5DWMA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
HMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphinothricin N-acetyltransferase
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Transferase
total genus 53
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwmA00
5H86A 3SXOA 4H6ZA 3TTHA 1MK4A 4QUSA 2QIRA 4IUSA 1XMTA 1WWZA 2FIWA 4XNHC 2Q44A 4CAWA 3E0KA 3I9SA 2HUZA 3VWDA 2BEIA 4JXRA 3GY9A 3JVNA 4QC6A 1PUAA 1Z4RA 4L89A 2ZW6A 3MGDA 2CNSA 1KUYA 1YLEA 1KUVA 4UA3A 4XPDB 1QSRA 5J8FA 2PQ8A 4AVBA 4F0YA 1Z9UA 4AVAA 1I21A 3TOBA 2PDOA 3G8WA 4KOUA 5J8CA 4KVXA 4JD6A 3D2PA 4J3GA 3W6SA 3FBUA 4KVME 4L8AA 2Q4YA 4LX9A 1J4JA 3QAHA 2OZHA 4KUBA 3FNCA 2GANA 4PSWA 2PR1A 3CXSA 3R9FA 4PK2A 4BMHA 4RI1A 5EC4A 5E96A 4HNYB 1FY7A 4E2AA 2FE7A 2WPWA 2K5TA 2Y0MA 1N71A 3S6FA 2VBQA 2ARHA 1KZFA 4NSQA 2QMLA 4XPDC 2I79A 4FD4A 4PK3A 3EO4A 1MJ9A 2B3VA 2Q7BA 2D4OA 4CAVA 2DXQA 3F8KA 1TIQA 2FT0A 4IF5A 4U5YA 2OU2A 1IIDA 2VI7A 1CM0A 4U9YA 2B3UA 2JDDA 4JJXA 1S7FA 2NMTA 1YR0A 1GHEA 1S3ZA 4II9A 4CS0B 5F49A 2R7HA 2Z10A 3D8PA 2I00A 5H84A 2JEVA 2FSRA 4OADA 1YK3A 2P6EA 4H6UA 2R98A 4CRZB 2O28A 4NF1A 5EBVA 1U6MA 2KCWA 3S6GA 4UWIA 4NXYA 1M44A 1L0CA 2F5IA 3DR6A 3V8IA 3H4QA 3BJ8A 1NE9A 3D2MA 2R1IA 1Q2DA 1S7LA 2AE6A 4MY3A 4EVYA 5C88A 1V0CA 2D4PA 2B4BA 2B5GA 4MBUA 4AG7A 3PP9A 2ZW5A 4F6AA 2C27A 3EY5A 2OZGA 1RO5A 3R96A 4R57A 3R9EA 4JWPA 4B5PA 4KORA 2BUEA 1VHSA 3F0AA 1VKCA 3CXQA 3JUWA 1YX0A 5DWNA 4LUAA 3EFAA 2GIVA 3R95A 1QSOA 2WPXA 1B6BA 2OH1A 2FL4A 4AG9A 3NE7A 4QB9A 1YGHA 3BJ7A 4M3SA 3CXPA 3FXTA 4ONUA 3S6HA 3TFYA 3G3SA 2ZPAA 4HNXB 4XPLA 2H5MA 4H89A 2J8MA 3LODA 4OLLA 1MJAA 2Q0YA 4MJ8A 2P6FA 3FRMA 2VEZA 5DWMA 3SXNA 4I49A 5JPHA 3K9UA 4KVOE 1BOBA 3TT2A 4YGOA 1K4JA 1S7NA 3D3SA 4KOTA 1M4DA 1CJWA 2RC4A 1M4GA 2G0BA 4PV6A 1RXTA 2REFA 2BSWA 2FCKA 4Y49B 2G3TA 3TE4A 2X7BA 2Z11A 1XF8A 4AVCA 3F5BA 4U9ZA 1Y9KA 2B58A 3FYNA 4GS4A 3I3GA 4KOWA 2PRBA 2GE3A 2B4DA 2Q04A 2EUIA 2HQYA 2CNTA 4ZBGA 3TO6A 3WR7A 2PC1A 1P4NA 1I1DA 1IYKA 3EC4A 1P0HA 4QVTA 3W91A 2JDCA 2ZXVA 1YVKA 1MJBA 5C82A 5JQ4A 2BL1A 4FD5A 1OZPA 4E0AA 1YVOA 3T90A 3BLNA 1XEBA 1KUXA 2J8NA 2HV2A 2VZYA 2Z0ZA 5F48A 4PSXA 2AJ6A 1IB1E 4Y49C 4AB7A 5HMNA 3T9YA 2CY2A 4HKFA 5F47A 3ZZIA 4FD6A 4YRHA 2QECA 4NEXA 2REEA 5IB0A 2FIAA 4KOYA 3GYAA 3B8GA 3DSBA 4KOVA 1Q2YA 3QB8A 4DNCA 2Q4VA 3LD2A 4OAEA 4UBRA 4QBJA 4R3LA 4JLYA 2VZZA 3DDDA 5GCNA 1Q2CA 4NCZA 5KTDA 4R9MA 1S7KA 2B5GB 2R8VA 1PU9A 5HH1A 4HNWB 3TOAA 5KTAA 1Y7RA 2ZW7A 4B5PB 1M1DA 3S6KA 3PGPA 2EVNA 4E8OA 3RYOA 4KLWA 4M85A 4UWJA 4K30A 1LRZA 2CNMA 2ATRA 3UY5A 4YFJA 3FIXA 1BO4A 1R57A 1WK4A 3R9GA 1XE4A 2VXKA 3ZJ0A 3TO7A 5CNPA 3DR8A 4CRYB 4KOSA 1M4IA 4ORFA 3TCVA 2A4NA 2PSWA 5I0CA 1NMTA 4KUAA 1I12A 3C26A 1B87A 1IYLA 2P6GA 4R3KA 3N7ZA 4XPKA 4RS2A 4X5KA 3R1KA 5ISVA 2JLMA 2J8RA 5FVJA 5IV0A 1XIXA 1Y9WA 3TO9A 4KZTA 3KKWA 3SHPA 2IL4A 4MHDA 2OB0A 4XNHB 3FB3A 4JXQA 1QSTA 3OWCA 3GKRA 3PZJA 2P0WA 4R87A 1ON0A 1S5KA 4MI4A 2OZUA 2FXFA 1YREA 4KLVA 1QSMA 4KOXA 4FD7A 3P2HA 4B5OA 3VWEA 2G3AA 4CAXA 5KTCA 3EXNA 3DNSA 1NSLA 2ZW4A 5IX3A 1QSNA 2B4DB 1UFHA 1Z4EA 3IGRA 2PR8A 3IWGA 3P2FA 1S60A 2VQYA 1SQHA 1IICA 3W6XA 2FS5A 5F46A 4MY0A
chains in the Genus database with same CATH superfamily
5H86A 3SXOA 4H6ZA 2DPSA 1VGYA 1MK4A 3TTHA 1JQGA 2PJ7A 2JBJA 4M6GA 4P10A 4QUSA 2QIRA 1PCAA 4IUSA 4B12A 1XMTA 1WWZA 2FIWA 2PJ8A 4UIBA 4XNHC 4O23A 2Q44A 5JM6A 3PFOA 4CAWA 3E0KA 1DTDA 2I3CA 3IU2A 4A37A 2Z3PA 3I9SA 2HUZA 3VWDA 2BEIA 4JXRA 3WABA 3GY9A 3B3SA 3JVNA 4QC6A 1PUAA 1NSAA 1Z4RA 4L89A 2ZW6A 3H8FA 3MGDA 3NA6A 2CNSA 2GU2A 1KUYA 4IHMA 1YLEA 3PB4X 1KUVA 4NGQA 2PJ6A 4UA3A 2Q7SA 1QSRA 4XPDB 2NYQA 3PBEA 1IOFA 5J8FA 2PQ8A 4X8IA 4R6TA 4AVBA 2XEIA 4F0YA 3I1UA 1Z9UA 4AVAA 2C6CA 1A2ZA 1DE4C 2IJZA 3B3VA 4A31A 3HLPA 1CX8A 2HB6A 2O4HA 2PVVA 4P4JA 1I21A 3TX8A 1TKFA 4P4BA 2PDOA 4UFWA 3TOBA 5JGFA 2VL1A 2ZEOA 3G8WA 4KOUA 4A38A 5J8CA 4KVXA 4JD6A 4OIDA 3D2PA 4J3GA 3IIBA 2PE3A 4IK2A 4C7HA 2Q43A 3W6SA 3FBUA 4KVME 4L8AA 1HDQA 2Q4YA 4LX9A 2PCUA 1J4JA 3CPXA 1TXRA 2IMOA 2V8VA 3QAHA 1Y0RA 2OZHA 2EK9A 4KUBA 3FNCA 3MRUA 4ZY0A 3FEDA 2GANA 5K8PA 1IOIA 4PSWA 4UEEA 4Z65A 2PR1A 3CXSA 2J9AA 3NH8A 3R9FA 4PK2A 4BMHA 5HXDA 4FWUA 4RI1A 4LQGA 5EC4A 5E96A 4HNYB 1FY7A 4E2AA 2FE7A 2WPWA 2K5TA 4UIAA 3BI1A 5AG6A 7CPAA 2Y0MA 1N71A 3D7FA 4P6YA 3S6FA 4RUHA 1HDUA 2WYRA 2GLFA 2VBQA 2ARHA 2RFHA 4PQAA 2ZEEA 2YGWA 2EWBA 3B7IA 1KZFA 4NSQA 4FBEA 2QMLA 2PIZA 3SI2A 5CBMA 3V38A 4A33A 4XPDC 2I79A 4FD4A 3LACA 4PK3A 3EO4A 3PB7X 1MJ9A 2BOAA 2F8HA 2B3VA 3B3TA 5CPAA 2WSAA 4M6HA 2Q7BA 2AFMA 2D4OA 4A32A 4OIWA 4CAVA 2DXQA 3F8KA 4ZY2A 1HEEA 1TIQA 2FT0A 3BHXA 5LYIA 4IF5A 4U5YA 2DF5A 2OU2A 2ZOGA 3IFEA 3VARA 5HVGA 1IIDA 2VI7A 4DYOA 5THWA 1CM0A 2ABZA 1CP6A 4FAIA 5HVHA 1XFOA 3GLJA 4U9YA 2B3UA 1Y0YA 4R7MA 4NGPA 2JDDA 5EMIA 4JJXA 1S7FA 2NMTA 4F9VA 5LRKA 1YR0A 3D7GA 1ZLIA 5BWAB 5J1QA 1GHEA 1S3ZA 4II9A 3FECA 4BD9A 1IGBA 2C1CA 3KZWA 3S9MA 4OC2A 4MCRA 4CS0B 1TKHA 5F49A 2R7HA 2Z10A 3D8PA 3L2NA 4JZ0A 1CP7A 2I00A 2XEFA 5H84A 2JEVA 2FSRA 4OADA 5G21A 1YK3A 5LYLA 1CPXA 4MFQA 2P6EA 4H6UA 1Z8XA 2YNCA 2R98A 4CRZB 2O28A 4ZY1A 4NF1A 5EBVA 4MCSA 3KQZA 3SJXA 4P45A 1U6MA 1ARMA 2KCWA 3S6GA 4UWIA 4NXYA 1M44A 1L0CA 2F5IA 2EK8A 4YU9A 4FUUA 3DR6A 3V8IA 3H4QA 3BJ8A 2AFZA 4P4DA 1NE9A 2Q4ZA 1BPNA 2ZEFA 3D2MA 2R1IA 5I4MA 1Q2DA 5DS0A 3IEHA 3SJEA 1S7LA 2AE6A 1AUGA 4MY3A 3SJGA 3VH9A 4B13A 4CGPA 4EVYA 4MXUA 4MHYA 5C88A 1V0CA 2D4PA 3K9TA 4B14A 3KHZA 5LYDA 2B4BA 2B5GA 4NJRA 3TC8A 1RTQA 4MBUA 4A95A 2JEWA 4AG7A 3PP9A 5JH9A 4X3RA 2ZW5A 4F6AA 2C27A 3EY5A 2OZGA 1RO5A 3R96A 4R57A 3R9EA 3T8WA 4JWPA 1JWQA 3CT9A 4B5PA 3PBBA 4TNUA 4KORA 2BUEA 3BXMA 1LANA 3WC5A 3GIUA 4MHNA 4UF4A 1TF9A 1VHSA 1YSJA 1VKCA 3F0AA 3CXQA 3GUXA 3JUWA 4AXVA 4B11A 1YX0A 3ISXA 3WC7A 5DWNA 2EO8A 4LUAA 4CYQA 3A9LA 3EFAA 2GIVA 3R95A 2OR4A 1QSOA 2WPXA 2IQ6A 4DJLA 2Z3MA 1B6BA 2BCOA 2OH1A 2FL4A 3JTKA 3V7ZA 4AG9A 1Y7EA 3NE7A 4P4EA 4WJBA 3LWUA 2ZEDA 4F0XA 1ELLP 2CXAA 3WC6A 3CZXA 1Z8WA 4ZX9A 3B35A 3D7DA 3B2YA 4M6IA 4A39A 1BPMA 4QB9A 1YGHA 3BJ7A 4M3SA 2ZOFA 3CXPA 3FXTA 4ONUA 5A27A 4OKOA 4UFVA 3S6HA 5IB9A 3TFYA 3MN8A 3QNVA 3D67A 3G3SA 3PRTA 2V8HA 3KQXA 2ZPAA 4HNXB 5D8NA 4XPLA 3KHXA 4OC0A 4OC5A 2H5MA 4NGTA 2OOTA 4H89A 2J8MA 3LODA 1XRYA 1LCPA 2V77A 4OLLA 1MJAA 2Q0YA 4MJ8A 4ZYQA 2P6FA 3FRMA 4CYOA 2VEZA 5DWMA 1VHOA 3SXNA 5LYFA 2Q51A 1ZG9A 4I49A 5JPHA 3K9UA 4A2ZA 3KR5A 4KVOE 3FF3A 4GM5A 4MHZA 4NFRA 4ZI6A 2GFQA 5K8NA 1BOBA 3TT2A 4YGOA 1S7NA 1K4JA 3S9LA 5F09A 2G9DA 3D3SA 4MHPA 4KOTA 1M4DA 3PFEA 2HC9A 1CJWA 1IY7A 1XMBA 2RC4A 4BINA 1M4GA 4R8FA 1H8LA 2G0BA 2ZEMA 4PV6A 2NSMA 4PPZA 4Q7AA 1RXTA 2REFA 2BSWA 2FCKA 2QJ8A 4Y49B 2G3TA 2CF4A 3TE4A 2X7BA 3LMSA 4KS9A 5K8OA 2AFOA 2Z11A 1XF8A 2ZENA 1CBXA 4AVCA 3F5BA 4U9ZA 1Y9KA 2B58A 3FYNA 4C2XA 4GS4A 1FT7A 3I3GA 1BAVA 3D66A 3H5ZA 4KOWA 4WWVA 4A30A 1F57A 1VHEA 2PRBA 1Z5RA 1LAPA 1PYTB 1TF8A 3IWWA 4OC4A 5A28A 4OP4A 3IWEA 2GE3A 3B3WA 1QQ9A 2CTCA 3IJ3A 2B4DA 2Q04A 2EUIA 2HQYA 2CNTA 3FVLA 3PB8X 4UCNA 5K8MA 4ZBGA 2PJ4A 4MFKA 3TO6A 4C2YA 4G1PA 1VIXA 2PC1A 3WR7A 3WT4A 3DGVA 1P4NA 2PJ3A 1I1DA 3D7HA 2AFUA 1YMEA 1IYKA 4OMEA 3EC4A 1P0HA 3CDXA 4RN7A 1ARLA 1GYTA 2FVGA 1ZLHA 1KWMA 3NE8A 4QVTA 3W91A 1Z2LA 5G22A 2JDCA 1EE3P 1R43A 2ZXVA 4UCMA 1AMPA 1YVKA 1ELMP 4F8ZA 2Z3LA 1MJBA 5C82A 4UEFA 3H8GA 5JQ4A 2BL1A 2V8DA 1OZPA 3D4UA 1YVOA 2PJ0A 4FD5A 5AG7A 4E0AA 3T90A 4Q38A 3BLNA 1XEBA 1KUXA 2J8NA 2HV2A 2QVPA 2VZYA 2Z0ZA 3FJUA 4MFLA 5F48A 4PSXA 2AJ6A 4NGNA 1IB1E 3ISZA 2ZELA 4Y49C 4AB7A 5HMNA 3T9YA 1LAMA 1M4LA 2CY2A 4HKFA 4IAVA 4OC3A 5F47A 3ZZIA 2Z3NA 4FD6A 3PB9X 2YNDA 4C68A 4CYNA 4YRHA 2PJAA 4P4IA 2PVWA 3QAYA 4YWYA 2QECA 4NEXA 2REEA 3KASA 1OBRA 2JBKA 5IB0A 2FIAA 2PJ5A 1UWYA 3PEIA 2CIJA 4ZX8A 4KOYA 4MFZA 3GYAA 4DUKA 4ZGYB 3IC1A 5G1ZA 3B8GA 5G20A 4P4FA 4X2TA 3DSBA 2YNEA 1FNOA 1Q7LA 1Q2YA 2ZEHA 3CPAA 3QB8A 3GB0A 4HPSA 4KOVA 1X10A 2RB7A 4DNCA 3KR4A 2Q4VA 1XOVA 3NH4A 3LD2A 3IO1A 4OAEA 4UBRA 4QBJA 4R3LA 4JLYA 4JYWA 4B10A 4TWEA 2VZZA 3DDDA 4W9YA 1Q2CA 4NCZA 5GCNA 5KTDA 2PJ1A 4R9MA 4PXCA 1S7KA 2B5GB 3FX6A 4H2KA 2WUUA 2R8VA 1PU9A 5HH1A 4CAFA 4PXBA 2Z3KA 4HNWB 3TOAA 5KTAA 4Q36A 1F2OA 4MRIA 1ZG8A 3RNZA 1Y7RA 2ZW7A 2BO9A 2PJ9A 4B5PB 1M1DA 4PXDA 3S6KA 4KSFA 4MCQA 4CGNA 2ANPA 3IU1A 1TKJA 3PGPA 4UCPA 2EVNA 2CTBA 4E8OA 3N5FA 4CGOA 3RYOA 3NFZA 4KLWA 2PJBA 4M85A 2GREA 3BI0A 5AGEA 4C7IA 2ODFA 4UWJA 4K30A 1LRZA 2AFSA 2XEJA 2CNMA 2ATRA 3UY5A 4YFJA 1YW4A 3FIXA 1BO4A 2WZNA 1R57A 1X12A 1WK4A 2YNCC 3R9GA 3RO0A 1CG2A 3HUVA 1CPSA 1XE4A 2AFXA 2VXKA 5HVFA 3SI0A 4B6ZA 3DLJA 3ZJ0A 4K3NA 4KSAA 1LOKA 1Z8TA 4EMEA 2POKA 3TO7A 4NGSA 2C6PA 5CNPA 2V8GA 3FH4A 2PJCA 3DR8A 2Z3OA 4EWTA 2PIYA 4CRYB 3D68A 2EBJA 4UEZA 4C2ZA 4KOSA 4CAEA 1M4IA 2AFWA 3RBUA 2QYVA 4ORFA 3TCVA 4CYPA 2A4NA 2PSWA 3K2KA 5AG5A 3SI1A 1AYEA 5I0CA 1NMTA 4KUAA 1I12A 1QMUA 3C26A 4MFJA 1B87A 1F2PA 4PXEA 1IYLA 2P6GA 4R3KA 3N7ZA 4XPKA 2XEGA 4RS2A 2O53A 4OC1A 3B3CA 4X5KA 3R1KA 5ISVA 2JLMA 8CPAA 4EFDA 1YQEA 3FEEA 2J8RA 1Z8LA 3KI9A 1XIXA 1Y9WA 1BLLE 5FVJA 5IV0A 3JRUA 2PJ2A 3TO9A 3KKWA 4KZTA 3SHPA 1ZO0A 2IL4A 4MHDA 2OB0A 5AG4A 4XNHB 3FB3A 4CGLA 3H8EA 4NGMA 4JXQA 1XBUA 1QSTA 3NH5A 3OWCA 3S9NA 1XJOA 3GKRA 2ZEPA 3PZJA 2P0WA 5LRJA 4CPAA 4R87A 2DEAA 3VATA 1ON0A 1S5KA 4MMOA 4MI4A 4A94A 2OZUA 3PB6X 3SJFA 2FXFA 2DPTA 4NJQA 1YREA 4KLVA 4BBHA 1QSMA 3FMCA 4KOXA 4FD7A 4NGRA 3P2HA 5LRGA 4B5OA 6CPAA 4P44A 4F9UA 3VWEA 4ONWA 4MCPA 2G3AA 4CAXA 4MFPA 5KTCA 3EXNA 1YLOA 2C6GA 5D29A 3DNSA 3RAMA 4UFXA 1NSLA 2ZW4A 1ZG7A 3KGQA 1IU8A 1QSNA 3KL9A 5IX3A 2B4DB 1YW6A 1UFHA 4KSIA 2ZEGA 1Z4EA 3IGRA 2PR8A 3IWGA 3P2FA 1R3NA 1S60A 2VQYA 1SQHA 4R76A 2GLJA 4LQ6A 1IICA 5ELYA 3W6XA 2FS5A 4GXHA 3RZAA 4CGMA 1LFWA 5F46A 2PRQA 2F7VA 4MY0A
chains in the Genus database with same CATH topology
5H86A 3SXOA 4H6ZA 2DPSA 3TTHA 1MK4A 4QUSA 2QIRA 4IUSA 4B12A 1XMTA 1WWZA 2FIWA 4XNHC 2Q44A 4CAWA 3E0KA 3IU2A 2Z3PA 3I9SA 2HUZA 3VWDA 2BEIA 4JXRA 3GY9A 3JVNA 4QC6A 1PUAA 1Z4RA 4L89A 2ZW6A 3MGDA 2CNSA 1KUYA 1YLEA 1KUVA 4UA3A 4XPDB 1QSRA 5J8FA 2PQ8A 4AVBA 4F0YA 1Z9UA 4AVAA 4A31A 1I21A 3TOBA 2PDOA 4UFWA 3G8WA 4KOUA 5J8CA 4KVXA 4JD6A 3D2PA 4J3GA 4C7HA 3W6SA 3FBUA 4KVME 4L8AA 2Q4YA 4LX9A 1J4JA 3QAHA 2OZHA 4KUBA 3FNCA 2GANA 4PSWA 2PR1A 3CXSA 3R9FA 4PK2A 4BMHA 4RI1A 5EC4A 5E96A 4HNYB 1FY7A 4E2AA 2FE7A 2WPWA 2K5TA 5AG6A 2Y0MA 1N71A 3S6FA 2VBQA 2ARHA 2YGWA 1KZFA 4NSQA 2QMLA 4A33A 4XPDC 2I79A 4FD4A 4PK3A 3EO4A 1MJ9A 2B3VA 2WSAA 2Q7BA 2D4OA 4A32A 4CAVA 2DXQA 3F8KA 1TIQA 2FT0A 4IF5A 4U5YA 2OU2A 1IIDA 2VI7A 1CM0A 4U9YA 2B3UA 2JDDA 4JJXA 1S7FA 2NMTA 1YR0A 5BWAB 1GHEA 1S3ZA 4II9A 4CS0B 5F49A 2R7HA 2Z10A 3D8PA 2I00A 5H84A 2JEVA 2FSRA 4OADA 5G21A 1YK3A 4MFQA 2P6EA 4H6UA 2YNCA 2R98A 4CRZB 2O28A 4NF1A 5EBVA 1U6MA 2KCWA 3S6GA 4UWIA 4NXYA 1M44A 1L0CA 2F5IA 3DR6A 3V8IA 3H4QA 3BJ8A 1NE9A 3D2MA 2R1IA 1Q2DA 4CGPA 1S7LA 2AE6A 4B13A 4MY3A 4EVYA 5C88A 1V0CA 2D4PA 4B14A 2B4BA 2B5GA 4MBUA 4A95A 4AG7A 3PP9A 2ZW5A 4F6AA 2C27A 3EY5A 2OZGA 1RO5A 3R96A 4R57A 3R9EA 4JWPA 4B5PA 4KORA 2BUEA 1VHSA 3F0AA 1VKCA 3CXQA 3JUWA 4B11A 1YX0A 5DWNA 4LUAA 4CYQA 3A9LA 3EFAA 2GIVA 3R95A 1QSOA 2WPXA 2Z3MA 1B6BA 2OH1A 2FL4A 3JTKA 4AG9A 3NE7A 4F0XA 2CXAA 4QB9A 1YGHA 3BJ7A 4M3SA 3CXPA 3FXTA 4ONUA 5A27A 4UFVA 3S6HA 3TFYA 3G3SA 2ZPAA 4HNXB 4XPLA 2H5MA 4H89A 2J8MA 3LODA 4OLLA 1MJAA 2Q0YA 4MJ8A 2P6FA 3FRMA 4CYOA 2VEZA 5DWMA 3SXNA 4I49A 5JPHA 3K9UA 4A2ZA 4KVOE 1BOBA 3TT2A 4YGOA 1K4JA 1S7NA 3D3SA 4KOTA 1M4DA 1CJWA 2RC4A 1M4GA 2G0BA 4PV6A 1RXTA 2REFA 2BSWA 2FCKA 4Y49B 2G3TA 3TE4A 2X7BA 4KS9A 2Z11A 1XF8A 4AVCA 3F5BA 4U9ZA 1Y9KA 2B58A 3FYNA 4C2XA 4GS4A 3I3GA 3H5ZA 4KOWA 4A30A 2PRBA 5A28A 3IWEA 2GE3A 2B4DA 2Q04A 2EUIA 2HQYA 2CNTA 4UCNA 4ZBGA 4C2YA 4MFKA 3TO6A 3WR7A 2PC1A 1P4NA 1I1DA 1IYKA 3EC4A 1P0HA 4QVTA 3W91A 5G22A 2JDCA 2ZXVA 4UCMA 1YVKA 2Z3LA 1MJBA 5C82A 5JQ4A 2BL1A 4FD5A 1OZPA 4E0AA 1YVOA 5AG7A 3T90A 4Q38A 3BLNA 1XEBA 1KUXA 2J8NA 2HV2A 2VZYA 2Z0ZA 5F48A 4MFLA 4PSXA 2AJ6A 1IB1E 4Y49C 4AB7A 5HMNA 3T9YA 2CY2A 4HKFA 5F47A 3ZZIA 2Z3NA 4FD6A 2YNDA 4C68A 4CYNA 4YRHA 2QECA 4NEXA 2REEA 5IB0A 2FIAA 4KOYA 4MFZA 3GYAA 4ZGYB 5G1ZA 3B8GA 5G20A 3DSBA 2YNEA 4KOVA 1Q2YA 3QB8A 4DNCA 2Q4VA 3LD2A 4OAEA 4UBRA 4QBJA 4R3LA 4JLYA 4B10A 2VZZA 3DDDA 5GCNA 1Q2CA 4NCZA 5KTDA 4R9MA 1S7KA 2B5GB 2WUUA 2R8VA 1PU9A 5HH1A 4CAFA 2Z3KA 4HNWB 3TOAA 5KTAA 4Q36A 1Y7RA 2ZW7A 4B5PB 1M1DA 3S6KA 4KSFA 4CGNA 3IU1A 3PGPA 4UCPA 2EVNA 4E8OA 4CGOA 3RYOA 4KLWA 4M85A 5AGEA 4C7IA 4UWJA 4K30A 1LRZA 2CNMA 2ATRA 3UY5A 4YFJA 3FIXA 1BO4A 1R57A 1WK4A 2YNCC 3R9GA 1XE4A 2VXKA 3ZJ0A 4KSAA 3TO7A 5CNPA 3DR8A 2Z3OA 4CRYB 4C2ZA 4KOSA 4CAEA 1M4IA 4ORFA 3TCVA 4CYPA 2A4NA 2PSWA 5AG5A 5I0CA 1NMTA 4KUAA 1I12A 4MFJA 3C26A 1B87A 1IYLA 2P6GA 4R3KA 3N7ZA 4XPKA 4RS2A 4X5KA 3R1KA 5ISVA 2JLMA 2J8RA 5FVJA 5IV0A 1XIXA 1Y9WA 3TO9A 3KKWA 4KZTA 3SHPA 1ZO0A 2IL4A 4MHDA 2OB0A 5AG4A 4XNHB 3FB3A 4CGLA 4JXQA 1QSTA 3OWCA 3GKRA 3PZJA 2P0WA 4R87A 1ON0A 1S5KA 4MI4A 2OZUA 2FXFA 2DPTA 1YREA 4KLVA 4BBHA 1QSMA 4KOXA 4FD7A 3P2HA 4B5OA 3VWEA 2G3AA 4CAXA 4MFPA 5KTCA 3EXNA 3DNSA 4UFXA 1NSLA 2ZW4A 5IX3A 1QSNA 2B4DB 1UFHA 1Z4EA 3IGRA 2PR8A 3IWGA 3P2FA 1S60A 2VQYA 1SQHA 1IICA 3W6XA 4CGMA 2FS5A 5F46A 4MY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H86 A;  3SXO A;  4H6Z A;  3TTH A;  1MK4 A;  4QUS A;  2QIR A;  4IUS A;  1XMT A;  1WWZ A;  2FIW A;  4XNH C;  2Q44 A;  4CAW A;  3E0K A;  3I9S A;  2HUZ A;  3VWD A;  2BEI A;  4JXR A;  3GY9 A;  3JVN A;  4QC6 A;  1PUA A;  1Z4R A;  4L89 A;  2ZW6 A;  3MGD A;  2CNS A;  1KUY A;  1YLE A;  1KUV A;  4UA3 A;  4XPD B;  1QSR A;  5J8F A;  2PQ8 A;  4AVB A;  4F0Y A;  1Z9U A;  4AVA A;  1I21 A;  3TOB A;  2PDO A;  3G8W A;  4KOU A;  5J8C A;  4KVX A;  4JD6 A;  3D2P A;  4J3G A;  3W6S A;  3FBU A;  4KVM E;  4L8A A;  2Q4Y A;  4LX9 A;  1J4J A;  3QAH A;  2OZH A;  4KUB A;  3FNC A;  2GAN A;  4PSW A;  2PR1 A;  3CXS A;  3R9F A;  4PK2 A;  4BMH A;  4RI1 A;  5EC4 A;  5E96 A;  4HNY B;  1FY7 A;  4E2A A;  2FE7 A;  2WPW A;  2K5T A;  2Y0M A;  1N71 A;  3S6F A;  2VBQ A;  2ARH A;  1KZF A;  4NSQ A;  2QML A;  4XPD C;  2I79 A;  4FD4 A;  4PK3 A;  3EO4 A;  1MJ9 A;  2B3V A;  2Q7B A;  2D4O A;  4CAV A;  2DXQ A;  3F8K A;  1TIQ A;  2FT0 A;  4IF5 A;  4U5Y A;  2OU2 A;  1IID A;  2VI7 A;  1CM0 A;  4U9Y A;  2B3U A;  2JDD A;  4JJX A;  1S7F A;  2NMT A;  1YR0 A;  1GHE A;  1S3Z A;  4II9 A;  4CS0 B;  5F49 A;  2R7H A;  2Z10 A;  3D8P A;  2I00 A;  5H84 A;  2JEV A;  2FSR A;  4OAD A;  1YK3 A;  2P6E A;  4H6U A;  2R98 A;  4CRZ B;  2O28 A;  4NF1 A;  5EBV A;  1U6M A;  2KCW A;  3S6G A;  4UWI A;  4NXY A;  1M44 A;  1L0C A;  2F5I A;  3DR6 A;  3V8I A;  3H4Q A;  3BJ8 A;  1NE9 A;  3D2M A;  2R1I A;  1Q2D A;  1S7L A;  2AE6 A;  4MY3 A;  4EVY A;  5C88 A;  1V0C A;  2D4P A;  2B4B A;  2B5G A;  4MBU A;  4AG7 A;  3PP9 A;  2ZW5 A;  4F6A A;  2C27 A;  3EY5 A;  2OZG A;  1RO5 A;  3R96 A;  4R57 A;  3R9E A;  4JWP A;  4B5P A;  4KOR A;  2BUE A;  1VHS A;  3F0A A;  1VKC A;  3CXQ A;  3JUW A;  1YX0 A;  5DWN A;  4LUA A;  3EFA A;  2GIV A;  3R95 A;  1QSO A;  2WPX A;  1B6B A;  2OH1 A;  2FL4 A;  4AG9 A;  3NE7 A;  4QB9 A;  1YGH A;  3BJ7 A;  4M3S A;  3CXP A;  3FXT A;  4ONU A;  3S6H A;  3TFY A;  3G3S A;  2ZPA A;  4HNX B;  4XPL A;  2H5M A;  4H89 A;  2J8M A;  3LOD A;  4OLL A;  1MJA A;  2Q0Y A;  4MJ8 A;  2P6F A;  3FRM A;  2VEZ A;  5DWM A;  3SXN A;  4I49 A;  5JPH A;  3K9U A;  4KVO E;  1BOB A;  3TT2 A;  4YGO A;  1K4J A;  1S7N A;  3D3S A;  4KOT A;  1M4D A;  1CJW A;  2RC4 A;  1M4G A;  2G0B A;  4PV6 A;  1RXT A;  2REF A;  2BSW A;  2FCK A;  4Y49 B;  2G3T A;  3TE4 A;  2X7B A;  2Z11 A;  1XF8 A;  4AVC A;  3F5B A;  4U9Z A;  1Y9K A;  2B58 A;  3FYN A;  4GS4 A;  3I3G A;  4KOW A;  2PRB A;  2GE3 A;  2B4D A;  2Q04 A;  2EUI A;  2HQY A;  2CNT A;  4ZBG A;  3TO6 A;  3WR7 A;  2PC1 A;  1P4N A;  1I1D A;  1IYK A;  3EC4 A;  1P0H A;  4QVT A;  3W91 A;  2JDC A;  2ZXV A;  1YVK A;  1MJB A;  5C82 A;  5JQ4 A;  2BL1 A;  4FD5 A;  1OZP A;  4E0A A;  1YVO A;  3T90 A;  3BLN A;  1XEB A;  1KUX A;  2J8N A;  2HV2 A;  2VZY A;  2Z0Z A;  5F48 A;  4PSX A;  2AJ6 A;  1IB1 E;  4Y49 C;  4AB7 A;  5HMN A;  3T9Y A;  2CY2 A;  4HKF A;  5F47 A;  3ZZI A;  4FD6 A;  4YRH A;  2QEC A;  4NEX A;  2REE A;  5IB0 A;  2FIA A;  4KOY A;  3GYA A;  3B8G A;  3DSB A;  4KOV A;  1Q2Y A;  3QB8 A;  4DNC A;  2Q4V A;  3LD2 A;  4OAE A;  4UBR A;  4QBJ A;  4R3L A;  4JLY A;  2VZZ A;  3DDD A;  5GCN A;  1Q2C A;  4NCZ A;  5KTD A;  4R9M A;  1S7K A;  2B5G B;  2R8V A;  1PU9 A;  5HH1 A;  4HNW B;  3TOA A;  5KTA A;  1Y7R A;  2ZW7 A;  4B5P B;  1M1D A;  3S6K A;  3PGP A;  2EVN A;  4E8O A;  3RYO A;  4KLW A;  4M85 A;  4UWJ A;  4K30 A;  1LRZ A;  2CNM A;  2ATR A;  3UY5 A;  4YFJ A;  3FIX A;  1BO4 A;  1R57 A;  1WK4 A;  3R9G A;  1XE4 A;  2VXK A;  3ZJ0 A;  3TO7 A;  5CNP A;  3DR8 A;  4CRY B;  4KOS A;  1M4I A;  4ORF A;  3TCV A;  2A4N A;  2PSW A;  5I0C A;  1NMT A;  4KUA A;  1I12 A;  3C26 A;  1B87 A;  1IYL A;  2P6G A;  4R3K A;  3N7Z A;  4XPK A;  4RS2 A;  4X5K A;  3R1K A;  5ISV A;  2JLM A;  2J8R A;  5FVJ A;  5IV0 A;  1XIX A;  1Y9W A;  3TO9 A;  4KZT A;  3KKW A;  3SHP A;  2IL4 A;  4MHD A;  2OB0 A;  4XNH B;  3FB3 A;  4JXQ A;  1QST A;  3OWC A;  3GKR A;  3PZJ A;  2P0W A;  4R87 A;  1ON0 A;  1S5K A;  4MI4 A;  2OZU A;  2FXF A;  1YRE A;  4KLV A;  1QSM A;  4KOX A;  4FD7 A;  3P2H A;  4B5O A;  3VWE A;  2G3A A;  4CAX A;  5KTC A;  3EXN A;  3DNS A;  1NSL A;  2ZW4 A;  5IX3 A;  1QSN A;  2B4D B;  1UFH A;  1Z4E A;  3IGR A;  2PR8 A;  3IWG A;  3P2F A;  1S60 A;  2VQY A;  1SQH A;  1IIC A;  3W6X A;  2FS5 A;  5F46 A;  4MY0 A; 
#chains in the Genus database with same CATH topology
 5H86 A;  3SXO A;  4H6Z A;  2DPS A;  1VGY A;  1MK4 A;  3TTH A;  1JQG A;  2PJ7 A;  2JBJ A;  4M6G A;  4P10 A;  4QUS A;  2QIR A;  1PCA A;  4IUS A;  4B12 A;  1XMT A;  1WWZ A;  2FIW A;  2PJ8 A;  4UIB A;  4XNH C;  4O23 A;  2Q44 A;  5JM6 A;  3PFO A;  4CAW A;  3E0K A;  1DTD A;  2I3C A;  3IU2 A;  4A37 A;  2Z3P A;  3I9S A;  2HUZ A;  3VWD A;  2BEI A;  4JXR A;  3WAB A;  3GY9 A;  3B3S A;  3JVN A;  4QC6 A;  1PUA A;  1NSA A;  1Z4R A;  4L89 A;  2ZW6 A;  3H8F A;  3MGD A;  3NA6 A;  2CNS A;  2GU2 A;  1KUY A;  4IHM A;  1YLE A;  3PB4 X;  1KUV A;  4NGQ A;  2PJ6 A;  4UA3 A;  2Q7S A;  1QSR A;  4XPD B;  2NYQ A;  3PBE A;  1IOF A;  5J8F A;  2PQ8 A;  4X8I A;  4R6T A;  4AVB A;  2XEI A;  4F0Y A;  3I1U A;  1Z9U A;  4AVA A;  2C6C A;  1A2Z A;  1DE4 C;  2IJZ A;  3B3V A;  4A31 A;  3HLP A;  1CX8 A;  2HB6 A;  2O4H A;  2PVV A;  4P4J A;  1I21 A;  3TX8 A;  1TKF A;  4P4B A;  2PDO A;  4UFW A;  3TOB A;  5JGF A;  2VL1 A;  2ZEO A;  3G8W A;  4KOU A;  4A38 A;  5J8C A;  4KVX A;  4JD6 A;  4OID A;  3D2P A;  4J3G A;  3IIB A;  2PE3 A;  4IK2 A;  4C7H A;  2Q43 A;  3W6S A;  3FBU A;  4KVM E;  4L8A A;  1HDQ A;  2Q4Y A;  4LX9 A;  2PCU A;  1J4J A;  3CPX A;  1TXR A;  2IMO A;  2V8V A;  3QAH A;  1Y0R A;  2OZH A;  2EK9 A;  4KUB A;  3FNC A;  3MRU A;  4ZY0 A;  3FED A;  2GAN A;  5K8P A;  1IOI A;  4PSW A;  4UEE A;  4Z65 A;  2PR1 A;  3CXS A;  2J9A A;  3NH8 A;  3R9F A;  4PK2 A;  4BMH A;  5HXD A;  4FWU A;  4RI1 A;  4LQG A;  5EC4 A;  5E96 A;  4HNY B;  1FY7 A;  4E2A A;  2FE7 A;  2WPW A;  2K5T A;  4UIA A;  3BI1 A;  5AG6 A;  7CPA A;  2Y0M A;  1N71 A;  3D7F A;  4P6Y A;  3S6F A;  4RUH A;  1HDU A;  2WYR A;  2GLF A;  2VBQ A;  2ARH A;  2RFH A;  4PQA A;  2ZEE A;  2YGW A;  2EWB A;  3B7I A;  1KZF A;  4NSQ A;  4FBE A;  2QML A;  2PIZ A;  3SI2 A;  5CBM A;  3V38 A;  4A33 A;  4XPD C;  2I79 A;  4FD4 A;  3LAC A;  4PK3 A;  3EO4 A;  3PB7 X;  1MJ9 A;  2BOA A;  2F8H A;  2B3V A;  3B3T A;  5CPA A;  2WSA A;  4M6H A;  2Q7B A;  2AFM A;  2D4O A;  4A32 A;  4OIW A;  4CAV A;  2DXQ A;  3F8K A;  4ZY2 A;  1HEE A;  1TIQ A;  2FT0 A;  3BHX A;  5LYI A;  4IF5 A;  4U5Y A;  2DF5 A;  2OU2 A;  2ZOG A;  3IFE A;  3VAR A;  5HVG A;  1IID A;  2VI7 A;  4DYO A;  5THW A;  1CM0 A;  2ABZ A;  1CP6 A;  4FAI A;  5HVH A;  1XFO A;  3GLJ A;  4U9Y A;  2B3U A;  1Y0Y A;  4R7M A;  4NGP A;  2JDD A;  5EMI A;  4JJX A;  1S7F A;  2NMT A;  4F9V A;  5LRK A;  1YR0 A;  3D7G A;  1ZLI A;  5BWA B;  5J1Q A;  1GHE A;  1S3Z A;  4II9 A;  3FEC A;  4BD9 A;  1IGB A;  2C1C A;  3KZW A;  3S9M A;  4OC2 A;  4MCR A;  4CS0 B;  1TKH A;  5F49 A;  2R7H A;  2Z10 A;  3D8P A;  3L2N A;  4JZ0 A;  1CP7 A;  2I00 A;  2XEF A;  5H84 A;  2JEV A;  2FSR A;  4OAD A;  5G21 A;  1YK3 A;  5LYL A;  1CPX A;  4MFQ A;  2P6E A;  4H6U A;  1Z8X A;  2YNC A;  2R98 A;  4CRZ B;  2O28 A;  4ZY1 A;  4NF1 A;  5EBV A;  4MCS A;  3KQZ A;  3SJX A;  4P45 A;  1U6M A;  1ARM A;  2KCW A;  3S6G A;  4UWI A;  4NXY A;  1M44 A;  1L0C A;  2F5I A;  2EK8 A;  4YU9 A;  4FUU A;  3DR6 A;  3V8I A;  3H4Q A;  3BJ8 A;  2AFZ A;  4P4D A;  1NE9 A;  2Q4Z A;  1BPN A;  2ZEF A;  3D2M A;  2R1I A;  5I4M A;  1Q2D A;  5DS0 A;  3IEH A;  3SJE A;  1S7L A;  2AE6 A;  1AUG A;  4MY3 A;  3SJG A;  3VH9 A;  4B13 A;  4CGP A;  4EVY A;  4MXU A;  4MHY A;  5C88 A;  1V0C A;  2D4P A;  3K9T A;  4B14 A;  3KHZ A;  5LYD A;  2B4B A;  2B5G A;  4NJR A;  3TC8 A;  1RTQ A;  4MBU A;  4A95 A;  2JEW A;  4AG7 A;  3PP9 A;  5JH9 A;  4X3R A;  2ZW5 A;  4F6A A;  2C27 A;  3EY5 A;  2OZG A;  1RO5 A;  3R96 A;  4R57 A;  3R9E A;  3T8W A;  4JWP A;  1JWQ A;  3CT9 A;  4B5P A;  3PBB A;  4TNU A;  4KOR A;  2BUE A;  3BXM A;  1LAN A;  3WC5 A;  3GIU A;  4MHN A;  4UF4 A;  1TF9 A;  1VHS A;  1YSJ A;  1VKC A;  3F0A A;  3CXQ A;  3GUX A;  3JUW A;  4AXV A;  4B11 A;  1YX0 A;  3ISX A;  3WC7 A;  5DWN A;  2EO8 A;  4LUA A;  4CYQ A;  3A9L A;  3EFA A;  2GIV A;  3R95 A;  2OR4 A;  1QSO A;  2WPX A;  2IQ6 A;  4DJL A;  2Z3M A;  1B6B A;  2BCO A;  2OH1 A;  2FL4 A;  3JTK A;  3V7Z A;  4AG9 A;  1Y7E A;  3NE7 A;  4P4E A;  4WJB A;  3LWU A;  2ZED A;  4F0X A;  1ELL P;  2CXA A;  3WC6 A;  3CZX A;  1Z8W A;  4ZX9 A;  3B35 A;  3D7D A;  3B2Y A;  4M6I A;  4A39 A;  1BPM A;  4QB9 A;  1YGH A;  3BJ7 A;  4M3S A;  2ZOF A;  3CXP A;  3FXT A;  4ONU A;  5A27 A;  4OKO A;  4UFV A;  3S6H A;  5IB9 A;  3TFY A;  3MN8 A;  3QNV A;  3D67 A;  3G3S A;  3PRT A;  2V8H A;  3KQX A;  2ZPA A;  4HNX B;  5D8N A;  4XPL A;  3KHX A;  4OC0 A;  4OC5 A;  2H5M A;  4NGT A;  2OOT A;  4H89 A;  2J8M A;  3LOD A;  1XRY A;  1LCP A;  2V77 A;  4OLL A;  1MJA A;  2Q0Y A;  4MJ8 A;  4ZYQ A;  2P6F A;  3FRM A;  4CYO A;  2VEZ A;  5DWM A;  1VHO A;  3SXN A;  5LYF A;  2Q51 A;  1ZG9 A;  4I49 A;  5JPH A;  3K9U A;  4A2Z A;  3KR5 A;  4KVO E;  3FF3 A;  4GM5 A;  4MHZ A;  4NFR A;  4ZI6 A;  2GFQ A;  5K8N A;  1BOB A;  3TT2 A;  4YGO A;  1S7N A;  1K4J A;  3S9L A;  5F09 A;  2G9D A;  3D3S A;  4MHP A;  4KOT A;  1M4D A;  3PFE A;  2HC9 A;  1CJW A;  1IY7 A;  1XMB A;  2RC4 A;  4BIN A;  1M4G A;  4R8F A;  1H8L A;  2G0B A;  2ZEM A;  4PV6 A;  2NSM A;  4PPZ A;  4Q7A A;  1RXT A;  2REF A;  2BSW A;  2FCK A;  2QJ8 A;  4Y49 B;  2G3T A;  2CF4 A;  3TE4 A;  2X7B A;  3LMS A;  4KS9 A;  5K8O A;  2AFO A;  2Z11 A;  1XF8 A;  2ZEN A;  1CBX A;  4AVC A;  3F5B A;  4U9Z A;  1Y9K A;  2B58 A;  3FYN A;  4C2X A;  4GS4 A;  1FT7 A;  3I3G A;  1BAV A;  3D66 A;  3H5Z A;  4KOW A;  4WWV A;  4A30 A;  1F57 A;  1VHE A;  2PRB A;  1Z5R A;  1LAP A;  1PYT B;  1TF8 A;  3IWW A;  4OC4 A;  5A28 A;  4OP4 A;  3IWE A;  2GE3 A;  3B3W A;  1QQ9 A;  2CTC A;  3IJ3 A;  2B4D A;  2Q04 A;  2EUI A;  2HQY A;  2CNT A;  3FVL A;  3PB8 X;  4UCN A;  5K8M A;  4ZBG A;  2PJ4 A;  4MFK A;  3TO6 A;  4C2Y A;  4G1P A;  1VIX A;  2PC1 A;  3WR7 A;  3WT4 A;  3DGV A;  1P4N A;  2PJ3 A;  1I1D A;  3D7H A;  2AFU A;  1YME A;  1IYK A;  4OME A;  3EC4 A;  1P0H A;  3CDX A;  4RN7 A;  1ARL A;  1GYT A;  2FVG A;  1ZLH A;  1KWM A;  3NE8 A;  4QVT A;  3W91 A;  1Z2L A;  5G22 A;  2JDC A;  1EE3 P;  1R43 A;  2ZXV A;  4UCM A;  1AMP A;  1YVK A;  1ELM P;  4F8Z A;  2Z3L A;  1MJB A;  5C82 A;  4UEF A;  3H8G A;  5JQ4 A;  2BL1 A;  2V8D A;  1OZP A;  3D4U A;  1YVO A;  2PJ0 A;  4FD5 A;  5AG7 A;  4E0A A;  3T90 A;  4Q38 A;  3BLN A;  1XEB A;  1KUX A;  2J8N A;  2HV2 A;  2QVP A;  2VZY A;  2Z0Z A;  3FJU A;  4MFL A;  5F48 A;  4PSX A;  2AJ6 A;  4NGN A;  1IB1 E;  3ISZ A;  2ZEL A;  4Y49 C;  4AB7 A;  5HMN A;  3T9Y A;  1LAM A;  1M4L A;  2CY2 A;  4HKF A;  4IAV A;  4OC3 A;  5F47 A;  3ZZI A;  2Z3N A;  4FD6 A;  3PB9 X;  2YND A;  4C68 A;  4CYN A;  4YRH A;  2PJA A;  4P4I A;  2PVW A;  3QAY A;  4YWY A;  2QEC A;  4NEX A;  2REE A;  3KAS A;  1OBR A;  2JBK A;  5IB0 A;  2FIA A;  2PJ5 A;  1UWY A;  3PEI A;  2CIJ A;  4ZX8 A;  4KOY A;  4MFZ A;  3GYA A;  4DUK A;  4ZGY B;  3IC1 A;  5G1Z A;  3B8G A;  5G20 A;  4P4F A;  4X2T A;  3DSB A;  2YNE A;  1FNO A;  1Q7L A;  1Q2Y A;  2ZEH A;  3CPA A;  3QB8 A;  3GB0 A;  4HPS A;  4KOV A;  1X10 A;  2RB7 A;  4DNC A;  3KR4 A;  2Q4V A;  1XOV A;  3NH4 A;  3LD2 A;  3IO1 A;  4OAE A;  4UBR A;  4QBJ A;  4R3L A;  4JLY A;  4JYW A;  4B10 A;  4TWE A;  2VZZ A;  3DDD A;  4W9Y A;  1Q2C A;  4NCZ A;  5GCN A;  5KTD A;  2PJ1 A;  4R9M A;  4PXC A;  1S7K A;  2B5G B;  3FX6 A;  4H2K A;  2WUU A;  2R8V A;  1PU9 A;  5HH1 A;  4CAF A;  4PXB A;  2Z3K A;  4HNW B;  3TOA A;  5KTA A;  4Q36 A;  1F2O A;  4MRI A;  1ZG8 A;  3RNZ A;  1Y7R A;  2ZW7 A;  2BO9 A;  2PJ9 A;  4B5P B;  1M1D A;  4PXD A;  3S6K A;  4KSF A;  4MCQ A;  4CGN A;  2ANP A;  3IU1 A;  1TKJ A;  3PGP A;  4UCP A;  2EVN A;  2CTB A;  4E8O A;  3N5F A;  4CGO A;  3RYO A;  3NFZ A;  4KLW A;  2PJB A;  4M85 A;  2GRE A;  3BI0 A;  5AGE A;  4C7I A;  2ODF A;  4UWJ A;  4K30 A;  1LRZ A;  2AFS A;  2XEJ A;  2CNM A;  2ATR A;  3UY5 A;  4YFJ A;  1YW4 A;  3FIX A;  1BO4 A;  2WZN A;  1R57 A;  1X12 A;  1WK4 A;  2YNC C;  3R9G A;  3RO0 A;  1CG2 A;  3HUV A;  1CPS A;  1XE4 A;  2AFX A;  2VXK A;  5HVF A;  3SI0 A;  4B6Z A;  3DLJ A;  3ZJ0 A;  4K3N A;  4KSA A;  1LOK A;  1Z8T A;  4EME A;  2POK A;  3TO7 A;  4NGS A;  2C6P A;  5CNP A;  2V8G A;  3FH4 A;  2PJC A;  3DR8 A;  2Z3O A;  4EWT A;  2PIY A;  4CRY B;  3D68 A;  2EBJ A;  4UEZ A;  4C2Z A;  4KOS A;  4CAE A;  1M4I A;  2AFW A;  3RBU A;  2QYV A;  4ORF A;  3TCV A;  4CYP A;  2A4N A;  2PSW A;  3K2K A;  5AG5 A;  3SI1 A;  1AYE A;  5I0C A;  1NMT A;  4KUA A;  1I12 A;  1QMU A;  3C26 A;  4MFJ A;  1B87 A;  1F2P A;  4PXE A;  1IYL A;  2P6G A;  4R3K A;  3N7Z A;  4XPK A;  2XEG A;  4RS2 A;  2O53 A;  4OC1 A;  3B3C A;  4X5K A;  3R1K A;  5ISV A;  2JLM A;  8CPA A;  4EFD A;  1YQE A;  3FEE A;  2J8R A;  1Z8L A;  3KI9 A;  1XIX A;  1Y9W A;  1BLL E;  5FVJ A;  5IV0 A;  3JRU A;  2PJ2 A;  3TO9 A;  3KKW A;  4KZT A;  3SHP A;  1ZO0 A;  2IL4 A;  4MHD A;  2OB0 A;  5AG4 A;  4XNH B;  3FB3 A;  4CGL A;  3H8E A;  4NGM A;  4JXQ A;  1XBU A;  1QST A;  3NH5 A;  3OWC A;  3S9N A;  1XJO A;  3GKR A;  2ZEP A;  3PZJ A;  2P0W A;  5LRJ A;  4CPA A;  4R87 A;  2DEA A;  3VAT A;  1ON0 A;  1S5K A;  4MMO A;  4MI4 A;  4A94 A;  2OZU A;  3PB6 X;  3SJF A;  2FXF A;  2DPT A;  4NJQ A;  1YRE A;  4KLV A;  4BBH A;  1QSM A;  3FMC A;  4KOX A;  4FD7 A;  4NGR A;  3P2H A;  5LRG A;  4B5O A;  6CPA A;  4P44 A;  4F9U A;  3VWE A;  4ONW A;  4MCP A;  2G3A A;  4CAX A;  4MFP A;  5KTC A;  3EXN A;  1YLO A;  2C6G A;  5D29 A;  3DNS A;  3RAM A;  4UFX A;  1NSL A;  2ZW4 A;  1ZG7 A;  3KGQ A;  1IU8 A;  1QSN A;  3KL9 A;  5IX3 A;  2B4D B;  1YW6 A;  1UFH A;  4KSI A;  2ZEG A;  1Z4E A;  3IGR A;  2PR8 A;  3IWG A;  3P2F A;  1R3N A;  1S60 A;  2VQY A;  1SQH A;  4R76 A;  2GLJ A;  4LQ6 A;  1IIC A;  5ELY A;  3W6X A;  2FS5 A;  4GXH A;  3RZA A;  4CGM A;  1LFW A;  5F46 A;  2PRQ A;  2F7V A;  4MY0 A; 
#chains in the Genus database with same CATH homology
 5H86 A;  3SXO A;  4H6Z A;  2DPS A;  3TTH A;  1MK4 A;  4QUS A;  2QIR A;  4IUS A;  4B12 A;  1XMT A;  1WWZ A;  2FIW A;  4XNH C;  2Q44 A;  4CAW A;  3E0K A;  3IU2 A;  2Z3P A;  3I9S A;  2HUZ A;  3VWD A;  2BEI A;  4JXR A;  3GY9 A;  3JVN A;  4QC6 A;  1PUA A;  1Z4R A;  4L89 A;  2ZW6 A;  3MGD A;  2CNS A;  1KUY A;  1YLE A;  1KUV A;  4UA3 A;  4XPD B;  1QSR A;  5J8F A;  2PQ8 A;  4AVB A;  4F0Y A;  1Z9U A;  4AVA A;  4A31 A;  1I21 A;  3TOB A;  2PDO A;  4UFW A;  3G8W A;  4KOU A;  5J8C A;  4KVX A;  4JD6 A;  3D2P A;  4J3G A;  4C7H A;  3W6S A;  3FBU A;  4KVM E;  4L8A A;  2Q4Y A;  4LX9 A;  1J4J A;  3QAH A;  2OZH A;  4KUB A;  3FNC A;  2GAN A;  4PSW A;  2PR1 A;  3CXS A;  3R9F A;  4PK2 A;  4BMH A;  4RI1 A;  5EC4 A;  5E96 A;  4HNY B;  1FY7 A;  4E2A A;  2FE7 A;  2WPW A;  2K5T A;  5AG6 A;  2Y0M A;  1N71 A;  3S6F A;  2VBQ A;  2ARH A;  2YGW A;  1KZF A;  4NSQ A;  2QML A;  4A33 A;  4XPD C;  2I79 A;  4FD4 A;  4PK3 A;  3EO4 A;  1MJ9 A;  2B3V A;  2WSA A;  2Q7B A;  2D4O A;  4A32 A;  4CAV A;  2DXQ A;  3F8K A;  1TIQ A;  2FT0 A;  4IF5 A;  4U5Y A;  2OU2 A;  1IID A;  2VI7 A;  1CM0 A;  4U9Y A;  2B3U A;  2JDD A;  4JJX A;  1S7F A;  2NMT A;  1YR0 A;  5BWA B;  1GHE A;  1S3Z A;  4II9 A;  4CS0 B;  5F49 A;  2R7H A;  2Z10 A;  3D8P A;  2I00 A;  5H84 A;  2JEV A;  2FSR A;  4OAD A;  5G21 A;  1YK3 A;  4MFQ A;  2P6E A;  4H6U A;  2YNC A;  2R98 A;  4CRZ B;  2O28 A;  4NF1 A;  5EBV A;  1U6M A;  2KCW A;  3S6G A;  4UWI A;  4NXY A;  1M44 A;  1L0C A;  2F5I A;  3DR6 A;  3V8I A;  3H4Q A;  3BJ8 A;  1NE9 A;  3D2M A;  2R1I A;  1Q2D A;  4CGP A;  1S7L A;  2AE6 A;  4B13 A;  4MY3 A;  4EVY A;  5C88 A;  1V0C A;  2D4P A;  4B14 A;  2B4B A;  2B5G A;  4MBU A;  4A95 A;  4AG7 A;  3PP9 A;  2ZW5 A;  4F6A A;  2C27 A;  3EY5 A;  2OZG A;  1RO5 A;  3R96 A;  4R57 A;  3R9E A;  4JWP A;  4B5P A;  4KOR A;  2BUE A;  1VHS A;  3F0A A;  1VKC A;  3CXQ A;  3JUW A;  4B11 A;  1YX0 A;  5DWN A;  4LUA A;  4CYQ A;  3A9L A;  3EFA A;  2GIV A;  3R95 A;  1QSO A;  2WPX A;  2Z3M A;  1B6B A;  2OH1 A;  2FL4 A;  3JTK A;  4AG9 A;  3NE7 A;  4F0X A;  2CXA A;  4QB9 A;  1YGH A;  3BJ7 A;  4M3S A;  3CXP A;  3FXT A;  4ONU A;  5A27 A;  4UFV A;  3S6H A;  3TFY A;  3G3S A;  2ZPA A;  4HNX B;  4XPL A;  2H5M A;  4H89 A;  2J8M A;  3LOD A;  4OLL A;  1MJA A;  2Q0Y A;  4MJ8 A;  2P6F A;  3FRM A;  4CYO A;  2VEZ A;  5DWM A;  3SXN A;  4I49 A;  5JPH A;  3K9U A;  4A2Z A;  4KVO E;  1BOB A;  3TT2 A;  4YGO A;  1K4J A;  1S7N A;  3D3S A;  4KOT A;  1M4D A;  1CJW A;  2RC4 A;  1M4G A;  2G0B A;  4PV6 A;  1RXT A;  2REF A;  2BSW A;  2FCK A;  4Y49 B;  2G3T A;  3TE4 A;  2X7B A;  4KS9 A;  2Z11 A;  1XF8 A;  4AVC A;  3F5B A;  4U9Z A;  1Y9K A;  2B58 A;  3FYN A;  4C2X A;  4GS4 A;  3I3G A;  3H5Z A;  4KOW A;  4A30 A;  2PRB A;  5A28 A;  3IWE A;  2GE3 A;  2B4D A;  2Q04 A;  2EUI A;  2HQY A;  2CNT A;  4UCN A;  4ZBG A;  4C2Y A;  4MFK A;  3TO6 A;  3WR7 A;  2PC1 A;  1P4N A;  1I1D A;  1IYK A;  3EC4 A;  1P0H A;  4QVT A;  3W91 A;  5G22 A;  2JDC A;  2ZXV A;  4UCM A;  1YVK A;  2Z3L A;  1MJB A;  5C82 A;  5JQ4 A;  2BL1 A;  4FD5 A;  1OZP A;  4E0A A;  1YVO A;  5AG7 A;  3T90 A;  4Q38 A;  3BLN A;  1XEB A;  1KUX A;  2J8N A;  2HV2 A;  2VZY A;  2Z0Z A;  5F48 A;  4MFL A;  4PSX A;  2AJ6 A;  1IB1 E;  4Y49 C;  4AB7 A;  5HMN A;  3T9Y A;  2CY2 A;  4HKF A;  5F47 A;  3ZZI A;  2Z3N A;  4FD6 A;  2YND A;  4C68 A;  4CYN A;  4YRH A;  2QEC A;  4NEX A;  2REE A;  5IB0 A;  2FIA A;  4KOY A;  4MFZ A;  3GYA A;  4ZGY B;  5G1Z A;  3B8G A;  5G20 A;  3DSB A;  2YNE A;  4KOV A;  1Q2Y A;  3QB8 A;  4DNC A;  2Q4V A;  3LD2 A;  4OAE A;  4UBR A;  4QBJ A;  4R3L A;  4JLY A;  4B10 A;  2VZZ A;  3DDD A;  5GCN A;  1Q2C A;  4NCZ A;  5KTD A;  4R9M A;  1S7K A;  2B5G B;  2WUU A;  2R8V A;  1PU9 A;  5HH1 A;  4CAF A;  2Z3K A;  4HNW B;  3TOA A;  5KTA A;  4Q36 A;  1Y7R A;  2ZW7 A;  4B5P B;  1M1D A;  3S6K A;  4KSF A;  4CGN A;  3IU1 A;  3PGP A;  4UCP A;  2EVN A;  4E8O A;  4CGO A;  3RYO A;  4KLW A;  4M85 A;  5AGE A;  4C7I A;  4UWJ A;  4K30 A;  1LRZ A;  2CNM A;  2ATR A;  3UY5 A;  4YFJ A;  3FIX A;  1BO4 A;  1R57 A;  1WK4 A;  2YNC C;  3R9G A;  1XE4 A;  2VXK A;  3ZJ0 A;  4KSA A;  3TO7 A;  5CNP A;  3DR8 A;  2Z3O A;  4CRY B;  4C2Z A;  4KOS A;  4CAE A;  1M4I A;  4ORF A;  3TCV A;  4CYP A;  2A4N A;  2PSW A;  5AG5 A;  5I0C A;  1NMT A;  4KUA A;  1I12 A;  4MFJ A;  3C26 A;  1B87 A;  1IYL A;  2P6G A;  4R3K A;  3N7Z A;  4XPK A;  4RS2 A;  4X5K A;  3R1K A;  5ISV A;  2JLM A;  2J8R A;  5FVJ A;  5IV0 A;  1XIX A;  1Y9W A;  3TO9 A;  3KKW A;  4KZT A;  3SHP A;  1ZO0 A;  2IL4 A;  4MHD A;  2OB0 A;  5AG4 A;  4XNH B;  3FB3 A;  4CGL A;  4JXQ A;  1QST A;  3OWC A;  3GKR A;  3PZJ A;  2P0W A;  4R87 A;  1ON0 A;  1S5K A;  4MI4 A;  2OZU A;  2FXF A;  2DPT A;  1YRE A;  4KLV A;  4BBH A;  1QSM A;  4KOX A;  4FD7 A;  3P2H A;  4B5O A;  3VWE A;  2G3A A;  4CAX A;  4MFP A;  5KTC A;  3EXN A;  3DNS A;  4UFX A;  1NSL A;  2ZW4 A;  5IX3 A;  1QSN A;  2B4D B;  1UFH A;  1Z4E A;  3IGR A;  2PR8 A;  3IWG A;  3P2F A;  1S60 A;  2VQY A;  1SQH A;  1IIC A;  3W6X A;  4CGM A;  2FS5 A;  5F46 A;  4MY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...