTXL 5IFAL 4LEOB 3GMLB 3VWKB 4HXBH 1MI5A 2CLVB 3ZLQC 5I30H 2BXYA 1R5IB 5C0AD 1R3IH 5INDA 1AE6L 5D1XC 3SGKA 3FO0H 2YBRB 3MJ9A 4I18A 4MAYA 5KOMC 1HILB 4WWKC 4OZHA 5DRZA 3B9KC 5GJTH 3NIDE 3BW9A 5DJXA 1P7QB 3FN9A 3V5DA 1E4WL 1YNKL 2YK1H 3TJEH 4CL7A 1JI1A 3P2TA 1XGQA 3RNQA 3SKOB 2XWTA 4N9GB 3FB5A 3QXAB 3C8DA 2E6QA 3VG0L 2A74B 4JO3H 3RIAF 3WXVL 5IHBA 5EO0B 3IFOB 2X4NB 4U1LA 3VGAB 1AQDB 1O7VA 4GXVH 2OR9L 3KHOA 1FP5A 2ENSA 2H2PC 4P99A 3MBEC 5HYFA 3V6OA 1G7QA 2DN7A 2R0KH 4Q6IB 3WHXB 4NYLB 4QRQB 4RFNB 5EIIB 2XI9A 1VEOA 4FABL 4NCC2 1JCKA 4X7EC 4LLUA 2CGRH 3FCTB 5FGRA 1A4JA 4EXPX 1VPOH 3RHWF 3K2MC 2X70B 1S3KL 3UTZA 5IMOA 1XF2B 2D7PA 3KPRD 4ALAL 3PJSB 1RIHH 1B0GA 2EDDA 4YDJA 5MI0C 1Y6KR 3PNWB 5F96H 3O8XD 3V79C 2BVTA 4LDLB 2AJVH 4G8EB 4N1EA 3ULUE 2X4PA 5IB4B 2IANE 3D3VA 1A6UL 2X4OB 4KXZH 3TT3H 5EZLB 4F7MB 2CUHA 1MRFH 1SYVB 3O41A 3QJFA 1SEQH 1NANI 4OJFL 3SDXA 4V1DE 3EYFB 4WHYG 4XVJH 5EZJB 3HA0A 4QNPF 3O4LB 5HGBB 2EKSB 1B0RA 3OR6B 1FYTA 2PR4L 1B6DA 2BSSA 5KSUB 3SPVB 1ZHNB 3BIKA 1MRDH 1WTGT 2UWEF 3SCMD 4FQCL 1AO7A 2Y5EA 2FO1A 4HC1L 5EU6E 5IHUH 3E3QC 5GISL 1DVFA 1W72H 2H6PB 5FO7B 5D2LA 4K3DL 3K8LA 1RZKC 2BNUA 5IR1A 4D9LL 1KIRB 3VGEA 2C4XA 4LFHG 3V4UL 5IB3A 4C4KT 4TQEL 5HVFB 3GGWB 1AGEB 4LSRH 1FAIL 4UQ3B 4O2EB 4MZ3A 3KYOA 4AG4H 4XC1L 1XGYH 5T3ZH 4XNUL 2LAGB 2JLLA 4LKCA 2GJ6A 1W0WB 3HFML 4LSQH 4OF3A 1LD9A 4PTUA 1C16B 2UZIL 2BNRB 3RWEB 3C87A 4HGWA 4X4XB 2CLRB 3OZ9H 3EGSB 4NC1C 3SEPA 3UTSB 4MDJA 5A40E 1P5UA 1OAXH 5JPMB 1QA9B 3NPSB 3MC0A 2W60B 1DDHB 3IU3B 1A1OB 3GRWH 4LVHC 5JR1H 3QDME 1MJ7L 2AGJL 4OFYA 2A6DB 4HKXB 3RL2B 4JLRB 4PGBB 1FFOB 4YEFA 2NX5B 3CVHA 3BISA 4Y4HB 3MJ7A 2DOCA 4PJIF 4JZJC 3PV6A 1INDH 2DQGH 4I48A 3T3PE 3B83A 3QO1A 3U0PB 5IESH 2VR5A 2E8YA 1OGTA 4GAJL 3KJ4C 4Y16B 4P3DB 2AXJA 4PLNC 5EC1B 3DURB 5HVGB 5IUSA 2GT9B 4N5EC 5EPMA 3CNKA 1NGXA 2CRIA 5D7SL 4H5SA 4DZBB 3C9NA 1EXUA 1DBBL 5DD3L 5JOPD 1PEZA 1MFEH 3VXOA 4E41D 1UB6B 1ZWIB 4N8CL 5J6HA 1HEZB 2EXWD 4NSKB 3FT2B 4S10A 4NFCA 4HKZA 5JOEA 3W39B 4PGZA 5DJ2A 1TIUA 2Y5TA 1QLFB 3OJ2C 3RTQC 3EBAA 2DWEB 3WE6A 5FCUH 1R3HB 4OF0A 3SDCB 2ENYA 3P73B 2D9QB 1WTLA 3GMRB 2GAZA 4LSDA 4O4YH 3WFCL 3IRPX 1OSZB 2MQ3A 5FUZH 5FGBA 4JHWH 1VB9A 3MLWL 1KCSL 2QHRH 1ZTXH 4UQ2B 1FRGH 1CXFA 5AYQA 4NWUL 5IGXL 1YEDA 3NH7L 2AKRB 2CK0H 3IKCB 4PY7B 3VXRB 4AIOA 5C0FB 4H0HB 3U7WH 5JDJA 4IRSA 3GBNL 3DMMB 1C5BL 3QSKB 3WS6A 3V7AE 2Z4QA 3MOBH 1WZMA 1KJVB 5D6DA 3UXFA 1ITCA 2B8OT 3FTGA 5HI5D 4WI8A 3QHZH 4HS3B 3IDYB 5D7KD 5FDWB 3ARFA 3LV3B 2SEBB 3E8UH 1I9EA 2HWZH 3IDXL 4F7TA 3HUJA 3LY6A 2DM7A 1H3PL 3ILQD 1FV1A 5ESQA 3M8OH 3VXTB 3G5XA 3QUMA 1MFDH 4EBQH 5K59F 1NCWL 3U4BL 1IAOA 5E1AA 5JW4N 3D0VA 5EOQH 4R7DA 2VDKL 4PRAA 4ZAKB 1I4FA 4X9FA 3L3GB 3L5XH 1MHEB 3K4AA 3GK8H 1NMCB 1BGXL 3AXLA 4ONFL 4IOFD 3OV6A 1EBPA 2YXFA 4NUJA 4OIBA 1HN1A 1UGNA 1R5WA 3CCHB 1J7VR 3GDBA 4ZUWA 4HKBB 1KPVA 4EN3D 3MV8A 2J8OA 2E3VA 1PJ9A 4OB5H 3GMMA 3G6JB 2H3NA 3O4LE 1KCVH 1CGUA 2D0HA 4ODBD 4ZFFB 4D3CH 5D7JA 2HTKC 1JNLL 4FS0A 1UXSB 1CTNA 2Q76A 2Q8AH 1AHWC 1IBGH 1U8MB 1ZANL 4F7EB 2ED8A 4ZUUB 5T1KA 3MUHL 4ZD3H 5A2JH 5A2FA 1FSKB 4W81A 1NGYB 1FJ1B 1HXYA 3QWRD 2P5WB 4AYFA 3HB3C 5DK2B 3BH9B 1MAMH 2DQHL 5TJWK 3K81A 4YHKH 4F7CA 1GHFH 1RUQL 3GI9L 4I3RL 1LDPL 2QSCH 1CFQA 4G7VL 5FO9A 1FG9C 4Y19A 1JMXA 2MQ0A 1M7IA 5KBNC 3UTSE 3VWJA 5C09E 4QY8A 1U91B 4O5LL 3MGOA 1FBIL 5K33A 3IDMB 3HG1A 2N7AA 4MNHA 2P24B 2BVQA 3K74B 1QRNA 1IGYA 2FJGB 3QISA 3TPUA 3MMEA 2NX5E 5F9WC 1MREL 1ZHBA 5IWLC 4NJAH 4YR6B 2WW8A 4AEIH 1BD2D 2Z92B 1NL0H 4NCDA 1ORSA 5LVEA 2Y36H 3TVMD 1FGVL 2IBBA 3OAUL 4XPBH 4BJLA 4MNGE 4JHAL 1NEZA 4PV9B 1CF8H 4X4ZA 3QH3A 5DUML 5IJVB 1DLFH 2AK4E 4CVUA 3CXHK 4QHNB 4OF5A 4OLVL 3L1OH 5EC2A 4U1JA 2IG2L 5HHQA 3EIFA 4NM4H 5GIRA 3ZDYE 1FL6A 3Q5YA 1RY7B 4LCUA 4U6YB 4XVUD 2LTQB 3MRPA 4NZRH 1J8KA 3VJ6A 1U8HB 3WBDA 5FDYA 4PRBA 1QBAA 2QADD 1QHPA 2CO7B 4LL9A 5D1ZD 3LB6D 3VDAA 4P9MH 2BRQA 4NNYA 2EIZB 3QCVH 4HWZB 4WCYL 5D5MF 2HLAA 4OUUB 1G7HB 4XPAL 2JCCB 5DEGA 5CGYC 1OTTD 3OAYH 4QHKJ 3T0WA 1T21A 5C6PB 3MLSH 4AT6A 2DWDB 2HMID 3QUXD 4Z7WF 4JRYA 4YPGB 5T3ZE 4L8CA 2HG5B 2W0FA 1A64A 4G43B 1TETL 3FQNA 4PPTA 4E5XA 2XIDA 4UT6H 1UFUA 3BPNC 1WK0A 3CH8A 5GS2D 4WU5B 2E7BA 3WIHA 1HE7A 1U3HA 5E2WH 1TCMA 4ZOEA 1T0NA 2PXYB 1A6AB 4EI6A 4UTAH 3MXVH 3N85L 5E0QA 4NRZA 1Y0LB 4RIRB 1N4XH 1KTLA 4LVNC 2Q7YB 4NBYB 4FP8H 8CGTA 2YA1A 1PKQE 1MWAH 2F54A 2AJXH 2ZSWA 4KV5E 3K3QA 5CMAA 3BZDA 2VZOA 4KZEH 4Y5XA 3UBXB 4AQ1B 1T04B 3WNNA 3SE9L 3TH2T 4XVTL 1YUHA 2FBJL 3BKMH 1CXLA 4DK3A 5I6XB 1FGNL 3BQUD 1UM5L 2H32A 1Z0NA 3VFPB 4XTRC 4NQTA 2C4FU 5DZNA 1DQLH 1X6NA 2V7NA 3OG4B 5BRZB 3HRPA 3MRBA 3PWLB 3MLVL 5BZWA 5HYSG 5F88B 1HYSC 3HZKB 1U2HA 1KSRA 1EGJL 5I8EA 4OCWL 2BJML 3MCKB 2OP4H 3QNXB 5HVWA 3G6JE 1UWEH 5CJXC 2OTUB 2HFGL 2D31B 5SWSD 2YD1A 5HPMB 3ARED 1FN4B 1YECH 4MXWH 1F42A 3DJ9A 1G9MH 5MERA 2O5ZH 1I8LC 3QRGH 3RUGB 1XGRB 1K2DB 1X5FA 4YIQB 2APVA 2R0WL 4GMTL 2QQNL 1N6UA 1YDPB 1TCRA 4Q0XL 5E4EB 3MLTB 1UH2A 2P5WE 4HT1L 4LOUD 1MCLA 2FWOA 2EXYD 3D0LB 4HH8A 5EU4A 4XP5L 1A3RH 5TPWL 1NAMH 3UBXG 3W11D 3BKCL 5TE7H 1CVSC 3O8XA 5J6GA 3RAJL 4OFVA 3T0EB 4R96B 3DHMA 2EYRA 4C58B 4BQCA 3X3GL 1OGAB 4NBZB 3GSRB 5DK3A 2COQA 5E9DB 5ETUA 5L0QC 3S88L 1KTKE 4ESKA 5C0GB 2ICCA 2HTLC 4WI5A 5EBWA 2CKBH 4GG6B 4F2MB 3FO1B 4TVPD 4HIXH 4WTWA 2ATKB 4YFDB 5TE6H 1MJUL 3ZE0F 4EDWL 3HI1A 1Z5LB 1Q9OA 4X6BA 3MRDA 2X4UA 3CH1B 4Z7OE 2HJLB 3QXTA 3SJVD 1IGML 2VXTL 2KPNA 5LQBH 5E08L 4PJDE 2DL2A 3MO1B 2ZOLB 3SKMA 1DP0A 2LTQC 1NSNL 1AIFA 1LGVA 1YNTA 3C8KA 3EFFB 1UQSB 2EYSA 2Y72A 4HWBL 3QDAA 3TBWB 3CPLA 3V4PL 1WFUA 3PWNB 5GGTA 2ORBL 1AH1A 1MF2L 4LNRA 4KWUA 4NQSA 4PRNB 2BSRB 3MV7D 3CFCH 5IK3B 5CSBA 2F53B 4HUVB 4BUHA 4LRNH 1KLUA 5KVEH 4KUZL 2DTSA 4N90D 5CGTA 3TN0B 4UNVA 4KJPD 3ROOB 3O11B 3TA3D 4Z78A 4GW4B 5CJBA 4P4RB 3NVQA 1EAJA 4MD4A 1K8IA 5FF6B 1NCCL 2JCCE 2FATL 5KG9B 3TH3T 2HJKB 1CGYA 4I2XA 1R24A 5ESAA 4XHJC 1ZVYA 3TO2A 2BXZA 5C08B 1NDMB 5ICZA 3P4OA 3BJ91 4IDJL 5IQ9A 5LWYH 2E27L 4QXUH 3TBVB 3TYGH 1LK2A 1RZJC 1BFOA 2OI9B 4YUEL 3C60B 4YWGL 4F9LC 5KW9H 4JY6B 4L3EB 5CIPA 4L5FH 3CDYA 3NFSL 2H2SC 1K85A 2VDPL 2EC9U 3SE3A 4EUPB 3Q6GH 4RRPG 4RNRB 2F5BH 3VFNA 2LAAA 1JNHA 1P7KB 1LO0L 4E41A 2JJWA 4KGLA 1E6OH 4PS4H 3KLDA 5JQ6H 4HDIA 3WSQL 2OSLA 4JM4L 3LKOB 1HIMH 4PJBB 3OXRB 4WDIA 3RBSA 3U46B 3GUTB 2N56A 2NXZB 2VLKE 1UYWH 1R3KA 5MHSE 1ITBB 3EYSL 1Q9KA 2EIDA 1HCFX 3SGDI 3L3DA 3WDHA 1J8HD 5IF0B 4PLJD 4FQXC 3C09B 3GIVB 4OKVA 3MRMA 5ERWA 1FZOA 5I66B 2ERJB 1ND0A 4QXGH 5EULV 5H94B 3MJ6A 5BRZE 2E7MA 2OYPA 2ARJA 3D69A 5FFLA 2WBKA 3VRJA 1SEBA 1L6ZA 2ICEB 1KIPA 4XAWH 1INQA 1G7LA 3VXMD 2Y4SA 2R1WB 4X4YB 3NABH 3KPOB 4OQTH 2NY3D 3DX7A 1ZT4B 1N59A 1BZ7B 2O26U 4PJ7B 4P2RD 3MLZH 2J6EL 3VXSD 1RD6A 1KPRA 2FX8H 4HWUA 2L7UA 5E24E 1GPOL 3HMWH 4X80H 4XNQB 3RUGE 5GGQH 1XIWC 3P0YL 5JUEH 2JB5H 4AEFA 2X4RA 2IALB 3PP4L 2GTWA 3QHTC 1CD9B 1R3LA 1RZGA 2V9QA 1JV5A 3HLAB 2BMKA 3WUZA 1KCRH 4XCNB 3BD5A 5I1IL 2CD0A 4LHUD 4JVUA 3JTSA 1F6FB 2NY1B 5EORH 2VN7A 3RWHB 4X6FB 4OLXL 4OD2B 4BELD 3T0EE 3GMQB 1RIVL 4BFEA 5FB8A 4AMKL 2JJVA 5FKPB 2FD6L 4EN3A 5EZOH 4NWTH 1Q9WB 3OR7B 1JPGB 3LSOA 5DJCA 2B7DT 1A7QL 5E00A 1LO3L 4GAGL 4KQ3L 4Q58C 4I0PD 4NZJA 3IFNL 4LBEB 4OZIF 1U8PA 2AP2A 4G3YH 4G8FA 4GS7C 1MVUA 2XKNA 3Q5TA 2CRYA 4L4JA 1IAMA 1F4AA 3GNML 1IC4L 4APQA 5HDQH 4BK5A 3ZT6A 3ZKNC 4YNYB 3G5ZA 5KSAD 4AEEA 1EHLH 1VADA 1Z6JT 2JJTA 2J7LA 2FR4B 5I1EH 4LLQA 2IPUK 3A6BL 3QWRA 5HYJE 3IGAB 4LCCA 4DGIH 3W0WB 1J1PH 5CBAA 4TTDC 5DRXA 4XH2B 4M5YL 1RZFH 3DBXB 3MA9L 3I9GH 1NQBA 4M7JH 1CDYA 3HC3H 3UC0L 1JTPA 1MCQA 4IHOA 4KY1H 4PR5A 4LRIC 2VISB 1QFWM 5F8QC 1QLRA 4LGPB 4Y4FA 1JK8A 1CLCA 4R8WL 2F53E 3VFRB 6FABH 1DQML 3VE0A 1R0AH 3HAEA 2ARWA 1D6EA 2FL5B 3VRIA 4OIIL 4F3FA 4NT6A 5IVZB 4UT7H 4Y4KB 1TNNA 1T5WB 2P8LA 4FOMA 5C2BH 4KDTC 5EU7C 4ZUTA 3IJYA 1EEZB 2A9NL 3C60C 5E2UL 1CCZA 2XOTA 3DROA 3GSQB 4C83B 2DLGA 3MRKB 2FCBA 1CFNB 2RCSL 2ZSVB 4P5TB 5K9OA 5LBSL 4AEHL 2AQ2A 5KVDH 2IQAB 1XGTB 1KEGL 3IJHA 4L3EE 3TVMA 4ERSL 4M48L 1TQBB 1X7QA 4X8JB 4JREB 3GJFK 4J3WA 5L8KB 3ULUL 2VDOL 1M7DA 1I9IH 4HMDA 4L9LB 1FPTL 5FYKU 3L7FB 3MV9B 5D2NC 5B3JF 5J57B 1WC7B 1P6AB 4BZYA 3EJYC 1ZHKA 1JGEB 2X4QB 2IAND 2Y06L 4PJBE 5CZVH 1QEWB 5D1ZA 3PGFL 5EUOF 1G1YA 3DUSB 4UV4L 5JQHC 4MCZA 1QFWI 1GCFA 2ZG1A 4WW2A 2N1KA 3BWAA 3VXPB 2WIIB 4KKBC 3AAZA 3GSWB 4P0DA 2B1AH 4XNYL 4BZ2L 5CWSB 2V5TA 4P59H 1T1XA 1AKJD 1RJYA 4JZOB 2IFFL 5TQ0H 2V2TA 4PJFA 2YPLB 3X14A 3DXAB 4FA8A 5BVPL 1FVDA 1D7FA 4UNUA 3I02B 3QZWB 5ADOH 4MS8D 4RGMB 3FT4B 4IRJB 1HI6A 5I1AB 3KNBB 3O6FB 4HFWA 1K8DA 1S8DA 2WWKO 4KI5C 2R15A 4PJ7E 1RZKH 1NCAH 3GBML 4WI6A 5GGVL 3I3EA 5GRXG 2DLHA 1ONQA 2PYFB 4FZ8L 4WO4D 3QJHA 4H1LA 4NO2A 2BVUA 4JFFE 1JFQL 4XXDB 1UWXH 5E1HB 2X1OA 3T8XB 1U8LB 1BREA 3MA7B 5J1TC 3NPZB 3C6SA 3NCEB 3M17A 3QEHA 1L7IL 2FBOJ 1IEAB 2W9DH 1YEEH 5HPOA 3QDMD 3QDJE 1KYOJ 4NP4H 5FHBL 3RWGA 4NNPL 5GSRA 4O2CB 2OZ4L 4K7PX 4Q2ZB 1DQQB 1MQKL 2VDLL 4FQIH 1N5YL 1NBVL 1KB5B 3OG6B 1ETZB 5INCB 4PJ9C 3JTTB 1HK6A 1KULA 2C3VB 3WMSA 1BM3H 4NO5A 4J4PA 5SWSA 4UU9A 1PLGL 2AV1B 2HJFA 3AREA 3LEXB 4G8IA 1A02N 3EO9H 4HIJA 1PG7W 4JFYA 3WEXA 2ZCKL 3U4AA 1W2KT 4KAQH 4JY4B 1BQUA 3DX8A 1DN2A 3X3FH 1N7MH 2Y1VA 4UTBH 1JWUA 3QIUB 3LDBC 2P8MB 1U8JA 3VWKD 2R39A 4ODSL 5HGDA 1FFNA 2J8UA 4HWNA 4KQ4H 4TYUA 1EHAA 1FNAA 4DVRH 1KGCD 4N5ED 1JVKA 4KKAD 1EMTL 4OFKA 5FA3B 2X05A 4JFEA 4PP2B 4YH6A 1ROWA 3UO1L 3BE1H 3F12A 2IADA 3C5ZB 4YXHH 5FUOH 3QEGL 5CD3B 3QWOA 5ALBH 3RX5A 4XWOD 1P7QD 3GB7B 5BS0A 2C3XA 4WEBH 2EICA 3CD4A 5GS1C 2JF1A 5DQ9B 3CMOL 5CJOH 3SHSA 4FG6D 2BVYA 4Q9RH 2PYEA 3G9VA 5EIQA 2NTSP 4P5TC 4MCYA 5DO2C 3WJJA 3U79A 3RWCB 5I1KL 4DEPC 1UKTA 7CGTA 4DGYH 4H0GA 4RX4D 3MGAA 1AI1L 4ZODA 1T1WA 2WSKA 15C8H 4LFHD 3SJVA 3WN5B 4I77L 2B2XL 4HIHA 3ZTJH 2WK2A 3PWPB 4HLZG 4L9LC 4OZGF 1ZLUK 3PHQB 3ME0A 2AJYL 1DQDL 1HNGA 3ARBC 3FQRB 2VLJE 4YQXH 4EI5C 1DBMH 4X7SL 1XGPA 4K3GA 1NBZB 4DW2H 1H5BC 1F02I 4HWBA 2OR7A 5IIEA 4HXBL 5FKAA 4J1UA 3KPPB 1XR8A 3QR2A 5DSCB 5I30L 1GC1C 1R3IL 3BZFA 3TA3A 1OARH 2RHEA 3SKUD 5SX4H 4MVBC 3FO0L 4YGVB 2VLME 1U92A 1EAPA 3TNMB 4NHUA 2Q6WA 2UY7A 3BYTA 1FNGB 1CT8B 1UJTA 2I60H 2XXMB 3O4LD 4HJGB 4JANB 3IFPB 1HHJB 3FO2A 5GJTL 4JFQA 4EZMA 1ZOXA 3HZYB 1F4XH 4GRMA 5JLZB 2A0LD 3UMTA 3OPZH 4YDLC 2YK1L 3TJEL 1CVRA 5FK9B 2MCPH 1TZHA 3DVNA 2YPLE 1MCJA 3DXAE 1BPVA 1JHTA 2HN7A 3RKDC 3V5KB 3EOAA 4X9IA 1BZ9B 2XXCB 3G08B 4JFOB 1H0DA 4JO3L 3IFLH 1X5KA 3MXWH 5BMFH 4U3HA 4M1CD 4PJXB 4GXVL 3RWFB 3PL6A 3W5NA 5CEXB 5CEYA 2VITA 3MODH 1A6TB 4OD3H 4Y2DB 4HG4K 5IOPA 2R23B 3GSVB 2R0KL 1XCTB 3HB3D 3RPIA 4MQXC 2BNRD 1KTDB 5TH2A 4U33A 1TZIB 1WBXB 3DVFA 1T2XA 4QRUA 4JG1H 2IPKB 3BO8A 1AXSB 2CGRL 2ZOKB 4MJ2A 1VACB 3V4VH 4DCQA 2VIRA 1VPOL 4S2SA 5E99H 4LLDB 3CFDA 1N2RA 4HJ0C 3VFWA 1YYLH 1J8HA 1OWWA 4MQ7A 3KDMB 1RIHL 3CSPA 3S3SA 4JRXB 5A16A 4G80B 5LGHH 1IL1A 3V6ZB 5F96L 5KAQG 1SMOA 5CGMA 1A47A 2AJVL 2ZZUT 4PJCF 3RGVB 1MEXH 4R2GB 2GTZA 2C4FT 3EJJX 4XI5D 3TT3L 3VFOA 1MRFL 1V5JA 2P5EB 4Y4HD 2F74A 3G6AA 3SKNB 3Q5OA 1SEQL 2D2OA 4PUBH 5B38B 3DECA 1WUNT 4P2QB 3VXMA 4XVJL 4Y16D 2X1WL 3R8BB 3ULSB 3V2AR 4P2RA 3MRIA 3DV6B 1DE4B 1MRDL 1RK0B 4HAFA 5DMGD 4RMRA 1JIBA 2XICA 5IHUL 5ID1B 3ILPA 1SBSH 3GSOB 1W72L 1OT1A 5DYOB 5DRWB 3TP4A 3QXWA 3INUH 2IBGA 3MCG1 3FAXA 3STZB 1FAKT 4LEXH 5H35A 2R9HC 3FL7A 3MR9A 4L4TB 4NKOB 4LSRL 5F6HJ 1NJ9B 3B9DA 2VLLB 3SDCD 3T4AB 3G6DH 2DIAA 3F65A 5HI3C 3WFBH 3VFTA 4AG4L 3FHAA 5T3ZL 1XGYL 4PRHB 3SE8H 3TEUA 5IW3A 3ARPA 1WWBX 1PDKA 3WIFB 4LSQL 3T1WA 1GH7A 3DX6B 4EVNB 4RFEA 5A3ID 4OV5A 1L4IA 3E3QE 4ZQKB 2ICWJ 3KJ6H 4PD4K 5C8JA 3OZ9L 2Y7QB 1QBBA 2HT2C 4ONGH 5I8CA 1NGWB 3REVA 1GAFH 1UZ8A 4NJ9H 3RIFF 1CDGA 1OAXL 3VXRD 4JKMA 3PGCB 1E6JH 1YC8A 4CADA 3DMMD 5HYIA 5GRVL 5JDSB 2NY0C 3GRWL 3BT2H 2X9YA 5JR1L 4U1SA 4FTVE 5EUKA 5J1AA 4F33B 3S4SB 2DI9A 5KSAA 4HUUB 4FQQA 2AJ3B 2P49B 3OL2A 1INDL 4JJ5A 2DQGL 4ZNEE 3PWVA 5IESL 3RI5F 1JP5A 2H26A 1HSBA 3VRLF 4PY8J 5DQDH 1Q9LB 4D9QE 4HHAB 4YHZH 1TTFA 4ZAKD 3MNZA 2H45A 3CFBB 4JO1H 3S96A 1MFEL 5F3BB 2BNQB 4C56B 5D6CB 5I73C 3F5WA 3MFFB 3LKPA 4MHHG 4HJJH 4HV8A 1C12B 1I9JH 3T2NH 3OMZA 1KXVC 1JZ7A 4JPIA 4LP4A 3KS0H 3EKCA 2HT4D 3TO4C 2XQYG 4PTTA 3D48R 4KKCC 4XX1E 5FCUL 3W5MA 4WTZG 5E94A 4PJ5B 1QR4A 3E1F1 3SY0B 2ZP0T 2R2HB 4O4YL 5DA0B 1RUAH 1MUJA 2JK5A 2V2WA 3RVXC 3CK0H 3WNPA 5FUZL 4JHWL 4DVBB 1XCQA 1HYSD 1PAMA 1KN4H 1KELH 4PJEE 4NZDA 5JXED 5HY9A 2NY4C 2QHRL 1ZTXL 4XT1C 3MYJA 1FRGL 4GLRH 1IEBB 2AEPH 2CK0L 4JCLA 4ZSOB 1BVLB 5I75B 3QIWB 3S4SG 3U7WL 2P5WD 2XN9B 3BOVA 4FMKA 2NYYC 3MOBL 4M6AA 5SWQA 4PJXE 2EC9T 4DAGH 4GBXB 1MFCH 3REWB 2P1YA 3TCLB 3BW9B 1UJ3A 3LVEA 5DJXB 1G7JA 1IMHC 3QHZL 3NCJH 4LLAA 4JM2B 2FSEA 3E8UL 3HS0A 4QRPE 2HWZL 4Y1AB 3WDIA 2XWTB 4RZCA 4Z95H 2IANA 2OQJB 1A3QA 1T83C 2IAMC 3M8OL 3UZVB 4K71C 5AD0A 1MFDL 4ACPA 4EBQL 3HPLA 2A83A 3HMXA 4V1DA 3ECBA 2XWJA 2EDTA 4YZFE 1U8QA 5EOQL 4ZMAT 1OP9A 4ORZC 1FIGH 5C0BD 5AAMA 5DJDA 2I07A 1MHPH 3L5XL 1CICA 5C0RH 3GK8L 1CG9A 1OB1A 3DYOA 3NACH 1K4DA 3BGFC 4BKLB 4CN4A 5EU6A 2FZ3A 4BUGA 5DS8A 1PEWA 3DIFA 4LLUB 3MGTB 3K1KC 2P5EE 2ZUWA 5T1MA 3FN0H 4HPOH 4OB5L 5IMOB 4LF3B 4W4OC 1KCVL 1C8PA 4R26H 1PQZA 4YDJB 4D3CL 1BWWA 4YBLB 3PHOA 1X5ZA 5BQ7B 1KBGH 4FQ1H 3T0DA 2Q8AL 1IBGL 4WO4A 4Q6YA 5TDPA 3Q6FB 1CDBA 3O41B 3QJFB 4G6AC 5A2LH 4ZD3L 4EXKA 5KAQF 1N6VA 4X7DC 4X6CF 2A6IB 1MAML 3VGBA 1KG0B 4BH7B 5KN5B 1FYTB 4K7FA 4YHKL 2PW2A 2DQFB 2ARJQ 1NLBH 3QDMA 1XEDA 1GHFL 1AO7B 1R3JB 4NC2B 2QSCL 5FIEA 5HYQA 4JAMA 4R4FH 2EDQA 3QUZB 3DGCR 2DLIA 3WFDH 2FIKA 3H0TB 3IF1A 1F97A 1HKFA 4L8DB 2OZ4A 4MSWB 3S35H 1RZJH 3H7BA 5TE4H 2PXYD 4P46B 1NBYB 5IVNA 1YN7A 2M2DA 4LEOA 5JZ7C 3GI8H 2H2SD 3VWKA 4NJAL 1OLLA 3QWQB 1GGCH 2CLVA 4G9DB 4AEIL 1NL0L 2B5IB 2ILLA 2Y36L 5FYLH 3U36B 4XPBL 3SOBH 5FV2A 3X17A 4Q9BA 4U1IB 2R69H 1CF8L 1HILA 4M8VA 1DLFL 3L1OL 1JRHI 4WGWB 1CXIA 4NM4L 2NTFA 3CVHB 3FONB 4OCYH 2FEEL 3HCVB 2AEQH 4P2OC 2BNQE 2BHZA 3MJ7B 5DC4B 4NZRL 2XWBB 1N0XH 3PV6B 4FN0A 1MFBH 3KLAB 3WLBA 1JYWA 3QCTH 5F1OB 5BRZD 3SKOA 4N9GA 3QXAA 2NY2C 1E28B 3MRRB 4P9ML 5E8DH 1EFXB 2WP3O 3QCVL 5ICYB 3KS0J 2A74A 4FZEH 2DBJA 5EO0A 3EYQD 3IFOA 2X4NA 4ZPTA 5EPMB 4BQ8A 1NGXB 3C9NB 1Z9MA 3SGKC 2NXYC 5I75C 3N0PB 5J6HB 5D7LE 3MLSL 4RX4A 4K94H 4I18C 3WO4C 4MAYC 4Q6IA 4N0CC 4QRSA 4QRQA 5EIIA 1ADQA 5LG1A 4I4WB 2DS4A 3L5WB 4KROB 1ED3A 1BBDH 4A6YH 4JVWA 2ZJSH 2YD8A 1EO5A 4GW5B 4UT6L 1UADC 4ZSOE 3WE6B 3FCTA 3CZFA 2C1PA 1WBZA 4JHBA 5C70A 3ZE1E 2XN9E 4R90H 2XACC 5EOCH 2X70A 5E2WL 1XF2A 5LCVH 1XIWD 4UTAL 3UAJD 4UBDD 3MXVL 2R2BB 3PNWA 1F3JB 1N4XL 5DJYA 3CX2A 4FP8L 4Y1AE 5D7IB 5BOPA 3O2WH 3T0ED 1MWAL 4GRWH 3NFNB 5IB4A 5IFJA 4OCLC 3H8NA 2X4OA 1S9YB 2AJXL 4F7MA 5EZLA 5DMKB 1KV3A 1SYVA 3JWDC 5E7FA 4KK6C 3V6OC 4JO2H 5K9QI 4KZEL 1OGAD 4IRSB 1MHHB 4BQ6A 2ESVD 3EYFA 5E9DD 5EZJA 5DFVD 3FB8A 3O4LA 4X4ME 5HGBA 3D39B 3BKML 2NZIA 3QXUA 3OR6A 3FTGB 1QSZA 5KSUA 3SPVA 3ARFB 8FABB 2R29H 1TVBB 3HUJB 1DQLL 1ZSDB 4ODUB 3QCUH 3U82B 5ESQB 2H6PA 1K4CB 1KIRA 1QPXA 5E1AB 2Y6SD 4UDTB 3D0VB 4OAWB 4R7DB 2OP4L 4U7KA 4UQ3A 1UWEL 2PCPA 4PRAB 3IDIB 3T3ME 1YECL 3AXLB 4MXWL 5BOZG 3WYRA 1BWMA 1W0WA 1G9ML 4K2UH 1C16A 3KPSB 2O5ZL 3DGGB 5DFTA 3QRGL 5EO9B 4X4XA 2F53D 2CLRA 3ZKQD 2FGZA 4HIIA 1OTSC 3UTSA 1UA6H 1A0QH 4HUMB 5JPMA 2H3NB 1DVFC 2HRPH 3BH8A 1QA9A 4UUJB 1LE5B 2W60A 3IU3A 1SJVA 4A6YB 4K9EH 1A1OA 4QHUB 1A3RL 1FCGA 1U8OB 1NAML 2Q76B 3CU7A 4NHCH 5C0NC 2A6DA 3L3JB 5DJAB 1A7OH 5DUBB 5TE7L 3AS0A 3RL2A 3TH4T 4PGBA 1JTTA 1CGWA 1TENA 2NX5A 5C08D 1AXIB 1GGIH 4C59B 1FZJB 3B9VA 2VUOA 2D7NA 1RJZB 3ALPA 4OZHF 5KJRH 3C60D 3JWNC 3U0PA 4L3ED 1FQ9C 4Y16A 4MNGA 4P3DA 4FFZH 1C5CH 5K93A 3DURA 1WFNA 2GT9A 2CKBL 3NFPB 3RVWC 5T33H 4DZBA 1CFQB 5IVXB 3IRZA 4Y19B 1UB6A 1ZWIA 4HIXL 2FH6A 4XPHH 4E42A 5TE6L 1HEZA 1NGPH 1W0VA 3B43A 4NSKA 4AIZA 3W39A 5LQBL 2NXZD 3MGOB 1O5DT 1QLFA 1VA9A 2DWEA 5H2BA 1R3HA 4WUKH 4MNHB 3QFJD 3AY4A 1MELA 2CLZA 3GMRA 2EDEA 3QEUB 2XKUA 3KYNB 1EERB 1OSZA 3LQAC 2E7HA 3D18A 4XVSH 2P48B 1F3DH 1U3ZA 3CFCL 4YBHA 1H3GA 1KIQB 4NO3B 4Y2OA 4UQ2A 4LRNL 5KVEL 3C6LB 4K7PY 1RVFH 4MA7H 2AKRA 3IKCA 3VMNA 4PY7A 1UT9A 5F1SA 2Z91B 2H9GA 2P7TB 3ZDZE 2A9MH 4OI7A 3DMMA 3S6CA 2VDMH 3C5JB 3LKRA 4U1JB 3JWOC 1YJDC 4I1NB 5GIRB 3OX8B 4DFIA 5D1QB 5GRVK 5LWYL 3EHBD 4X6DE 2SEBA 4QXUL 3VGFA 1QFUH 3DRTB 1NGZA 3SDXF 2OL3H 1PKQA 3TYGL 4MLSA 3SO3B 5FGBC 5KW9L 4YAQB 3VXTA 1L9NA 1PG7X 4NNYB 4L5FL 1J87A 3AB0C 3EW3B 1MCKA 2J4WH 4RAVA 3BWUC 2AERT 3QUYA 2VMFA 3Q6GL 1TPXB 3U48A 2F5BL 5EOCJ 5DEGB 1QLEH 4YE4H 5HI4D 4YHNB 2AXGA 4ZAKA 1T21B 2WQ8A 5D2LF 1L7TH 3L3GA 1MHEA 4IRSC 1E6OL 3F7YB 4PS4L 3WS6C 2QSQA 2NY1D 1FORH 5JQ6L 4AM0B 3GEWB 4QHMB 5D7IE 5D6DC 2EDJA 4E5XB 2R0LH 3NZHH 4PB9H 5I1GH 1HIML 5L8JB 3CCHA 1V3JA 3CFKA 1UYWL 4QOKE 1PZ5B 3F7QA 4IJ3C 3UCRA 1T1ZA 1SHMA 4MA8H 1T0NB 2CDFB 3G6JA 1VFOA 4YFLF 3D39E 3QP3A 4AQOA 4ZFFA 4XP6H 3BI9X 4HK3N 4NRZB 4PJAE 1NEZG 5I8KH 1UXSA 3S37H 3H9YA 2F54B 4YC2C 1HNFA 4QXGL 2A6JA 1U8IB 2ZSWB 4QRRB 4Y5XB 2P5WA 2EEAA 4ZFOL 4XAWL 3W0WD 5J3HC 5DK2A 3BH9A 1YUHB 3RA7H 1OAZH 3NABL 3QNYB 4OQTL 3MLZL 1XR9B 2FX8L 3KPSE 5E95B 4AENA 3HMWL 4X80L 5GGQL 5JUEL 5FYKD 1T4KB 2JB5L 5D7JC 2OXGA 4XCCH 5FGCE 4JPVH 1A6PA 1DBKH 5CD5C 3O2VH 2ITCB 3KXFB 1E4KA 4LPTA 1U91A 1T89C 4H25A 4U2ZA 1ZKAA 3K7UA 1KCRL 3IDMA 1Y6NR 3O4OC 4JPWH 2LE9A 5DRNA 3RVUC 4LCWE 2BOBB 3DSNA 2Z8RA 5MERB 1G7MB 3HNSH 3QQ9C 2FJGA 5EORL 3BFOA 2EE6A 3AS3A 5B8CB 1U3JA 4YR6A 4P57B 4P5TD 5DO2D 1TCRB 5DK0B 5EZOL 2Z92A 4NWTL 3MBXH 4DGVH 3BDYH 4GRWE 5EU4B 4MA3B 3VH8B 1MCSA 3HPJA 3MLPA 2B4CC 2X4SB 3MX0A 1RU9H 2DD8H 2E9JA 4G3YL 1G6RH 4LAJH 3VWJC 3TGXA 3D85A 1LMKA 1OP3H 5TF1H 4U6YA 1WIOA 3MV9D 5HDQL 4HULB 3ARUA 1U8HA 1EHLL 4EQ2A 5I1EL 3MREB 4DGIL 4NFDA 1CBVH 4ELME 1J1PL 4F15B 2VLMD 4MQSB 4FQ2H 1G7HA 4WEUD 3BRFA 2JCCA 1RZFL 3HUJF 3WLWC 4BSWA 4X5WB 4P4KC 3H7LA 3I9GL 1GC1H 4M7JL 3HC3L 4NUGH 1VESA 5I15H 3MZTA 4KY1L 2DWDA 1Q9OB 1CXKA 3MRDB 6FABL 1RZ7H 2HG5A 1M4KA 1P4BH 2YPLD 4G43A 1R0AL 3DXAD 3E2HC 1Q0XH 3GMOA 4UT7L 1ZK9A 2IEPA 5ISZB 1A4KB 5I71B 1AIFB 4WU5A 5C2BL 5SWZB 4IRJD 2PUQT 1A6AA 4ZXBB 3LHPH 3SGJA 5JHDE 4U1NB 1KF9B 4NQSB 4OFPA 2WUCH 1Y0LA 4RIRA 3MRLB 2XV6B 3RVVD 3HC0B 1JPFA 3AVEA 3VXNB 3RQ3A 1MRCH 3QO0A 4YGAB 4Z78B 4UILH 5KVDL 2VLKA 3QFDB 1ACYH 2LFGA 1FL5A 1ULVA 5HTSA 1BVKB 4YX2H 2EZ0D 5EU7E 4MQXD 4F57H 1I9IL 3TO2B 3WHE1 5ICZB 5IQ9B 3GIZH 3FMGH 1U3HC 4O51B 4DOHB 1BFOB 1KACB 5ABDE 5BRZA 5I74B 1ZVSB 2UZXB 5CIPB 3U9UB 4YDKH 4I5BA 5CZVL 3HZKA 5C07B 3S8WA 3O45B 3EDDA 5C92A 2PETA 2ZG3A 4L8SA 5F6HI 2H41A 3MCKA 3QNXA 3VFNB 5IVXF 1JNHB 5D93C 2OJZH 1FC1A 1G0DA 3ALXA 2OTUA 3CJJA 2D31A 3HN3A 2B1AL 5F7KC 1KXTB 5HPMA 2PTVA 4P59L 2VR4A 5DEFA 4V2BA 4YDIH 1WCQA 5D2NE 2OSLB 3RUGA 5TQ0L 1XGRA 4O02H 3QIUD 5CCKH 3OAYK 5HDBF 1K2DA 4YIQA 4NIKB 1R3KB 1HH6B 4QRRE 1ZE3C 1Q9KB 5ADOL 3WFZA 1ZGLM 3MLTA 1T6WA 5E03A 1QO3B 1VENA 3D0LA 1IQWH 2Q87A 3WS3B 4XPGH 2XZCH 2Y23A 2Z93B 3LS5H 1RZKL 1NCAL 3E6HB 3BXNB 5ACLA 3L9RA 1KC5H 4MD5A 1ND0B 4LVOB 2XQBH 4YXKH 1YEIH 1DBJH 3T0EA 3QXDB 3D69B 3LCYA 5H37G 2OCFD 5HGAA 3KXFE 4XXCA 3GSRA 1MWAA 4PY8I 5I8OH 1D5MB 3NCFB 4EKXA 4XCYB 4KI5E 3TZVB 5C0GA 2W9DL 1YEEL 4OF6A 2VNCA 1CGVA 4GG6A 2FLBT 3LRGA 5DMJB 4F2MA 3LN4B 2K7PA 1I75A 4NP4L 2ATKA 4NQVB 5FA4B 1Z5LA 3K8MA 2OJEB 1KIUA 5BW7C 2HJLA 2GTWB 3DVGA 3F7PC 4FQIL 3LEVH 3O8XC 3ZYJA 5I1HH 3MPCA 4RRPA 3RDTA 3PWPD 5HYJA 1RZGB 5SX4I 1JV5B 1VFMA 5GGUB 1BM3L 3MO1A 5ENWA 3TPKA 1T7WA 2R2EA 4LLWA 4JY5H 4S1DD 3EFFA 3EO9L 1BOGB 4Z7UE 3BN9D 3PWNA 4D9QD 2LU4A 4R6UA 4KAQL 3WJLA 2GY5A 1HH9A 3X3FL 1N7ML 4PRNA 2BSRA 4UTBL 5IK3A 4M8QB 2F53A 1AJ7H 3B2UC 4TNVK 3TN0A 4KQ4L 4DVRL 3ROOA 4OF8A 5E00B 2CH8A 1FVCB 4GW4A 3GHEH 4P4RA 1QR1B 4MHHI 5FF6A 2R1XA 4XMLH 1RK1B 5KG9A 3BE1L 2R8SH 2HJKA 2Z35A 1JJUA 5CSZB 1QQDA 3TBTB 2DBLH 4YXHL 1MVUB 2D03H 5FUOL 4PRDB 1J12A 2DIBA 3DI2B 5ALBL 1QBMH 3TBVA 4KKCD 3G5ZB 1NAMA 4WEBL 4JY6A 2DKMA 4L3EA 4ONOA 5CJOL 4HK3J 4Q9RL 5ISZE 4EUPA 5SWZE 1MCBA 4RNRA 3W9DB 2ZUVA 1P7KA 1XT5A 4YJZL 1FC2D 3C2AH 4Y4FB 3DHJA 4DGYL 43C9A 1RJLB 15C8L 4MGXA 5F3HB 5E8PB 2G5BB 3LKOA 3KG5A 4PJBA 4NT6B 3GUTA 1RIUH 3L6FB 5KS9E 1P9MA 1P1ZB 3S34H 3KYAA 1G0YR 4OQ1A 4NN5B 3IJYB 5L2KE 3OB8A 4YQXL 1DBML 2YWYA 3VG9C 5IJKC 4L29B 5IF0A 4DW2L 4JRXD 1S7SB 3GIVA 3TC9A 3SE3C 3F6IA 3FZUD 5H94A 3RGVD 4MJ4A 4R2GD 3IJHB 4GOSA 1OARL 1JMZA 1YNLH 2EXWC 5C07E 2BVPA 1QTYT 4P2QD 5GRJH 2IPUG 3GJFB 4GXUN 3GO1H 1UZ6E 2R1WA 2VSDA 2I60L 4X4YA 3KPOA 1QYGH 1QFHA 1J18A 5T3XD 3FKUS 1BZ7A 4AZ8A 4KTEH 4PJ7A 3QG6A 1F4XL 3UJTH 3OPZL 4FFVC 4PG2A 4Z7NE 2DM3A 1WWAX 5DZOA 1I8MB 1Q8MA 4XNQA 2MCPL 4YHLH 1NUFA 4CGTA 1YPZE 3B5GA 3FHQA 4H8WC 1FYHB 4MCZB 3BP4B 4XHQA 2P45B 3HAEG 1HYRC 1B90A 3IFLL 4L4TD 3LRHA 3MXWL 3S36H 4JGMA 5BMFL 1EHNA 2DI8A 1RJYB 4PRHD 3QDJA 3MODL 5E70A 4OD3L 3IJSB 1OW0A 3RWHA 4X6FA 4JHZA 2V2TB 4PJFB 4OD2A 3X14B 3WIIH 1FVEB 4HZLB 3GMQA 1K6QH 1L0QA 3U30C 3UJJH 2LV4A 5HI5C 4JG1L 5FKPA 5J12B 3MRJA 1Q9WA 3OR7A 1EV2E 3V4VL 1AD9B 4NC0B 5E99L 1BFVH 3ILQC 3TV3H 5BO1H 1YYLL 3E6FB 4KFZC 4LBEA 1NUNB 5LGHL 5F7EH 2VC2H 2FJFA 1J9CT 1AY1H 3A0OA 1MEXL 4RMWA 4OCMC 3WNLA 1NFIB 5FYJH 4KK5D 4XGZB 2KZ1B 2FR4A 1F11B 1BX2B 2BY2A 4LCYB 4PUBL 3IGAA 3QEHB 2CRMA 4XH2A 3OGOE 4EN3C 1T22B 5F9JB 3DBXA 1S78D 4BQBA 4ZFOA 1MIEH 3RWGB 1KJ2H 2EKJA 4WI7A 4CJ0A 1WCBA 2VISA 2FO4B 1CGXA 2V17H 5I2IB 4Z7QE 1SBSL 4C56D 3VFRA 3CVIH 3L3OA 3INUL 3QIBB 1D3CA 4XC3H 1OD7A 4LEXL 4OGXH 5M94B 5IVZA 2AXFB 1BIHA 4Y4KA 4U1GC 3UTPE 4NQCB 4APQC 4PYHA 2HJFB 4QO1A 4JPKH 3G6DL 3GSNH 3WFBL 2JJTC 4HFUH 3WEXB 4JFYB 5EIVA 1EEZA 3SE8L 2YEZB 1CDCA 1W0YT 4PJ5D 5J11B 2VZSA 4LCCC 1HSAB 3GSQA 2F19H 2NY2D 1JWUB 3MRKA 1CFNA 3O3AA 3KJ6L 1FFNB 2J8UB 2ZSVA 3HNVH 1KYOK 4H1LG 4ONGL 4WTXA 1GAFL 2NXYD 4NJ9L 3Q48A 3RY5A 4JFEB 4CAGA 4IBLT 3SDAA 3MJ9H 3KR3H 4JN2B 4W4NA 4X8JA 1E6JL 3F12B 4EQ3A 1WSST 2VLJA 3BT2L 1R5VB 1FL3B 3FAWA 2X2YA 2E7CA 4OCXH 1D5XB 5BS0B 3L7FA 4JM2D 1WC7A 5J13C 3GSXB 4Y1AD 3AS2A 1JGEA 5L88H 2X4QA 1QEWA 4H88H 4TSCH 2PYEB 5DQJB 3DUSA 1CL7I 3GSUA 2YD5A 4MCYB 5JOFA 3VXPA 3CLFH 5DQDL 1BQLH 3AMKA 3GSWA 2E9WA 4R4BB 2BX5A 3TVMC 4YHZL 3G9AB 1H3VA 5IT2H 5E6IB 3JWDH 4JO1L 3KYMB 5F1NA 1LEIB 4JZOA 1T1WB 4KK8D 4P5KB 5DVNA 2YD3A 4GMSH 4R4ND 4HJJL 2YPLA 3DXAA 2DIJA 1FG2B 1I9JL 1CFSB 1F4WH 1KJ2B 3SGEI 3T2NL 3RWJB 3ARXA 3I02A 3QZWA 4KRNA 1D6VH 3FT4A 5CP3H 4IRJA 5I1AA 3KNBA 3O6FA 3DWTA 5D1ZC 4N0UB 3LB6C 1J0ZA 4WFFE 4OCSH 1RUAL 2E7LA 1SJXA 1JGUH 3CK0L 4GSDH 4WW2C 5DHXB 3NOIA 2LQRA 1KN4L 4Z9KB 1KELL 5C0CE 1T7YA 5L8LB 5DFWH 4HSQA 1OTTC 2AEPL 4XXDA 2HMIC 2MNUA 2I9TA 2HT3D 3T8XA 1EAPB 2FX9H 1J0IA 3EAKA 1J05A 4DAGL 1FYTD 3OJDA 1MFCL 2DMBA 3VXUE 3VI3F 5BXFB 3K2UH 3K4DA 4XB7A 1Y6MR 2CPCA 1AO7D 3NCJL 3NIGE 5IMLB 1YEGH 1IILE 3UDWA 2IH3A 3NBNA 1TZHB 3RX7A 4O2CA 4Z95L 5C3TA 1JHTB 1YEJH 1QPPA 2NZ9D 4HCRA 4HXAH 1KB5A 5FO8A 5INCA 4CW1A 1IQDA 2QSTA 2C3VA 3QYCA 1GYAA 3JBG7 1EEUA 1FIGL 3D6GA 1S7VB 1JHLH 1MHPL 2O61B 5C0RL 4P46D 4JY4A 3NACL 1NMAH 1K3IA 3QIUA 3LD8C 2P8MA 5FOBB 1ZT7B 3BN3B 4PRPB 4QRUB 5C71A 2CSPA 4HBCH 2X6MA 2LVCA 4HEME 4OLZH 3FN0L 4HPOL 1L0YA 4PP2A 1QZ1A 5C0EB 2ZUYA 4R26L 1ZEAH 4H26B 4LSPH 3C5ZA 2WBJA 4JKWA 1KBGL 1T03H 4FQ1L 5CD3A 4WENB 3AREC 4M7KH 1E4JA 3GB7A 3NIFF 2F74B 3G6AB 4G9FB 5F8RC 2DRUA 4PJ8B 5DQ9A 4P2YA 4NQCE 1EFXD 1V7MH 1UWXK 2HP4A 3WNKA 1BHGA 3P9MB 4LARH 3MRIB 1GOGA 1NLBL 4LOUC 3BPLB 4O00A 2EXYC 3RWCA 2WBWB 1AGBA 3CFEB 1IGCH 3DV4B 2G9HB 2J5LC 1A1NA 4R4FL 5F6IB 4YHMH 1OHQA 4WW2F 5CJ5A 3W11C 3WN5A 4JRWA 1FO0H 4FRWA 3WFDL 2VDQH 2XTJB 1J0YA 4ZNEA 4KROD 2HYMA 4WHDA 1YJDH 2BSTA 3UYPA 3PHQA 2MTPA 3L3HA 4NNXA 4P23B 7FABH 5IMKB 4M6MH 3FQRA 3S35L 2BVOB 4PJFF 3OKMA 1RZJL 5TE4L 1NBZA 5TDOB 5BV7C 2AI0H 1RULH 2C7UB 3GI8L 4DUXA 3O6MH 3WJJC 5C8JB 3V0VA 4F9PA 1GGCL 4BFIA 3LPGA 1BJ8A 3REVB 3V8OA 3KPPA 5HSFA 3BPOB 5DSCA 5I8CB 1UZ8B 3QQ4A 3IXAA 3RFZC 4YGVA 5FYLL 3SDYH 1NAKH 3ARDA 3R06B 3SOBL 2GITB 3PG2A 4IRSD 2RIKA 5C3LD 5FYJE 3TNMA 2R69L 5A2KH 5DEZA 2J88H 4U1SB 1CDJA 2G2RB 3IFPA 1HHJA 1E0OB 3D39D 4JFHE 4X5LA 4XMPH 3HZYA 5EB9A 4ZUSB 3DO7B 2Z9TA 4OCYL 4TULH 2AJZB 5JLZA 3ARFD 4KJQC 4PJEA 2AEQL 5FK9A 4ZFGH 4FQQB 3HTLX 1N0XL 1MFBL 3QCTL 3QUMH 5MEQB 4GW1B 1UH4A 2H26B 3V5KA 3KPNB 2EDFA 4C4KO 5E8DL 4JFOA 5CEZH 1NMBH 4QWWD 4FZEL 4N8PA 3WHE0 4FXKA 4KJPC 4OZFB 3TA3C 4N0UE 4PJXA 5CEXA 4AL8H 5KANI 4X98B 4FXGB 4K94L 1A6TA 4Y2DA 3F5WB 1JNJA 2R23A 3GSVA 3KPSD 3LKPB 1YQVH 4QRPA 3ZO0A 4LPVA 4HV8B 1XCTA 1YMMB 5IBUG 2F8XC 1TZIA 1WBXA 4MA1B 1BBDL 2IPKA 5IHLB 4A6YL 2ZJSL 2ZOKA 1MI5E 1RI8A 1VACA 2JIXB 4JVPA 3QQNA 2Z31B 1FO0B 4LLDA 4R90L 5EOCL 1P2CB 5LCVL 3WKNA 1EHXA 2JK5B 3VDCA 1XCQB 4JRXA 2J8UF 4G80A 5IQ7H 1EPFA 3IETB 2X44D 4LU5H 1M7XA 1JPTH 5IMMB 3RGVA 3O2WL 3PL6C 4XAKD 3MRCA 1IARB 3GBLA 2WLZA 2P5EA 4Y5YB 4BFGA 4JO2L 5B38A 3QI9B 3P9LA 3MJ8B 2XKSA 3VD9A 1AGDA 2X4TA 3ULSA 5I0DA 1CIDA 4D0CA 1A8JH 3B3IB 5DJ0B 1EVUA 1DE4A 2LU3A 2R29L 4R97B 1HCVA 1RK0A 2UY6A 4I3SH 4RZCB 2VQ1A 4Y19D 5JW5A 5ID1A 4PLJC 2B0SH 3GSOA 3QCUL 3L3IA 4UB0H 5J89A 4PRPE 1ZGLA 2B4CH 1TJGH 1WF5A 5AD0B 2E9BA 1YYMH 2IC2A 2JE8A 3STZA 2A83B 4V1DB 4XNXH 3ECBB 2QV2A 2VH5H 1IM9A 4NKOA 1NJ9A 3OKDA 1EVTC 2VLLA 3DRQA 2I07B 3EDFA 4MNQB 5DD5H 4TTGA 1CICB 1VGEH 4PRHA 5AZ2H 4N0YH 3V0AC 3QUKB 3WIFA 1K4DB 4OT1H 4FHBD 4JDZB 4K2UL 5EU6B 4EVNA 2NY3C 3ULVH 2YPVH 4ZQKA 5DS8B 1A5FH 5DR5H 4K3HA 3MNVB 2Y7QA 3VA6A 1MCWW 3C6LD 2D7TH 1LO4H 1NGWA 1UA6L 4HF5H 1A0QL 4RCAA 2HRPL 4M3KB 3ZHLA 5D70H 4K9EL 5JDSA 3PHOB 1EEYA 4JDVA 3IT8D 3SDXE 3C08H 4NHCL 3H9ZA 4M6OH 1A7OL 4TRPH 5TDPB 1HQRB 1GGIL 4F33A 3ZKXB 4G6KH 3S4SA 4G5ZH 2AJ3A 4WVRA 5KJRL 1T0MB 2UYLB 3P77B 3B8YA 5CJQH 1KCLA 5JO5B 2RQ8A 5IB1B 1XGUB 2PW2B 4FFZL 1C5CL 2X1QA 3P9WB 4TUJA 4HHAA 4J2XA 2F8VA 3L95B 5T33L 4PGCB 3CFBA 4HMCA 5HYQB 2NY5H 4I0PC 4XPHL 5F3BA 2BNQA 1NGPL 3BKJH 5D6CA 3MFFA 2G5RA 3UYOD 3S7GA 1C12A 3BGMB 3IF1B 2BC4B 2W0PA 1S7RA 5KSAC 4WUKL 1TTUA 2QHLA 1U3HD 3RKPA 3SY0A 3DPBA 4OKDA 4J8RB 5JNYB 1IAIH 4ONHA 4OIAA 5D7LA 4XVSL 4DVBA 43CAB 4L1DA 4HQQH 4ETQB 2F54D 1IEBA 2G75B 4DKEH 5GSVB 1RVFL 4XBPB 4MA7L 4M7ZC 4ZSOA 1BVLA 2P47B 4RGOH 3QIWA 4JB9H 4QRRD 3H6JA 5IBLD 2EECA 4DKFH 3EOYG 3EJZD 2A9ML 2XN9A 4JN1H 1HOCB 1ACZA 2VDML 4MA1C 5IM7A 5HHNA 4M62H 1QSEE 4GBXA 3REWA 3TCLA 2NTFB 2H32H 5ICXA 5HVHB 3LKNB 4JM2A 1QFUL 4FXLA 3B5TA 3HE6B 4X7TA 4Y1AA 3WLBB 2OL3L 3KLHD 2NY6B 1YMME 1OTUC 2OQJA 4ZS6C 3FJTA 3VCLB 1T7VA 3EO0A 4AY0A 2J4WL 4GT7A 4ZPTB 4TSAH 4X4MA 5I0ZA 1F45A 2R1YA 1QLEL 4YE4L 3W9EA 1L7TL 1YY8A 2GI7A 3VD7A 4LLVB 2ZUSA 4BKLA 4QRSB 1FORL 2OXHA 4I0KA 1NFDB 2R0LL 3NZHL 1ED3B 4PB9L 5I1GL 1UJ3C 2VOTA 4NOBA 3MGTA 4HS8H 3CZFB 2C1PB 1WBZB 3FFCB 4RBPH 3SDDB 3I6KB 1AXTH 3BHBA 1FHGA 3ROLB 4MAUH 4MA8L 3H9HB 2DQIH 4LF3A 3H42H 1N0LA 5DGRA 4S1SH 4RAHA 2G60H 1EX0A 3RNKB 4XP6L 4RAUA 4OBSA 4WFHE 5BQ7A 1JF6A 2YS4A 3WUWA 5I8KL 5DJYB 3S37L 5EH1A 2C1OA 4KVNH 3CSYB 1MCDA 5IFJB 4JFXA 3Q6FA 3VW3H 4EJ1C 5I1DA 4LMQE 4LKXA 3VFMA 3LIZH 3FB8B 2A6IA 1KTRL 1FZKB 2GJZB 2IMMA 1VFBB 1KG0A 1OAZL 2FHCA 5D96B 3RA7L 4BH7A 1I1AB 5KN5A 1I1CA 3IDUA 1OM3H 4MNQE 4MS8C 4PRIE 2DQFA 1KEMH 1PX3A 1LEKA 5CEZE 3B2UD 2HVJB 3OKOA 3V7AG 3VFGH 1R3JA 1UKQA 3T65A 1I8LA 1AGCB 3PWUB 2ZUQC 3QUZA 2WANA 1DBAH 1G84A 3MRGB 4HGMA 4XCCL 4JGUA 4JPVL 3H0TA 4LGSB 1DBKL 4WO4C 4PIRF 1GIGH 2VWEE 3V7MA 1U2CA 3O2VL 4KUCF 2AABH 3NIDF 4X7FC 1IGFH 2PCPB 4L8DA 3B6SB 1BFSA 4MSWA 5ISZD 5FOJA 5SWZD 4JPWL 3ARSA 4OF7A 5GGTH 4IOIB 2WP3T 1DEDA 3ZT5A 3I2CH 4P46A 1A6WH 4ZXBD 3HNSL 1NBYA 1WAAE 2CR6A 4YXLH 4XNMB 1UM6H 1Q72H 4R0LB 1B9ZA 5KOVC 4HIIB 4G9DA 2BCKB 5C09B 3MBXL 4DGVL 3BH8B 3BDYL 1IAKA 4LVEA 3U36A 2X89A 4IS6B 4U1IA 1JZ5A 1RU9L 2DD8L 1G6RL 4NN6C 5E8NB 4OD1H 4WI4A 4CVXA 4YK4C 3GJEA 5H37H 3FONA 1W8OA 3HCVA 5B3NA 1ZLVH 5TF1L 2GFBB 4CN1A 5TFSH 2XWBA 3KLAA 3AM8C 4WRLA 3M45A 3N9GH 1JGLH 5D4QA 4TUKH 4OGZA 1E28A 3MRRA 4MNGB 1CBVL 4KPHH 3VWKC 1EFXA 5C07D 5A1AA 5ICYA 3RZCA 1OAUH 4FQ2L 4CMHB 4KK9D 3I6LD 1A9EB 1IGJB 2X9XA 3ULUF 2ADGB 2Z8VC 2AK4B 2R4SH 2DQEH 4KKAC 1GC1L 1XF5A 4NUGL 1TTGA 5I15L 4E42B 5GGSB 4J3UA 4W6XB 1G1CA 1W0VB 5EOTB 3U83A 3CLEH 1QSFE 4X6DA 2VRAA 4AIZB 4WUUB 3SCMB 4HZAA 4M1GH 1RZ7L 1QRNE 4LAQH 1P4BL 4I4WA 3T2OA 3L5WA 1Q0XL 4XWOC 4Y5VA 3ULVE 4GW5A 1W72B 5H2BB 4JQXC 2DMCA 2CLZB 3G04B 4OI9A 4FFVD 1NANH 2GCYA 5HHOB 3UJIH 4FG6C 3D18B 3LHPL 3BP5B 4XCEB 1WBYB 2R2BA 4H8WH 2WUCL 1F3JA 3VGAC 4WI9A 1UXWB 5D7IA 1MRCL 3NFNA 1I85A 1S9YA 4UILL 5DMKA 1ERNA 1ACYL 4O58H 3SKJH 4NKIH 2H9GB 4Q6IC 2GSGB 1IC5H 4RFNC 4YX2L 1MHHA 4R3SB 4NQDB 3X12B 5F72S 3LKRB 2X7LB 3ISWA 2M8XA 3D39A 4F57L 1S5IH 3TZVD 2XRAH 2NMSA 4PJAA 2QQKH 5EN2B 3GIZL 8FABA 3FMGL 1EO7A 1TVBA 1NGZB 2DYPB 5KVMC 3BKYH 1PKQB 1ZSDA 5L2JB 4HX1B 3BP7A 1NFDE 4ODUA 3VD4A 1N5AB 4YDKL 1K4CA 1G9NC 4RAVB 1EK3A 3FFCE 4OCRH 4UDTA 3ARGB 5IVOA 3QUYB 4OAWA 3WKMH 5C0JA 1LP9E 5HHMB 1MCWM 2AXGB 2OJZL 5GRUH 3IDIA 5HJ3A 3MRFB 3ZSSA 3I6GB 3T3PF 4YDIL 3KPSA 3DGGA 1HHIB 1PSKH 5EO9A 5FXCH 4O02L 1JHKH 5CCKL 1LHZA 3CFKB 2A0LC 5M95B 5EBMA 1T1ZB 6CGTA 5C0AE 3UTPD 1OF2B 4UUJA 1LE5A 1IQWL 2W9EH 4A6YA 4XPGL 3ZDXE 2XZCL 5DC0A 4QHUA 3LS5L 4LCWA 1U8OA 2VO5A 1HHHB 2W38A 3BEWB 3L3JA 5DJAA 1D9KB 1KC5L 2GY7B 5DUBA 2BOCA 2A6JB 3UZQA 2XQBL 4M1CC 4YXKL 1YEIL 1DBJL 4APQD 5F89B 3OKEA 1NGQH 1FZJA 2VAAA 1RJZA 3UP1A 2BY1A 1LEGA 5LJYH 4U0QB 5I8OL 1UM4H 5DD6B 1L6XA 3TIEB 4XMKH 3OXSB 35C8H 1JYXA 5F7WC 4POZC 3NCYS 3NFPA 5J7CC 4LPXA 4AENB 5IVXA 3NPSC 1J10A 4Y4FD 2W91A 2DICA 1IEHA 1IM3B 2AJUH 3LEVL 5I1HL 4GRLB 4H25B 4ELMA 2K1MA 4XI5C 5DRNB 2C3WA 4Y4HC 4JY5L 3HZMB 3QEUA 2VQUA 3KYNA 5F7MC 5I18H 4Y16C 3KPRE 3HI5H 2KL6A 5GRWA 2ICES 1MCFA 4ODWB 4CMHC 1F2XK 4NO3A 1KIQA 1AJ7L 3BIBX 4M93B 3D9AH 1I7RB 3C6LA 5DMGC 4PJDB 3CDGA 3NTCH 1SM3H 3GHEL 3HPJB 4NPYB 2C3HA 2Z91A 4DN4H 2P7TA 5AEAA 4XMLL 3UTQB 3FO9B 3TT1H 2R8SL 3C5JA 3D85B 2DBLL 2D03L 4WFFD 2EDRA 1CIUA 5JHDA 5EO1B 2A6KA 4LRIA 3OX8A 3SDCC 2AJSH 1QBML 3EOBB 5D1QA 3AY4C 4P2CG 3DRTA 4WUUE 2V6HA 2VLRB 2YKLH 5A3IC 3MLRH 5GPRA 4YAQA 2RBLA 4PLKC 2IFGA 4AH2B 4Z7VB 1UB5B 4BSWB 5E2TH 3ES6A 4YHNA 4GXUM 5HHOE 3MRHA 3MJGX 2DJ4A 3ARZA 4C57C 3HE7A 3C2AL 1RZ8A 4PGEA 5FM5M 2MWCA 3DMMC 1QACA 3F7YA 3HZVB 1F6AB 3LZFH 4AM0A 4QHMA 1CGSH 5BZDB 3R0MA 3GMOB 1RIUL 4LSSH 4NGHH 3IDYC 5DHVH 5GS2H 1PZ5A 3S34L 5FUCC 4NQDE 2CDFA 5CILH 2M26A 5B4MD 3VFUA 1RZIB 4K3EH 4ETYA 4PJGB 4Y8AA 1JPFB 1EIBA 2D3VA 2NW2B 3QO0B 3QAZB 1XH3B 4ZAKC 3ZT7A 3PDOA 1U8IA 3MNWB 2VLKB 5DZLA 3FFDB 1NMCC 1YNLL 4P48A 2BFVH 4QRRA 1FL5B 5E5RB 4DZ8B 2KKQA 2AEIT 3BRGC 5GRJL 3GO1L 5HHME 3QNYA 1QYGL 2HT4C 4KTEL 4RQQA 1BAFH 2ZNWA 1MCCA 1R6VA 3UJTL 1XR9A 1T2JA 5JHLH 4YHLL 2EIEA 5JOPE 1WIPA 1KN2H 1D5ZB 4I5BB 1T4KA 2J3SA 4JCMA 4IMLB 3QIBD 5JXEC 3K0WA 2ZKHH 4L8SB 3P4LA 2APBA 2ITCA 3KXFA 4CN6A 4NQCD 4J4PD 2QADB 3VMOA 3ZDYF 3S36L 3Q3GB 2HVKB 5DMYA 3MYZA 3SQOH 1FSKC 3GM8A 5DEFB 4NQXA 2BOBA 2CQVA 3BEVA 1OCWH 3HR5B 2OMNA 1G7MA 4G6MH 4CRPA 1BQSA 1I1YB 3P3YA 1ORQB 1BIIB 3WIIL 5B8CA 1F90H 2Y07H 1K6QL 3UJJL 4P57A 3UTOA 4ODHH 3QUXB 4OCNC 5DK0A 3AGVA 4NRXA 4U0RB 3P30H 4QF1B 1ZA3B 4KRLB 4N1HB 1BFVL 1DUYB 4JFED 2QQQA 3FOMB 3TV3L 4MA3A 5DD1H 1I1FA 1IT9H 5BO1L 3VH8A 5CAYB 2X4SA 5DHVB 4Z7UA 3L9RB 4MD5B 1E4KC 5F7EL 4D9RD 2VC2L 1XF4B 1FDLH 1C5DB 1JWMB 3MRNB 4ELKB 1AY1L 3UX9B 4P3WA 1BQHB 5BJTB 2DKSA 5BS0D 1MJ8H 5FYJL 4NKMB 4WWID 4XRCB 5DVLA 1TLKA 5HGAB 1AGFB 2IBZX 1MWAB 3MREA 4UT9H 2PYED 5BV7H 2EH8H 4MJ6B 1ZLSH 4X5WA 4KMQA 1C7TA 4FQJH 4JFHD 4TVPH 1MIEL 4KV5F 5E6ID 1KJ2L 3WDJA 1TITA 1HZHH 2OMBA 2V17L 1SBBA 1X5LA 4NKDB 2ED7A 4R9HA 1A7NH 3CVIL 1A7BA 3DVGB 5HYJB 3RDTB 4HC1A 4XC3L 1GRWA 4OGXL 2Q20A 1LO5A 3B8SA 4LLMB 1WVZA 5ENWB 5ISZA 5KSBB 1A4KA 2R2EB 4LLWB 4JPKL 2OK0H 4KJQD 5SWZA 3GSNL 4HFUL 5AYUH 1GZQB 3LS4H 4ZXBA 1HH9B 1KNOB 4U1NA 5D9SB 2F19L 3DUUB 3MRLA 1A14H 3HC0A 1A7PH 3VXNA 4IMKA 4S1RH 1BFTA 2VLRE 3HNVL 4HUKB 5F71A 3G6JF 3QFDA 4N5UA 1S9XB 4KZDH 3LH2H 4Z7VE 1A3LH 3P4NB 3EYVB 3MJ9L 2R1XB 3KR3L 3VI3E 1BVKA 1JGVH 1S7TA 1XAUA 2B1HH 3ARQA 4KJYB 3ARYA 2Z35B 5ID0B 3KLSA 4G8GB 1QQDB 2MHAB 5F7YC 2MCG1 2J2ZA 4CMMB 3AS1A 3VI4E 4OCXL 1PW3A 5I19H 1NAMB 3L3KA 4O51A 1G6RA 2PXYC 3FOLB 3SGJC 5L88L 1ZVSA 2GKIA 3U9UA 4H88L 3KYKH 4TSCL 1OP3K 5C07A 3O45A 2AV7B 2V7HA 1P84J 3CLFL 1QG3A 1BQLL 3JUZA 4EI5A 1QUNA 1CDHA 3I3BA 1P5VA 3PL6D 1MVFA 4PJGE 5IT2L 3JWDL 3CIQA 43C9B 1JL8A 2FB4H 4GMSL 2CKBB 3PXHA 3MUZ1 1TQCB 4C55A 4K23H 4URTB 5I6XC 4MXVE 4LPCA 1YPZA 2HKHH 3QG7H 1F4WL 1HH6A 1OY3B 4B0MM 2AS5M 2KZWA 1BD2E 1D6VL 1QO3A 3V0WH 4M6NH 2E8ZA 3TJHD 3FB7B 3WS3A 1LK3H 1U3YA 2ADJB 2Z93A 2LU7A 4K8RC 4OCSL 4Z7OF 1JGUL 4GSDL 3E6HA 3BXNA 3EYQC 2NW3B 2ATPA 2V5MA 4M61B 2PN5A 2MFNA 3QXDA 1NUGA 1RMFH 4U1KB 4G9FD 2BVPB 4MZ2A 1EA9C 4PJ8D 3O9WB 5MENB 2FX9L 4NQEB 3L5IA 5D8JH 1D5MA 3BZ4A 4B5EA 3BDBA 4XCYA 1G0XA 5HHVH 2A2QT 3TZVA 3QG6B 2NR6C 5C9KA 4X9HA 3K2UL 5E4EC 4EUPG 5JIPA 1YEGL 3LN4A 4NQVA 3UAJC 4UBDC 3UPCA 4JFFB 5FA4A 1J5OH 2D7MA 1KJMB 5ELIA 1YEJL 2OJEA 2JCCF 3T1FB 3DO3A 4HXAL 2XTJD 4YHIA 2EDBA 3T0EC 2PO6B 5GGUA 1QNZH 4GAFB 1BJ1H 4OBRA 4P23D 1JHLL 1BOGA 4CBPA 3QDJB 1Z9SA 4XXCC 5K9QG 3F58H 5DFVC 1NMAL 1DANU 4KGJA 4LMQI 5EBLB 2DLFH 4M8QA 3S97C 2CDEA 3MRJB 3KPMB 4HBCL 2GW5A 3FQUB 4OLZL 1FVCA 5HBBA 1AD0B 1QR1A 3OWEA 2F8OA 1QBLH 1ZLWH 4K7PH 2VUYA 1ZEAL 1RK1A 4XP9H 2Y6SC 4LSPL 5CSZA 3LN5A 3RDTC 3S9DB 3TBTA 2HFEA 3MCLH 4PRDA 2FJFB 4TNWK 1T03L 4RGNB 4KDVA 1DUZB 2XNAB 3WFHA 4OLYH 4M7KL 3KWWA 3OTTA 5E2VH 2FJHA 2W65A 3JV5A 2DKUA 2GHWB 3WJLC 1N8ZA 3HKFA 4MD0A 1JZ4A 3C8HA 2YZ1A 4XB8A 1I3RB 1OAYH 1WWWX 5IEHA 5ALCH 3UYRH 5KSBE 1V7ML 5I76B 3TN0C 4LARL 1S9WA 3W9DA 4ZFOB 1CWVA 3F6LA 3C2SA 1S7XB 4KUCD 3KPLA 1YA5A 1WCBB 4KRPB 1IGCL 4JR9H 1CE1H 4BH8B 5DXWA 4YHML 1RJLA 3L3OB 5F3HA 1S7WB 5E8PA 1FO0L 2G5BA 1ZA6B 1YMMD 2VDQL 3OSKA 4P3CH 4HPYH 3L6FA 1YJDL 5CUSH 4FQHB 1P1ZA 1VDGA 4OFIA 4PJHE 1BECA 2JIXD 2Z31D 2OI9C 7FABL 2R4RH 3MLYH 4M6ML 3RUGF 3JVGA 4G8GE 4YO0B 4L29A 1OTUD 3RBGA 4Z8FH 4ZS6D 3O3AB 2AI0L 1S7SA 1RULL 3I3DA 1E4XH 2Q8BH 3O6ML 4L3AA 3S3JA 2YPKA 3O2DH 4ZTOH 1MLBB 3IDNB 1OWRM 4PYGA 3PGDB 3SDAB 2CMRH 3SDYL 1NAKL 2EDLA 2JB6B 1IVLA 1F4HA 5CZKA 1FFPB 1TQCC 3QI9D 3GJFA 2VLJB 2J88L 2NXZC 2V2XB 1P9MC 1Q0YH 4XMPL 4TULL 5C0CA 5ADPH 3QULA 1I8MA 3ULUD 4ZFGL 3KAAA 1N64H 1LWRA 3QUML 3C09C 4U1MB 3GSUB 2XA3A 3BP4A 4QCIB 2BDNH 5JOFB 1INEH 2ERJC 4CVZA 3HMXH 5CEZL 1NMBL 4GG6F 2XZAH 2UWEB 4V1DD 2CJUH 3ORJA 1SVZA 1UH3A 4MNQD 3VXUA 5F1NB 1CICD 3MFGB 2HH0H 4AL8L 3IJSA 12E8H 5EU6D 3D2UA 4GQPH 1YQVL 3BUYB 4X6EB 1FVEA 4HZLA 3T4YB 1CQKA 5D1XB 2EDKA 3MV7E 1OT2A 2XY1A 3EHBC 4KTYA 4PG2C 4QKXB 5MENE 1AD9A 4N90E 4NQEE 4WWKB 1J1OH 5E6YA 3B9KB 4JDTH 1H3WM 4D0BA 3SE4A 3E6FA 4PG9B 5JIKA 5JW3H 4TNVF 5IQ7L 5EDXA 5DD0H 4LU5L 5E4IA 5HI4C 1JPTL 4ZO6A 3O3EB 3HC4H 4MJ5B 1NFIA 1T83A 5L7XH 2P46B 2YN5A 1UG9A 2I9TB 4XGZA 2NY1C 1OW0C 1F11A 1BX2A 4LCYA 4X7CC 4ZNCD 3T2PA 1JZ3A 2QLVB 2VXUH 3IXTB 4Q9CA 2BRRH 4M7LT 1J05B 4LSTH 3OJDB 1E27B 2ZCLH 1T22A 5F9JA 1BJ1J 3MBEB 1UACH 3ZE2E 3WL9B 5F7HA 4PJIB 4WY7H 2FGWH 3MUJA 1LNUB 2IH3B 3G5YB 1S9KC 4I3SL 2FO4A 3GKWH 5I2IA 1ODAA 2B0SL 4UB0L 3OKNB 2B4CL 1TJGL 4BSVB 1UCBH 3QIBA 5FO8B 4CW1B 1YYML 1YQ2A 1IQDB 3OKKA 1PYWB 4HK0B 4XNXL 2AXFA 4JFPB 4NQCA 5EA0H 2VH5L 3QZWG 1U36A 4NO0B 1EGJA 5MI0B 5DD5L 1VGEL 2YEZA 1CFBA 4N0YL 1HQ4B 3BVNB 5AZ2L 4PJBF 1HSAA 4OT1L 1K9TA 4RGNE 1U93B 3ULVL 2I26N 2YPVL 1A5FL 4KDWA 5DR5L 3VGDA 1F4YH 3FRUA 1I7ZB 2D7TL 1LO4L 2YD2A 4HF5L 2FECL 1CD1B 3RWIA 4F80A 3JV0A 4JN2A 4JGJA 5D70L 5BVJA 1TJIH 2KDGA 1QFWH 1X5XA 2GK0A 2WBJB 3C08L 4Y4KC 1R5VA 1FL3A 1YEKH 4M6OL 4OLWH 3QPQD 3O3BB 2AW2A 2QR0B 5KSVB 4TRPL 1QD0A 4AIXA 4EIGB 1D5XA 3O3UN 1X4XA 4G6KL 3VXSE 3GSXA 5ESVA 3HE6D 3MUGA 4WHYH 5HD8C 4G5ZL 2NY6D 3FQTA 1D5IH 3T09A 4NRYB 5DQJA 4PJ7F 5CJQL 1SJHA 3PHSA 5F9DC 1P69B 3LRSB 4R4BA 2IF7A 1P4LB 4FTVB 1AGBB 4D2NA 4PP1D 1NKRA 3LN9A 5E6IA 2VL5B 1A1NB 3KYMA 2NY5L 4RA0C 1TQBC 4I3GA 1LEIA 4HH9B 4JREC 4P5KA 3BKJL 4MWFB 1ADQH 5DI8B 3QA3B 4KXZI 1FG2A 1CFSA 1KJ2A 3W2DH 3RWJA 2BSTB 5DHYB 2X9WA 3EYOB 3FFCD 1FZMA 3L3HB 4NNXB 5IG7A 3MV11 4LVHB 1CI5A 3CUPA 4UNTA 3OKMB 1J0HA 3ARRA 1LE9A 4N0UA 3DYMA 2CIKB 2I9LA 1X5IA 1JUFA 5EU3B 1IAIL 3RL1A 3VGHA 1HKLH 1G9NH 3R1GH 3V0VB 3GSNA 4EEEA 2CKNA 4BFIB 4HQQL 4QNPE 4PFEA 4RWHA 2PF6A 3QQ4B 5DT1H 4DKEL 3KJ4B 3IXAB 1L9MA 2XZQH 3ARDB 4RGOL 2Y25A 4JB9L 2OTWB 2UWEE 4DKFL 4JN1L 1FFQA 4KHXH 1I1AD 4M62L 5BXFA 4JZNA 2P43B 2DI7A 1UKSA 1TMCB 3JSSA 4RGMC 2WV3A 4IRJC 4PJEB 2DQTH 2GQHA 5IMLA 3O6FC 5C1MB 2APTA 2A1WH 2YC1A 2E7LC 5IB2B 2ICWB 3RTQB 1SJEA 3RVVC 1MCEA 3EO1A 5JIHA 4FXKB 4OGAD 4TSAL 3WD5H 3V95A 4B53A 1S7VA 4N8VA 1I7TA 1WIUA 2CRZA 3H3BC 2O61A 2EZ0C 2O5XH 3KGRA 4QRPB 4ENEC 2YD9A 2YRZA 5FOBA 1ZT7A 4PRPA 4J3TA 3MTRA 3IVKB 4HS8L 3UTSD 3NN8B 3UDWC 4POZD 5AAWA 5J9PB 1AXTL 5C09D 2P8PB 4OI8A 4MAUL 2DQIL 5IKCB 3H42L 5C0EA 1T3FB 4S1SL 3PXJA 4XX1G 2G60L 1QKZH 4H26A 1X4ZA 4PJIE 5CP3A 2JJSA 1UVQB 4KVNL 2EE3A 4QRTB 1I7UA 2NX5D 3EDJA 3LKSB 5I1JH 3DVIA 1BF8A 3IAPA 1KLGB 2DDQH 1PX4A 3BUTA 3MRCB 5E56A 1C08A 3VW3L 2O5YH 3O0RH 4G9FA 4PJ8A 3P9LB 1XMWA 3LIZL 3QIUC 3OF6A 1TVHB 1AGDB 4CU6A 2X4TB 2QEJA 3QHFH 5FEBA 5DJZB 1OM3L 4D0CB 3P9MA 4QHKI 1KEML 2AK4D 3JUYA 3VFGL 2WWMD 3CFEA 2VQ1B 5JW5B 1PZUB 3DV4A 1A1MA 1K3ZA 4OGYH 2CIIA 2G9HA 1ZGLB 3L3IB 3W82A 5D5MB 3LQZA 1OQXA 2J6EA 4U6HA 1DBAL 3C5ZC 4WUUD 2WBJC 4U3XA 3PABB 3ZMRA 5T5NG 2QSVA 3BD4A 2DB8A 1GIGL 1IM9B 2AABL 1N26A 1IGFL 3OKDB 2L0DA 3DRQB 2Q3AA 3TLRA 1YMHB 4Z7WB 4M7LH 4P23A 5IMKA 2BVOA 2OR8A 5GGTL 1AHWB 1P7HL 1H8NA 5HHOD 1I9RH 2X5PA 3RZWA 3I2CL 3ZTJG 1DLHA 1A6WL 4UIKH 5TDOA 4IRZH 4YXLL 4PLKD 1UM6L 1Q72L 2C7UA 1C7SA 5T3ZD 2H8PB 4LIQH 4JFDB 3TYFA 3BSZH 2PW1B