5DWMA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
HMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Transferase
molecule keywords Phosphinothricin N-acetyltransferase
total genus 53
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwmA00
3EC4A 4AVAA 1P4NA 3PGPA 2B58A 3FYNA 3R9EA 1B87A 1N71A 4OADA 2I00A 1XE4A 4RS2A 5JPHA 1MK4A 4R3LA 4QC6A 4NSQA 3T90A 4JD6A 2R8VA 1L0CA 1IYLA 1YK3A 1QSMA 3MGDA 4IUSA 4L89A 3I3GA 3QAHA 2I79A 2PRBA 5F48A 1Q2DA 3FIXA 1M4DA 3NE7A 1ON0A 1M1DA 1Q2YA 1KUVA 2J8RA 3EO4A 4HKFA 1KUXA 5GCNA 2ZW7A 1XF8A 5JQ4A 5CNPA 2OU2A 2ATRA 4KOSA 3DR8A 2BL1A 4YFJA 1Z4RA 2K5TA 3W6XA 4J3GA 3T9YA 3R9FA 2GANA 2QMLA 2G0BA 4H89A 2JDCA 4KOTA 3S6FA 3W6SA 4KOUA 4KLWA 4CRZB 4II9A 1NE9A 2BUEA 1I21A 2GE3A 3B8GA 1XEBA 2P6GA 1S5KA 2HV2A 4EVYA 4MY0A 3SXOA 2R1IA 2Q04A 3WR7A 2ZXVA 2FIAA 3FRMA 4QUSA 4R87A 4JXQA 2ZW5A 5J8CA 4X5KA 1YREA 2A4NA 3IWGA 2PR1A 4R57A 2B3VA 3V8IA 4KVOE 4LX9A 3D2MA 4FD5A 5DWNA 3JUWA 1S7FA 3TE4A 1WWZA 1VKCA 1BOBA 2FIWA 1NMTA 3GY9A 2F5IA 1S60A 2B4DB 4F0YA 1M44A 1M4GA 1BO4A 1VHSA 4UWJA 4Y49C 3LD2A 3FNCA 2PR8A 5F47A 2OB0A 3K9UA 5IB0A 1WK4A 3EFAA 1Y7RA 4B5OA 1RXTA 5HH1A 5KTAA 2EVNA 2QIRA 4NF1A 3PZJA 4PK2A 4AVCA 3JVNA 2CY2A 2FL4A 3TTHA 3TO6A 2PC1A 2RC4A 1QSNA 3N7ZA 4XNHB 4MHDA 2P0WA 4GS4A 1YX0A 3I9SA 4H6UA 4DNCA 4F6AA 2BEIA 2EUIA 5C82A 1Z9UA 4KZTA 4KOVA 2VZYA 5KTDA 4JXRA 2VEZA 5EC4A 1UFHA 1IB1E 2GIVA 1TIQA 2WPWA 2X7BA 4AG9A 2G3AA 4PK3A 4KVME 1KUYA 1QSRA 2AE6A 3FBUA 2Y0MA 4JWPA 3R95A 2B5GA 1LRZA 2B4BA 4I49A 3DNSA 3R9GA 1YVKA 4MI4A 1IIDA 2R7HA 4XPDB 4AVBA 1YR0A 4E2AA 3F8KA 4OAEA 2AJ6A 2Z11A 2D4PA 4YGOA 4JLYA 5E96A 5C88A 2JEVA 1PUAA 3BLNA 4R3KA 4U9ZA 4KVXA 5HMNA 4NXYA 1GHEA 2PQ8A 4E0AA 1PU9A 1YGHA 3F5BA 4U5YA 5IV0A 1K4JA 2P6EA 1Y9WA 2CNTA 4M85A 4E8OA 2Q4YA 2QECA 3DR6A 4MBUA 3TO7A 3W91A 5H84A 3EXNA 4R9MA 1Q2CA 3P2HA 5F49A 2PSWA 3PP9A 2REFA 5EBVA 2HQYA 4KOWA 3D2PA 2OZGA 4HNXB 4KUAA 1RO5A 5J8FA 2J8MA 2O28A 5ISVA 4K30A 1QSOA 4ZBGA 1XIXA 4B5PB 2PDOA 3SHPA 4CAWA 2Z0ZA 1FY7A 4KORA 2NMTA 3D8PA 4QVTA 3EY5A 1S7KA 3DDDA 1U6MA 2HUZA 4U9YA 3S6GA 4YRHA 3TFYA 2OZHA 3UY5A 3C26A 2VBQA 4XNHC 2ARHA 1B6BA 4PSWA 3ZZIA 4CRYB 1M4IA 4IF5A 2OH1A 1S3ZA 2FT0A 4ONUA 2H5MA 2J8NA 1MJAA 1MJBA 2FXFA 1V0CA 3H4QA 3GKRA 2FS5A 4NEXA 2VI7A 3OWCA 2Q44A 4MJ8A 2FSRA 4UA3A 3P2FA 5DWMA 2CNMA 2B4DA 2Z10A 5H86A 2Q4VA 3TOAA 4AG7A 2B3UA 3KKWA 2C27A 1XMTA 3RYOA 4KOXA 2VZZA 4CS0B 1IYKA 1QSTA 1S7NA 3CXSA 2KCWA 4HNWB 4XPKA 3S6KA 3F0AA 1S7LA 3TO9A 1I1DA 3GYAA 4PSXA 5I0CA 2JLMA 1Z4EA 4FD7A 5KTCA 4MY3A 3FB3A 4L8AA 3VWDA 5IX3A 2ZW6A 2FCKA 2DXQA 5F46A 2ZW4A 4FD4A 1IICA 3D3SA 3CXPA 4XPDC 1OZPA 3BJ7A 4HNYB 4OLLA 4XPLA 3ZJ0A 4CAVA 2OZUA 3CXQA 3SXNA 4M3SA 1NSLA 4B5PA 3IGRA 2WPXA 3BJ8A 2Q0YA 3LODA 1CJWA 4RI1A 1YVOA 2G3TA 3E0KA 3VWEA 4CAXA 5FVJA 3G3SA 4UWIA 4BMHA 3TT2A 1CM0A 2IL4A 2JDDA 4JJXA 2BSWA 1MJ9A 1R57A 2REEA 3TCVA 1I12A 1SQHA 4UBRA 3R1KA 4AB7A 3S6HA 4KUBA 2P6FA 3G8WA 1J4JA 4FD6A 3FXTA 2CNSA 2R98A 2Q7BA 4KOYA 3TOBA 1Y9KA 4Y49B 3R96A 4QBJA 1KZFA 4PV6A 4H6ZA 4ORFA 4KLVA 1YLEA 3QB8A 2FE7A 2VQYA 2VXKA 2B5GB 3DSBA 4NCZA 2ZPAA 1P0HA 4LUAA 2D4OA 4QB9A
chains in the Genus database with same CATH superfamily
3EC4A 4ZY1A 4AVAA 5HVHA 1P4NA 3BI1A 2PJ4A 4LQ6A 3PGPA 2B58A 1Y7EA 3FYNA 3R9EA 3WC7A 1B87A 1N71A 1Z8WA 2DPSA 4OADA 2PJ2A 2PVVA 4OIDA 5LYIA 5AGEA 2I00A 4ONWA 1XE4A 4RS2A 5JPHA 1MK4A 4R3LA 1AYEA 2Z3MA 4QC6A 1ELMP 3SJFA 3VH9A 1ZO0A 4NSQA 3T90A 1BPNA 4JD6A 4KS9A 2R8VA 1L0CA 4NGPA 4OMEA 3WC5A 4P6YA 5K8NA 1M4LA 1IYLA 2PIYA 4NFRA 2O4HA 2C6GA 4OC5A 1CX8A 1YK3A 1QSMA 3MGDA 4DUKA 2ABZA 4IUSA 4L89A 3I3GA 2BOAA 3QAHA 4B6ZA 2I79A 5A28A 3GB0A 4RN7A 2PRBA 3PEIA 5F48A 3PFOA 4IK2A 1Q2DA 3FIXA 4WWVA 2ZEMA 5THWA 1M4DA 3NE7A 3B3WA 1ON0A 1M1DA 1Q2YA 1KUVA 2J8RA 2QYVA 3EO4A 3KHXA 4HKFA 4A31A 1KUXA 4B11A 5F09A 4MXUA 1VHEA 3D7GA 1QQ9A 5GCNA 2QVPA 3CZXA 4HPSA 4OC1A 1R3NA 4JZ0A 2PJCA 2EWBA 2RFHA 3TC8A 4MFPA 4UFVA 2ZW7A 2XEFA 5LRGA 4Q38A 1XBUA 1XF8A 5G1ZA 5JQ4A 1DE4C 4GM5A 5CNPA 2C1CA 2OU2A 2ATRA 3FJUA 4KOSA 1CP6A 3DR8A 3SJEA 3VARA 4BD9A 1YMEA 2BL1A 4YFJA 2DF5A 2IJZA 1ELLP 1Z4RA 1ZG8A 2K5TA 3DGVA 4A95A 3N5FA 3W6XA 1YLOA 4J3GA 1HDUA 3T9YA 2ZEGA 4Z65A 3R9FA 1AUGA 4B10A 2GANA 2Z3LA 2QMLA 1CG2A 2G0BA 3QNVA 1ZG7A 4C2ZA 2ZEPA 4H89A 2JDCA 4KOTA 4MHPA 4P10A 2ZEHA 2YNCA 5K8MA 1XOVA 3KHZA 3KQZA 4FAIA 3B3TA 3S6FA 4MHYA 3W6SA 4KOUA 3KZWA 4KLWA 4CRZB 4II9A 2PJBA 5CBMA 3H8FA 1NE9A 2BUEA 1X12A 1I21A 2GE3A 3B8GA 4MFKA 1XEBA 4NGRA 4A33A 2P6GA 3S9MA 4ZI6A 3ISZA 2F7VA 4C2YA 1F2PA 5D29A 2Q4ZA 4EWTA 1S5KA 2HV2A 4IHMA 4CGPA 4EVYA 4MY0A 3SXOA 2R1IA 2Q04A 3WR7A 2ZXVA 3B7IA 2FIAA 5K8OA 6CPAA 4ZY0A 3FRMA 4QUSA 4R87A 4JXQA 2JEWA 2ZW5A 2PJ0A 4A32A 5A27A 5J8CA 2ANPA 5G21A 4M6GA 4X5KA 2Z3OA 4CGMA 3SI1A 2ZEFA 4IAVA 4Q7AA 1YREA 2A4NA 3IWGA 2PR1A 3K2KA 3D7FA 2PJAA 2V8GA 4WJBA 4JYWA 3NH8A 4R57A 2B3VA 4NGSA 5HVFA 2CXAA 3V8IA 4KVOE 4C2XA 3S9LA 4MMOA 3S9NA 4LX9A 3D2MA 4FD5A 2VL1A 1TF9A 5DWNA 3JUWA 1S7FA 4A38A 3TE4A 1WWZA 1VKCA 2GLFA 1BOBA 2FIWA 1NMTA 2OR4A 5LYDA 5K8PA 3GY9A 4B13A 2F5IA 1JQGA 1BLLE 1S60A 5AG5A 1ARLA 2B4DB 4F0YA 3PFEA 3LMSA 1M44A 1M4GA 1IOIA 1BO4A 3RBUA 5LYLA 1VHSA 4UWJA 1FNOA 4Y49C 2PJ3A 3LD2A 2GU2A 3FNCA 2PR8A 5F47A 4MFLA 1Q7LA 1LAMA 4PXBA 2OB0A 2BO9A 2GLJA 3K9UA 1LCPA 1WK4A 2YNDA 4UFXA 1TF8A 4NGTA 3EFAA 1Y7RA 4P4JA 4Q36A 1LFWA 2PJ9A 1LOKA 4B5OA 3QAYA 1RXTA 5IB9A 5HH1A 5KTAA 2EVNA 2QIRA 4ZX8A 3FEDA 5IB0A 3IC1A 1F57A 3GLJA 4CGOA 3FH4A 4NF1A 2V8HA 3PZJA 1PCAA 1CPSA 2AFUA 4PK2A 5LYFA 4AVCA 3JVNA 2PCUA 2CY2A 2FL4A 4F0XA 3TTHA 4EFDA 3TO6A 2PC1A 3IEHA 2RC4A 1QSNA 3N7ZA 2CIJA 2EO8A 3PRTA 4MHDA 4XNHB 5D8NA 3CDXA 3NFZA 2P0WA 4GS4A 1YX0A 3CPAA 3I9SA 3K9TA 5HVGA 4H6UA 4DNCA 4F6AA 3SI0A 2BEIA 2EUIA 4ZY2A 5C82A 5EMIA 1Z9UA 5AG6A 3RZAA 4KZTA 4A37A 2V8DA 4NGQA 7CPAA 5J1QA 4BBHA 4KOVA 3SI2A 1F2OA 2VZYA 4KSFA 1NSAA 2Z3PA 3B3VA 4JXRA 2VEZA 2WYRA 2XEJA 5EC4A 5KTDA 1UFHA 1IB1E 2GIVA 1A2ZA 2IMOA 2XEIA 1TIQA 2ZEEA 2WPWA 2EK9A 2X7BA 4AG9A 2QJ8A 4YWYA 2G3AA 4PK3A 4X2TA 3H5ZA 4KVME 4A2ZA 1KUYA 1QSRA 2AE6A 3FBUA 1CBXA 2Y0MA 4JWPA 3R95A 4KSIA 3MN8A 2B5GA 4MFZA 1XJOA 2ZENA 1LRZA 2B4BA 4I49A 3DNSA 2CF4A 3R9GA 1YVKA 4P44A 4MI4A 4CGLA 1IIDA 4CYPA 5I4MA 2ODFA 2R7HA 3JTKA 1QMUA 4XPDB 4M6IA 3D4UA 4R8FA 4AVBA 1YR0A 2G9DA 4O23A 4CYQA 4F9UA 4K3NA 3F8KA 4E2AA 4OAEA 5JM6A 2AJ6A 2Z11A 4EMEA 2D4PA 4YGOA 4JLYA 3B35A 5E96A 5C88A 1XRYA 2JEVA 4A94A 1FT7A 1PUAA 2I3CA 3BLNA 3D68A 3GIUA 4KVXA 4R3KA 4U9ZA 4TWEA 4NXYA 5HMNA 1GHEA 2PQ8A 2FVGA 4FUUA 4C7HA 3RNZA 4E0AA 1PU9A 1YGHA 2JBKA 4NJRA 3F5BA 4A39A 4U5YA 5IV0A 3PBBA 5LRKA 2C6CA 5JH9A 1K4JA 4MCRA 2P6EA 1Y9WA 3V38A 1GYTA 2CNTA 4M85A 2PJ5A 3PB6X 4P45A 2Q4YA 3HUVA 3KI9A 2QECA 1VHOA 3SJGA 4E8OA 3DR6A 4MBUA 3TO7A 3W91A 4UIBA 5H84A 3EXNA 4R9MA 1Q2CA 3P2HA 5F49A 1OBRA 2PSWA 3PP9A 2REFA 5EBVA 2HQYA 2PE3A 3IO1A 4KOWA 1TKJA 2AFZA 1ZG9A 3D2PA 2OZGA 2YNCC 1YW6A 2DEAA 2ZELA 4HNXB 1VIXA 4KUAA 1RO5A 2EK8A 5J8FA 2J8MA 2O28A 5ISVA 4ZGYB 4K30A 1QSOA 2OOTA 1PYTB 4MRIA 4ZBGA 3A9LA 4ZYQA 1HEEA 4OC4A 1Z8TA 2NSMA 3B2YA 4C68A 1XIXA 4B5PB 3IWWA 4NGNA 3TX8A 2PDOA 4P4DA 4PXEA 3SHPA 4PPZA 4CAWA 2Z0ZA 3NA6A 1Z8XA 2V8VA 5DS0A 1Z5RA 1FY7A 2V77A 4KORA 2NMTA 3MRUA 1LANA 4CGNA 3D8PA 4QVTA 3D7DA 5AG7A 3H8EA 1TKFA 2HB6A 4OC2A 3KL9A 8CPAA 4P4EA 3EY5A 1S7KA 3DDDA 1YW4A 1U6MA 1ARMA 2HUZA 4U9YA 4OIWA 3WABA 4AXVA 2O53A 1ZLHA 3S6GA 1Y0RA 4YRHA 3TFYA 3CT9A 2OZHA 3UY5A 3C26A 1LAPA 1X10A 3KGQA 3BI0A 2YNEA 2VBQA 4XNHC 5JGFA 2ARHA 1IU8A 4UCMA 1B6BA 3FVLA 4MFQA 4PSWA 3ZZIA 4CRYB 5HXDA 1M4IA 4IF5A 2AFOA 2HC9A 2OH1A 1S3ZA 1CP7A 2FT0A 4ONUA 2H5MA 2J8NA 1MJAA 3NE8A 1MJBA 2FXFA 4UF4A 1V0CA 4CYOA 3H4QA 3GKRA 1VGYA 2EBJA 2FS5A 3I1UA 3SJXA 4NEXA 3WT4A 2VI7A 3OWCA 2Q44A 3B3SA 3DLJA 4F8ZA 2CTBA 4M6HA 2J9AA 4MJ8A 1EE3P 4MFJA 2FSRA 4UA3A 3P2FA 2JBJA 5DWMA 2PRQA 2CNMA 4OC3A 2B4DA 2Z10A 5H86A 2Q4VA 3TOAA 4AG7A 2IQ6A 4G1PA 1ZLIA 2B3UA 1HDQA 1Y0YA 3KKWA 4X3RA 2C27A 1XMTA 3RYOA 4BINA 3FEEA 4YU9A 4KOXA 2VZZA 4CS0B 2BCOA 1IYKA 1QSTA 1S7NA 3CXSA 2KCWA 4HNWB 4R76A 4XPKA 3S6KA 3F0AA 3B3CA 3D66A 1S7LA 3TO9A 4MCQA 1I1DA 3L2NA 3GYAA 1TXRA 1TKHA 3IWEA 4PSXA 5I0CA 2JLMA 1Z4EA 2Z3KA 3PB4X 4FD7A 5KTCA 4MY3A 1CPXA 1IOFA 3FB3A 1H8LA 2GREA 3FF3A 4FWUA 4NJQA 3FX6A 3KQXA 4L8AA 5LRJA 3KR4A 4W9YA 2ZW6A 3IU1A 3VWDA 2FCKA 5IX3A 4ZX9A 2DXQA 1UWYA 1KWMA 1AMPA 5F46A 1RTQA 2ZW4A 4FD4A 1IICA 3D3SA 3CXPA 4CAEA 4XPDC 1OZPA 2GFQA 4FBEA 3BJ7A 4CYNA 1YQEA 4HNYB 4OLLA 1IY7A 3NH5A 3KR5A 4XPLA 3ZJ0A 2WSAA 1YSJA 4CAVA 2OZUA 4TNUA 4KSAA 4CAFA 4P4FA 3CXQA 4PXCA 4UEZA 2WZNA 3SXNA 4M3SA 4OP4A 1BAVA 1NSLA 1DTDA 4B5PA 3IGRA 3V7ZA 4A30A 2WPXA 3FECA 2ZOFA 3BJ8A 3BHXA 3HLPA 3NH4A 4PQAA 3KASA 2Q0YA 2PIZA 2PJ7A 2C6PA 5BWAB 2XEGA 3LODA 1CJWA 4LQGA 1Z8LA 4RI1A 1YVOA 4DYOA 2G3TA 3E0KA 3JRUA 5G20A 2PJ8A 3VWEA 2AFSA 4CAXA 3IFEA 5FVJA 4UCPA 3PBEA 3G3SA 4UWIA 4BMHA 3TT2A 4UEFA 1CM0A 2IL4A 2JDDA 2ZOGA 4JJXA 4CPAA 2BSWA 4MCSA 1MJ9A 1R57A 1XMBA 2REEA 4P4BA 4MHNA 3TCVA 1BPMA 3H8GA 4MCPA 2Q43A 1I12A 2Z3NA 4UEEA 4B14A 4OKOA 1SQHA 4UBRA 3LACA 3R1KA 3FMCA 4AB7A 3S6HA 4KUBA 2P6FA 2POKA 1J4JA 3G8WA 4X8IA 3BXMA 2YGWA 1JWQA 2DPTA 4FD6A 4UIAA 2AFWA 2PJ6A 3WC6A 2Q7SA 2ZEDA 3FXTA 3IJ3A 2CNSA 3GUXA 2R98A 2Q7BA 4KOYA 2AFMA 3TOBA 1Z2LA 2WUUA 4DJLA 1IGBA 1Y9KA 3PB9X 4Y49B 3R96A 4NGMA 4QBJA 1R43A 2AFXA 1KZFA 4F9VA 2CTCA 5G22A 3CPXA 4PV6A 3PB7X 2F8HA 4H6ZA 4ORFA 2PVWA 4R6TA 3D7HA 3D67A 4C7IA 4KLVA 4RUHA 3RAMA 2PJ1A 4H2KA 3RO0A 1YLEA 4PXDA 3ISXA 5CPAA 3PB8X 3QB8A 3LWUA 2ZEOA 2FE7A 4R7MA 5AG4A 2VQYA 5ELYA 4UCNA 2NYQA 2VXKA 3VATA 3IU2A 2B5GB 4OC0A 4GXHA 3DSBA 1XFOA 4NCZA 4P4IA 2RB7A 3T8WA 3IIBA 2ZPAA 4MHZA 1P0HA 4LUAA 4UFWA 2D4OA 4B12A 2Q51A 4QB9A
chains in the Genus database with same CATH topology
3EC4A 4AVAA 1P4NA 3PGPA 2B58A 3FYNA 3R9EA 1B87A 1N71A 2DPSA 4OADA 5AGEA 2I00A 1XE4A 4RS2A 5JPHA 1MK4A 4R3LA 2Z3MA 4QC6A 1ZO0A 4NSQA 3T90A 4KS9A 4JD6A 2R8VA 1L0CA 1IYLA 1YK3A 1QSMA 3MGDA 4IUSA 4L89A 3I3GA 3QAHA 2I79A 5A28A 2PRBA 5F48A 1Q2DA 3FIXA 1M4DA 3NE7A 1ON0A 1M1DA 1Q2YA 1KUVA 2J8RA 3EO4A 4A31A 4HKFA 1KUXA 4B11A 5GCNA 4MFPA 4UFVA 2ZW7A 4Q38A 1XF8A 5G1ZA 5JQ4A 5CNPA 2OU2A 2ATRA 4KOSA 3DR8A 2BL1A 4YFJA 1Z4RA 2K5TA 4A95A 3W6XA 4J3GA 3T9YA 3R9FA 4B10A 2GANA 2Z3LA 2QMLA 2G0BA 4C2ZA 4H89A 2JDCA 4KOTA 2YNCA 3S6FA 3W6SA 4KOUA 4KLWA 4CRZB 4II9A 1NE9A 2BUEA 4MFKA 1I21A 2GE3A 3B8GA 4A33A 1XEBA 2P6GA 4C2YA 1S5KA 2HV2A 4CGPA 4EVYA 4MY0A 3SXOA 2R1IA 2Q04A 3WR7A 2ZXVA 2FIAA 3FRMA 4QUSA 4R87A 4JXQA 2ZW5A 4A32A 5A27A 5J8CA 5G21A 4X5KA 2Z3OA 4CGMA 1YREA 2A4NA 3IWGA 2PR1A 4R57A 2B3VA 2CXAA 3V8IA 4KVOE 4C2XA 4LX9A 3D2MA 4FD5A 5DWNA 3JUWA 1S7FA 3TE4A 1WWZA 1VKCA 1BOBA 2FIWA 1NMTA 3GY9A 4B13A 2F5IA 1S60A 5AG5A 2B4DB 4F0YA 1M44A 1M4GA 1BO4A 1VHSA 4UWJA 4Y49C 3LD2A 3FNCA 2PR8A 5F47A 4MFLA 2OB0A 4UFXA 3K9UA 5IB0A 1WK4A 2YNDA 3EFAA 1Y7RA 4Q36A 4B5OA 1RXTA 5HH1A 5KTAA 2EVNA 2QIRA 4CGOA 4NF1A 3PZJA 4PK2A 4AVCA 3JVNA 2CY2A 2FL4A 4F0XA 3TTHA 3TO6A 2PC1A 2RC4A 1QSNA 3N7ZA 4XNHB 4MHDA 2P0WA 4GS4A 1YX0A 3I9SA 4H6UA 4DNCA 4F6AA 2BEIA 2EUIA 5C82A 1Z9UA 5AG6A 4KZTA 4BBHA 4KOVA 2VZYA 4KSFA 2Z3PA 5KTDA 4JXRA 2VEZA 5EC4A 1UFHA 1IB1E 2GIVA 1TIQA 2WPWA 2X7BA 4AG9A 2G3AA 4PK3A 3H5ZA 4KVME 4A2ZA 1KUYA 1QSRA 2AE6A 3FBUA 2Y0MA 4JWPA 3R95A 4MFZA 2B5GA 1LRZA 2B4BA 4I49A 3DNSA 3R9GA 1YVKA 4MI4A 4CGLA 1IIDA 4CYPA 2R7HA 3JTKA 4XPDB 4AVBA 1YR0A 4CYQA 4E2AA 3F8KA 4OAEA 2AJ6A 2Z11A 2D4PA 4YGOA 4JLYA 5E96A 5C88A 2JEVA 1PUAA 3BLNA 4R3KA 4U9ZA 4KVXA 5HMNA 4NXYA 1GHEA 2PQ8A 4C7HA 4E0AA 1PU9A 1YGHA 3F5BA 4U5YA 5IV0A 1K4JA 2P6EA 1Y9WA 2CNTA 4M85A 4E8OA 2Q4YA 2QECA 3DR6A 4MBUA 3TO7A 3W91A 5H84A 3EXNA 4R9MA 1Q2CA 3P2HA 5F49A 2PSWA 3PP9A 2REFA 5EBVA 2HQYA 4KOWA 3D2PA 2OZGA 2YNCC 4HNXB 4KUAA 1RO5A 5J8FA 2J8MA 2O28A 5ISVA 4ZGYB 4K30A 1QSOA 4ZBGA 3A9LA 4C68A 1XIXA 4B5PB 2PDOA 3SHPA 4CAWA 2Z0ZA 1FY7A 4KORA 2NMTA 4CGNA 3D8PA 4QVTA 5AG7A 3EY5A 1S7KA 3DDDA 1U6MA 2HUZA 4U9YA 3S6GA 4YRHA 3TFYA 2OZHA 3UY5A 3C26A 2YNEA 2VBQA 4XNHC 2ARHA 4UCMA 1B6BA 4MFQA 4PSWA 3ZZIA 4CRYB 1M4IA 4IF5A 2OH1A 1S3ZA 2FT0A 4ONUA 2H5MA 2J8NA 1MJAA 1MJBA 2FXFA 1V0CA 4CYOA 3H4QA 3GKRA 2FS5A 4NEXA 2VI7A 3OWCA 2Q44A 4MJ8A 4MFJA 2FSRA 4UA3A 3P2FA 5DWMA 2CNMA 2B4DA 2Z10A 5H86A 2Q4VA 3TOAA 4AG7A 2B3UA 3KKWA 2C27A 1XMTA 3RYOA 4KOXA 2VZZA 4CS0B 1IYKA 1QSTA 1S7NA 3CXSA 2KCWA 4HNWB 4XPKA 3S6KA 3F0AA 1S7LA 3TO9A 1I1DA 3GYAA 3IWEA 4PSXA 5I0CA 2JLMA 1Z4EA 2Z3KA 4FD7A 5KTCA 4MY3A 3FB3A 4L8AA 3VWDA 5IX3A 2ZW6A 3IU1A 2FCKA 2DXQA 5F46A 2ZW4A 4FD4A 1IICA 3D3SA 3CXPA 4CAEA 4XPDC 1OZPA 3BJ7A 4CYNA 4HNYB 4OLLA 4XPLA 3ZJ0A 2WSAA 4CAVA 2OZUA 4KSAA 4CAFA 3CXQA 3SXNA 4M3SA 1NSLA 4B5PA 3IGRA 4A30A 2WPXA 3BJ8A 2Q0YA 5BWAB 3LODA 1CJWA 4RI1A 1YVOA 2G3TA 3E0KA 5G20A 3VWEA 4CAXA 5FVJA 4UCPA 3G3SA 4UWIA 4BMHA 3TT2A 1CM0A 2IL4A 2JDDA 4JJXA 2BSWA 1MJ9A 1R57A 2REEA 3TCVA 1I12A 2Z3NA 4B14A 1SQHA 4UBRA 3R1KA 4AB7A 3S6HA 4KUBA 2P6FA 3G8WA 1J4JA 2YGWA 2DPTA 4FD6A 3FXTA 2CNSA 2R98A 2Q7BA 4KOYA 3TOBA 2WUUA 1Y9KA 4Y49B 3R96A 4QBJA 1KZFA 5G22A 4PV6A 4H6ZA 4ORFA 4C7IA 4KLVA 1YLEA 3QB8A 5AG4A 2FE7A 2VQYA 4UCNA 2VXKA 3IU2A 2B5GB 3DSBA 4NCZA 2ZPAA 4UFWA 1P0HA 4LUAA 2D4OA 4B12A 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC4 A;  4AVA A;  1P4N A;  3PGP A;  2B58 A;  3FYN A;  3R9E A;  1B87 A;  1N71 A;  4OAD A;  2I00 A;  1XE4 A;  4RS2 A;  5JPH A;  1MK4 A;  4R3L A;  4QC6 A;  4NSQ A;  3T90 A;  4JD6 A;  2R8V A;  1L0C A;  1IYL A;  1YK3 A;  1QSM A;  3MGD A;  4IUS A;  4L89 A;  3I3G A;  3QAH A;  2I79 A;  2PRB A;  5F48 A;  1Q2D A;  3FIX A;  1M4D A;  3NE7 A;  1ON0 A;  1M1D A;  1Q2Y A;  1KUV A;  2J8R A;  3EO4 A;  4HKF A;  1KUX A;  5GCN A;  2ZW7 A;  1XF8 A;  5JQ4 A;  5CNP A;  2OU2 A;  2ATR A;  4KOS A;  3DR8 A;  2BL1 A;  4YFJ A;  1Z4R A;  2K5T A;  3W6X A;  4J3G A;  3T9Y A;  3R9F A;  2GAN A;  2QML A;  2G0B A;  4H89 A;  2JDC A;  4KOT A;  3S6F A;  3W6S A;  4KOU A;  4KLW A;  4CRZ B;  4II9 A;  1NE9 A;  2BUE A;  1I21 A;  2GE3 A;  3B8G A;  1XEB A;  2P6G A;  1S5K A;  2HV2 A;  4EVY A;  4MY0 A;  3SXO A;  2R1I A;  2Q04 A;  3WR7 A;  2ZXV A;  2FIA A;  3FRM A;  4QUS A;  4R87 A;  4JXQ A;  2ZW5 A;  5J8C A;  4X5K A;  1YRE A;  2A4N A;  3IWG A;  2PR1 A;  4R57 A;  2B3V A;  3V8I A;  4KVO E;  4LX9 A;  3D2M A;  4FD5 A;  5DWN A;  3JUW A;  1S7F A;  3TE4 A;  1WWZ A;  1VKC A;  1BOB A;  2FIW A;  1NMT A;  3GY9 A;  2F5I A;  1S60 A;  2B4D B;  4F0Y A;  1M44 A;  1M4G A;  1BO4 A;  1VHS A;  4UWJ A;  4Y49 C;  3LD2 A;  3FNC A;  2PR8 A;  5F47 A;  2OB0 A;  3K9U A;  5IB0 A;  1WK4 A;  3EFA A;  1Y7R A;  4B5O A;  1RXT A;  5HH1 A;  5KTA A;  2EVN A;  2QIR A;  4NF1 A;  3PZJ A;  4PK2 A;  4AVC A;  3JVN A;  2CY2 A;  2FL4 A;  3TTH A;  3TO6 A;  2PC1 A;  2RC4 A;  1QSN A;  3N7Z A;  4XNH B;  4MHD A;  2P0W A;  4GS4 A;  1YX0 A;  3I9S A;  4H6U A;  4DNC A;  4F6A A;  2BEI A;  2EUI A;  5C82 A;  1Z9U A;  4KZT A;  4KOV A;  2VZY A;  5KTD A;  4JXR A;  2VEZ A;  5EC4 A;  1UFH A;  1IB1 E;  2GIV A;  1TIQ A;  2WPW A;  2X7B A;  4AG9 A;  2G3A A;  4PK3 A;  4KVM E;  1KUY A;  1QSR A;  2AE6 A;  3FBU A;  2Y0M A;  4JWP A;  3R95 A;  2B5G A;  1LRZ A;  2B4B A;  4I49 A;  3DNS A;  3R9G A;  1YVK A;  4MI4 A;  1IID A;  2R7H A;  4XPD B;  4AVB A;  1YR0 A;  4E2A A;  3F8K A;  4OAE A;  2AJ6 A;  2Z11 A;  2D4P A;  4YGO A;  4JLY A;  5E96 A;  5C88 A;  2JEV A;  1PUA A;  3BLN A;  4R3K A;  4U9Z A;  4KVX A;  5HMN A;  4NXY A;  1GHE A;  2PQ8 A;  4E0A A;  1PU9 A;  1YGH A;  3F5B A;  4U5Y A;  5IV0 A;  1K4J A;  2P6E A;  1Y9W A;  2CNT A;  4M85 A;  4E8O A;  2Q4Y A;  2QEC A;  3DR6 A;  4MBU A;  3TO7 A;  3W91 A;  5H84 A;  3EXN A;  4R9M A;  1Q2C A;  3P2H A;  5F49 A;  2PSW A;  3PP9 A;  2REF A;  5EBV A;  2HQY A;  4KOW A;  3D2P A;  2OZG A;  4HNX B;  4KUA A;  1RO5 A;  5J8F A;  2J8M A;  2O28 A;  5ISV A;  4K30 A;  1QSO A;  4ZBG A;  1XIX A;  4B5P B;  2PDO A;  3SHP A;  4CAW A;  2Z0Z A;  1FY7 A;  4KOR A;  2NMT A;  3D8P A;  4QVT A;  3EY5 A;  1S7K A;  3DDD A;  1U6M A;  2HUZ A;  4U9Y A;  3S6G A;  4YRH A;  3TFY A;  2OZH A;  3UY5 A;  3C26 A;  2VBQ A;  4XNH C;  2ARH A;  1B6B A;  4PSW A;  3ZZI A;  4CRY B;  1M4I A;  4IF5 A;  2OH1 A;  1S3Z A;  2FT0 A;  4ONU A;  2H5M A;  2J8N A;  1MJA A;  1MJB A;  2FXF A;  1V0C A;  3H4Q A;  3GKR A;  2FS5 A;  4NEX A;  2VI7 A;  3OWC A;  2Q44 A;  4MJ8 A;  2FSR A;  4UA3 A;  3P2F A;  5DWM A;  2CNM A;  2B4D A;  2Z10 A;  5H86 A;  2Q4V A;  3TOA A;  4AG7 A;  2B3U A;  3KKW A;  2C27 A;  1XMT A;  3RYO A;  4KOX A;  2VZZ A;  4CS0 B;  1IYK A;  1QST A;  1S7N A;  3CXS A;  2KCW A;  4HNW B;  4XPK A;  3S6K A;  3F0A A;  1S7L A;  3TO9 A;  1I1D A;  3GYA A;  4PSX A;  5I0C A;  2JLM A;  1Z4E A;  4FD7 A;  5KTC A;  4MY3 A;  3FB3 A;  4L8A A;  3VWD A;  5IX3 A;  2ZW6 A;  2FCK A;  2DXQ A;  5F46 A;  2ZW4 A;  4FD4 A;  1IIC A;  3D3S A;  3CXP A;  4XPD C;  1OZP A;  3BJ7 A;  4HNY B;  4OLL A;  4XPL A;  3ZJ0 A;  4CAV A;  2OZU A;  3CXQ A;  3SXN A;  4M3S A;  1NSL A;  4B5P A;  3IGR A;  2WPX A;  3BJ8 A;  2Q0Y A;  3LOD A;  1CJW A;  4RI1 A;  1YVO A;  2G3T A;  3E0K A;  3VWE A;  4CAX A;  5FVJ A;  3G3S A;  4UWI A;  4BMH A;  3TT2 A;  1CM0 A;  2IL4 A;  2JDD A;  4JJX A;  2BSW A;  1MJ9 A;  1R57 A;  2REE A;  3TCV A;  1I12 A;  1SQH A;  4UBR A;  3R1K A;  4AB7 A;  3S6H A;  4KUB A;  2P6F A;  3G8W A;  1J4J A;  4FD6 A;  3FXT A;  2CNS A;  2R98 A;  2Q7B A;  4KOY A;  3TOB A;  1Y9K A;  4Y49 B;  3R96 A;  4QBJ A;  1KZF A;  4PV6 A;  4H6Z A;  4ORF A;  4KLV A;  1YLE A;  3QB8 A;  2FE7 A;  2VQY A;  2VXK A;  2B5G B;  3DSB A;  4NCZ A;  2ZPA A;  1P0H A;  4LUA A;  2D4O A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 3EC4 A;  4ZY1 A;  4AVA A;  5HVH A;  1P4N A;  3BI1 A;  2PJ4 A;  4LQ6 A;  3PGP A;  2B58 A;  1Y7E A;  3FYN A;  3R9E A;  3WC7 A;  1B87 A;  1N71 A;  1Z8W A;  2DPS A;  4OAD A;  2PJ2 A;  2PVV A;  4OID A;  5LYI A;  5AGE A;  2I00 A;  4ONW A;  1XE4 A;  4RS2 A;  5JPH A;  1MK4 A;  4R3L A;  1AYE A;  2Z3M A;  4QC6 A;  1ELM P;  3SJF A;  3VH9 A;  1ZO0 A;  4NSQ A;  3T90 A;  1BPN A;  4JD6 A;  4KS9 A;  2R8V A;  1L0C A;  4NGP A;  4OME A;  3WC5 A;  4P6Y A;  5K8N A;  1M4L A;  1IYL A;  2PIY A;  4NFR A;  2O4H A;  2C6G A;  4OC5 A;  1CX8 A;  1YK3 A;  1QSM A;  3MGD A;  4DUK A;  2ABZ A;  4IUS A;  4L89 A;  3I3G A;  2BOA A;  3QAH A;  4B6Z A;  2I79 A;  5A28 A;  3GB0 A;  4RN7 A;  2PRB A;  3PEI A;  5F48 A;  3PFO A;  4IK2 A;  1Q2D A;  3FIX A;  4WWV A;  2ZEM A;  5THW A;  1M4D A;  3NE7 A;  3B3W A;  1ON0 A;  1M1D A;  1Q2Y A;  1KUV A;  2J8R A;  2QYV A;  3EO4 A;  3KHX A;  4HKF A;  4A31 A;  1KUX A;  4B11 A;  5F09 A;  4MXU A;  1VHE A;  3D7G A;  1QQ9 A;  5GCN A;  2QVP A;  3CZX A;  4HPS A;  4OC1 A;  1R3N A;  4JZ0 A;  2PJC A;  2EWB A;  2RFH A;  3TC8 A;  4MFP A;  4UFV A;  2ZW7 A;  2XEF A;  5LRG A;  4Q38 A;  1XBU A;  1XF8 A;  5G1Z A;  5JQ4 A;  1DE4 C;  4GM5 A;  5CNP A;  2C1C A;  2OU2 A;  2ATR A;  3FJU A;  4KOS A;  1CP6 A;  3DR8 A;  3SJE A;  3VAR A;  4BD9 A;  1YME A;  2BL1 A;  4YFJ A;  2DF5 A;  2IJZ A;  1ELL P;  1Z4R A;  1ZG8 A;  2K5T A;  3DGV A;  4A95 A;  3N5F A;  3W6X A;  1YLO A;  4J3G A;  1HDU A;  3T9Y A;  2ZEG A;  4Z65 A;  3R9F A;  1AUG A;  4B10 A;  2GAN A;  2Z3L A;  2QML A;  1CG2 A;  2G0B A;  3QNV A;  1ZG7 A;  4C2Z A;  2ZEP A;  4H89 A;  2JDC A;  4KOT A;  4MHP A;  4P10 A;  2ZEH A;  2YNC A;  5K8M A;  1XOV A;  3KHZ A;  3KQZ A;  4FAI A;  3B3T A;  3S6F A;  4MHY A;  3W6S A;  4KOU A;  3KZW A;  4KLW A;  4CRZ B;  4II9 A;  2PJB A;  5CBM A;  3H8F A;  1NE9 A;  2BUE A;  1X12 A;  1I21 A;  2GE3 A;  3B8G A;  4MFK A;  1XEB A;  4NGR A;  4A33 A;  2P6G A;  3S9M A;  4ZI6 A;  3ISZ A;  2F7V A;  4C2Y A;  1F2P A;  5D29 A;  2Q4Z A;  4EWT A;  1S5K A;  2HV2 A;  4IHM A;  4CGP A;  4EVY A;  4MY0 A;  3SXO A;  2R1I A;  2Q04 A;  3WR7 A;  2ZXV A;  3B7I A;  2FIA A;  5K8O A;  6CPA A;  4ZY0 A;  3FRM A;  4QUS A;  4R87 A;  4JXQ A;  2JEW A;  2ZW5 A;  2PJ0 A;  4A32 A;  5A27 A;  5J8C A;  2ANP A;  5G21 A;  4M6G A;  4X5K A;  2Z3O A;  4CGM A;  3SI1 A;  2ZEF A;  4IAV A;  4Q7A A;  1YRE A;  2A4N A;  3IWG A;  2PR1 A;  3K2K A;  3D7F A;  2PJA A;  2V8G A;  4WJB A;  4JYW A;  3NH8 A;  4R57 A;  2B3V A;  4NGS A;  5HVF A;  2CXA A;  3V8I A;  4KVO E;  4C2X A;  3S9L A;  4MMO A;  3S9N A;  4LX9 A;  3D2M A;  4FD5 A;  2VL1 A;  1TF9 A;  5DWN A;  3JUW A;  1S7F A;  4A38 A;  3TE4 A;  1WWZ A;  1VKC A;  2GLF A;  1BOB A;  2FIW A;  1NMT A;  2OR4 A;  5LYD A;  5K8P A;  3GY9 A;  4B13 A;  2F5I A;  1JQG A;  1BLL E;  1S60 A;  5AG5 A;  1ARL A;  2B4D B;  4F0Y A;  3PFE A;  3LMS A;  1M44 A;  1M4G A;  1IOI A;  1BO4 A;  3RBU A;  5LYL A;  1VHS A;  4UWJ A;  1FNO A;  4Y49 C;  2PJ3 A;  3LD2 A;  2GU2 A;  3FNC A;  2PR8 A;  5F47 A;  4MFL A;  1Q7L A;  1LAM A;  4PXB A;  2OB0 A;  2BO9 A;  2GLJ A;  3K9U A;  1LCP A;  1WK4 A;  2YND A;  4UFX A;  1TF8 A;  4NGT A;  3EFA A;  1Y7R A;  4P4J A;  4Q36 A;  1LFW A;  2PJ9 A;  1LOK A;  4B5O A;  3QAY A;  1RXT A;  5IB9 A;  5HH1 A;  5KTA A;  2EVN A;  2QIR A;  4ZX8 A;  3FED A;  5IB0 A;  3IC1 A;  1F57 A;  3GLJ A;  4CGO A;  3FH4 A;  4NF1 A;  2V8H A;  3PZJ A;  1PCA A;  1CPS A;  2AFU A;  4PK2 A;  5LYF A;  4AVC A;  3JVN A;  2PCU A;  2CY2 A;  2FL4 A;  4F0X A;  3TTH A;  4EFD A;  3TO6 A;  2PC1 A;  3IEH A;  2RC4 A;  1QSN A;  3N7Z A;  2CIJ A;  2EO8 A;  3PRT A;  4MHD A;  4XNH B;  5D8N A;  3CDX A;  3NFZ A;  2P0W A;  4GS4 A;  1YX0 A;  3CPA A;  3I9S A;  3K9T A;  5HVG A;  4H6U A;  4DNC A;  4F6A A;  3SI0 A;  2BEI A;  2EUI A;  4ZY2 A;  5C82 A;  5EMI A;  1Z9U A;  5AG6 A;  3RZA A;  4KZT A;  4A37 A;  2V8D A;  4NGQ A;  7CPA A;  5J1Q A;  4BBH A;  4KOV A;  3SI2 A;  1F2O A;  2VZY A;  4KSF A;  1NSA A;  2Z3P A;  3B3V A;  4JXR A;  2VEZ A;  2WYR A;  2XEJ A;  5EC4 A;  5KTD A;  1UFH A;  1IB1 E;  2GIV A;  1A2Z A;  2IMO A;  2XEI A;  1TIQ A;  2ZEE A;  2WPW A;  2EK9 A;  2X7B A;  4AG9 A;  2QJ8 A;  4YWY A;  2G3A A;  4PK3 A;  4X2T A;  3H5Z A;  4KVM E;  4A2Z A;  1KUY A;  1QSR A;  2AE6 A;  3FBU A;  1CBX A;  2Y0M A;  4JWP A;  3R95 A;  4KSI A;  3MN8 A;  2B5G A;  4MFZ A;  1XJO A;  2ZEN A;  1LRZ A;  2B4B A;  4I49 A;  3DNS A;  2CF4 A;  3R9G A;  1YVK A;  4P44 A;  4MI4 A;  4CGL A;  1IID A;  4CYP A;  5I4M A;  2ODF A;  2R7H A;  3JTK A;  1QMU A;  4XPD B;  4M6I A;  3D4U A;  4R8F A;  4AVB A;  1YR0 A;  2G9D A;  4O23 A;  4CYQ A;  4F9U A;  4K3N A;  3F8K A;  4E2A A;  4OAE A;  5JM6 A;  2AJ6 A;  2Z11 A;  4EME A;  2D4P A;  4YGO A;  4JLY A;  3B35 A;  5E96 A;  5C88 A;  1XRY A;  2JEV A;  4A94 A;  1FT7 A;  1PUA A;  2I3C A;  3BLN A;  3D68 A;  3GIU A;  4KVX A;  4R3K A;  4U9Z A;  4TWE A;  4NXY A;  5HMN A;  1GHE A;  2PQ8 A;  2FVG A;  4FUU A;  4C7H A;  3RNZ A;  4E0A A;  1PU9 A;  1YGH A;  2JBK A;  4NJR A;  3F5B A;  4A39 A;  4U5Y A;  5IV0 A;  3PBB A;  5LRK A;  2C6C A;  5JH9 A;  1K4J A;  4MCR A;  2P6E A;  1Y9W A;  3V38 A;  1GYT A;  2CNT A;  4M85 A;  2PJ5 A;  3PB6 X;  4P45 A;  2Q4Y A;  3HUV A;  3KI9 A;  2QEC A;  1VHO A;  3SJG A;  4E8O A;  3DR6 A;  4MBU A;  3TO7 A;  3W91 A;  4UIB A;  5H84 A;  3EXN A;  4R9M A;  1Q2C A;  3P2H A;  5F49 A;  1OBR A;  2PSW A;  3PP9 A;  2REF A;  5EBV A;  2HQY A;  2PE3 A;  3IO1 A;  4KOW A;  1TKJ A;  2AFZ A;  1ZG9 A;  3D2P A;  2OZG A;  2YNC C;  1YW6 A;  2DEA A;  2ZEL A;  4HNX B;  1VIX A;  4KUA A;  1RO5 A;  2EK8 A;  5J8F A;  2J8M A;  2O28 A;  5ISV A;  4ZGY B;  4K30 A;  1QSO A;  2OOT A;  1PYT B;  4MRI A;  4ZBG A;  3A9L A;  4ZYQ A;  1HEE A;  4OC4 A;  1Z8T A;  2NSM A;  3B2Y A;  4C68 A;  1XIX A;  4B5P B;  3IWW A;  4NGN A;  3TX8 A;  2PDO A;  4P4D A;  4PXE A;  3SHP A;  4PPZ A;  4CAW A;  2Z0Z A;  3NA6 A;  1Z8X A;  2V8V A;  5DS0 A;  1Z5R A;  1FY7 A;  2V77 A;  4KOR A;  2NMT A;  3MRU A;  1LAN A;  4CGN A;  3D8P A;  4QVT A;  3D7D A;  5AG7 A;  3H8E A;  1TKF A;  2HB6 A;  4OC2 A;  3KL9 A;  8CPA A;  4P4E A;  3EY5 A;  1S7K A;  3DDD A;  1YW4 A;  1U6M A;  1ARM A;  2HUZ A;  4U9Y A;  4OIW A;  3WAB A;  4AXV A;  2O53 A;  1ZLH A;  3S6G A;  1Y0R A;  4YRH A;  3TFY A;  3CT9 A;  2OZH A;  3UY5 A;  3C26 A;  1LAP A;  1X10 A;  3KGQ A;  3BI0 A;  2YNE A;  2VBQ A;  4XNH C;  5JGF A;  2ARH A;  1IU8 A;  4UCM A;  1B6B A;  3FVL A;  4MFQ A;  4PSW A;  3ZZI A;  4CRY B;  5HXD A;  1M4I A;  4IF5 A;  2AFO A;  2HC9 A;  2OH1 A;  1S3Z A;  1CP7 A;  2FT0 A;  4ONU A;  2H5M A;  2J8N A;  1MJA A;  3NE8 A;  1MJB A;  2FXF A;  4UF4 A;  1V0C A;  4CYO A;  3H4Q A;  3GKR A;  1VGY A;  2EBJ A;  2FS5 A;  3I1U A;  3SJX A;  4NEX A;  3WT4 A;  2VI7 A;  3OWC A;  2Q44 A;  3B3S A;  3DLJ A;  4F8Z A;  2CTB A;  4M6H A;  2J9A A;  4MJ8 A;  1EE3 P;  4MFJ A;  2FSR A;  4UA3 A;  3P2F A;  2JBJ A;  5DWM A;  2PRQ A;  2CNM A;  4OC3 A;  2B4D A;  2Z10 A;  5H86 A;  2Q4V A;  3TOA A;  4AG7 A;  2IQ6 A;  4G1P A;  1ZLI A;  2B3U A;  1HDQ A;  1Y0Y A;  3KKW A;  4X3R A;  2C27 A;  1XMT A;  3RYO A;  4BIN A;  3FEE A;  4YU9 A;  4KOX A;  2VZZ A;  4CS0 B;  2BCO A;  1IYK A;  1QST A;  1S7N A;  3CXS A;  2KCW A;  4HNW B;  4R76 A;  4XPK A;  3S6K A;  3F0A A;  3B3C A;  3D66 A;  1S7L A;  3TO9 A;  4MCQ A;  1I1D A;  3L2N A;  3GYA A;  1TXR A;  1TKH A;  3IWE A;  4PSX A;  5I0C A;  2JLM A;  1Z4E A;  2Z3K A;  3PB4 X;  4FD7 A;  5KTC A;  4MY3 A;  1CPX A;  1IOF A;  3FB3 A;  1H8L A;  2GRE A;  3FF3 A;  4FWU A;  4NJQ A;  3FX6 A;  3KQX A;  4L8A A;  5LRJ A;  3KR4 A;  4W9Y A;  2ZW6 A;  3IU1 A;  3VWD A;  2FCK A;  5IX3 A;  4ZX9 A;  2DXQ A;  1UWY A;  1KWM A;  1AMP A;  5F46 A;  1RTQ A;  2ZW4 A;  4FD4 A;  1IIC A;  3D3S A;  3CXP A;  4CAE A;  4XPD C;  1OZP A;  2GFQ A;  4FBE A;  3BJ7 A;  4CYN A;  1YQE A;  4HNY B;  4OLL A;  1IY7 A;  3NH5 A;  3KR5 A;  4XPL A;  3ZJ0 A;  2WSA A;  1YSJ A;  4CAV A;  2OZU A;  4TNU A;  4KSA A;  4CAF A;  4P4F A;  3CXQ A;  4PXC A;  4UEZ A;  2WZN A;  3SXN A;  4M3S A;  4OP4 A;  1BAV A;  1NSL A;  1DTD A;  4B5P A;  3IGR A;  3V7Z A;  4A30 A;  2WPX A;  3FEC A;  2ZOF A;  3BJ8 A;  3BHX A;  3HLP A;  3NH4 A;  4PQA A;  3KAS A;  2Q0Y A;  2PIZ A;  2PJ7 A;  2C6P A;  5BWA B;  2XEG A;  3LOD A;  1CJW A;  4LQG A;  1Z8L A;  4RI1 A;  1YVO A;  4DYO A;  2G3T A;  3E0K A;  3JRU A;  5G20 A;  2PJ8 A;  3VWE A;  2AFS A;  4CAX A;  3IFE A;  5FVJ A;  4UCP A;  3PBE A;  3G3S A;  4UWI A;  4BMH A;  3TT2 A;  4UEF A;  1CM0 A;  2IL4 A;  2JDD A;  2ZOG A;  4JJX A;  4CPA A;  2BSW A;  4MCS A;  1MJ9 A;  1R57 A;  1XMB A;  2REE A;  4P4B A;  4MHN A;  3TCV A;  1BPM A;  3H8G A;  4MCP A;  2Q43 A;  1I12 A;  2Z3N A;  4UEE A;  4B14 A;  4OKO A;  1SQH A;  4UBR A;  3LAC A;  3R1K A;  3FMC A;  4AB7 A;  3S6H A;  4KUB A;  2P6F A;  2POK A;  1J4J A;  3G8W A;  4X8I A;  3BXM A;  2YGW A;  1JWQ A;  2DPT A;  4FD6 A;  4UIA A;  2AFW A;  2PJ6 A;  3WC6 A;  2Q7S A;  2ZED A;  3FXT A;  3IJ3 A;  2CNS A;  3GUX A;  2R98 A;  2Q7B A;  4KOY A;  2AFM A;  3TOB A;  1Z2L A;  2WUU A;  4DJL A;  1IGB A;  1Y9K A;  3PB9 X;  4Y49 B;  3R96 A;  4NGM A;  4QBJ A;  1R43 A;  2AFX A;  1KZF A;  4F9V A;  2CTC A;  5G22 A;  3CPX A;  4PV6 A;  3PB7 X;  2F8H A;  4H6Z A;  4ORF A;  2PVW A;  4R6T A;  3D7H A;  3D67 A;  4C7I A;  4KLV A;  4RUH A;  3RAM A;  2PJ1 A;  4H2K A;  3RO0 A;  1YLE A;  4PXD A;  3ISX A;  5CPA A;  3PB8 X;  3QB8 A;  3LWU A;  2ZEO A;  2FE7 A;  4R7M A;  5AG4 A;  2VQY A;  5ELY A;  4UCN A;  2NYQ A;  2VXK A;  3VAT A;  3IU2 A;  2B5G B;  4OC0 A;  4GXH A;  3DSB A;  1XFO A;  4NCZ A;  4P4I A;  2RB7 A;  3T8W A;  3IIB A;  2ZPA A;  4MHZ A;  1P0H A;  4LUA A;  4UFW A;  2D4O A;  4B12 A;  2Q51 A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 3EC4 A;  4AVA A;  1P4N A;  3PGP A;  2B58 A;  3FYN A;  3R9E A;  1B87 A;  1N71 A;  2DPS A;  4OAD A;  5AGE A;  2I00 A;  1XE4 A;  4RS2 A;  5JPH A;  1MK4 A;  4R3L A;  2Z3M A;  4QC6 A;  1ZO0 A;  4NSQ A;  3T90 A;  4KS9 A;  4JD6 A;  2R8V A;  1L0C A;  1IYL A;  1YK3 A;  1QSM A;  3MGD A;  4IUS A;  4L89 A;  3I3G A;  3QAH A;  2I79 A;  5A28 A;  2PRB A;  5F48 A;  1Q2D A;  3FIX A;  1M4D A;  3NE7 A;  1ON0 A;  1M1D A;  1Q2Y A;  1KUV A;  2J8R A;  3EO4 A;  4A31 A;  4HKF A;  1KUX A;  4B11 A;  5GCN A;  4MFP A;  4UFV A;  2ZW7 A;  4Q38 A;  1XF8 A;  5G1Z A;  5JQ4 A;  5CNP A;  2OU2 A;  2ATR A;  4KOS A;  3DR8 A;  2BL1 A;  4YFJ A;  1Z4R A;  2K5T A;  4A95 A;  3W6X A;  4J3G A;  3T9Y A;  3R9F A;  4B10 A;  2GAN A;  2Z3L A;  2QML A;  2G0B A;  4C2Z A;  4H89 A;  2JDC A;  4KOT A;  2YNC A;  3S6F A;  3W6S A;  4KOU A;  4KLW A;  4CRZ B;  4II9 A;  1NE9 A;  2BUE A;  4MFK A;  1I21 A;  2GE3 A;  3B8G A;  4A33 A;  1XEB A;  2P6G A;  4C2Y A;  1S5K A;  2HV2 A;  4CGP A;  4EVY A;  4MY0 A;  3SXO A;  2R1I A;  2Q04 A;  3WR7 A;  2ZXV A;  2FIA A;  3FRM A;  4QUS A;  4R87 A;  4JXQ A;  2ZW5 A;  4A32 A;  5A27 A;  5J8C A;  5G21 A;  4X5K A;  2Z3O A;  4CGM A;  1YRE A;  2A4N A;  3IWG A;  2PR1 A;  4R57 A;  2B3V A;  2CXA A;  3V8I A;  4KVO E;  4C2X A;  4LX9 A;  3D2M A;  4FD5 A;  5DWN A;  3JUW A;  1S7F A;  3TE4 A;  1WWZ A;  1VKC A;  1BOB A;  2FIW A;  1NMT A;  3GY9 A;  4B13 A;  2F5I A;  1S60 A;  5AG5 A;  2B4D B;  4F0Y A;  1M44 A;  1M4G A;  1BO4 A;  1VHS A;  4UWJ A;  4Y49 C;  3LD2 A;  3FNC A;  2PR8 A;  5F47 A;  4MFL A;  2OB0 A;  4UFX A;  3K9U A;  5IB0 A;  1WK4 A;  2YND A;  3EFA A;  1Y7R A;  4Q36 A;  4B5O A;  1RXT A;  5HH1 A;  5KTA A;  2EVN A;  2QIR A;  4CGO A;  4NF1 A;  3PZJ A;  4PK2 A;  4AVC A;  3JVN A;  2CY2 A;  2FL4 A;  4F0X A;  3TTH A;  3TO6 A;  2PC1 A;  2RC4 A;  1QSN A;  3N7Z A;  4XNH B;  4MHD A;  2P0W A;  4GS4 A;  1YX0 A;  3I9S A;  4H6U A;  4DNC A;  4F6A A;  2BEI A;  2EUI A;  5C82 A;  1Z9U A;  5AG6 A;  4KZT A;  4BBH A;  4KOV A;  2VZY A;  4KSF A;  2Z3P A;  5KTD A;  4JXR A;  2VEZ A;  5EC4 A;  1UFH A;  1IB1 E;  2GIV A;  1TIQ A;  2WPW A;  2X7B A;  4AG9 A;  2G3A A;  4PK3 A;  3H5Z A;  4KVM E;  4A2Z A;  1KUY A;  1QSR A;  2AE6 A;  3FBU A;  2Y0M A;  4JWP A;  3R95 A;  4MFZ A;  2B5G A;  1LRZ A;  2B4B A;  4I49 A;  3DNS A;  3R9G A;  1YVK A;  4MI4 A;  4CGL A;  1IID A;  4CYP A;  2R7H A;  3JTK A;  4XPD B;  4AVB A;  1YR0 A;  4CYQ A;  4E2A A;  3F8K A;  4OAE A;  2AJ6 A;  2Z11 A;  2D4P A;  4YGO A;  4JLY A;  5E96 A;  5C88 A;  2JEV A;  1PUA A;  3BLN A;  4R3K A;  4U9Z A;  4KVX A;  5HMN A;  4NXY A;  1GHE A;  2PQ8 A;  4C7H A;  4E0A A;  1PU9 A;  1YGH A;  3F5B A;  4U5Y A;  5IV0 A;  1K4J A;  2P6E A;  1Y9W A;  2CNT A;  4M85 A;  4E8O A;  2Q4Y A;  2QEC A;  3DR6 A;  4MBU A;  3TO7 A;  3W91 A;  5H84 A;  3EXN A;  4R9M A;  1Q2C A;  3P2H A;  5F49 A;  2PSW A;  3PP9 A;  2REF A;  5EBV A;  2HQY A;  4KOW A;  3D2P A;  2OZG A;  2YNC C;  4HNX B;  4KUA A;  1RO5 A;  5J8F A;  2J8M A;  2O28 A;  5ISV A;  4ZGY B;  4K30 A;  1QSO A;  4ZBG A;  3A9L A;  4C68 A;  1XIX A;  4B5P B;  2PDO A;  3SHP A;  4CAW A;  2Z0Z A;  1FY7 A;  4KOR A;  2NMT A;  4CGN A;  3D8P A;  4QVT A;  5AG7 A;  3EY5 A;  1S7K A;  3DDD A;  1U6M A;  2HUZ A;  4U9Y A;  3S6G A;  4YRH A;  3TFY A;  2OZH A;  3UY5 A;  3C26 A;  2YNE A;  2VBQ A;  4XNH C;  2ARH A;  4UCM A;  1B6B A;  4MFQ A;  4PSW A;  3ZZI A;  4CRY B;  1M4I A;  4IF5 A;  2OH1 A;  1S3Z A;  2FT0 A;  4ONU A;  2H5M A;  2J8N A;  1MJA A;  1MJB A;  2FXF A;  1V0C A;  4CYO A;  3H4Q A;  3GKR A;  2FS5 A;  4NEX A;  2VI7 A;  3OWC A;  2Q44 A;  4MJ8 A;  4MFJ A;  2FSR A;  4UA3 A;  3P2F A;  5DWM A;  2CNM A;  2B4D A;  2Z10 A;  5H86 A;  2Q4V A;  3TOA A;  4AG7 A;  2B3U A;  3KKW A;  2C27 A;  1XMT A;  3RYO A;  4KOX A;  2VZZ A;  4CS0 B;  1IYK A;  1QST A;  1S7N A;  3CXS A;  2KCW A;  4HNW B;  4XPK A;  3S6K A;  3F0A A;  1S7L A;  3TO9 A;  1I1D A;  3GYA A;  3IWE A;  4PSX A;  5I0C A;  2JLM A;  1Z4E A;  2Z3K A;  4FD7 A;  5KTC A;  4MY3 A;  3FB3 A;  4L8A A;  3VWD A;  5IX3 A;  2ZW6 A;  3IU1 A;  2FCK A;  2DXQ A;  5F46 A;  2ZW4 A;  4FD4 A;  1IIC A;  3D3S A;  3CXP A;  4CAE A;  4XPD C;  1OZP A;  3BJ7 A;  4CYN A;  4HNY B;  4OLL A;  4XPL A;  3ZJ0 A;  2WSA A;  4CAV A;  2OZU A;  4KSA A;  4CAF A;  3CXQ A;  3SXN A;  4M3S A;  1NSL A;  4B5P A;  3IGR A;  4A30 A;  2WPX A;  3BJ8 A;  2Q0Y A;  5BWA B;  3LOD A;  1CJW A;  4RI1 A;  1YVO A;  2G3T A;  3E0K A;  5G20 A;  3VWE A;  4CAX A;  5FVJ A;  4UCP A;  3G3S A;  4UWI A;  4BMH A;  3TT2 A;  1CM0 A;  2IL4 A;  2JDD A;  4JJX A;  2BSW A;  1MJ9 A;  1R57 A;  2REE A;  3TCV A;  1I12 A;  2Z3N A;  4B14 A;  1SQH A;  4UBR A;  3R1K A;  4AB7 A;  3S6H A;  4KUB A;  2P6F A;  3G8W A;  1J4J A;  2YGW A;  2DPT A;  4FD6 A;  3FXT A;  2CNS A;  2R98 A;  2Q7B A;  4KOY A;  3TOB A;  2WUU A;  1Y9K A;  4Y49 B;  3R96 A;  4QBJ A;  1KZF A;  5G22 A;  4PV6 A;  4H6Z A;  4ORF A;  4C7I A;  4KLV A;  1YLE A;  3QB8 A;  5AG4 A;  2FE7 A;  2VQY A;  4UCN A;  2VXK A;  3IU2 A;  2B5G B;  3DSB A;  4NCZ A;  2ZPA A;  4UFW A;  1P0H A;  4LUA A;  2D4O A;  4B12 A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...