5DWMA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
HMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Transferase
molecule keywords Phosphinothricin N-acetyltransferase
total genus 53
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwmA00
5HH1A 2B58A 1R57A 1VKCA 2CNMA 2KCWA 2O28A 2REEA 3CXPA 5C88A 1M4DA 4XPDC 4R87A 5F46A 4JJXA 1Z9UA 4KOTA 3R9FA 2CY2A 4AVCA 2A4NA 1YGHA 2B4DB 4U9ZA 4PV6A 2Q7BA 3ZZIA 1S5KA 3RYOA 2GIVA 5JQ4A 1RXTA 2VXKA 3FRMA 2BSWA 4H6UA 1IIDA 3F0AA 4RS2A 1B87A 4GS4A 3B8GA 3TO6A 2VI7A 2PDOA 3OWCA 4F6AA 2Z10A 1S7LA 4KVME 4R57A 4LX9A 4QUSA 3D3SA 4HNWB 3R95A 2FSRA 1IYKA 2IL4A 3T90A 5KTAA 1NSLA 1NE9A 5J8CA 4EVYA 4X5KA 4IF5A 3D8PA 2BEIA 1KUYA 2BL1A 3PP9A 1WK4A 1S7FA 4B5OA 2K5TA 3PGPA 4H6ZA 4YGOA 5GCNA 2PQ8A 4FD6A 4MHDA 4NF1A 3TFYA 4AG7A 2WPXA 2R8VA 4R3KA 4K30A 3R1KA 2WPWA 2NMTA 3DSBA 1MJBA 2JDDA 3EC4A 4F0YA 3S6FA 3K9UA 3TTHA 3R96A 3W6XA 1QSOA 4M85A 2PC1A 4B5PB 2GE3A 4UWIA 1RO5A 2PR1A 3NE7A 4FD5A 1S7NA 5ISVA 3LODA 4MBUA 3I3GA 2PSWA 4KUAA 2FT0A 4KORA 3JVNA 3G3SA 3LD2A 1SQHA 4MY3A 3GYAA 3G8WA 1M4GA 4XPKA 4AVBA 3V8IA 5IB0A 3QB8A 1L0CA 4KLWA 3W91A 3D2MA 4KOUA 4KOVA 1ON0A 2P6GA 2OH1A 3PZJA 2VBQA 4PK2A 1KUXA 4YRHA 4NEXA 3S6KA 5JPHA 1IYLA 1VHSA 2VZYA 1WWZA 3TE4A 1Y9KA 2H5MA 2BUEA 2J8NA 2HV2A 2HUZA 5H84A 3EXNA 2Z0ZA 2QIRA 2FIAA 3N7ZA 1S3ZA 1S7KA 4ZBGA 1M4IA 4B5PA 4ORFA 3FIXA 1KUVA 1MK4A 3TO7A 4CRYB 1NMTA 4IUSA 4CAVA 4KVXA 5F48A 1CJWA 3I9SA 2ZW7A 1Q2DA 1OZPA 3P2FA 2DXQA 1B6BA 1V0CA 3BJ8A 2Q44A 4QVTA 2HQYA 3CXQA 4UBRA 3UY5A 3P2HA 4J3GA 1BO4A 4Y49B 2Q04A 4MJ8A 3TT2A 4MY0A 4R9MA 2VEZA 4YFJA 1YVKA 3W6SA 3EO4A 3SXNA 2B4DA 2Y0MA 2Q4VA 2P6FA 1P0HA 2P0WA 1I12A 4JXRA 5HMNA 2D4OA 1QSRA 3IGRA 3EFAA 3KKWA 2B5GB 2CNTA 2G3AA 2QECA 4LUAA 3CXSA 2FCKA 4E8OA 1Q2YA 4QC6A 3ZJ0A 3T9YA 3R9EA 3E0KA 1Z4RA 2Q0YA 2J8RA 4U5YA 2ZW6A 2R1IA 4PK3A 4CS0B 4BMHA 1PU9A 2F5IA 2OB0A 4JD6A 4NSQA 4KOSA 1LRZA 3FYNA 4I49A 3S6HA 1YK3A 3TOAA 2FIWA 1UFHA 1XE4A 2G0BA 4CAWA 2JLMA 3TO9A 5C82A 4QBJA 2Z11A 4XNHC 2PRBA 2ZW4A 2D4PA 3VWDA 1QSTA 2R98A 5F47A 3DR8A 3JUWA 5DWNA 5E96A 2FXFA 2C27A 2OZUA 4OADA 4NXYA 5KTDA 1U6MA 4XPLA 3TOBA 2B5GA 2PR8A 1K4JA 4AVAA 4L89A 4UWJA 1Y7RA 2AJ6A 4U9YA 3F8KA 3H4QA 4R3LA 4OLLA 1PUAA 2FL4A 3BJ7A 4KVOE 2B3VA 3IWGA 4E0AA 4FD4A 5IX3A 4XPDB 1CM0A 2QMLA 3EY5A 4PSWA 2CNSA 4KOYA 1Z4EA 5EC4A 4FD7A 4XNHB 3SXOA 1I21A 1TIQA 3FB3A 2AE6A 1BOBA 2OZHA 4QB9A 4CAXA 2FS5A 4L8AA 4DNCA 4KZTA 2VZZA 3FNCA 4KUBA 3FXTA 2B3UA 2Q4YA 2R7HA 2REFA 1XIXA 1KZFA 2I79A 1QSMA 3F5BA 5EBVA 3C26A 1IB1E 4RI1A 1XF8A 5J8FA 3DR6A 2ZXVA 5DWMA 3GY9A 2P6EA 1YR0A 2G3TA 5IV0A 3R9GA 1M1DA 2J8MA 4AB7A 3VWEA 2FE7A 1YVOA 2OZGA 4ONUA 3BLNA 4KOXA 3WR7A 1YX0A 2OU2A 1I1DA 4M3SA 2GANA 2JDCA 1GHEA 5F49A 2X7BA 4PSXA 5KTCA 1M44A 1YREA 1J4JA 3S6GA 4Y49C 5FVJA 2ATRA 5I0CA 4HNYB 3SHPA 1MJ9A 3DDDA 4KOWA 1YLEA 4KLVA 1QSNA 2ARHA 1IICA 1Q2CA 1S60A 2JEVA 1N71A 3D2PA 4II9A 1P4NA 2EUIA 4JLYA 4NCZA 4OAEA 3GKRA 4MI4A 3FBUA 4HNXB 2EVNA 4CRZB 1Y9WA 2VQYA 5CNPA 2ZW5A 5H86A 1FY7A 4JWPA 3QAHA 1XEBA 1XMTA 4JXQA 4HKFA 2I00A 3MGDA 3DNSA 1MJAA 4E2AA 3TCVA 4AG9A 2B4BA 4UA3A 4H89A 2RC4A 2ZPAA
chains in the Genus database with same CATH superfamily
2JEWA 2B58A 5HH1A 1YMEA 3PEIA 4B13A 4P4BA 1R57A 5A28A 1VKCA 2CNMA 2KCWA 2O28A 2REEA 2ZENA 4MFKA 3CXPA 3FMCA 4NJRA 3NH8A 1M4DA 4XPDC 5C88A 4R87A 3WC5A 4M6GA 5LRGA 4A37A 5F46A 4JJXA 1Z9UA 3S9MA 1YSJA 3SI0A 4KOTA 3R9FA 2CY2A 4P4JA 4AVCA 2G9DA 4DUKA 2A4NA 3D7FA 2AFWA 4M6HA 4MFLA 2HB6A 3D68A 4MFQA 2PJ2A 1YGHA 4YWYA 2B4DB 4U9ZA 1VHEA 4K3NA 4BBHA 4MFJA 4MCRA 1ZLHA 2DEAA 4PV6A 4OC5A 2Q7BA 3RAMA 3D66A 3ZZIA 1S5KA 4CGMA 3RYOA 2GIVA 2PJ4A 5JQ4A 1RXTA 2ZEEA 2VXKA 3FRMA 2BSWA 3D7DA 2PJ0A 4C68A 5HXDA 4H6UA 1HEEA 5AG5A 3LWUA 1IIDA 1XMBA 4R6TA 2V8VA 3WT4A 3F0AA 4RS2A 1B87A 3QNVA 4GS4A 5AG7A 3B8GA 5LYDA 3K2KA 3CT9A 3TO6A 4OC0A 2WUUA 2VI7A 2PDOA 3OWCA 4NGNA 4F6AA 3BHXA 2Z10A 2Q7SA 1BPMA 3SJGA 1CX8A 1S7LA 4UEEA 4KVME 4R57A 4LX9A 4QUSA 3D3SA 3B2YA 5G1ZA 4MXUA 4HNWB 1ELLP 2O4HA 3DGVA 3R95A 3FF3A 2FSRA 3D7GA 1IYKA 3FEEA 2IL4A 5LYIA 3PFEA 4P4IA 3PBBA 4OKOA 4FWUA 3T90A 5KTAA 1NSLA 4A38A 4B6ZA 1NE9A 3VATA 4X2TA 5J8CA 1CPXA 3JTKA 4EVYA 2J9AA 4UIAA 4IF5A 4X5KA 1Z8WA 4MCSA 2JBJA 3D8PA 2BEIA 4PXBA 1TKJA 2V8HA 1LOKA 2CXAA 1EE3P 1FNOA 1KUYA 2BL1A 3PP9A 1QMUA 1S7FA 1WK4A 2PJ7A 3KHZA 4B5OA 2K5TA 3GIUA 1ZO0A 5CBMA 1VHOA 2RFHA 4C2YA 3PGPA 4DJLA 1PCAA 2AFUA 3K9TA 4H6ZA 4YGOA 5GCNA 2PQ8A 4FD6A 1Y7EA 4MHDA 4NF1A 2YGWA 3TFYA 4AG7A 2WPXA 2R8VA 4K30A 4R3KA 3R1KA 2OOTA 4A94A 2WPWA 2NMTA 5D8NA 3DSBA 2V77A 3SJXA 1MJBA 2JDDA 3EC4A 3IU2A 4RN7A 4F0YA 5LRJA 3S6FA 3K9UA 4CGLA 3D67A 2DF5A 3IIBA 1QQ9A 4MHNA 3R96A 3TTHA 4Z65A 3W6XA 1QSOA 2YNEA 4M85A 1F57A 3TC8A 2PC1A 2PJBA 4R7MA 4B5PB 2GE3A 4CYPA 5LYFA 3FH4A 1VIXA 3KR4A 4UWIA 1RO5A 2PR1A 1XRYA 2EK8A 3NE7A 1S7NA 4FD5A 4CAEA 2Z3PA 5ISVA 3LODA 4MBUA 3I3GA 3FVLA 4C7HA 2PSWA 4EMEA 4HPSA 3RZAA 2HC9A 3FJUA 3FEDA 3GUXA 3KI9A 3LACA 2FT0A 4KUAA 4KORA 3JVNA 3L2NA 3CPXA 3G3SA 3LD2A 1SQHA 4MY3A 4NGQA 3IWWA 3GLJA 3GYAA 4UFVA 4ZX9A 2XEIA 1ZG7A 3G8WA 5K8OA 1M4GA 4XPKA 4G1PA 4AVBA 1Z8XA 2ANPA 5CPAA 3V8IA 5IB0A 5JH9A 3HLPA 3QB8A 1L0CA 3GB0A 4KLWA 3D2MA 3KL9A 4KOUA 3W91A 1ARMA 4KOVA 3B3SA 4F8ZA 3KQZA 1XOVA 1ON0A 2P6GA 2OH1A 1AUGA 3PZJA 4R76A 2GLFA 2VBQA 4PK2A 1KUXA 1LFWA 3PB7X 4YRHA 4NEXA 3S6KA 5JPHA 2NYQA 2Z3MA 1RTQA 1HDQA 2EWBA 5G21A 1IYLA 1VHSA 3IWEA 4ZI6A 5JGFA 1PYTB 2VZYA 1WWZA 3TE4A 3B35A 1Y9KA 1IGBA 4F9UA 2H5MA 2BUEA 1LAPA 2J8NA 1FT7A 2HV2A 2HUZA 1Q7LA 5H84A 2GFQA 4F0XA 1YW6A 2Q43A 3EXNA 3PBEA 2WZNA 2Z0ZA 4UCMA 2QIRA 2FIAA 3N7ZA 1S3ZA 1S7KA 4NFRA 4ZBGA 1M4IA 2O53A 4Q36A 4ZYQA 3KGQA 4BD9A 3IU1A 1TF9A 2C6CA 4B10A 3H8EA 1CP6A 4PXDA 4B5PA 4ORFA 5AGEA 4NGPA 3FIXA 2C6PA 5EMIA 1KUVA 1MK4A 3TO7A 4CRYB 1NMTA 4MCQA 2GU2A 3B7IA 4IUSA 4OC3A 1TXRA 4CAFA 4M6IA 4PXCA 5F09A 1Y0RA 4CAVA 4KVXA 4IAVA 5F48A 1CJWA 3I9SA 2ZW7A 3IEHA 1Q2DA 8CPAA 1OZPA 4A95A 2Q51A 4C7IA 3P2FA 4DYOA 3FX6A 2CTBA 2DXQA 1B6BA 1V0CA 3BJ8A 4P4DA 4NGSA 2Q44A 4QVTA 5G22A 2HQYA 3CXQA 1XBUA 4UBRA 4JZ0A 3PB9X 2EO8A 3P2HA 4J3GA 3UY5A 1BO4A 4Y49B 2Q04A 3NFZA 4MJ8A 4UEFA 4AXVA 3ISXA 3TT2A 4MY0A 5G20A 4R9MA 2VEZA 1CPSA 1DE4C 4YFJA 4ZGYB 1YVKA 3B3CA 4C2ZA 4CGNA 3W6SA 3EO4A 1ZLIA 3SXNA 2IJZA 4GXHA 2B4DA 3A9LA 2Y0MA 1R3NA 2Q4VA 2P6FA 4NGTA 4CPAA 3S9LA 1P0HA 3IC1A 3MRUA 1ARLA 2AFMA 2P0WA 3PB6X 1I12A 4JXRA 3CZXA 4WJBA 4EFDA 2WYRA 4W9YA 5HMNA 2D4OA 4UCPA 4GM5A 4NJQA 1QSRA 2PJ6A 1AYEA 2OR4A 3IGRA 1CP7A 3EFAA 2F7VA 3KKWA 2B5GB 1ELMP 3KZWA 4MHPA 2CNTA 2PJ8A 2V8GA 1X12A 5LRKA 2G3AA 2QECA 1CBXA 2RB7A 4LUAA 1M4LA 3CXSA 4A30A 2FCKA 4E8OA 3D7HA 1Q2YA 4QC6A 3ZJ0A 1HDUA 2ZOGA 3T9YA 3R9EA 1UWYA 2ZEDA 3E0KA 2IMOA 5HVHA 2PJ5A 3NA6A 1GYTA 1A2ZA 3RNZA 1Z4RA 2Q0YA 1CG2A 2J8RA 2BO9A 2ZW6A 3PRTA 4U5YA 2PJAA 3BI1A 1Z8TA 2R1IA 1LAMA 4PK3A 4CS0B 4BMHA 4UF4A 5IB9A 1PU9A 2F5IA 2OB0A 4JD6A 4NSQA 1LRZA 4KOSA 4OC4A 3FYNA 4I49A 5K8MA 5LYLA 3S6HA 4TWEA 1LANA 1YK3A 3KASA 3TOAA 4YU9A 2FIWA 4A31A 4A33A 1UFHA 1XE4A 2GREA 2G0BA 3PB4X 2QJ8A 3I1UA 3FECA 1KWMA 4CAWA 2XEGA 4X8IA 2CTCA 2JLMA 2ABZA 2ZELA 4ONWA 4X3RA 3H5ZA 3B3TA 5AG6A 3TO9A 4CYOA 3IFEA 5C82A 3KQXA 4QBJA 2Z11A 4XNHC 4NGRA 2PRBA 3BI0A 2ZW4A 2PJ3A 2D4PA 1IOIA 5HVGA 3QAYA 3PFOA 3VWDA 2YNCC 1QSTA 4CYQA 5ELYA 3NE8A 1YLOA 2R98A 4A39A 4A32A 5F47A 1JWQA 2PJ1A 2XEJA 1ZG8A 2Z3OA 3DR8A 3JUWA 5DWNA 5E96A 2FXFA 2C27A 2OZUA 3MN8A 3CPAA 3PB8X 3SJFA 4EWTA 4UIBA 5I4MA 4OADA 4NXYA 3RBUA 5KTDA 2ZEHA 3T8WA 1U6MA 4XPLA 3TOBA 2B5GA 2PR8A 3LMSA 1K4JA 4IHMA 4AVAA 1YQEA 5JM6A 1H8LA 1ZG9A 4L89A 2DPSA 4UWJA 1Y7RA 4NGMA 2V8DA 2AJ6A 5HVFA 4U9YA 4R8FA 2ZEMA 4TNUA 4MFPA 3TX8A 1YW4A 3WABA 2PIZA 2AFSA 3F8KA 4KSIA 3H4QA 4R3LA 3CDXA 2PCUA 2CF4A 2Z3LA 4LQGA 1PUAA 2FL4A 3BJ7A 4KVOE 4OLLA 1XJOA 1TKFA 2B3VA 2PE3A 3IWGA 4B11A 4E0AA 2FVGA 4MMOA 2PRQA 3KR5A 1Z2LA 4FD4A 2PVVA 4OC2A 5IX3A 6CPAA 3D4UA 4XPDB 2ZEPA 1CM0A 2QMLA 1XFOA 1TKHA 2PVWA 4MFZA 4Q7AA 3EY5A 4PSWA 2CNSA 4KOYA 1Z4EA 5EC4A 4FD7A 2IQ6A 4P4EA 3HUVA 4XNHB 1BPNA 3SXOA 3VARA 1F2PA 1I21A 1TIQA 3V7ZA 3NH4A 3FB3A 4Q38A 4CGOA 2ZOFA 2ZEGA 2AE6A 1BOBA 4MCPA 2OZHA 2Z3KA 4CGPA 4QB9A 4OC1A 3NH5A 1Z8LA 4UEZA 2FS5A 4CAXA 1OBRA 4L8AA 3IJ3A 4P10A 5K8PA 4DNCA 2AFXA 3S9NA 4KZTA 4P4FA 2VZZA 3FNCA 4KUBA 2ZEFA 4OMEA 3FXTA 4UCNA 1AMPA 4BINA 4ZY2A 2B3UA 2Q4YA 2R7HA 2REFA 4OP4A 1XIXA 1KZFA 5AG4A 2NSMA 2I79A 1QSMA 3F5BA 3VH9A 5THWA 5EBVA 4B12A 3C26A 3H8FA 3SI1A 4A2ZA 2JBKA 1IB1E 5J1QA 4RI1A 4IK2A 1XF8A 4P45A 1VGYA 2ZXVA 3DR6A 5J8FA 5DWMA 4FAIA 1F2OA 2AFOA 2QYVA 3RO0A 2AFZA 3GY9A 2YNCA 4ZY0A 2P6EA 2QVPA 1YR0A 2G3TA 4H2KA 3JRUA 5IV0A 1DTDA 1IOFA 1Z5RA 1M1DA 2BCOA 3R9GA 4ZX8A 3H8GA 2J8MA 4B14A 4KS9A 4UFXA 4AB7A 3VWEA 4UFWA 2FE7A 1YVOA 2OZGA 2XEFA 3B3VA 2PJ9A 2DPTA 4ONUA 1X10A 3BLNA 3IO1A 1YX0A 4KOXA 2OU2A 4MHYA 3WR7A 4F9VA 1Y0YA 1I1DA 3B3WA 4M3SA 4FBEA 2BOAA 2GANA 2JDCA 1R43A 4MRIA 4C2XA 1IU8A 1GHEA 4P44A 4PPZA 5F49A 2X7BA 4PSXA 5KTCA 1M44A 2ODFA 1YREA 4OIDA 1J4JA 3S6GA 5DS0A 1JQGA 3KHXA 3V38A 4Y49C 4MHZA 5FVJA 2ATRA 5I0CA 4HNYB 4WWVA 3SHPA 4PXEA 1NSAA 1MJ9A 3DDDA 2C6GA 4KOWA 1LCPA 1YLEA 2I3CA 4KLVA 1QSNA 2PIYA 2EBJA 2GLJA 2Z3NA 2ARHA 5BWAB 1IICA 1Q2CA 1S60A 4RUHA 2F8HA 4KSFA 4LQ6A 2JEVA 4FUUA 1N71A 3D2PA 4II9A 1P4NA 2Q4ZA 2C1CA 2CIJA 2EUIA 4JLYA 4NCZA 4OAEA 4P6YA 3GKRA 1TF8A 2WSAA 3N5FA 4MI4A 3FBUA 4OIWA 1IY7A 2EVNA 4HNXB 4CRZB 1Y9WA 4KSAA 2VQYA 5A27A 5CNPA 2ZW5A 5H86A 1BAVA 1FY7A 4JWPA 5D29A 3QAHA 3SI2A 1XEBA 4CYNA 4ZY1A 2VL1A 1XMTA 5K8NA 3ISZA 4JYWA 4JXQA 4HKFA 2YNDA 4O23A 7CPAA 2I00A 3MGDA 2PJCA 2POKA 3DNSA 1MJAA 4E2AA 3WC6A 3TCVA 3WC7A 3BXMA 2EK9A 4AG9A 1BLLE 2B4BA 4PQAA 4H89A 4UA3A 3SJEA 2ZEOA 3DLJA 2RC4A 2ZPAA
chains in the Genus database with same CATH topology
5HH1A 2B58A 4B13A 1R57A 5A28A 1VKCA 2CNMA 2KCWA 2O28A 2REEA 4MFKA 3CXPA 5C88A 1M4DA 4XPDC 4R87A 5F46A 4JJXA 1Z9UA 4KOTA 3R9FA 2CY2A 4AVCA 2A4NA 4MFLA 4MFQA 1YGHA 2B4DB 4U9ZA 4BBHA 4MFJA 4PV6A 2Q7BA 3ZZIA 1S5KA 4CGMA 3RYOA 2GIVA 5JQ4A 1RXTA 2VXKA 3FRMA 2BSWA 4C68A 4H6UA 5AG5A 1IIDA 3F0AA 4RS2A 1B87A 4GS4A 5AG7A 3B8GA 3TO6A 2WUUA 2VI7A 2PDOA 3OWCA 4F6AA 2Z10A 1S7LA 4KVME 4R57A 4LX9A 4QUSA 3D3SA 5G1ZA 4HNWB 3R95A 2FSRA 1IYKA 2IL4A 3T90A 5KTAA 1NSLA 1NE9A 5J8CA 3JTKA 4EVYA 4X5KA 4IF5A 3D8PA 2BEIA 2CXAA 1KUYA 2BL1A 3PP9A 1WK4A 1S7FA 4B5OA 2K5TA 1ZO0A 4C2YA 3PGPA 4H6ZA 4YGOA 5GCNA 2PQ8A 4FD6A 4MHDA 4NF1A 2YGWA 3TFYA 4AG7A 2WPXA 2R8VA 4K30A 4R3KA 3R1KA 2WPWA 2NMTA 3DSBA 1MJBA 2JDDA 3EC4A 3IU2A 4F0YA 3S6FA 3K9UA 4CGLA 3TTHA 3R96A 3W6XA 2YNEA 1QSOA 4M85A 2PC1A 4B5PB 4CYPA 2GE3A 4UWIA 1RO5A 2PR1A 4CAEA 3NE7A 4FD5A 1S7NA 2Z3PA 5ISVA 3LODA 4MBUA 3I3GA 4C7HA 2PSWA 4KUAA 2FT0A 4KORA 3JVNA 3G3SA 3LD2A 1SQHA 4MY3A 4UFVA 3GYAA 3G8WA 1M4GA 4XPKA 4AVBA 3V8IA 5IB0A 3QB8A 1L0CA 4KLWA 3W91A 3D2MA 4KOUA 4KOVA 1ON0A 2P6GA 2OH1A 3PZJA 2VBQA 4PK2A 1KUXA 4YRHA 4NEXA 3S6KA 5JPHA 2Z3MA 5G21A 1IYLA 1VHSA 3IWEA 2VZYA 1WWZA 3TE4A 1Y9KA 2H5MA 2BUEA 2J8NA 2HV2A 2HUZA 5H84A 4F0XA 3EXNA 2Z0ZA 4UCMA 2QIRA 2FIAA 3N7ZA 1S3ZA 1S7KA 4ZBGA 1M4IA 4Q36A 3IU1A 4B10A 4B5PA 4ORFA 5AGEA 3FIXA 1KUVA 1MK4A 3TO7A 4CRYB 1NMTA 4IUSA 4CAFA 4CAVA 4KVXA 5F48A 1CJWA 3I9SA 2ZW7A 1Q2DA 1OZPA 4A95A 4C7IA 3P2FA 2DXQA 1B6BA 1V0CA 3BJ8A 2Q44A 4QVTA 5G22A 2HQYA 3CXQA 4UBRA 3UY5A 3P2HA 4J3GA 1BO4A 4Y49B 2Q04A 4MJ8A 3TT2A 4MY0A 5G20A 4R9MA 2VEZA 4YFJA 4ZGYB 1YVKA 4C2ZA 4CGNA 3W6SA 3EO4A 3SXNA 2B4DA 3A9LA 2Y0MA 2Q4VA 2P6FA 1P0HA 2P0WA 1I12A 4JXRA 5HMNA 2D4OA 4UCPA 1QSRA 3IGRA 3EFAA 3KKWA 2B5GB 2CNTA 2G3AA 2QECA 4LUAA 3CXSA 4A30A 2FCKA 4E8OA 1Q2YA 4QC6A 3ZJ0A 3T9YA 3R9EA 3E0KA 1Z4RA 2Q0YA 2J8RA 4U5YA 2ZW6A 2R1IA 4PK3A 4CS0B 4BMHA 1PU9A 2F5IA 2OB0A 4JD6A 4NSQA 4KOSA 1LRZA 3FYNA 4I49A 3S6HA 1YK3A 3TOAA 2FIWA 4A31A 4A33A 1UFHA 1XE4A 2G0BA 4CAWA 2JLMA 3H5ZA 5AG6A 3TO9A 4CYOA 5C82A 4QBJA 2Z11A 4XNHC 2PRBA 2ZW4A 2D4PA 3VWDA 2YNCC 1QSTA 4CYQA 2R98A 4A32A 5F47A 2Z3OA 3DR8A 3JUWA 5DWNA 5E96A 2FXFA 2C27A 2OZUA 4OADA 4NXYA 5KTDA 1U6MA 4XPLA 3TOBA 2B5GA 2PR8A 1K4JA 4AVAA 4L89A 4UWJA 2DPSA 1Y7RA 2AJ6A 4U9YA 4MFPA 3F8KA 3H4QA 4R3LA 2Z3LA 1PUAA 2FL4A 3BJ7A 4KVOE 4OLLA 2B3VA 3IWGA 4B11A 4E0AA 4FD4A 5IX3A 4XPDB 1CM0A 2QMLA 4MFZA 3EY5A 4PSWA 2CNSA 4KOYA 1Z4EA 5EC4A 4FD7A 4XNHB 3SXOA 1I21A 1TIQA 3FB3A 4Q38A 4CGOA 2AE6A 1BOBA 2OZHA 2Z3KA 4CGPA 4QB9A 4CAXA 2FS5A 4L8AA 4DNCA 4KZTA 2VZZA 3FNCA 4KUBA 3FXTA 4UCNA 2B3UA 2Q4YA 2R7HA 2REFA 5AG4A 1XIXA 1KZFA 2I79A 1QSMA 3F5BA 5EBVA 4B12A 3C26A 4A2ZA 1IB1E 4RI1A 1XF8A 5J8FA 3DR6A 2ZXVA 5DWMA 3GY9A 2YNCA 2P6EA 1YR0A 2G3TA 5IV0A 3R9GA 1M1DA 2J8MA 4B14A 4KS9A 4UFXA 4AB7A 3VWEA 4UFWA 2FE7A 1YVOA 2OZGA 2DPTA 4ONUA 3BLNA 4KOXA 3WR7A 1YX0A 2OU2A 1I1DA 4M3SA 2GANA 2JDCA 4C2XA 1GHEA 5F49A 2X7BA 4PSXA 5KTCA 1M44A 1YREA 1J4JA 3S6GA 4Y49C 5FVJA 2ATRA 5I0CA 4HNYB 3SHPA 1MJ9A 3DDDA 4KOWA 1YLEA 4KLVA 1QSNA 2Z3NA 2ARHA 5BWAB 1IICA 1Q2CA 1S60A 4KSFA 2JEVA 1N71A 3D2PA 4II9A 1P4NA 2EUIA 4JLYA 4NCZA 4OAEA 3GKRA 2WSAA 4MI4A 3FBUA 4HNXB 2EVNA 4CRZB 4KSAA 1Y9WA 2VQYA 5A27A 5CNPA 2ZW5A 5H86A 4CYNA 1FY7A 4JWPA 3QAHA 1XEBA 1XMTA 4JXQA 4HKFA 2YNDA 2I00A 3MGDA 3DNSA 1MJAA 4E2AA 3TCVA 4AG9A 2B4BA 4UA3A 4H89A 2RC4A 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HH1 A;  2B58 A;  1R57 A;  1VKC A;  2CNM A;  2KCW A;  2O28 A;  2REE A;  3CXP A;  5C88 A;  1M4D A;  4XPD C;  4R87 A;  5F46 A;  4JJX A;  1Z9U A;  4KOT A;  3R9F A;  2CY2 A;  4AVC A;  2A4N A;  1YGH A;  2B4D B;  4U9Z A;  4PV6 A;  2Q7B A;  3ZZI A;  1S5K A;  3RYO A;  2GIV A;  5JQ4 A;  1RXT A;  2VXK A;  3FRM A;  2BSW A;  4H6U A;  1IID A;  3F0A A;  4RS2 A;  1B87 A;  4GS4 A;  3B8G A;  3TO6 A;  2VI7 A;  2PDO A;  3OWC A;  4F6A A;  2Z10 A;  1S7L A;  4KVM E;  4R57 A;  4LX9 A;  4QUS A;  3D3S A;  4HNW B;  3R95 A;  2FSR A;  1IYK A;  2IL4 A;  3T90 A;  5KTA A;  1NSL A;  1NE9 A;  5J8C A;  4EVY A;  4X5K A;  4IF5 A;  3D8P A;  2BEI A;  1KUY A;  2BL1 A;  3PP9 A;  1WK4 A;  1S7F A;  4B5O A;  2K5T A;  3PGP A;  4H6Z A;  4YGO A;  5GCN A;  2PQ8 A;  4FD6 A;  4MHD A;  4NF1 A;  3TFY A;  4AG7 A;  2WPX A;  2R8V A;  4R3K A;  4K30 A;  3R1K A;  2WPW A;  2NMT A;  3DSB A;  1MJB A;  2JDD A;  3EC4 A;  4F0Y A;  3S6F A;  3K9U A;  3TTH A;  3R96 A;  3W6X A;  1QSO A;  4M85 A;  2PC1 A;  4B5P B;  2GE3 A;  4UWI A;  1RO5 A;  2PR1 A;  3NE7 A;  4FD5 A;  1S7N A;  5ISV A;  3LOD A;  4MBU A;  3I3G A;  2PSW A;  4KUA A;  2FT0 A;  4KOR A;  3JVN A;  3G3S A;  3LD2 A;  1SQH A;  4MY3 A;  3GYA A;  3G8W A;  1M4G A;  4XPK A;  4AVB A;  3V8I A;  5IB0 A;  3QB8 A;  1L0C A;  4KLW A;  3W91 A;  3D2M A;  4KOU A;  4KOV A;  1ON0 A;  2P6G A;  2OH1 A;  3PZJ A;  2VBQ A;  4PK2 A;  1KUX A;  4YRH A;  4NEX A;  3S6K A;  5JPH A;  1IYL A;  1VHS A;  2VZY A;  1WWZ A;  3TE4 A;  1Y9K A;  2H5M A;  2BUE A;  2J8N A;  2HV2 A;  2HUZ A;  5H84 A;  3EXN A;  2Z0Z A;  2QIR A;  2FIA A;  3N7Z A;  1S3Z A;  1S7K A;  4ZBG A;  1M4I A;  4B5P A;  4ORF A;  3FIX A;  1KUV A;  1MK4 A;  3TO7 A;  4CRY B;  1NMT A;  4IUS A;  4CAV A;  4KVX A;  5F48 A;  1CJW A;  3I9S A;  2ZW7 A;  1Q2D A;  1OZP A;  3P2F A;  2DXQ A;  1B6B A;  1V0C A;  3BJ8 A;  2Q44 A;  4QVT A;  2HQY A;  3CXQ A;  4UBR A;  3UY5 A;  3P2H A;  4J3G A;  1BO4 A;  4Y49 B;  2Q04 A;  4MJ8 A;  3TT2 A;  4MY0 A;  4R9M A;  2VEZ A;  4YFJ A;  1YVK A;  3W6S A;  3EO4 A;  3SXN A;  2B4D A;  2Y0M A;  2Q4V A;  2P6F A;  1P0H A;  2P0W A;  1I12 A;  4JXR A;  5HMN A;  2D4O A;  1QSR A;  3IGR A;  3EFA A;  3KKW A;  2B5G B;  2CNT A;  2G3A A;  2QEC A;  4LUA A;  3CXS A;  2FCK A;  4E8O A;  1Q2Y A;  4QC6 A;  3ZJ0 A;  3T9Y A;  3R9E A;  3E0K A;  1Z4R A;  2Q0Y A;  2J8R A;  4U5Y A;  2ZW6 A;  2R1I A;  4PK3 A;  4CS0 B;  4BMH A;  1PU9 A;  2F5I A;  2OB0 A;  4JD6 A;  4NSQ A;  4KOS A;  1LRZ A;  3FYN A;  4I49 A;  3S6H A;  1YK3 A;  3TOA A;  2FIW A;  1UFH A;  1XE4 A;  2G0B A;  4CAW A;  2JLM A;  3TO9 A;  5C82 A;  4QBJ A;  2Z11 A;  4XNH C;  2PRB A;  2ZW4 A;  2D4P A;  3VWD A;  1QST A;  2R98 A;  5F47 A;  3DR8 A;  3JUW A;  5DWN A;  5E96 A;  2FXF A;  2C27 A;  2OZU A;  4OAD A;  4NXY A;  5KTD A;  1U6M A;  4XPL A;  3TOB A;  2B5G A;  2PR8 A;  1K4J A;  4AVA A;  4L89 A;  4UWJ A;  1Y7R A;  2AJ6 A;  4U9Y A;  3F8K A;  3H4Q A;  4R3L A;  4OLL A;  1PUA A;  2FL4 A;  3BJ7 A;  4KVO E;  2B3V A;  3IWG A;  4E0A A;  4FD4 A;  5IX3 A;  4XPD B;  1CM0 A;  2QML A;  3EY5 A;  4PSW A;  2CNS A;  4KOY A;  1Z4E A;  5EC4 A;  4FD7 A;  4XNH B;  3SXO A;  1I21 A;  1TIQ A;  3FB3 A;  2AE6 A;  1BOB A;  2OZH A;  4QB9 A;  4CAX A;  2FS5 A;  4L8A A;  4DNC A;  4KZT A;  2VZZ A;  3FNC A;  4KUB A;  3FXT A;  2B3U A;  2Q4Y A;  2R7H A;  2REF A;  1XIX A;  1KZF A;  2I79 A;  1QSM A;  3F5B A;  5EBV A;  3C26 A;  1IB1 E;  4RI1 A;  1XF8 A;  5J8F A;  3DR6 A;  2ZXV A;  5DWM A;  3GY9 A;  2P6E A;  1YR0 A;  2G3T A;  5IV0 A;  3R9G A;  1M1D A;  2J8M A;  4AB7 A;  3VWE A;  2FE7 A;  1YVO A;  2OZG A;  4ONU A;  3BLN A;  4KOX A;  3WR7 A;  1YX0 A;  2OU2 A;  1I1D A;  4M3S A;  2GAN A;  2JDC A;  1GHE A;  5F49 A;  2X7B A;  4PSX A;  5KTC A;  1M44 A;  1YRE A;  1J4J A;  3S6G A;  4Y49 C;  5FVJ A;  2ATR A;  5I0C A;  4HNY B;  3SHP A;  1MJ9 A;  3DDD A;  4KOW A;  1YLE A;  4KLV A;  1QSN A;  2ARH A;  1IIC A;  1Q2C A;  1S60 A;  2JEV A;  1N71 A;  3D2P A;  4II9 A;  1P4N A;  2EUI A;  4JLY A;  4NCZ A;  4OAE A;  3GKR A;  4MI4 A;  3FBU A;  4HNX B;  2EVN A;  4CRZ B;  1Y9W A;  2VQY A;  5CNP A;  2ZW5 A;  5H86 A;  1FY7 A;  4JWP A;  3QAH A;  1XEB A;  1XMT A;  4JXQ A;  4HKF A;  2I00 A;  3MGD A;  3DNS A;  1MJA A;  4E2A A;  3TCV A;  4AG9 A;  2B4B A;  4UA3 A;  4H89 A;  2RC4 A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 2JEW A;  2B58 A;  5HH1 A;  1YME A;  3PEI A;  4B13 A;  4P4B A;  1R57 A;  5A28 A;  1VKC A;  2CNM A;  2KCW A;  2O28 A;  2REE A;  2ZEN A;  4MFK A;  3CXP A;  3FMC A;  4NJR A;  3NH8 A;  1M4D A;  4XPD C;  5C88 A;  4R87 A;  3WC5 A;  4M6G A;  5LRG A;  4A37 A;  5F46 A;  4JJX A;  1Z9U A;  3S9M A;  1YSJ A;  3SI0 A;  4KOT A;  3R9F A;  2CY2 A;  4P4J A;  4AVC A;  2G9D A;  4DUK A;  2A4N A;  3D7F A;  2AFW A;  4M6H A;  4MFL A;  2HB6 A;  3D68 A;  4MFQ A;  2PJ2 A;  1YGH A;  4YWY A;  2B4D B;  4U9Z A;  1VHE A;  4K3N A;  4BBH A;  4MFJ A;  4MCR A;  1ZLH A;  2DEA A;  4PV6 A;  4OC5 A;  2Q7B A;  3RAM A;  3D66 A;  3ZZI A;  1S5K A;  4CGM A;  3RYO A;  2GIV A;  2PJ4 A;  5JQ4 A;  1RXT A;  2ZEE A;  2VXK A;  3FRM A;  2BSW A;  3D7D A;  2PJ0 A;  4C68 A;  5HXD A;  4H6U A;  1HEE A;  5AG5 A;  3LWU A;  1IID A;  1XMB A;  4R6T A;  2V8V A;  3WT4 A;  3F0A A;  4RS2 A;  1B87 A;  3QNV A;  4GS4 A;  5AG7 A;  3B8G A;  5LYD A;  3K2K A;  3CT9 A;  3TO6 A;  4OC0 A;  2WUU A;  2VI7 A;  2PDO A;  3OWC A;  4NGN A;  4F6A A;  3BHX A;  2Z10 A;  2Q7S A;  1BPM A;  3SJG A;  1CX8 A;  1S7L A;  4UEE A;  4KVM E;  4R57 A;  4LX9 A;  4QUS A;  3D3S A;  3B2Y A;  5G1Z A;  4MXU A;  4HNW B;  1ELL P;  2O4H A;  3DGV A;  3R95 A;  3FF3 A;  2FSR A;  3D7G A;  1IYK A;  3FEE A;  2IL4 A;  5LYI A;  3PFE A;  4P4I A;  3PBB A;  4OKO A;  4FWU A;  3T90 A;  5KTA A;  1NSL A;  4A38 A;  4B6Z A;  1NE9 A;  3VAT A;  4X2T A;  5J8C A;  1CPX A;  3JTK A;  4EVY A;  2J9A A;  4UIA A;  4IF5 A;  4X5K A;  1Z8W A;  4MCS A;  2JBJ A;  3D8P A;  2BEI A;  4PXB A;  1TKJ A;  2V8H A;  1LOK A;  2CXA A;  1EE3 P;  1FNO A;  1KUY A;  2BL1 A;  3PP9 A;  1QMU A;  1S7F A;  1WK4 A;  2PJ7 A;  3KHZ A;  4B5O A;  2K5T A;  3GIU A;  1ZO0 A;  5CBM A;  1VHO A;  2RFH A;  4C2Y A;  3PGP A;  4DJL A;  1PCA A;  2AFU A;  3K9T A;  4H6Z A;  4YGO A;  5GCN A;  2PQ8 A;  4FD6 A;  1Y7E A;  4MHD A;  4NF1 A;  2YGW A;  3TFY A;  4AG7 A;  2WPX A;  2R8V A;  4K30 A;  4R3K A;  3R1K A;  2OOT A;  4A94 A;  2WPW A;  2NMT A;  5D8N A;  3DSB A;  2V77 A;  3SJX A;  1MJB A;  2JDD A;  3EC4 A;  3IU2 A;  4RN7 A;  4F0Y A;  5LRJ A;  3S6F A;  3K9U A;  4CGL A;  3D67 A;  2DF5 A;  3IIB A;  1QQ9 A;  4MHN A;  3R96 A;  3TTH A;  4Z65 A;  3W6X A;  1QSO A;  2YNE A;  4M85 A;  1F57 A;  3TC8 A;  2PC1 A;  2PJB A;  4R7M A;  4B5P B;  2GE3 A;  4CYP A;  5LYF A;  3FH4 A;  1VIX A;  3KR4 A;  4UWI A;  1RO5 A;  2PR1 A;  1XRY A;  2EK8 A;  3NE7 A;  1S7N A;  4FD5 A;  4CAE A;  2Z3P A;  5ISV A;  3LOD A;  4MBU A;  3I3G A;  3FVL A;  4C7H A;  2PSW A;  4EME A;  4HPS A;  3RZA A;  2HC9 A;  3FJU A;  3FED A;  3GUX A;  3KI9 A;  3LAC A;  2FT0 A;  4KUA A;  4KOR A;  3JVN A;  3L2N A;  3CPX A;  3G3S A;  3LD2 A;  1SQH A;  4MY3 A;  4NGQ A;  3IWW A;  3GLJ A;  3GYA A;  4UFV A;  4ZX9 A;  2XEI A;  1ZG7 A;  3G8W A;  5K8O A;  1M4G A;  4XPK A;  4G1P A;  4AVB A;  1Z8X A;  2ANP A;  5CPA A;  3V8I A;  5IB0 A;  5JH9 A;  3HLP A;  3QB8 A;  1L0C A;  3GB0 A;  4KLW A;  3D2M A;  3KL9 A;  4KOU A;  3W91 A;  1ARM A;  4KOV A;  3B3S A;  4F8Z A;  3KQZ A;  1XOV A;  1ON0 A;  2P6G A;  2OH1 A;  1AUG A;  3PZJ A;  4R76 A;  2GLF A;  2VBQ A;  4PK2 A;  1KUX A;  1LFW A;  3PB7 X;  4YRH A;  4NEX A;  3S6K A;  5JPH A;  2NYQ A;  2Z3M A;  1RTQ A;  1HDQ A;  2EWB A;  5G21 A;  1IYL A;  1VHS A;  3IWE A;  4ZI6 A;  5JGF A;  1PYT B;  2VZY A;  1WWZ A;  3TE4 A;  3B35 A;  1Y9K A;  1IGB A;  4F9U A;  2H5M A;  2BUE A;  1LAP A;  2J8N A;  1FT7 A;  2HV2 A;  2HUZ A;  1Q7L A;  5H84 A;  2GFQ A;  4F0X A;  1YW6 A;  2Q43 A;  3EXN A;  3PBE A;  2WZN A;  2Z0Z A;  4UCM A;  2QIR A;  2FIA A;  3N7Z A;  1S3Z A;  1S7K A;  4NFR A;  4ZBG A;  1M4I A;  2O53 A;  4Q36 A;  4ZYQ A;  3KGQ A;  4BD9 A;  3IU1 A;  1TF9 A;  2C6C A;  4B10 A;  3H8E A;  1CP6 A;  4PXD A;  4B5P A;  4ORF A;  5AGE A;  4NGP A;  3FIX A;  2C6P A;  5EMI A;  1KUV A;  1MK4 A;  3TO7 A;  4CRY B;  1NMT A;  4MCQ A;  2GU2 A;  3B7I A;  4IUS A;  4OC3 A;  1TXR A;  4CAF A;  4M6I A;  4PXC A;  5F09 A;  1Y0R A;  4CAV A;  4KVX A;  4IAV A;  5F48 A;  1CJW A;  3I9S A;  2ZW7 A;  3IEH A;  1Q2D A;  8CPA A;  1OZP A;  4A95 A;  2Q51 A;  4C7I A;  3P2F A;  4DYO A;  3FX6 A;  2CTB A;  2DXQ A;  1B6B A;  1V0C A;  3BJ8 A;  4P4D A;  4NGS A;  2Q44 A;  4QVT A;  5G22 A;  2HQY A;  3CXQ A;  1XBU A;  4UBR A;  4JZ0 A;  3PB9 X;  2EO8 A;  3P2H A;  4J3G A;  3UY5 A;  1BO4 A;  4Y49 B;  2Q04 A;  3NFZ A;  4MJ8 A;  4UEF A;  4AXV A;  3ISX A;  3TT2 A;  4MY0 A;  5G20 A;  4R9M A;  2VEZ A;  1CPS A;  1DE4 C;  4YFJ A;  4ZGY B;  1YVK A;  3B3C A;  4C2Z A;  4CGN A;  3W6S A;  3EO4 A;  1ZLI A;  3SXN A;  2IJZ A;  4GXH A;  2B4D A;  3A9L A;  2Y0M A;  1R3N A;  2Q4V A;  2P6F A;  4NGT A;  4CPA A;  3S9L A;  1P0H A;  3IC1 A;  3MRU A;  1ARL A;  2AFM A;  2P0W A;  3PB6 X;  1I12 A;  4JXR A;  3CZX A;  4WJB A;  4EFD A;  2WYR A;  4W9Y A;  5HMN A;  2D4O A;  4UCP A;  4GM5 A;  4NJQ A;  1QSR A;  2PJ6 A;  1AYE A;  2OR4 A;  3IGR A;  1CP7 A;  3EFA A;  2F7V A;  3KKW A;  2B5G B;  1ELM P;  3KZW A;  4MHP A;  2CNT A;  2PJ8 A;  2V8G A;  1X12 A;  5LRK A;  2G3A A;  2QEC A;  1CBX A;  2RB7 A;  4LUA A;  1M4L A;  3CXS A;  4A30 A;  2FCK A;  4E8O A;  3D7H A;  1Q2Y A;  4QC6 A;  3ZJ0 A;  1HDU A;  2ZOG A;  3T9Y A;  3R9E A;  1UWY A;  2ZED A;  3E0K A;  2IMO A;  5HVH A;  2PJ5 A;  3NA6 A;  1GYT A;  1A2Z A;  3RNZ A;  1Z4R A;  2Q0Y A;  1CG2 A;  2J8R A;  2BO9 A;  2ZW6 A;  3PRT A;  4U5Y A;  2PJA A;  3BI1 A;  1Z8T A;  2R1I A;  1LAM A;  4PK3 A;  4CS0 B;  4BMH A;  4UF4 A;  5IB9 A;  1PU9 A;  2F5I A;  2OB0 A;  4JD6 A;  4NSQ A;  1LRZ A;  4KOS A;  4OC4 A;  3FYN A;  4I49 A;  5K8M A;  5LYL A;  3S6H A;  4TWE A;  1LAN A;  1YK3 A;  3KAS A;  3TOA A;  4YU9 A;  2FIW A;  4A31 A;  4A33 A;  1UFH A;  1XE4 A;  2GRE A;  2G0B A;  3PB4 X;  2QJ8 A;  3I1U A;  3FEC A;  1KWM A;  4CAW A;  2XEG A;  4X8I A;  2CTC A;  2JLM A;  2ABZ A;  2ZEL A;  4ONW A;  4X3R A;  3H5Z A;  3B3T A;  5AG6 A;  3TO9 A;  4CYO A;  3IFE A;  5C82 A;  3KQX A;  4QBJ A;  2Z11 A;  4XNH C;  4NGR A;  2PRB A;  3BI0 A;  2ZW4 A;  2PJ3 A;  2D4P A;  1IOI A;  5HVG A;  3QAY A;  3PFO A;  3VWD A;  2YNC C;  1QST A;  4CYQ A;  5ELY A;  3NE8 A;  1YLO A;  2R98 A;  4A39 A;  4A32 A;  5F47 A;  1JWQ A;  2PJ1 A;  2XEJ A;  1ZG8 A;  2Z3O A;  3DR8 A;  3JUW A;  5DWN A;  5E96 A;  2FXF A;  2C27 A;  2OZU A;  3MN8 A;  3CPA A;  3PB8 X;  3SJF A;  4EWT A;  4UIB A;  5I4M A;  4OAD A;  4NXY A;  3RBU A;  5KTD A;  2ZEH A;  3T8W A;  1U6M A;  4XPL A;  3TOB A;  2B5G A;  2PR8 A;  3LMS A;  1K4J A;  4IHM A;  4AVA A;  1YQE A;  5JM6 A;  1H8L A;  1ZG9 A;  4L89 A;  2DPS A;  4UWJ A;  1Y7R A;  4NGM A;  2V8D A;  2AJ6 A;  5HVF A;  4U9Y A;  4R8F A;  2ZEM A;  4TNU A;  4MFP A;  3TX8 A;  1YW4 A;  3WAB A;  2PIZ A;  2AFS A;  3F8K A;  4KSI A;  3H4Q A;  4R3L A;  3CDX A;  2PCU A;  2CF4 A;  2Z3L A;  4LQG A;  1PUA A;  2FL4 A;  3BJ7 A;  4KVO E;  4OLL A;  1XJO A;  1TKF A;  2B3V A;  2PE3 A;  3IWG A;  4B11 A;  4E0A A;  2FVG A;  4MMO A;  2PRQ A;  3KR5 A;  1Z2L A;  4FD4 A;  2PVV A;  4OC2 A;  5IX3 A;  6CPA A;  3D4U A;  4XPD B;  2ZEP A;  1CM0 A;  2QML A;  1XFO A;  1TKH A;  2PVW A;  4MFZ A;  4Q7A A;  3EY5 A;  4PSW A;  2CNS A;  4KOY A;  1Z4E A;  5EC4 A;  4FD7 A;  2IQ6 A;  4P4E A;  3HUV A;  4XNH B;  1BPN A;  3SXO A;  3VAR A;  1F2P A;  1I21 A;  1TIQ A;  3V7Z A;  3NH4 A;  3FB3 A;  4Q38 A;  4CGO A;  2ZOF A;  2ZEG A;  2AE6 A;  1BOB A;  4MCP A;  2OZH A;  2Z3K A;  4CGP A;  4QB9 A;  4OC1 A;  3NH5 A;  1Z8L A;  4UEZ A;  2FS5 A;  4CAX A;  1OBR A;  4L8A A;  3IJ3 A;  4P10 A;  5K8P A;  4DNC A;  2AFX A;  3S9N A;  4KZT A;  4P4F A;  2VZZ A;  3FNC A;  4KUB A;  2ZEF A;  4OME A;  3FXT A;  4UCN A;  1AMP A;  4BIN A;  4ZY2 A;  2B3U A;  2Q4Y A;  2R7H A;  2REF A;  4OP4 A;  1XIX A;  1KZF A;  5AG4 A;  2NSM A;  2I79 A;  1QSM A;  3F5B A;  3VH9 A;  5THW A;  5EBV A;  4B12 A;  3C26 A;  3H8F A;  3SI1 A;  4A2Z A;  2JBK A;  1IB1 E;  5J1Q A;  4RI1 A;  4IK2 A;  1XF8 A;  4P45 A;  1VGY A;  2ZXV A;  3DR6 A;  5J8F A;  5DWM A;  4FAI A;  1F2O A;  2AFO A;  2QYV A;  3RO0 A;  2AFZ A;  3GY9 A;  2YNC A;  4ZY0 A;  2P6E A;  2QVP A;  1YR0 A;  2G3T A;  4H2K A;  3JRU A;  5IV0 A;  1DTD A;  1IOF A;  1Z5R A;  1M1D A;  2BCO A;  3R9G A;  4ZX8 A;  3H8G A;  2J8M A;  4B14 A;  4KS9 A;  4UFX A;  4AB7 A;  3VWE A;  4UFW A;  2FE7 A;  1YVO A;  2OZG A;  2XEF A;  3B3V A;  2PJ9 A;  2DPT A;  4ONU A;  1X10 A;  3BLN A;  3IO1 A;  1YX0 A;  4KOX A;  2OU2 A;  4MHY A;  3WR7 A;  4F9V A;  1Y0Y A;  1I1D A;  3B3W A;  4M3S A;  4FBE A;  2BOA A;  2GAN A;  2JDC A;  1R43 A;  4MRI A;  4C2X A;  1IU8 A;  1GHE A;  4P44 A;  4PPZ A;  5F49 A;  2X7B A;  4PSX A;  5KTC A;  1M44 A;  2ODF A;  1YRE A;  4OID A;  1J4J A;  3S6G A;  5DS0 A;  1JQG A;  3KHX A;  3V38 A;  4Y49 C;  4MHZ A;  5FVJ A;  2ATR A;  5I0C A;  4HNY B;  4WWV A;  3SHP A;  4PXE A;  1NSA A;  1MJ9 A;  3DDD A;  2C6G A;  4KOW A;  1LCP A;  1YLE A;  2I3C A;  4KLV A;  1QSN A;  2PIY A;  2EBJ A;  2GLJ A;  2Z3N A;  2ARH A;  5BWA B;  1IIC A;  1Q2C A;  1S60 A;  4RUH A;  2F8H A;  4KSF A;  4LQ6 A;  2JEV A;  4FUU A;  1N71 A;  3D2P A;  4II9 A;  1P4N A;  2Q4Z A;  2C1C A;  2CIJ A;  2EUI A;  4JLY A;  4NCZ A;  4OAE A;  4P6Y A;  3GKR A;  1TF8 A;  2WSA A;  3N5F A;  4MI4 A;  3FBU A;  4OIW A;  1IY7 A;  2EVN A;  4HNX B;  4CRZ B;  1Y9W A;  4KSA A;  2VQY A;  5A27 A;  5CNP A;  2ZW5 A;  5H86 A;  1BAV A;  1FY7 A;  4JWP A;  5D29 A;  3QAH A;  3SI2 A;  1XEB A;  4CYN A;  4ZY1 A;  2VL1 A;  1XMT A;  5K8N A;  3ISZ A;  4JYW A;  4JXQ A;  4HKF A;  2YND A;  4O23 A;  7CPA A;  2I00 A;  3MGD A;  2PJC A;  2POK A;  3DNS A;  1MJA A;  4E2A A;  3WC6 A;  3TCV A;  3WC7 A;  3BXM A;  2EK9 A;  4AG9 A;  1BLL E;  2B4B A;  4PQA A;  4H89 A;  4UA3 A;  3SJE A;  2ZEO A;  3DLJ A;  2RC4 A;  2ZPA A; 
#chains in the Genus database with same CATH homology
 5HH1 A;  2B58 A;  4B13 A;  1R57 A;  5A28 A;  1VKC A;  2CNM A;  2KCW A;  2O28 A;  2REE A;  4MFK A;  3CXP A;  5C88 A;  1M4D A;  4XPD C;  4R87 A;  5F46 A;  4JJX A;  1Z9U A;  4KOT A;  3R9F A;  2CY2 A;  4AVC A;  2A4N A;  4MFL A;  4MFQ A;  1YGH A;  2B4D B;  4U9Z A;  4BBH A;  4MFJ A;  4PV6 A;  2Q7B A;  3ZZI A;  1S5K A;  4CGM A;  3RYO A;  2GIV A;  5JQ4 A;  1RXT A;  2VXK A;  3FRM A;  2BSW A;  4C68 A;  4H6U A;  5AG5 A;  1IID A;  3F0A A;  4RS2 A;  1B87 A;  4GS4 A;  5AG7 A;  3B8G A;  3TO6 A;  2WUU A;  2VI7 A;  2PDO A;  3OWC A;  4F6A A;  2Z10 A;  1S7L A;  4KVM E;  4R57 A;  4LX9 A;  4QUS A;  3D3S A;  5G1Z A;  4HNW B;  3R95 A;  2FSR A;  1IYK A;  2IL4 A;  3T90 A;  5KTA A;  1NSL A;  1NE9 A;  5J8C A;  3JTK A;  4EVY A;  4X5K A;  4IF5 A;  3D8P A;  2BEI A;  2CXA A;  1KUY A;  2BL1 A;  3PP9 A;  1WK4 A;  1S7F A;  4B5O A;  2K5T A;  1ZO0 A;  4C2Y A;  3PGP A;  4H6Z A;  4YGO A;  5GCN A;  2PQ8 A;  4FD6 A;  4MHD A;  4NF1 A;  2YGW A;  3TFY A;  4AG7 A;  2WPX A;  2R8V A;  4K30 A;  4R3K A;  3R1K A;  2WPW A;  2NMT A;  3DSB A;  1MJB A;  2JDD A;  3EC4 A;  3IU2 A;  4F0Y A;  3S6F A;  3K9U A;  4CGL A;  3TTH A;  3R96 A;  3W6X A;  2YNE A;  1QSO A;  4M85 A;  2PC1 A;  4B5P B;  4CYP A;  2GE3 A;  4UWI A;  1RO5 A;  2PR1 A;  4CAE A;  3NE7 A;  4FD5 A;  1S7N A;  2Z3P A;  5ISV A;  3LOD A;  4MBU A;  3I3G A;  4C7H A;  2PSW A;  4KUA A;  2FT0 A;  4KOR A;  3JVN A;  3G3S A;  3LD2 A;  1SQH A;  4MY3 A;  4UFV A;  3GYA A;  3G8W A;  1M4G A;  4XPK A;  4AVB A;  3V8I A;  5IB0 A;  3QB8 A;  1L0C A;  4KLW A;  3W91 A;  3D2M A;  4KOU A;  4KOV A;  1ON0 A;  2P6G A;  2OH1 A;  3PZJ A;  2VBQ A;  4PK2 A;  1KUX A;  4YRH A;  4NEX A;  3S6K A;  5JPH A;  2Z3M A;  5G21 A;  1IYL A;  1VHS A;  3IWE A;  2VZY A;  1WWZ A;  3TE4 A;  1Y9K A;  2H5M A;  2BUE A;  2J8N A;  2HV2 A;  2HUZ A;  5H84 A;  4F0X A;  3EXN A;  2Z0Z A;  4UCM A;  2QIR A;  2FIA A;  3N7Z A;  1S3Z A;  1S7K A;  4ZBG A;  1M4I A;  4Q36 A;  3IU1 A;  4B10 A;  4B5P A;  4ORF A;  5AGE A;  3FIX A;  1KUV A;  1MK4 A;  3TO7 A;  4CRY B;  1NMT A;  4IUS A;  4CAF A;  4CAV A;  4KVX A;  5F48 A;  1CJW A;  3I9S A;  2ZW7 A;  1Q2D A;  1OZP A;  4A95 A;  4C7I A;  3P2F A;  2DXQ A;  1B6B A;  1V0C A;  3BJ8 A;  2Q44 A;  4QVT A;  5G22 A;  2HQY A;  3CXQ A;  4UBR A;  3UY5 A;  3P2H A;  4J3G A;  1BO4 A;  4Y49 B;  2Q04 A;  4MJ8 A;  3TT2 A;  4MY0 A;  5G20 A;  4R9M A;  2VEZ A;  4YFJ A;  4ZGY B;  1YVK A;  4C2Z A;  4CGN A;  3W6S A;  3EO4 A;  3SXN A;  2B4D A;  3A9L A;  2Y0M A;  2Q4V A;  2P6F A;  1P0H A;  2P0W A;  1I12 A;  4JXR A;  5HMN A;  2D4O A;  4UCP A;  1QSR A;  3IGR A;  3EFA A;  3KKW A;  2B5G B;  2CNT A;  2G3A A;  2QEC A;  4LUA A;  3CXS A;  4A30 A;  2FCK A;  4E8O A;  1Q2Y A;  4QC6 A;  3ZJ0 A;  3T9Y A;  3R9E A;  3E0K A;  1Z4R A;  2Q0Y A;  2J8R A;  4U5Y A;  2ZW6 A;  2R1I A;  4PK3 A;  4CS0 B;  4BMH A;  1PU9 A;  2F5I A;  2OB0 A;  4JD6 A;  4NSQ A;  4KOS A;  1LRZ A;  3FYN A;  4I49 A;  3S6H A;  1YK3 A;  3TOA A;  2FIW A;  4A31 A;  4A33 A;  1UFH A;  1XE4 A;  2G0B A;  4CAW A;  2JLM A;  3H5Z A;  5AG6 A;  3TO9 A;  4CYO A;  5C82 A;  4QBJ A;  2Z11 A;  4XNH C;  2PRB A;  2ZW4 A;  2D4P A;  3VWD A;  2YNC C;  1QST A;  4CYQ A;  2R98 A;  4A32 A;  5F47 A;  2Z3O A;  3DR8 A;  3JUW A;  5DWN A;  5E96 A;  2FXF A;  2C27 A;  2OZU A;  4OAD A;  4NXY A;  5KTD A;  1U6M A;  4XPL A;  3TOB A;  2B5G A;  2PR8 A;  1K4J A;  4AVA A;  4L89 A;  4UWJ A;  2DPS A;  1Y7R A;  2AJ6 A;  4U9Y A;  4MFP A;  3F8K A;  3H4Q A;  4R3L A;  2Z3L A;  1PUA A;  2FL4 A;  3BJ7 A;  4KVO E;  4OLL A;  2B3V A;  3IWG A;  4B11 A;  4E0A A;  4FD4 A;  5IX3 A;  4XPD B;  1CM0 A;  2QML A;  4MFZ A;  3EY5 A;  4PSW A;  2CNS A;  4KOY A;  1Z4E A;  5EC4 A;  4FD7 A;  4XNH B;  3SXO A;  1I21 A;  1TIQ A;  3FB3 A;  4Q38 A;  4CGO A;  2AE6 A;  1BOB A;  2OZH A;  2Z3K A;  4CGP A;  4QB9 A;  4CAX A;  2FS5 A;  4L8A A;  4DNC A;  4KZT A;  2VZZ A;  3FNC A;  4KUB A;  3FXT A;  4UCN A;  2B3U A;  2Q4Y A;  2R7H A;  2REF A;  5AG4 A;  1XIX A;  1KZF A;  2I79 A;  1QSM A;  3F5B A;  5EBV A;  4B12 A;  3C26 A;  4A2Z A;  1IB1 E;  4RI1 A;  1XF8 A;  5J8F A;  3DR6 A;  2ZXV A;  5DWM A;  3GY9 A;  2YNC A;  2P6E A;  1YR0 A;  2G3T A;  5IV0 A;  3R9G A;  1M1D A;  2J8M A;  4B14 A;  4KS9 A;  4UFX A;  4AB7 A;  3VWE A;  4UFW A;  2FE7 A;  1YVO A;  2OZG A;  2DPT A;  4ONU A;  3BLN A;  4KOX A;  3WR7 A;  1YX0 A;  2OU2 A;  1I1D A;  4M3S A;  2GAN A;  2JDC A;  4C2X A;  1GHE A;  5F49 A;  2X7B A;  4PSX A;  5KTC A;  1M44 A;  1YRE A;  1J4J A;  3S6G A;  4Y49 C;  5FVJ A;  2ATR A;  5I0C A;  4HNY B;  3SHP A;  1MJ9 A;  3DDD A;  4KOW A;  1YLE A;  4KLV A;  1QSN A;  2Z3N A;  2ARH A;  5BWA B;  1IIC A;  1Q2C A;  1S60 A;  4KSF A;  2JEV A;  1N71 A;  3D2P A;  4II9 A;  1P4N A;  2EUI A;  4JLY A;  4NCZ A;  4OAE A;  3GKR A;  2WSA A;  4MI4 A;  3FBU A;  4HNX B;  2EVN A;  4CRZ B;  4KSA A;  1Y9W A;  2VQY A;  5A27 A;  5CNP A;  2ZW5 A;  5H86 A;  4CYN A;  1FY7 A;  4JWP A;  3QAH A;  1XEB A;  1XMT A;  4JXQ A;  4HKF A;  2YND A;  2I00 A;  3MGD A;  3DNS A;  1MJA A;  4E2A A;  3TCV A;  4AG9 A;  2B4B A;  4UA3 A;  4H89 A;  2RC4 A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...