5DWMA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
b'HMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphinothricin N-acetyltransferase
molecule tags Transferase
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis
rcsb
total genus 53
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwmA00
1PU9A 2VZZA 3ZZIA 4JLYA 1S7LA 1M4IA 4H6ZA 4YGOA 2BL1A 2B5GA 2QIRA 2ZW5A 2Y0MA 5ISVA 4PV6A 3D3SA 1MJ9A 1IYLA 3EY5A 1Y9KA 1SQHA 1Q2CA 3R95A 1K4JA 2REFA 4DNCA 5J8CA 3S6HA 1OZPA 2Q44A 5HH1A 2CNTA 5EBVA 1GHEA 1B6BA 2K5TA 2F5IA 3JVNA 3S6KA 3NE7A 4QC6A 2OU2A 1IICA 2GANA 1XMTA 2B58A 3W6XA 4MY3A 4HNWB 2D4OA 4AB7A 3TO9A 4M85A 3R9EA 4QVTA 4KOTA 2Q7BA 3SHPA 4CRYB 4OLLA 2H5MA 3V8IA 3KKWA 2Q04A 4KORA 4HNYB 3BLNA 1N71A 2B4BA 4IF5A 4XPKA 3PP9A 1Z9UA 4QBJA 4NEXA 3D2MA 2AJ6A 1PUAA 2GE3A 2JEVA 3P2FA 1QSNA 3GKRA 4MHDA 4CS0B 4JJXA 1RO5A 1Q2YA 3FYNA 1V0CA 4JD6A 1UFHA 3OWCA 3FNCA 2VI7A 2NMTA 4U9ZA 2C27A 2EUIA 4JXQA 4UBRA 4OADA 2OB0A 2R98A 1B87A 3SXOA 3S6GA 2CNSA 2VEZA 4F0YA 3P2HA 4L89A 1QSTA 3EFAA 3CXQA 2GIVA 1NSLA 4R87A 2Z11A 1YX0A 3DR6A 5JPHA 4JXRA 4GS4A 3K9UA 2WPXA 5JQ4A 4XPDC 2G0BA 5KTCA 4E0AA 4KVOE 2B4DA 4MBUA 4NSQA 4CAWA 2J8MA 2PC1A 4XPLA 1J4JA 1KUYA 4Y49C 4KVXA 4YRHA 4NCZA 2B4DB 2WPWA 3VWDA 2HV2A 3TTHA 1BO4A 2REEA 1XE4A 4I49A 4PSXA 2BEIA 3D2PA 4IUSA 4LX9A 1S60A 1QSRA 5DWMA 3EO4A 5DWNA 3TOAA 4B5PB 1CJWA 2ZW6A 4MY0A 4YFJA 1LRZA 1M4GA 4JWPA 2OZUA 4XNHB 4PK3A 2HQYA 2ARHA 1VHSA 2ZW4A 3FXTA 1Z4EA 4KZTA 4II9A 1YVKA 3TE4A 3DDDA 2BSWA 1CM0A 3I9SA 2G3AA 3JUWA 3E0KA 4FD5A 4NF1A 4AVBA 1I12A 2PDOA 2JLMA 2B3VA 2JDDA 4HKFA 1R57A 3C26A 1Q2DA 3EC4A 3TO7A 5F47A 5F46A 1QSMA 3QB8A 1YK3A 3GY9A 4H89A 1RXTA 4R57A 3FIXA 2Z10A 2VXKA 4X5KA 4E8OA 2D4PA 5GCNA 3R96A 4KLWA 1IYKA 4ZBGA 2ZW7A 3W6SA 1S7KA 4U5YA 4PSWA 3DSBA 2FSRA 4FD4A 1IB1E 5E96A 4FD7A 4AG7A 4H6UA 1I21A 1KZFA 5H84A 5FVJA 2Q0YA 2DXQA 2FCKA 5F49A 3BJ8A 2RC4A 3W91A 5H86A 4M3SA 2Q4YA 1YR0A 2FL4A 2Z0ZA 3F8KA 2PSWA 4L8AA 4MI4A 5IV0A 4U9YA 2JDCA 2X7BA 2FIWA 5C82A 1Y9WA 1S7FA 1P4NA 3ZJ0A 2PQ8A 4UWIA 4ORFA 4PK2A 2Q4VA 2R1IA 3PZJA 2ATRA 3F5BA 4KOWA 1VKCA 2B3UA 5IB0A 4F6AA 2FE7A 3PGPA 4KOYA 3IGRA 1BOBA 3FBUA 1WWZA 4KOUA 3H4QA 4RS2A 1MJBA 1S7NA 5F48A 1QSOA 3TO6A 4R3KA 4QB9A 2FXFA 2J8NA 3LODA 2VQYA 3F0AA 1IIDA 4ONUA 2FIAA 3CXPA 1S3ZA 4KOSA 2I79A 1M1DA 4XPDB 2PR1A 2G3TA 2OZHA 4J3GA 4KOVA 3LD2A 3S6FA 4B5PA 2CNMA 1U6MA 2PRBA 2P6FA 2PR8A 3SXNA 2EVNA 4RI1A 3VWEA 1YVOA 2O28A 3FRMA 4KOXA 2P6GA 4QUSA 3FB3A 3MGDA 4XNHC 3D8PA 3R1KA 1NE9A 4LUAA 5HMNA 3RYOA 2R8VA 5C88A 1FY7A 3IWGA 4K30A 1YREA 2VBQA 3QAHA 2FT0A 3BJ7A 4FD6A 4AVCA 2R7HA 2FS5A 3I3GA 1M4DA 1L0CA 3G8WA 1I1DA 2BUEA 1MK4A 3T9YA 4Y49B 1YLEA 3GYAA 4KUBA 2KCWA 4KUAA 3TCVA 2P6EA 3G3SA 5CNPA 2P0WA 1S5KA 1KUXA 2QMLA 5I0CA 4R9MA 2HUZA 3UY5A 2ZXVA 1P0HA 2J8RA 1WK4A 4OAEA 4UA3A 2A4NA 2IL4A 4HNXB 5KTDA 4AG9A 3T90A 1ON0A 4R3LA 2VZYA 3R9GA 3DR8A 1YGHA 3TT2A 4BMHA 3DNSA 2CY2A 1NMTA 1XIXA 4CAXA 5IX3A 4AVAA 4EVYA 2ZPAA 4CAVA 5J8FA 1KUVA 1Y7RA 4E2AA 4KVME 4NXYA 3TFYA 3CXSA 3TOBA 2OZGA 1MJAA 2AE6A 1M44A 1XEBA 4UWJA 3R9FA 3EXNA 2OH1A 2I00A 1TIQA 2QECA 3N7ZA 4KLVA 3WR7A 1XF8A 5KTAA 3B8GA 4CRZB 5EC4A 4MJ8A 4B5OA 1Z4RA 2B5GB
chains in the Genus database with same CATH superfamily
1PU9A 4Z65A 3FEEA 1BPMA 4FWUA 2VZZA 4ZY2A 4JLYA 3ZZIA 1S7LA 1M4IA 2BOAA 4H6ZA 5J1QA 4YGOA 2BL1A 3IU1A 2B5GA 2QIRA 2ZW5A 3PB8X 4OKOA 4ZGYB 5THWA 2Y0MA 1EE3P 5LYFA 5ISVA 3PB6X 4ZY1A 1IY7A 1OBRA 4PV6A 3PRTA 3D3SA 4ZX8A 1MJ9A 2F8HA 2DPSA 3PEIA 1IYLA 3EY5A 1Y9KA 1LAMA 4A39A 1SQHA 3SI1A 1AUGA 1Q2CA 2WYRA 1K4JA 3IWEA 1XBUA 3R95A 4CYOA 2AFMA 4NGTA 2PJ9A 2REFA 4OIWA 2Q7SA 1FT7A 4NFRA 4C2ZA 4DNCA 3S6HA 1GYTA 3KGQA 4UCNA 5J8CA 3KHZA 4MXUA 3FMCA 1OZPA 2ZEHA 5F09A 1R3NA 4GXHA 2Q44A 3IFEA 2ZENA 5HH1A 4A2ZA 4TNUA 2CNTA 1CPXA 5EBVA 3RO0A 4W9YA 1GHEA 4BBHA 1X10A 1B6BA 2K5TA 2F5IA 3JVNA 4M6IA 4NGPA 1JWQA 3S6KA 1Z8LA 4P45A 4FBEA 1Y7EA 3NE7A 4QC6A 2OU2A 1IICA 3D4UA 2EK8A 5LYDA 2GANA 4JYWA 1XMTA 4ZI6A 1ZG8A 2B58A 3W6XA 3HUVA 4MY3A 1CP7A 4P4IA 4HNWB 2D4OA 3BI0A 4P4BA 4M85A 3TO9A 4AB7A 3R9EA 4QVTA 4KOTA 3KQXA 2Q7BA 3SHPA 3KHXA 4CRYB 4OLLA 2V8DA 2H5MA 3V8IA 1Z8WA 2DEAA 2Z3PA 3KKWA 2Q04A 1XFOA 3RNZA 3IO1A 4KORA 4HNYB 5HXDA 4A37A 2IJZA 3BLNA 1N71A 1XOVA 4Q7AA 2B4BA 4MCPA 2Q51A 4IF5A 4PXEA 5LRJA 2Q43A 4XPKA 3PP9A 3DLJA 1Z9UA 2O53A 1PCAA 4OC4A 4ZX9A 3WABA 4QBJA 3B2YA 4NEXA 3D2MA 2AJ6A 1PUAA 2GE3A 4CGMA 1FNOA 2BCOA 2JEVA 2Z3OA 2V8GA 3P2FA 1QSNA 3V38A 2CTBA 3GKRA 2PE3A 3IWWA 3QAYA 4LQ6A 4MHDA 4F9VA 4CS0B 2HB6A 3PB7X 4JJXA 4OC0A 4YWYA 1RO5A 2Z3NA 1YSJA 1IU8A 1Q2YA 4MHYA 3TC8A 3NH4A 3FYNA 4H2KA 4CYPA 4NGNA 1V0CA 2PJ0A 1UFHA 3OWCA 4JD6A 1ZLHA 3FNCA 2VI7A 2NMTA 4U9ZA 2C27A 5I4MA 2EUIA 4JXQA 3ISZA 4UBRA 2V8HA 4OADA 4MHNA 2OB0A 2R98A 1B87A 3SXOA 4P4JA 4R76A 3S6GA 2CNSA 4UFVA 2VEZA 4Q36A 4WJBA 1Z8TA 4F0YA 3NA6A 3P2HA 4MFPA 4OC3A 1X12A 4L89A 1QSTA 3BHXA 3EFAA 3CXQA 3I1UA 1ZG7A 2GIVA 3T8WA 2GU2A 2V8VA 2XEFA 3N5FA 1NSLA 4R87A 3CPXA 2Z11A 1YX0A 3DR6A 5JPHA 1XJOA 2EK9A 2Z3MA 4CGPA 4JZ0A 4JXRA 4GS4A 4UF4A 3K9UA 1TKFA 2WPXA 5HVGA 4NJQA 5JQ4A 1XRYA 3KR4A 4XPDC 4Q38A 1CPSA 2G0BA 3B3CA 2FVGA 3NH5A 5G22A 4A38A 5KTCA 4E0AA 4KVOE 2B4DA 1DTDA 1M4LA 3IIBA 4G1PA 5A28A 2Z3KA 4MBUA 4NSQA 4CAWA 2XEGA 2J8MA 2PC1A 3LACA 3NFZA 3PB9X 4XPLA 4ZY0A 1J4JA 4F0XA 1KUYA 4Y49C 4KVXA 4NGRA 1YW6A 4YRHA 4NCZA 4OC2A 2B4DB 2WPWA 2ABZA 4P6YA 3VWDA 5LYIA 2HV2A 3TTHA 4B13A 1BO4A 5G20A 2REEA 5LRKA 1PYTB 1XE4A 2AFWA 2I3CA 4GM5A 4I49A 3D7GA 4PSXA 2BEIA 1TXRA 3H8GA 3TX8A 3D2PA 3JTKA 4IUSA 1HEEA 1LAPA 4LX9A 1S60A 2ZEMA 5LRGA 1LOKA 1QSRA 2JEWA 3EO4A 5DWMA 1Z2LA 1ZG9A 5DWNA 3PBBA 2PJ3A 3TOAA 4B5PB 1CJWA 2ZW6A 5A27A 2WUUA 1YQEA 1LANA 4TWEA 4MY0A 3SJXA 2WSAA 2YNDA 1LRZA 4YFJA 3PFEA 1HDQA 1M4GA 4JWPA 2OZUA 4XNHB 4PK3A 2ZOFA 2HQYA 3BI1A 4X3RA 2PJCA 2EWBA 2XEJA 1IOFA 2ARHA 1IOIA 1VHSA 4UEZA 2YNCA 3BXMA 2ZW4A 3FXTA 1Z4EA 2WZNA 1ELMP 2PRQA 4KZTA 4C68A 4II9A 1YVKA 4B11A 3TE4A 3DDDA 1TF9A 1CM0A 2BSWA 2JBKA 3I9SA 2G3AA 4BD9A 5AG4A 3JUWA 1VHEA 2CF4A 3E0KA 4FD5A 2QYVA 4NF1A 4AVBA 1Y0RA 2AFZA 1I12A 1LFWA 2CXAA 2PDOA 2JLMA 2B3VA 2C6CA 2JDDA 3CT9A 4HKFA 1R57A 3C26A 4CGLA 3JRUA 1Q2DA 2EO8A 2YNEA 3A9LA 4MRIA 1YLOA 2AFXA 3EC4A 4CRZB 3TO7A 4YU9A 5F47A 5F46A 5DS0A 3QNVA 1QSMA 3QB8A 1VGYA 1YK3A 1BPNA 2AFUA 4CAEA 1VHOA 3GY9A 4H89A 1RXTA 4R57A 3FIXA 2Z10A 4WWVA 2VXKA 2PIYA 4HPSA 4P10A 1ARMA 4X5KA 4CPAA 4E8OA 2D4PA 1F2PA 5GCNA 3R96A 4KLWA 1BLLE 4KSFA 1IYKA 3B35A 2AFSA 1QQ9A 4MHPA 4NJRA 2ZW7A 4PQAA 4ZBGA 1S7KA 3FX6A 4IHMA 3DSBA 4PSWA 4U5YA 2HC9A 3FJUA 3W6SA 4OIDA 3FF3A 2FSRA 4FD4A 2YGWA 3LMSA 3FEDA 1IB1E 1CP6A 5E96A 4FD7A 5G21A 4AG7A 4H6UA 4NGSA 4ZYQA 2PJ4A 1I21A 1KZFA 5ELYA 5H84A 2OR4A 3H5ZA 5FVJA 2Q0YA 4MFJA 2O4HA 4OC5A 2DXQA 3SI0A 5BWAB 2FCKA 4R6TA 5F49A 3BJ8A 2RC4A 1VIXA 3W91A 5H86A 3PFOA 4M3SA 2Q4YA 1YR0A 2FL4A 2Z0ZA 3F8KA 2EBJA 1HDUA 2PSWA 1AYEA 3B3SA 4L8AA 4MI4A 4KS9A 4UFXA 5IV0A 4U9YA 3PBEA 2NSMA 3KQZA 2JDCA 2X7BA 2PVVA 3FECA 2FIWA 3CDXA 4OP4A 4PXDA 5C82A 1Y9WA 1S7FA 1P4NA 5AGEA 5AG7A 3ZJ0A 4OMEA 5CPAA 3S9MA 1JQGA 3D7HA 2PQ8A 4A30A 1Y0YA 3LWUA 4MFQA 3FH4A 4UWIA 4ORFA 2J9AA 2PJ1A 3D68A 4PK2A 2Q4VA 2R1IA 2ZEGA 3CPAA 3IC1A 2PJ6A 3PZJA 2ATRA 2CTCA 3F5BA 4KOWA 2DF5A 4RUHA 2PJ7A 1VKCA 1TKHA 3FVLA 2B3UA 1CG2A 2ZEPA 2ZEDA 3VATA 3VARA 5IB0A 4F6AA 2FE7A 2C1CA 3PGPA 4KOYA 2PJ8A 3RBUA 4A32A 3L2NA 4CYQA 3IGRA 1NSAA 3B7IA 1BOBA 3FBUA 1WWZA 4KOUA 4ONWA 3H4QA 4RS2A 1MJBA 2C6PA 4CGNA 5HVHA 4PXBA 1S7NA 5F48A 1QSOA 1IGBA 3ISXA 7CPAA 1YMEA 2ZEOA 4CAFA 2DPTA 4NGQA 4R3KA 4QB9A 3TO6A 2FXFA 2J8NA 3LODA 2VQYA 1ELLP 4NGMA 5JGFA 3D7DA 3F0AA 2RFHA 1RTQA 4MMOA 1IIDA 4C7IA 4B14A 3WC5A 4C2XA 4ONUA 3B3TA 4FAIA 2FIAA 3CXPA 4X8IA 1S3ZA 4P4DA 4KOSA 4A94A 2XEIA 3DGVA 2I79A 4MCQA 1M1DA 2ODFA 2F7VA 2GLJA 4KSAA 4B10A 4XPDB 2PR1A 2G3TA 4UIAA 2OZHA 1A2ZA 4J3GA 3MN8A 2Q4ZA 4KOVA 3LD2A 4UFWA 3S6FA 4B5PA 2CNMA 1U6MA 2PRBA 3D67A 5G1ZA 4AXVA 4C2YA 4EWTA 1ARLA 4R8FA 2PCUA 2P6FA 2PR8A 3CZXA 3SXNA 3B3VA 1BAVA 3S9LA 5K8OA 2EVNA 2C6GA 4RI1A 4UIBA 3GIUA 3KR5A 3VWEA 1TF8A 1YVOA 2O28A 3FRMA 3K2KA 2GFQA 2P6GA 2ZELA 4KOXA 4QUSA 3FB3A 3MGDA 5JH9A 4EMEA 1R43A 1XMBA 3HLPA 4M6GA 4XNHC 4UCPA 3D8PA 3GUXA 3R1KA 5K8NA 1NE9A 4LUAA 5HMNA 3GLJA 3RYOA 2R8VA 2IQ6A 1FY7A 2PJ2A 3IWGA 4K30A 2QJ8A 5C88A 1YREA 2VBQA 4A33A 1Q7LA 3QAHA 4RN7A 4P4FA 2FT0A 3D66A 3IJ3A 3BJ7A 2BO9A 3NH8A 4FD6A 4AVCA 5JM6A 2R7HA 2FS5A 3I3GA 3V7ZA 4LQGA 4A31A 1M4DA 4UEEA 4DUKA 1L0CA 2OOTA 1I1DA 2BUEA 3G8WA 1MK4A 3WT4A 8CPAA 3H8FA 4PXCA 3T9YA 4Y49B 2IMOA 1LCPA 1YLEA 4UCMA 2CIJA 5AG5A 3GYAA 3WC7A 4CGOA 4KUBA 2KCWA 2ZEFA 4KUAA 3TCVA 2ZOGA 4F8ZA 2P6EA 2PIZA 3G3SA 5CNPA 2P0WA 1S5KA 4X2TA 3SI2A 3GB0A 1KUXA 2QMLA 3MRUA 5KTAA 3KI9A 3KASA 4P4EA 4R9MA 5EMIA 5I0CA 2HUZA 4OC1A 3UY5A 4MHZA 4MCSA 3SJEA 2NYQA 1P0HA 2PVWA 2ZXVA 4B6ZA 2J8RA 4O23A 1WK4A 4F9UA 4OAEA 4R7MA 4UA3A 2A4NA 2IL4A 3H8EA 4HNXB 5KTDA 5AG6A 4AG9A 1CBXA 4DYOA 2JBJA 2Z3LA 3T90A 1ON0A 3VH9A 4R3LA 5CBMA 5K8PA 2VZYA 4KSIA 2GREA 6CPAA 4BINA 2RB7A 4P44A 3B3WA 3R9GA 4CYNA 3DR8A 1YGHA 1KWMA 1QMUA 3IU2A 4IK2A 1H8LA 4DJLA 3RAMA 3TT2A 1ZO0A 1F57A 1CX8A 4BMHA 3SJGA 3DNSA 2CY2A 1NMTA 1XIXA 2PJ5A 1TKJA 1YW4A 4FUUA 4UEFA 4K3NA 4CAXA 3KL9A 5IX3A 3SJFA 1UWYA 5D29A 4MFLA 3D7FA 1AMPA 2POKA 4IAVA 2YNCC 4AVAA 2ZPAA 1Z8XA 4B12A 4CAVA 4EFDA 4EVYA 5J8FA 5LYLA 4MFZA 1KUVA 1Y7RA 3S9NA 3RZAA 5IB9A 1DE4C 4E2AA 4KVME 4NXYA 3TFYA 4MCRA 3IEHA 4MFKA 5K8MA 4PPZA 3CXSA 4M6HA 3TOBA 2OZGA 3KZWA 1MJAA 2ANPA 1ZLIA 4A95A 2AE6A 2V77A 2VL1A 4C7HA 1M44A 1XEBA 4UWJA 3R9FA 3EXNA 2OH1A 2I00A 1TIQA 2QECA 5D8NA 2PJBA 3K9TA 3N7ZA 2G9DA 4KLVA 1F2OA 1Z5RA 1XF8A 2AFOA 5HVFA 3B8GA 3WR7A 3NE8A 2PJAA 3PB4X 4MJ8A 1Z4RA 2B5GB 5EC4A 2ZEEA 4B5OA 3WC6A 2GLFA 2QVPA
chains in the Genus database with same CATH topology
1PU9A 2VZZA 3ZZIA 4JLYA 1S7LA 1M4IA 4H6ZA 4YGOA 2BL1A 3IU1A 2B5GA 2QIRA 2ZW5A 4ZGYB 2Y0MA 5ISVA 4PV6A 3D3SA 1MJ9A 2DPSA 1IYLA 3EY5A 1Y9KA 1SQHA 4CYOA 1Q2CA 3R95A 1K4JA 3IWEA 2REFA 4C2ZA 4DNCA 3S6HA 4UCNA 5J8CA 1OZPA 2Q44A 5HH1A 4A2ZA 2CNTA 5EBVA 1GHEA 4BBHA 1B6BA 2K5TA 2F5IA 3JVNA 3S6KA 3NE7A 4QC6A 2OU2A 1IICA 2GANA 1XMTA 2B58A 3W6XA 4MY3A 4HNWB 2D4OA 4AB7A 3TO9A 4M85A 3R9EA 4QVTA 4KOTA 2Q7BA 3SHPA 4CRYB 4OLLA 2H5MA 3V8IA 2Z3PA 3KKWA 2Q04A 4KORA 4HNYB 3BLNA 1N71A 2B4BA 4IF5A 4XPKA 3PP9A 1Z9UA 4QBJA 4NEXA 3D2MA 2AJ6A 1PUAA 2GE3A 4CGMA 2JEVA 2Z3OA 3P2FA 1QSNA 3GKRA 4MHDA 4CS0B 4JJXA 1RO5A 2Z3NA 1Q2YA 3FYNA 4CYPA 1V0CA 4JD6A 1UFHA 3OWCA 3FNCA 2VI7A 2NMTA 4U9ZA 2C27A 2EUIA 4JXQA 4UBRA 4OADA 2OB0A 2R98A 1B87A 3SXOA 3S6GA 2CNSA 4UFVA 2VEZA 4Q36A 4F0YA 3P2HA 4MFPA 4L89A 1QSTA 3EFAA 3CXQA 2GIVA 1NSLA 4R87A 2Z11A 1YX0A 3DR6A 5JPHA 2Z3MA 4CGPA 4JXRA 4GS4A 3K9UA 2WPXA 5JQ4A 4XPDC 4Q38A 2G0BA 5G22A 5KTCA 4E0AA 4KVOE 2B4DA 5A28A 2Z3KA 4MBUA 4NSQA 4CAWA 2J8MA 2PC1A 4XPLA 1J4JA 4F0XA 1KUYA 4Y49C 4KVXA 4YRHA 4NCZA 2B4DB 2WPWA 3VWDA 2HV2A 3TTHA 4B13A 1BO4A 5G20A 2REEA 1XE4A 4I49A 4PSXA 2BEIA 3D2PA 3JTKA 4IUSA 4LX9A 1S60A 1QSRA 5DWMA 3EO4A 5DWNA 3TOAA 4B5PB 1CJWA 2ZW6A 5A27A 2WUUA 4MY0A 4YFJA 2WSAA 2YNDA 1LRZA 1M4GA 4JWPA 2OZUA 4XNHB 4PK3A 2HQYA 2ARHA 1VHSA 2YNCA 2ZW4A 3FXTA 1Z4EA 4C68A 4KZTA 4II9A 1YVKA 4B11A 3TE4A 3DDDA 2BSWA 1CM0A 3I9SA 2G3AA 5AG4A 3JUWA 3E0KA 4FD5A 4NF1A 4AVBA 1I12A 2CXAA 2PDOA 2JLMA 2B3VA 2JDDA 4CGLA 4HKFA 1R57A 3C26A 1Q2DA 2YNEA 3A9LA 3EC4A 3TO7A 5F47A 5F46A 1QSMA 3QB8A 1YK3A 4CAEA 3GY9A 4H89A 1RXTA 4R57A 3FIXA 2Z10A 2VXKA 4X5KA 4E8OA 2D4PA 5GCNA 3R96A 4KLWA 4KSFA 1IYKA 4ZBGA 2ZW7A 3W6SA 1S7KA 4U5YA 4PSWA 3DSBA 2FSRA 4FD4A 2YGWA 1IB1E 5E96A 4FD7A 5G21A 4AG7A 4H6UA 1I21A 1KZFA 5H84A 3H5ZA 5FVJA 2Q0YA 4MFJA 2DXQA 5BWAB 2FCKA 5F49A 3BJ8A 2RC4A 3W91A 5H86A 4M3SA 2Q4YA 1YR0A 2FL4A 2Z0ZA 3F8KA 2PSWA 4L8AA 4MI4A 4KS9A 4UFXA 5IV0A 4U9YA 2JDCA 2X7BA 2FIWA 5C82A 1Y9WA 1S7FA 1P4NA 5AGEA 5AG7A 3ZJ0A 2PQ8A 4A30A 4MFQA 4UWIA 4ORFA 4PK2A 2Q4VA 2R1IA 3PZJA 2ATRA 3F5BA 4KOWA 1VKCA 2B3UA 5IB0A 4F6AA 2FE7A 3PGPA 4KOYA 4A32A 4CYQA 3IGRA 1BOBA 3FBUA 1WWZA 4KOUA 3H4QA 4RS2A 1MJBA 4CGNA 1S7NA 5F48A 1QSOA 4CAFA 2DPTA 3TO6A 4R3KA 4QB9A 2FXFA 2J8NA 3LODA 2VQYA 3F0AA 1IIDA 4C7IA 4B14A 4C2XA 4ONUA 2FIAA 3CXPA 1S3ZA 4KOSA 2I79A 1M1DA 4KSAA 4B10A 4XPDB 2PR1A 2G3TA 2OZHA 4J3GA 4KOVA 3LD2A 4UFWA 3S6FA 4B5PA 2CNMA 1U6MA 2PRBA 5G1ZA 4C2YA 2P6FA 2PR8A 3SXNA 2EVNA 4RI1A 3VWEA 1YVOA 2O28A 3FRMA 4KOXA 2P6GA 4QUSA 3FB3A 3MGDA 4XNHC 4UCPA 3D8PA 3R1KA 1NE9A 4LUAA 5HMNA 3RYOA 2R8VA 5C88A 1FY7A 3IWGA 4K30A 1YREA 2VBQA 4A33A 3QAHA 2FT0A 3BJ7A 4FD6A 4AVCA 2R7HA 2FS5A 3I3GA 4A31A 1M4DA 1L0CA 3G8WA 1I1DA 2BUEA 1MK4A 3T9YA 4Y49B 1YLEA 4UCMA 5AG5A 4CGOA 3GYAA 4KUBA 2KCWA 4KUAA 3TCVA 2P6EA 3G3SA 5CNPA 2P0WA 1S5KA 1KUXA 2QMLA 5I0CA 4R9MA 2HUZA 3UY5A 2ZXVA 1P0HA 2J8RA 1WK4A 4OAEA 4UA3A 2A4NA 2IL4A 4HNXB 5KTDA 5AG6A 4AG9A 2Z3LA 3T90A 1ON0A 4R3LA 2VZYA 3R9GA 4CYNA 3DR8A 1YGHA 3IU2A 3TT2A 1ZO0A 4BMHA 3DNSA 2CY2A 1NMTA 1XIXA 4CAXA 5IX3A 4MFLA 4AVAA 2YNCC 4EVYA 2ZPAA 4B12A 4CAVA 5J8FA 4MFZA 1KUVA 1Y7RA 4E2AA 4KVME 4NXYA 3TFYA 4MFKA 3CXSA 3TOBA 2OZGA 1MJAA 4A95A 2AE6A 4C7HA 1M44A 1XEBA 4UWJA 3R9FA 3EXNA 2OH1A 2I00A 1TIQA 2QECA 3N7ZA 4KLVA 3WR7A 1XF8A 5KTAA 3B8GA 4CRZB 5EC4A 4MJ8A 4B5OA 1Z4RA 2B5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU9 A;  2VZZ A;  3ZZI A;  4JLY A;  1S7L A;  1M4I A;  4H6Z A;  4YGO A;  2BL1 A;  2B5G A;  2QIR A;  2ZW5 A;  2Y0M A;  5ISV A;  4PV6 A;  3D3S A;  1MJ9 A;  1IYL A;  3EY5 A;  1Y9K A;  1SQH A;  1Q2C A;  3R95 A;  1K4J A;  2REF A;  4DNC A;  5J8C A;  3S6H A;  1OZP A;  2Q44 A;  5HH1 A;  2CNT A;  5EBV A;  1GHE A;  1B6B A;  2K5T A;  2F5I A;  3JVN A;  3S6K A;  3NE7 A;  4QC6 A;  2OU2 A;  1IIC A;  2GAN A;  1XMT A;  2B58 A;  3W6X A;  4MY3 A;  4HNW B;  2D4O A;  4AB7 A;  3TO9 A;  4M85 A;  3R9E A;  4QVT A;  4KOT A;  2Q7B A;  3SHP A;  4CRY B;  4OLL A;  2H5M A;  3V8I A;  3KKW A;  2Q04 A;  4KOR A;  4HNY B;  3BLN A;  1N71 A;  2B4B A;  4IF5 A;  4XPK A;  3PP9 A;  1Z9U A;  4QBJ A;  4NEX A;  3D2M A;  2AJ6 A;  1PUA A;  2GE3 A;  2JEV A;  3P2F A;  1QSN A;  3GKR A;  4MHD A;  4CS0 B;  4JJX A;  1RO5 A;  1Q2Y A;  3FYN A;  1V0C A;  4JD6 A;  1UFH A;  3OWC A;  3FNC A;  2VI7 A;  2NMT A;  4U9Z A;  2C27 A;  2EUI A;  4JXQ A;  4UBR A;  4OAD A;  2OB0 A;  2R98 A;  1B87 A;  3SXO A;  3S6G A;  2CNS A;  2VEZ A;  4F0Y A;  3P2H A;  4L89 A;  1QST A;  3EFA A;  3CXQ A;  2GIV A;  1NSL A;  4R87 A;  2Z11 A;  1YX0 A;  3DR6 A;  5JPH A;  4JXR A;  4GS4 A;  3K9U A;  2WPX A;  5JQ4 A;  4XPD C;  2G0B A;  5KTC A;  4E0A A;  4KVO E;  2B4D A;  4MBU A;  4NSQ A;  4CAW A;  2J8M A;  2PC1 A;  4XPL A;  1J4J A;  1KUY A;  4Y49 C;  4KVX A;  4YRH A;  4NCZ A;  2B4D B;  2WPW A;  3VWD A;  2HV2 A;  3TTH A;  1BO4 A;  2REE A;  1XE4 A;  4I49 A;  4PSX A;  2BEI A;  3D2P A;  4IUS A;  4LX9 A;  1S60 A;  1QSR A;  5DWM A;  3EO4 A;  5DWN A;  3TOA A;  4B5P B;  1CJW A;  2ZW6 A;  4MY0 A;  4YFJ A;  1LRZ A;  1M4G A;  4JWP A;  2OZU A;  4XNH B;  4PK3 A;  2HQY A;  2ARH A;  1VHS A;  2ZW4 A;  3FXT A;  1Z4E A;  4KZT A;  4II9 A;  1YVK A;  3TE4 A;  3DDD A;  2BSW A;  1CM0 A;  3I9S A;  2G3A A;  3JUW A;  3E0K A;  4FD5 A;  4NF1 A;  4AVB A;  1I12 A;  2PDO A;  2JLM A;  2B3V A;  2JDD A;  4HKF A;  1R57 A;  3C26 A;  1Q2D A;  3EC4 A;  3TO7 A;  5F47 A;  5F46 A;  1QSM A;  3QB8 A;  1YK3 A;  3GY9 A;  4H89 A;  1RXT A;  4R57 A;  3FIX A;  2Z10 A;  2VXK A;  4X5K A;  4E8O A;  2D4P A;  5GCN A;  3R96 A;  4KLW A;  1IYK A;  4ZBG A;  2ZW7 A;  3W6S A;  1S7K A;  4U5Y A;  4PSW A;  3DSB A;  2FSR A;  4FD4 A;  1IB1 E;  5E96 A;  4FD7 A;  4AG7 A;  4H6U A;  1I21 A;  1KZF A;  5H84 A;  5FVJ A;  2Q0Y A;  2DXQ A;  2FCK A;  5F49 A;  3BJ8 A;  2RC4 A;  3W91 A;  5H86 A;  4M3S A;  2Q4Y A;  1YR0 A;  2FL4 A;  2Z0Z A;  3F8K A;  2PSW A;  4L8A A;  4MI4 A;  5IV0 A;  4U9Y A;  2JDC A;  2X7B A;  2FIW A;  5C82 A;  1Y9W A;  1S7F A;  1P4N A;  3ZJ0 A;  2PQ8 A;  4UWI A;  4ORF A;  4PK2 A;  2Q4V A;  2R1I A;  3PZJ A;  2ATR A;  3F5B A;  4KOW A;  1VKC A;  2B3U A;  5IB0 A;  4F6A A;  2FE7 A;  3PGP A;  4KOY A;  3IGR A;  1BOB A;  3FBU A;  1WWZ A;  4KOU A;  3H4Q A;  4RS2 A;  1MJB A;  1S7N A;  5F48 A;  1QSO A;  3TO6 A;  4R3K A;  4QB9 A;  2FXF A;  2J8N A;  3LOD A;  2VQY A;  3F0A A;  1IID A;  4ONU A;  2FIA A;  3CXP A;  1S3Z A;  4KOS A;  2I79 A;  1M1D A;  4XPD B;  2PR1 A;  2G3T A;  2OZH A;  4J3G A;  4KOV A;  3LD2 A;  3S6F A;  4B5P A;  2CNM A;  1U6M A;  2PRB A;  2P6F A;  2PR8 A;  3SXN A;  2EVN A;  4RI1 A;  3VWE A;  1YVO A;  2O28 A;  3FRM A;  4KOX A;  2P6G A;  4QUS A;  3FB3 A;  3MGD A;  4XNH C;  3D8P A;  3R1K A;  1NE9 A;  4LUA A;  5HMN A;  3RYO A;  2R8V A;  5C88 A;  1FY7 A;  3IWG A;  4K30 A;  1YRE A;  2VBQ A;  3QAH A;  2FT0 A;  3BJ7 A;  4FD6 A;  4AVC A;  2R7H A;  2FS5 A;  3I3G A;  1M4D A;  1L0C A;  3G8W A;  1I1D A;  2BUE A;  1MK4 A;  3T9Y A;  4Y49 B;  1YLE A;  3GYA A;  4KUB A;  2KCW A;  4KUA A;  3TCV A;  2P6E A;  3G3S A;  5CNP A;  2P0W A;  1S5K A;  1KUX A;  2QML A;  5I0C A;  4R9M A;  2HUZ A;  3UY5 A;  2ZXV A;  1P0H A;  2J8R A;  1WK4 A;  4OAE A;  4UA3 A;  2A4N A;  2IL4 A;  4HNX B;  5KTD A;  4AG9 A;  3T90 A;  1ON0 A;  4R3L A;  2VZY A;  3R9G A;  3DR8 A;  1YGH A;  3TT2 A;  4BMH A;  3DNS A;  2CY2 A;  1NMT A;  1XIX A;  4CAX A;  5IX3 A;  4AVA A;  4EVY A;  2ZPA A;  4CAV A;  5J8F A;  1KUV A;  1Y7R A;  4E2A A;  4KVM E;  4NXY A;  3TFY A;  3CXS A;  3TOB A;  2OZG A;  1MJA A;  2AE6 A;  1M44 A;  1XEB A;  4UWJ A;  3R9F A;  3EXN A;  2OH1 A;  2I00 A;  1TIQ A;  2QEC A;  3N7Z A;  4KLV A;  3WR7 A;  1XF8 A;  5KTA A;  3B8G A;  4CRZ B;  5EC4 A;  4MJ8 A;  4B5O A;  1Z4R A;  2B5G B; 
#chains in the Genus database with same CATH topology
 1PU9 A;  4Z65 A;  3FEE A;  1BPM A;  4FWU A;  2VZZ A;  4ZY2 A;  4JLY A;  3ZZI A;  1S7L A;  1M4I A;  2BOA A;  4H6Z A;  5J1Q A;  4YGO A;  2BL1 A;  3IU1 A;  2B5G A;  2QIR A;  2ZW5 A;  3PB8 X;  4OKO A;  4ZGY B;  5THW A;  2Y0M A;  1EE3 P;  5LYF A;  5ISV A;  3PB6 X;  4ZY1 A;  1IY7 A;  1OBR A;  4PV6 A;  3PRT A;  3D3S A;  4ZX8 A;  1MJ9 A;  2F8H A;  2DPS A;  3PEI A;  1IYL A;  3EY5 A;  1Y9K A;  1LAM A;  4A39 A;  1SQH A;  3SI1 A;  1AUG A;  1Q2C A;  2WYR A;  1K4J A;  3IWE A;  1XBU A;  3R95 A;  4CYO A;  2AFM A;  4NGT A;  2PJ9 A;  2REF A;  4OIW A;  2Q7S A;  1FT7 A;  4NFR A;  4C2Z A;  4DNC A;  3S6H A;  1GYT A;  3KGQ A;  4UCN A;  5J8C A;  3KHZ A;  4MXU A;  3FMC A;  1OZP A;  2ZEH A;  5F09 A;  1R3N A;  4GXH A;  2Q44 A;  3IFE A;  2ZEN A;  5HH1 A;  4A2Z A;  4TNU A;  2CNT A;  1CPX A;  5EBV A;  3RO0 A;  4W9Y A;  1GHE A;  4BBH A;  1X10 A;  1B6B A;  2K5T A;  2F5I A;  3JVN A;  4M6I A;  4NGP A;  1JWQ A;  3S6K A;  1Z8L A;  4P45 A;  4FBE A;  1Y7E A;  3NE7 A;  4QC6 A;  2OU2 A;  1IIC A;  3D4U A;  2EK8 A;  5LYD A;  2GAN A;  4JYW A;  1XMT A;  4ZI6 A;  1ZG8 A;  2B58 A;  3W6X A;  3HUV A;  4MY3 A;  1CP7 A;  4P4I A;  4HNW B;  2D4O A;  3BI0 A;  4P4B A;  4M85 A;  3TO9 A;  4AB7 A;  3R9E A;  4QVT A;  4KOT A;  3KQX A;  2Q7B A;  3SHP A;  3KHX A;  4CRY B;  4OLL A;  2V8D A;  2H5M A;  3V8I A;  1Z8W A;  2DEA A;  2Z3P A;  3KKW A;  2Q04 A;  1XFO A;  3RNZ A;  3IO1 A;  4KOR A;  4HNY B;  5HXD A;  4A37 A;  2IJZ A;  3BLN A;  1N71 A;  1XOV A;  4Q7A A;  2B4B A;  4MCP A;  2Q51 A;  4IF5 A;  4PXE A;  5LRJ A;  2Q43 A;  4XPK A;  3PP9 A;  3DLJ A;  1Z9U A;  2O53 A;  1PCA A;  4OC4 A;  4ZX9 A;  3WAB A;  4QBJ A;  3B2Y A;  4NEX A;  3D2M A;  2AJ6 A;  1PUA A;  2GE3 A;  4CGM A;  1FNO A;  2BCO A;  2JEV A;  2Z3O A;  2V8G A;  3P2F A;  1QSN A;  3V38 A;  2CTB A;  3GKR A;  2PE3 A;  3IWW A;  3QAY A;  4LQ6 A;  4MHD A;  4F9V A;  4CS0 B;  2HB6 A;  3PB7 X;  4JJX A;  4OC0 A;  4YWY A;  1RO5 A;  2Z3N A;  1YSJ A;  1IU8 A;  1Q2Y A;  4MHY A;  3TC8 A;  3NH4 A;  3FYN A;  4H2K A;  4CYP A;  4NGN A;  1V0C A;  2PJ0 A;  1UFH A;  3OWC A;  4JD6 A;  1ZLH A;  3FNC A;  2VI7 A;  2NMT A;  4U9Z A;  2C27 A;  5I4M A;  2EUI A;  4JXQ A;  3ISZ A;  4UBR A;  2V8H A;  4OAD A;  4MHN A;  2OB0 A;  2R98 A;  1B87 A;  3SXO A;  4P4J A;  4R76 A;  3S6G A;  2CNS A;  4UFV A;  2VEZ A;  4Q36 A;  4WJB A;  1Z8T A;  4F0Y A;  3NA6 A;  3P2H A;  4MFP A;  4OC3 A;  1X12 A;  4L89 A;  1QST A;  3BHX A;  3EFA A;  3CXQ A;  3I1U A;  1ZG7 A;  2GIV A;  3T8W A;  2GU2 A;  2V8V A;  2XEF A;  3N5F A;  1NSL A;  4R87 A;  3CPX A;  2Z11 A;  1YX0 A;  3DR6 A;  5JPH A;  1XJO A;  2EK9 A;  2Z3M A;  4CGP A;  4JZ0 A;  4JXR A;  4GS4 A;  4UF4 A;  3K9U A;  1TKF A;  2WPX A;  5HVG A;  4NJQ A;  5JQ4 A;  1XRY A;  3KR4 A;  4XPD C;  4Q38 A;  1CPS A;  2G0B A;  3B3C A;  2FVG A;  3NH5 A;  5G22 A;  4A38 A;  5KTC A;  4E0A A;  4KVO E;  2B4D A;  1DTD A;  1M4L A;  3IIB A;  4G1P A;  5A28 A;  2Z3K A;  4MBU A;  4NSQ A;  4CAW A;  2XEG A;  2J8M A;  2PC1 A;  3LAC A;  3NFZ A;  3PB9 X;  4XPL A;  4ZY0 A;  1J4J A;  4F0X A;  1KUY A;  4Y49 C;  4KVX A;  4NGR A;  1YW6 A;  4YRH A;  4NCZ A;  4OC2 A;  2B4D B;  2WPW A;  2ABZ A;  4P6Y A;  3VWD A;  5LYI A;  2HV2 A;  3TTH A;  4B13 A;  1BO4 A;  5G20 A;  2REE A;  5LRK A;  1PYT B;  1XE4 A;  2AFW A;  2I3C A;  4GM5 A;  4I49 A;  3D7G A;  4PSX A;  2BEI A;  1TXR A;  3H8G A;  3TX8 A;  3D2P A;  3JTK A;  4IUS A;  1HEE A;  1LAP A;  4LX9 A;  1S60 A;  2ZEM A;  5LRG A;  1LOK A;  1QSR A;  2JEW A;  3EO4 A;  5DWM A;  1Z2L A;  1ZG9 A;  5DWN A;  3PBB A;  2PJ3 A;  3TOA A;  4B5P B;  1CJW A;  2ZW6 A;  5A27 A;  2WUU A;  1YQE A;  1LAN A;  4TWE A;  4MY0 A;  3SJX A;  2WSA A;  2YND A;  1LRZ A;  4YFJ A;  3PFE A;  1HDQ A;  1M4G A;  4JWP A;  2OZU A;  4XNH B;  4PK3 A;  2ZOF A;  2HQY A;  3BI1 A;  4X3R A;  2PJC A;  2EWB A;  2XEJ A;  1IOF A;  2ARH A;  1IOI A;  1VHS A;  4UEZ A;  2YNC A;  3BXM A;  2ZW4 A;  3FXT A;  1Z4E A;  2WZN A;  1ELM P;  2PRQ A;  4KZT A;  4C68 A;  4II9 A;  1YVK A;  4B11 A;  3TE4 A;  3DDD A;  1TF9 A;  1CM0 A;  2BSW A;  2JBK A;  3I9S A;  2G3A A;  4BD9 A;  5AG4 A;  3JUW A;  1VHE A;  2CF4 A;  3E0K A;  4FD5 A;  2QYV A;  4NF1 A;  4AVB A;  1Y0R A;  2AFZ A;  1I12 A;  1LFW A;  2CXA A;  2PDO A;  2JLM A;  2B3V A;  2C6C A;  2JDD A;  3CT9 A;  4HKF A;  1R57 A;  3C26 A;  4CGL A;  3JRU A;  1Q2D A;  2EO8 A;  2YNE A;  3A9L A;  4MRI A;  1YLO A;  2AFX A;  3EC4 A;  4CRZ B;  3TO7 A;  4YU9 A;  5F47 A;  5F46 A;  5DS0 A;  3QNV A;  1QSM A;  3QB8 A;  1VGY A;  1YK3 A;  1BPN A;  2AFU A;  4CAE A;  1VHO A;  3GY9 A;  4H89 A;  1RXT A;  4R57 A;  3FIX A;  2Z10 A;  4WWV A;  2VXK A;  2PIY A;  4HPS A;  4P10 A;  1ARM A;  4X5K A;  4CPA A;  4E8O A;  2D4P A;  1F2P A;  5GCN A;  3R96 A;  4KLW A;  1BLL E;  4KSF A;  1IYK A;  3B35 A;  2AFS A;  1QQ9 A;  4MHP A;  4NJR A;  2ZW7 A;  4PQA A;  4ZBG A;  1S7K A;  3FX6 A;  4IHM A;  3DSB A;  4PSW A;  4U5Y A;  2HC9 A;  3FJU A;  3W6S A;  4OID A;  3FF3 A;  2FSR A;  4FD4 A;  2YGW A;  3LMS A;  3FED A;  1IB1 E;  1CP6 A;  5E96 A;  4FD7 A;  5G21 A;  4AG7 A;  4H6U A;  4NGS A;  4ZYQ A;  2PJ4 A;  1I21 A;  1KZF A;  5ELY A;  5H84 A;  2OR4 A;  3H5Z A;  5FVJ A;  2Q0Y A;  4MFJ A;  2O4H A;  4OC5 A;  2DXQ A;  3SI0 A;  5BWA B;  2FCK A;  4R6T A;  5F49 A;  3BJ8 A;  2RC4 A;  1VIX A;  3W91 A;  5H86 A;  3PFO A;  4M3S A;  2Q4Y A;  1YR0 A;  2FL4 A;  2Z0Z A;  3F8K A;  2EBJ A;  1HDU A;  2PSW A;  1AYE A;  3B3S A;  4L8A A;  4MI4 A;  4KS9 A;  4UFX A;  5IV0 A;  4U9Y A;  3PBE A;  2NSM A;  3KQZ A;  2JDC A;  2X7B A;  2PVV A;  3FEC A;  2FIW A;  3CDX A;  4OP4 A;  4PXD A;  5C82 A;  1Y9W A;  1S7F A;  1P4N A;  5AGE A;  5AG7 A;  3ZJ0 A;  4OME A;  5CPA A;  3S9M A;  1JQG A;  3D7H A;  2PQ8 A;  4A30 A;  1Y0Y A;  3LWU A;  4MFQ A;  3FH4 A;  4UWI A;  4ORF A;  2J9A A;  2PJ1 A;  3D68 A;  4PK2 A;  2Q4V A;  2R1I A;  2ZEG A;  3CPA A;  3IC1 A;  2PJ6 A;  3PZJ A;  2ATR A;  2CTC A;  3F5B A;  4KOW A;  2DF5 A;  4RUH A;  2PJ7 A;  1VKC A;  1TKH A;  3FVL A;  2B3U A;  1CG2 A;  2ZEP A;  2ZED A;  3VAT A;  3VAR A;  5IB0 A;  4F6A A;  2FE7 A;  2C1C A;  3PGP A;  4KOY A;  2PJ8 A;  3RBU A;  4A32 A;  3L2N A;  4CYQ A;  3IGR A;  1NSA A;  3B7I A;  1BOB A;  3FBU A;  1WWZ A;  4KOU A;  4ONW A;  3H4Q A;  4RS2 A;  1MJB A;  2C6P A;  4CGN A;  5HVH A;  4PXB A;  1S7N A;  5F48 A;  1QSO A;  1IGB A;  3ISX A;  7CPA A;  1YME A;  2ZEO A;  4CAF A;  2DPT A;  4NGQ A;  4R3K A;  4QB9 A;  3TO6 A;  2FXF A;  2J8N A;  3LOD A;  2VQY A;  1ELL P;  4NGM A;  5JGF A;  3D7D A;  3F0A A;  2RFH A;  1RTQ A;  4MMO A;  1IID A;  4C7I A;  4B14 A;  3WC5 A;  4C2X A;  4ONU A;  3B3T A;  4FAI A;  2FIA A;  3CXP A;  4X8I A;  1S3Z A;  4P4D A;  4KOS A;  4A94 A;  2XEI A;  3DGV A;  2I79 A;  4MCQ A;  1M1D A;  2ODF A;  2F7V A;  2GLJ A;  4KSA A;  4B10 A;  4XPD B;  2PR1 A;  2G3T A;  4UIA A;  2OZH A;  1A2Z A;  4J3G A;  3MN8 A;  2Q4Z A;  4KOV A;  3LD2 A;  4UFW A;  3S6F A;  4B5P A;  2CNM A;  1U6M A;  2PRB A;  3D67 A;  5G1Z A;  4AXV A;  4C2Y A;  4EWT A;  1ARL A;  4R8F A;  2PCU A;  2P6F A;  2PR8 A;  3CZX A;  3SXN A;  3B3V A;  1BAV A;  3S9L A;  5K8O A;  2EVN A;  2C6G A;  4RI1 A;  4UIB A;  3GIU A;  3KR5 A;  3VWE A;  1TF8 A;  1YVO A;  2O28 A;  3FRM A;  3K2K A;  2GFQ A;  2P6G A;  2ZEL A;  4KOX A;  4QUS A;  3FB3 A;  3MGD A;  5JH9 A;  4EME A;  1R43 A;  1XMB A;  3HLP A;  4M6G A;  4XNH C;  4UCP A;  3D8P A;  3GUX A;  3R1K A;  5K8N A;  1NE9 A;  4LUA A;  5HMN A;  3GLJ A;  3RYO A;  2R8V A;  2IQ6 A;  1FY7 A;  2PJ2 A;  3IWG A;  4K30 A;  2QJ8 A;  5C88 A;  1YRE A;  2VBQ A;  4A33 A;  1Q7L A;  3QAH A;  4RN7 A;  4P4F A;  2FT0 A;  3D66 A;  3IJ3 A;  3BJ7 A;  2BO9 A;  3NH8 A;  4FD6 A;  4AVC A;  5JM6 A;  2R7H A;  2FS5 A;  3I3G A;  3V7Z A;  4LQG A;  4A31 A;  1M4D A;  4UEE A;  4DUK A;  1L0C A;  2OOT A;  1I1D A;  2BUE A;  3G8W A;  1MK4 A;  3WT4 A;  8CPA A;  3H8F A;  4PXC A;  3T9Y A;  4Y49 B;  2IMO A;  1LCP A;  1YLE A;  4UCM A;  2CIJ A;  5AG5 A;  3GYA A;  3WC7 A;  4CGO A;  4KUB A;  2KCW A;  2ZEF A;  4KUA A;  3TCV A;  2ZOG A;  4F8Z A;  2P6E A;  2PIZ A;  3G3S A;  5CNP A;  2P0W A;  1S5K A;  4X2T A;  3SI2 A;  3GB0 A;  1KUX A;  2QML A;  3MRU A;  5KTA A;  3KI9 A;  3KAS A;  4P4E A;  4R9M A;  5EMI A;  5I0C A;  2HUZ A;  4OC1 A;  3UY5 A;  4MHZ A;  4MCS A;  3SJE A;  2NYQ A;  1P0H A;  2PVW A;  2ZXV A;  4B6Z A;  2J8R A;  4O23 A;  1WK4 A;  4F9U A;  4OAE A;  4R7M A;  4UA3 A;  2A4N A;  2IL4 A;  3H8E A;  4HNX B;  5KTD A;  5AG6 A;  4AG9 A;  1CBX A;  4DYO A;  2JBJ A;  2Z3L A;  3T90 A;  1ON0 A;  3VH9 A;  4R3L A;  5CBM A;  5K8P A;  2VZY A;  4KSI A;  2GRE A;  6CPA A;  4BIN A;  2RB7 A;  4P44 A;  3B3W A;  3R9G A;  4CYN A;  3DR8 A;  1YGH A;  1KWM A;  1QMU A;  3IU2 A;  4IK2 A;  1H8L A;  4DJL A;  3RAM A;  3TT2 A;  1ZO0 A;  1F57 A;  1CX8 A;  4BMH A;  3SJG A;  3DNS A;  2CY2 A;  1NMT A;  1XIX A;  2PJ5 A;  1TKJ A;  1YW4 A;  4FUU A;  4UEF A;  4K3N A;  4CAX A;  3KL9 A;  5IX3 A;  3SJF A;  1UWY A;  5D29 A;  4MFL A;  3D7F A;  1AMP A;  2POK A;  4IAV A;  2YNC C;  4AVA A;  2ZPA A;  1Z8X A;  4B12 A;  4CAV A;  4EFD A;  4EVY A;  5J8F A;  5LYL A;  4MFZ A;  1KUV A;  1Y7R A;  3S9N A;  3RZA A;  5IB9 A;  1DE4 C;  4E2A A;  4KVM E;  4NXY A;  3TFY A;  4MCR A;  3IEH A;  4MFK A;  5K8M A;  4PPZ A;  3CXS A;  4M6H A;  3TOB A;  2OZG A;  3KZW A;  1MJA A;  2ANP A;  1ZLI A;  4A95 A;  2AE6 A;  2V77 A;  2VL1 A;  4C7H A;  1M44 A;  1XEB A;  4UWJ A;  3R9F A;  3EXN A;  2OH1 A;  2I00 A;  1TIQ A;  2QEC A;  5D8N A;  2PJB A;  3K9T A;  3N7Z A;  2G9D A;  4KLV A;  1F2O A;  1Z5R A;  1XF8 A;  2AFO A;  5HVF A;  3B8G A;  3WR7 A;  3NE8 A;  2PJA A;  3PB4 X;  4MJ8 A;  1Z4R A;  2B5G B;  5EC4 A;  2ZEE A;  4B5O A;  3WC6 A;  2GLF A;  2QVP A; 
#chains in the Genus database with same CATH homology
 1PU9 A;  2VZZ A;  3ZZI A;  4JLY A;  1S7L A;  1M4I A;  4H6Z A;  4YGO A;  2BL1 A;  3IU1 A;  2B5G A;  2QIR A;  2ZW5 A;  4ZGY B;  2Y0M A;  5ISV A;  4PV6 A;  3D3S A;  1MJ9 A;  2DPS A;  1IYL A;  3EY5 A;  1Y9K A;  1SQH A;  4CYO A;  1Q2C A;  3R95 A;  1K4J A;  3IWE A;  2REF A;  4C2Z A;  4DNC A;  3S6H A;  4UCN A;  5J8C A;  1OZP A;  2Q44 A;  5HH1 A;  4A2Z A;  2CNT A;  5EBV A;  1GHE A;  4BBH A;  1B6B A;  2K5T A;  2F5I A;  3JVN A;  3S6K A;  3NE7 A;  4QC6 A;  2OU2 A;  1IIC A;  2GAN A;  1XMT A;  2B58 A;  3W6X A;  4MY3 A;  4HNW B;  2D4O A;  4AB7 A;  3TO9 A;  4M85 A;  3R9E A;  4QVT A;  4KOT A;  2Q7B A;  3SHP A;  4CRY B;  4OLL A;  2H5M A;  3V8I A;  2Z3P A;  3KKW A;  2Q04 A;  4KOR A;  4HNY B;  3BLN A;  1N71 A;  2B4B A;  4IF5 A;  4XPK A;  3PP9 A;  1Z9U A;  4QBJ A;  4NEX A;  3D2M A;  2AJ6 A;  1PUA A;  2GE3 A;  4CGM A;  2JEV A;  2Z3O A;  3P2F A;  1QSN A;  3GKR A;  4MHD A;  4CS0 B;  4JJX A;  1RO5 A;  2Z3N A;  1Q2Y A;  3FYN A;  4CYP A;  1V0C A;  4JD6 A;  1UFH A;  3OWC A;  3FNC A;  2VI7 A;  2NMT A;  4U9Z A;  2C27 A;  2EUI A;  4JXQ A;  4UBR A;  4OAD A;  2OB0 A;  2R98 A;  1B87 A;  3SXO A;  3S6G A;  2CNS A;  4UFV A;  2VEZ A;  4Q36 A;  4F0Y A;  3P2H A;  4MFP A;  4L89 A;  1QST A;  3EFA A;  3CXQ A;  2GIV A;  1NSL A;  4R87 A;  2Z11 A;  1YX0 A;  3DR6 A;  5JPH A;  2Z3M A;  4CGP A;  4JXR A;  4GS4 A;  3K9U A;  2WPX A;  5JQ4 A;  4XPD C;  4Q38 A;  2G0B A;  5G22 A;  5KTC A;  4E0A A;  4KVO E;  2B4D A;  5A28 A;  2Z3K A;  4MBU A;  4NSQ A;  4CAW A;  2J8M A;  2PC1 A;  4XPL A;  1J4J A;  4F0X A;  1KUY A;  4Y49 C;  4KVX A;  4YRH A;  4NCZ A;  2B4D B;  2WPW A;  3VWD A;  2HV2 A;  3TTH A;  4B13 A;  1BO4 A;  5G20 A;  2REE A;  1XE4 A;  4I49 A;  4PSX A;  2BEI A;  3D2P A;  3JTK A;  4IUS A;  4LX9 A;  1S60 A;  1QSR A;  5DWM A;  3EO4 A;  5DWN A;  3TOA A;  4B5P B;  1CJW A;  2ZW6 A;  5A27 A;  2WUU A;  4MY0 A;  4YFJ A;  2WSA A;  2YND A;  1LRZ A;  1M4G A;  4JWP A;  2OZU A;  4XNH B;  4PK3 A;  2HQY A;  2ARH A;  1VHS A;  2YNC A;  2ZW4 A;  3FXT A;  1Z4E A;  4C68 A;  4KZT A;  4II9 A;  1YVK A;  4B11 A;  3TE4 A;  3DDD A;  2BSW A;  1CM0 A;  3I9S A;  2G3A A;  5AG4 A;  3JUW A;  3E0K A;  4FD5 A;  4NF1 A;  4AVB A;  1I12 A;  2CXA A;  2PDO A;  2JLM A;  2B3V A;  2JDD A;  4CGL A;  4HKF A;  1R57 A;  3C26 A;  1Q2D A;  2YNE A;  3A9L A;  3EC4 A;  3TO7 A;  5F47 A;  5F46 A;  1QSM A;  3QB8 A;  1YK3 A;  4CAE A;  3GY9 A;  4H89 A;  1RXT A;  4R57 A;  3FIX A;  2Z10 A;  2VXK A;  4X5K A;  4E8O A;  2D4P A;  5GCN A;  3R96 A;  4KLW A;  4KSF A;  1IYK A;  4ZBG A;  2ZW7 A;  3W6S A;  1S7K A;  4U5Y A;  4PSW A;  3DSB A;  2FSR A;  4FD4 A;  2YGW A;  1IB1 E;  5E96 A;  4FD7 A;  5G21 A;  4AG7 A;  4H6U A;  1I21 A;  1KZF A;  5H84 A;  3H5Z A;  5FVJ A;  2Q0Y A;  4MFJ A;  2DXQ A;  5BWA B;  2FCK A;  5F49 A;  3BJ8 A;  2RC4 A;  3W91 A;  5H86 A;  4M3S A;  2Q4Y A;  1YR0 A;  2FL4 A;  2Z0Z A;  3F8K A;  2PSW A;  4L8A A;  4MI4 A;  4KS9 A;  4UFX A;  5IV0 A;  4U9Y A;  2JDC A;  2X7B A;  2FIW A;  5C82 A;  1Y9W A;  1S7F A;  1P4N A;  5AGE A;  5AG7 A;  3ZJ0 A;  2PQ8 A;  4A30 A;  4MFQ A;  4UWI A;  4ORF A;  4PK2 A;  2Q4V A;  2R1I A;  3PZJ A;  2ATR A;  3F5B A;  4KOW A;  1VKC A;  2B3U A;  5IB0 A;  4F6A A;  2FE7 A;  3PGP A;  4KOY A;  4A32 A;  4CYQ A;  3IGR A;  1BOB A;  3FBU A;  1WWZ A;  4KOU A;  3H4Q A;  4RS2 A;  1MJB A;  4CGN A;  1S7N A;  5F48 A;  1QSO A;  4CAF A;  2DPT A;  3TO6 A;  4R3K A;  4QB9 A;  2FXF A;  2J8N A;  3LOD A;  2VQY A;  3F0A A;  1IID A;  4C7I A;  4B14 A;  4C2X A;  4ONU A;  2FIA A;  3CXP A;  1S3Z A;  4KOS A;  2I79 A;  1M1D A;  4KSA A;  4B10 A;  4XPD B;  2PR1 A;  2G3T A;  2OZH A;  4J3G A;  4KOV A;  3LD2 A;  4UFW A;  3S6F A;  4B5P A;  2CNM A;  1U6M A;  2PRB A;  5G1Z A;  4C2Y A;  2P6F A;  2PR8 A;  3SXN A;  2EVN A;  4RI1 A;  3VWE A;  1YVO A;  2O28 A;  3FRM A;  4KOX A;  2P6G A;  4QUS A;  3FB3 A;  3MGD A;  4XNH C;  4UCP A;  3D8P A;  3R1K A;  1NE9 A;  4LUA A;  5HMN A;  3RYO A;  2R8V A;  5C88 A;  1FY7 A;  3IWG A;  4K30 A;  1YRE A;  2VBQ A;  4A33 A;  3QAH A;  2FT0 A;  3BJ7 A;  4FD6 A;  4AVC A;  2R7H A;  2FS5 A;  3I3G A;  4A31 A;  1M4D A;  1L0C A;  3G8W A;  1I1D A;  2BUE A;  1MK4 A;  3T9Y A;  4Y49 B;  1YLE A;  4UCM A;  5AG5 A;  4CGO A;  3GYA A;  4KUB A;  2KCW A;  4KUA A;  3TCV A;  2P6E A;  3G3S A;  5CNP A;  2P0W A;  1S5K A;  1KUX A;  2QML A;  5I0C A;  4R9M A;  2HUZ A;  3UY5 A;  2ZXV A;  1P0H A;  2J8R A;  1WK4 A;  4OAE A;  4UA3 A;  2A4N A;  2IL4 A;  4HNX B;  5KTD A;  5AG6 A;  4AG9 A;  2Z3L A;  3T90 A;  1ON0 A;  4R3L A;  2VZY A;  3R9G A;  4CYN A;  3DR8 A;  1YGH A;  3IU2 A;  3TT2 A;  1ZO0 A;  4BMH A;  3DNS A;  2CY2 A;  1NMT A;  1XIX A;  4CAX A;  5IX3 A;  4MFL A;  4AVA A;  2YNC C;  4EVY A;  2ZPA A;  4B12 A;  4CAV A;  5J8F A;  4MFZ A;  1KUV A;  1Y7R A;  4E2A A;  4KVM E;  4NXY A;  3TFY A;  4MFK A;  3CXS A;  3TOB A;  2OZG A;  1MJA A;  4A95 A;  2AE6 A;  4C7H A;  1M44 A;  1XEB A;  4UWJ A;  3R9F A;  3EXN A;  2OH1 A;  2I00 A;  1TIQ A;  2QEC A;  3N7Z A;  4KLV A;  3WR7 A;  1XF8 A;  5KTA A;  3B8G A;  4CRZ B;  5EC4 A;  4MJ8 A;  4B5O A;  1Z4R A;  2B5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...