5DWUH

Beta common receptor in complex with a fab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
209
structure length
199
Chain Sequence
b'VQLLESGGGLVQPGGSLRLSCAASGFTFPWYRVHWVRQAPGKGLEWVSSIRSSGGFPYYNYKVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARFYDSFFDIWGQGTMVTVSSASTKGPSVFPLATAALGCLVKDYPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokine receptor common subunit beta
publication title CSL311, a novel, potent, therapeutic monoclonal antibody for the treatment of diseases mediated by the common beta chain of the IL-3, GM-CSF and IL-5 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 17
structure length 199
sequence length 209
ec nomenclature
pdb deposition date 2015-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dwuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dwuH01
1ZTXH 2XZQL 2ZUUA 1IGMH 3IETB 1CT8B 5EU7C 5CGMA 1CQKA 3BIKB 3M1BA 1QSFB 4AQ1B 2IPUK 2IQ9L 2Y06L 4GRWF 1IC4H 3BKMH 4NRYB 4FQXC 3QWRD 5JMRA 3BI9X 2OZ4L 4LVOC 2NX5A 5IWLC 2AGJL 3DPBA 4NQVB 5J8OA 5GJTH 5D7IA 1EGJA 3MCLH 4OSUL 3UYPA 4AG4H 4WW2F 4OD3L 3QPQC 1WISA 3IXAA 2R8SL 4L8DB 3QIWD 4PP2B 4J7RA 1T1YA 5F7MC 1SMOA 5D2LA 3EO9H 5HSFA 3SDXF 1B0GA 1U8OA 3L3HA 1VKXB 4M7LT 4W6XB 1XCQA 2IH1B 3KPRD 5E8NA 5CFHA 1X6NA 1TVHB 4F57H 5H2BA 1Q0XH 4UAOC 2X4SA 4I5BB 4M61B 4XP5L 3UXFA 5IGXL 3VFRA 2Q76B 2P45B 2I5YH 3CFIC 5D1XC 5D70H 3WHE0 2J8UE 1DLFH 4JDTL 4MS8C 4CADA 4KRMB 4IHOA 1JZ7A 4LPXA 4NNPH 5FCUH 3B2VL 1FZMB 2V7NB 4N9GA 1XGUB 2DQJH 1EFQA 4S1SL 4JM2F 1GJIA 3TBVB 4D0BA 1UYWL 5FM5M 4JHWL 4OLZH 1F4WH 1QKZH 4OI7A 2C1PA 3S36X 3U7YH 3QIBA 2ICWA 3IXTA 1CLZL 3MBXH 1OGAD 5L8KB 5INCA 1IEAA 5IESL 5JZ7C 4G6AC 3IDGA 4OZFB 4S10A 4EN3B 3BKYH 2X4OA 4HW6A 4LHUD 1B90A 1TQBC 2QTEA 3MBED 1YEKH 1FIGL 1BD2A 2J5LC 4TVPD 4MDJB 1OAQL 1MIEH 4TNWF 4Y16B 3JXAA 4N0FA 4YPGA 5C08D 3GUTA 4YDVA 4JVUA 2ZSWA 4P99A 1FRGL 4N0UE 4YBQC 5A40E 4I4WB 1LD9B 1K6QH 4L8BB 4KROC 1CS6A 4HS8L 3WSQH 3PUCA 4MA1B 3V6ZA 3MROB 5HI4C 1MJ7L 3UZVB 4C83A 2BNQD 4WEBL 4WI6A 1OWWA 1HDMA 5IB2B 2BZDA 1V3JA 4NZTH 3L9RA 3IDJB 1BOGB 3D85A 3REVB 5IBLC 2R1WB 4MNQA 4X8XA 2CRIA 4JN1H 2FECL 1BVKA 2AJYL 4OF5A 2J8HA 4OQTA 1J8HD 4WFED 3MLZH 4HX1B 1HZHL 1NCWH 2BSTB 1TPXC 2VLRB 3IDYC 1D6EA 3RIFF 2GTZB 1B9ZA 4ZUTB 1GC1C 2UY7A 2C3XA 3SN6N 2JCCB 3D5OF 4G8GE 2MWCA 5FUCC 1RJLB 3ZTJG 1V8HA 4Q9RH 1T1ZB 3MRJA 2CUMA 5FYLH 4F58L 3CFCL 4XAKE 2GK0B 5C0RL 3PGFH 1T1XA 4OZHB 4OGYH 1NGWB 3UX9B 3WXWH 3OG4B 2VLKE 1GGIH 4EZMA 1DQTA 1GAFH 3SDAC 4MMZC 4Z8FH 2IBZY 3OKOA 2HVJA 3QZWB 2QADC 3L3IA 3GRWA 3B8SA 4MHHG 1YECL 1UB6A 3HNTL 3LN4A 3HI5H 4JQXC 1NDGA 1PZ5A 1X5HA 1VERA 2NX5D 3BPLB 5EBMA 5E5RB 2C1OB 1RHHA 3BVNA 1RUKL 5KVMC 3HC0B 5CINL 3WFDH 3P0YL 4MAYA 2VDMH 1UWXK 4FG6C 3UEZA 1I8MB 1BECA 3PQYD 4BJLA 3H8NA 4XVJH 3ES6B 2H32A 2DRUA 4RAUA 4HS3A 4WO4A 4Y4HD 1ZHNA 5B4MD 1IC5H 4C58B 5GRUL 5GS1A 2Z31A 4UDUB 4PY8I 5EA0L 4H0IA 4NM8H 2OMBA 4X4YA 4ZD3L 1AC0A 5F44A 5B22A 1NUNB 1IILE 4OIIH 1A4KB 1S7QA 4ZMAT 3MZTA 3MXWL 4MD5B 4WUUA 1C12B 3SCMC 2UWEF 4XMLL 3X11B 1MVUB 3NH7L 4XPFH 5DHVB 4XMKL 5FGBC 4ELMB 3ME0A 5IM7A 3M8OH 2XXCB 3VG9C 4W4OC 1KENL 3CDGB 4HKZA 1JGLL 1RFDL 1JHLL 4NCC1 4LHUG 5JORA 1Z3GH 3SE4C 3QIBD 5BS0E 4KWUA 3N1GC 1IQWH 4DVBA 4U3XA 3NAAL 4K23L 2XZAL 5I75B 1RUQL 4OCXL 2A77H 5AZEL 4FA8A 4KGLA 5EDXA 4BQ6A 2UY6A 1H3PL 4L4TB 2VDNH 3OJDA 4Y0GA 4LKXB 2HFFB 4KKLC 3HE7B 3WS6A 4UUJB 5E6ID 4TOYH 3NZHH 4CU6A 1QACA 4MNGA 5D93C 1GZQB 1S7XA 4KKAD 4LHJB 5FECA 1X7QB 4JFPA 3MRKB 2OI9C 2AV1A 3I6GA 5IBUB 4PJCF 1ACYH 1H0DA 1A14H 4I48B 2YD7A 4TTDC 4P46C 2EIDA 1DQDH 1JYWA 1A9EA 3GMLA 2AEPH 3ZTNH 3INUH 3UTSA 1JNHA 3D85D 2WINB 3U0WH 1BZ9A 3W82A 4ESKA 3KYNA 3P4OA 1A6UL 2AS5M 1XR9B 3WV0A 3O6LH 3HAEG 4HCRH 4PRIB 1ZXQA 5I1LB 3V6FA 4X99A 1BQHG 4ZXBC 4JFHD 2OTUA 1EVUA 2MNUA 4JHAH 4RGOH 2CJUH 3JWOH 3SJVE 5I74C 3TT3H 4GG6F 3SOBL 1AY1H 5A2IH 5F3BB 2CKBB 1N59A 3CC5A 1CICA 4HIHA 3ZSSA 4P59L 4NQCA 1LDPH 3L3DB 4XNUL 4Y5VA 3BAEL 3V0VB 4GKZB 3HMXA 5D6DC 1HWHB 5K9QG 5ECJE 4HT1L 5EZIH 2I60L 3V7AE 5DMGD 4NQEE 4ZFGH 3BEVB 3BO8B 3G6DH 1RULL 4HC1H 4N8VG 5IF0B 2NY4B 4WI3A 2IBZX 1FO0L 4NBXB 3V0AC 3J7HA 5CGTA 3GB7A 1P5VA 2CDFA 3FT3A 5FA3A 5EIQA 1W72H 2CDGA 3QEHA 2E7LA 2ESVA 5HHOD 4X98B 4R26L 4L3CA 3T8XB 4MAYD 3T3PE 5DJCB 5JUEH 2YPLE 1RIHL 5I1EL 3STLA 1JHKL 3HCVB 2R1YA 1HXYA 4WO4D 4PJ9D 43C9A 4AIZA 1MFBH 4G8EA 3OKDA 3OV6A 2C3VB 5FHAH 3RY6C 2I25N 1BLNB 3VA2C 1BGXL 3G04A 3MR9A 1I4FA 2XTJB 5CEZE 3LKRA 4UT9H 4GH7B 4G42B 2ARWA 3DIFA 5DK0A 3ILQC 4KUCF 4I3SL 1IGFH 4WUUD 4WWID 5IG7A 3WO4C 5ALCH 3C60C 1BBJA 5KSAB 1UFUA 3V5DA 4L3EA 4NZUL 4HKJB 1KIRB 1KJ2B 2DQHH 4PJ7E 5D96C 1E28A 1A6AB 4XI5D 1CDCA 5TQ0L 2OK0L 5HJ3A 1FZJB 3U46A 5FYJE 1OTTC 4QTHB 3C9NA 4JCLA 1KPVA 1Z9LA 4K7PY 1CXHA 3ET9F 3CUPA 1KB5L 5IB3B 1IZKA 1M7IB 3FFCB 2XKUA 5JW4N 2ZSVB 1RZJH 1M05A 4ZPVA 4V1DE 3P4MB 4P9HL 4YX2L 2FEEL 4M4PA 4JPIA 1BM3H 1U8NA 4KI5F 3GMMB 3ZT6A 2IADA 3B2UD 3GI9H 5TQ2L 1CD1B 3FAWA 4GKSB 3RGVC 2OTPA 4KZDH 2IF7A 5F6HJ 1QSEA 4FXGB 3U4EA 3C6SA 4U1SB 5H8DA 1JGEA 5E4IA 2PYEE 4U1KB 1A3RL 1EIBA 2EH8H 4PLNC 3RTQC 4CAGA 1P69B 4HJGB 3GSQB 2XFXA 4X6FA 4J1UB 3UTSD 3M17A 4Q2ZB 3IJHA 2PCPB 2QJDA 5H37G 1NGZB 2JJWA 4H0GA 4AL8H 2FX9H 4JREC 4LCWD 1YEGH 3SKNB 4YLQT 1SJEB 5HDBF 3DURA 4M1CC 2B4CH 4C56B 1CDGA 1IGIL 1IGYA 3OAUL 5CZVH 5MEQA 3MLYL 2R23A 3I75B 3MRRA 3DYMA 5JIPA 1CICD 3GSNL 5C0CA 3C6LC 1I9IH 3LRGA 1RIVH 2FD6L 1R24A 4OLUL 1F4XL 4WFHD 2ITDB 1V7NH 5FUZL 5MERB 1DBJH 3V4PH 4G7YH 3VXUB 3PG2A 2FB4H 3H3PH 3SY0A 3S96B 2V5RA 3QUYA 4LP5A 1LE9B 3D0LB 2QV2A 1R5WB 1ZA3B 5IMOA 1N3NB 1JBJA 1X5LA 5ANMB 2C4FU 3O2VL 3MJ9H 1NC2A 3PWPA 4OJFH 1F11B 4R9HA 3F5WA 4G5ZL 2ESVD 1EEQA 4DOHE 5AWNL 2RB8A 4E42B 3NN8A 3WKNA 4LCCA 2FJFA 5E9DE 5DD3L 3BRFA 1R3JA 4NN6B 1T3FA 1U8QA 5JXAH 2EDYA 4PJBB 4KHTL 5FB8A 3QQ4A 4M1GH 3MMEB 2RFXB 5T1MA 1A3LH 5GGTA 5C6TL 4ODWB 3IDNB 2HH0H 1G0YR 3ORJA 3KYMB 4XBGB 3MNVB 5B38B 5C0AE 3SDDA 3C5ZB 1WBZA 3MACL 4H5SB 2NZ9C 4XNQA 5D1ZB 1NGXB 3DI3B 5EZLB 2ICES 1U41A 1VFAB 3TCLA 5J9PA 4MVBD 4X6CE 4NFDA 4PG2A 4R7NB 1ORSA 2YXFA 4IIQA 1KLUB 3U2SB 1RQ5A 1S7VA 3ARGB 4HWBL 5DFVD 3O3BA 2Z91B 1ZA6B 3CDCA 2VQ1B 2Z9TA 2HT2C 1J0KA 5DMJB 5DQ9B 1CR9L 1KPRB 1OSZB 1A7NH 4NQDB 1WZKA 2PNDA 1KLGB 3O3DA 5DJDA 1A6PA 4RZCA 5J1TC 2VR9A 1ED3B 4RGNB 4PJ5E 5BW7C 4HPYH 3ROLB 3V6OE 2KKQA 4UV7L 4MA8H 5KN5A 3VD4A 1CFTB 1ZLUK 1D9KC 1KTDB 3AFLA 4L9DA 4U1MB 1I1CA 3WUWA 3MNWA 3HUJF 2VTFA 4Z77A 1VADA 1QSED 3O6ML 1RJYB 2GKIA 1Q9OA 3UCRA 4LVOB 3VWJD 5JNYA 3NTCH 3WFEL 3IFPA 4PY8J 4ZYKA 1ZANH 3ULUE 5I6XB 2DD8L 5F7EL 1WICA 4OUOA 2R0LL 3VFGH 5SX4I 4YBLC 3L95B 4XCNA 3VXNA 3BSZH 3S4SA 3GMRB 4XPAL 3L5XH 3GMQA 5SV3A 1AJ7H 3T0BA 5D7JB 4JKMA 4HV8A 1M7DB 4UAOB 3BZFB 5EO1A 5KTEL 1YY9D 3FONB 5JW4R 5C0CD 1KB9J 1CE6B 5D1XB 3OKNB 3R8BB 2Q8AH 1UCTA 3DVNB 2OZ4A 4GAYA 2IAMA 4HPOL 3RZCD 1NANI 4QRRE 4PRHE 1UM4L 4JRXB 2DLGA 2NY1B 3SKUD 5IB4A 1XF1A 2EE6A 1L6ZA 3LIZL 1KJVB 4HDIB 4OZGA 5ELIA 4U0QB 5F7WC 5IFHL 3GEWB 4RMWA 2R4RL 4Y4KC 4V2BA 2GT9A 3F6IA 2FSEA 5D7IF 3F58L 3BJLA 1CIUA 5HYJB 5IEHB 2FIKB 4WTXA 5E95B 5CZXC 4GMSL 4UB0H 1ETZA 2EH7H 4UDTA 4YE4L 1QLRA 4OT1L 3OKEB 4YR6A 3GBNL 1U3HA 3BKCH 5FDWB 1S8DA 3PWPD 4CGTA 2XWJA 1A1MB 4ZTPH 5D2LF 3HG1A 1DDHA 1SVCP 3EGSA 4NUGL 3GHEH 1A8JH 3E6HB 1YPZB 3O4LD 5FM8A 3WHXB 1I1RA 1CG9B 4JJ5B 2X9WA 4KV5E 1IJ9A 2Y5EA 4J3UA 3ARFD 1H3XA 3HKFA 3O8XB 2DTSA 1F4AA 4FMFA 4MJ4A 2BCKB 2NY5L 1LO4H 4KROB 3BE1L 3MLTB 5GZOC 5HHXH 4EI5D 1TJIH 2R1XB 3UBXG 1V3KA 2AJUL 2YD6A 1YNLH 4HLJA 1FVEB 2AEWA 4HBQA 1S7WB 1FHGA 4WWKA 2EIBA 2X89D 1ZGLA 2B1HL 4PB0L 2VITA 4L1DA 6FABH 4KI5C 4B53A 2A73B 2X4UB 3C5JA 3QUXB 4WU5B 4K3GA 5IHZA 4TSAL 2V7HA 3EYVA 1EHLL 4K2UH 5HHNB 4N8CL 4WI9A 1KNOB 3W9DB 1TPXB 1A7RL 2WANA 4WEUD 1MJ8H 5LCVL 1KCLA 3C8KA 4XCYB 2UZIH 2NTSP 2NY6D 5EU6B 3JV4B 5HD8C 3Q3GA 1SVZA 5CLTA 2LV4A 4RBPH 4NO2B 4P9MH 1NDMA 5GJSL 3QI9C 3O2WH 4CVUA 4OLYL 3KR3H 3VGAB 2NYYC 3LCYA 5FV1L 4J3TA 4G43A 2YA0A 3HPJB 1QLFB 2VLJB 5E03A 3C09B 5I1HL 2JB5L 4XX1E 1RZ7H 4POZD 3D9AH 4XPGH 2QADB 4E41B 1JPSH 4R4FH 2FH6A 3CPLB 3LEXB 1FIEA 4GG8A 4Z7OF 5IJVA 3WL9B 4OCWH 4LEOB 4Q9QL 4PLKD 1OB1B 4PJGE 5EUOA 2IFFL 2OMNA 2EECA 4XP1H 2GEEA 4EDXB 4QLRA 1INQA 2VAAB 5D2NA 5E99L 4OFDA 4QXWA 1MQKL 1QD0A 3KPMB 1EAJA 4OCYL 5C86A 5J13C 5AD0A 4GRMA 3MRHA 3U4BL 1E27A 1QNZH 4APQB 1DBML 3H0TA 3DRTA 3REWB 4CVXB 1TVBA 2UYLB 2QQKH 4ZO6A 3TBYB 1UJ3A 3FQRB 1OWRM 2BDNL 3HE6A 1QRNE 3V0WH 3DSFH 4HUUB 2EIZA 5C0JB 5EWIH 5IMMB 5IVXA 4K7PL 5KSBE 3MJ6A 3G6AA 2QBWA 4DK3A 4H1LG 1LO0L 3TPKA 1CLYH 4X5XB 3QDGE 1LEIB 4FQHA 5KSUB 2IAMD 3ARWA 3BD4A 2VXQH 1T03L 1CFBA 5FM4A 3IYLW 4QEGA 3RL2B 3TPUB 3UTTB 3VFOA 1Q9KB 4LASH 4F2MB 4OI8A 1CFQA 4G9FB 2CLVA 3ULVL 4F9PC 1T83A 1NUGA 4QRTB 1NGPH 4ZG1A 4KZEH 2VOTA 4HQQL 3ARXA 5KS9E 1W72B 5HHVH 2F58L 3QEQD 2WZPD 4X4XA 4UINH 1NCDL 1Q1JH 3QQ9C 4QRUB 1U3HD 2QQNH 1ZGLM 3HG1D 2FJGA 1VGKB 1J0HA 5TE6H 4XCCL 1FYTB 1K5NA 1CLOL 2BY2A 2GHWB 2YSSB 1G7PA 1HH6A 4TSCH 3L3KA 4DGVL 5B39A 5B21A 1OAZL 3C08H 4I0PB 4Y5XC 2A9ML 4PRNB 4BH8A 2O26U 4FS0A 5T3ZE 2IANA 2OI9B 2A6DA 1FE8H 2XWBA 1G1YA 4M48L 4F7TA 1WLHA 1QR1A 4WWKD 3RWDB 4WW1A 3ISWA 1D5ZA 3LRSB 3VWKA 3UC0H 1XR8B 1AI1L 3MV9E 4NRXB 4EVNB 1T5WB 3L3GA 4QNPF 4YWGL 1E6OL 5FYJH 3I6KB 1JF1A 3IDIA 3CFBA 3RVTD 6CGTA 4ZXBB 5HHME 4BFIA 3TV3L 2EEAA 4JFFB 3FB6A 1UB5A 5CBAB 1W0VB 1I3RA 2R2EB 4RMQA 3C87A 4D8PA 4QHKJ 4LPUA 2BHZA 3QXAA 1AGEB 1FLTX 4NO5A 4RFOL 1O7SA 3IKCA 5I1GH 1C8PA 3MV8A 3TIEA 5FGCB 3TA3A 4NSKA 5EOQL 2YUWA 5EC1A 1A6WL 4HZLB 1JFQL 4JFEA 2Y9RT 4JY5H 3MRBB 3OKYA 4GXVH 5J1SC 4HWEH 1A6VH 2E3VA 3O2DH 5CGYD 4H26B 5L6YH 1Z5LA 3WUZA 3WEXB 5K9OB 5DRZA 1Z9MA 1PBYA 1FH5H 1LO5A 1N64H 1KCRH 4Z7UA 3HS0B 3BQUB 1DANT 3ESUF 5BO1L 1P2CB 5SX4H 2NTFA 5JW3H 3KHOA 2HLAB 5D72L 4TPRL 5ERWB 1F4YL 4KDTA 5KZCB 4P3CL 4R2GD 2DQGL 4UIKH 5DEFB 1EHXA 2PO6D 3FQTB 3QDAA 4YHKH 5HYIA 4FFYH 5E00A 3I50L 1A7OL 1FO0A 1KEMH 4MX7A 2X9XA 1DBAL 3P0GB 5DT1L 3QUZA 5FM5O 3CNKA 3MLPA 3NCBB 5I30L 2NZIA 3MRIB 5I16B 3TO2B 1QPPA 3MRCA 3D3VD 2BMKA 1TITA 5J56B 1NANH 1F42A 4O51B 2FBJH 4MNHA 1UXSA 2LTQC 4MDIA 3UJJH 3ZDZF 4CNIA 4NQSA 3BX7C 1A1NA 1YUHB 1R3LB 3RPIB 5D96B 4X6BA 4P5MB 1ES0B 1LK2B 4HH9A 4PRPA 1D6VH 1PKOA 3GGWB 5I1DA 1P1ZB 2ITCA 5BCAA 4JAMB 4QRQB 1SBSH 3QIBC 3MSPA 4NKQB 1SYVA 4PR5A 1YJDL 2CKBL 3DV4B 3RL1A 2QQQA 3AAZA 1RIUL 1VESA 1FDLH 1L4IA 4G6FD 4P5TA 4IJ3C 4UBDD 1Z9SA 3QFDA 4GRLC 3EKCA 4PJXE 1MCFA 1D5XA 1HQRB 2KQNA 2V6HA 3I02B 2WUBH 3ZT5A 1DLHB 4FQ1L 2EDNA 3IB4A 1FG2B 4WGVB 3RNKB 3WLWD 3SKOB 3BZEA 2LVEA 5IFJA 5LGJA 4OAWA 4ZNEA 1YNTA 1NGQL 4GRWE 3VXSA 1R5IB 4ETQA 1S9WB 1KB5A 3FRPA 1F8TH 3VE0A 1YEIL 3HRZA 4U33A 4ONHB 2X1QA 2W9DL 2NW3B 1SY6L 2R0KL 3LB6C 3V5HA 4HWUA 4MJIB 1K9TA 1N0LA 2JJUA 4XC1L 3VFWA 2P8PA 2K7PA 5K9JL 2R15A 3BESR 1JVKA 1BX2B 5JW4M 4N0UB 5DJXA 1AXTH 1PG7H 3SDXE 1IT9H 3C6LB 4X6EA 2BRRL 3GSVA 4DFIA 3MV8D 2HJLA 4QHMA 4U7SA 5AG8A 1UH2A 3IFLL 4L9LA 3WFBH 3EYFA 1VFUA 2R2CA 2YZ8A 4LSVH 4NQTA 4FTVA 3CMGA 4NC0B 5BZDB 4HJJH 1RMFL 3STZA 4G6JL 4JFED 3VCLB 4GAJL 1HHIB 4TVSa 4MD0B 4ZUWB 4JM4H 4U6VH 1KJ2L 4JVWA 4NWTH 3IFNL 4TNVF 4G7VH 1AO7E 1ZK9A 3ULUH 5TFSH 3HNVL 3KYOA 4RNRA 4OLXL 3I3BA 3GSNA 4RISL 4PB9L 4I13B 3VFTA 3TBWB 2ZP0T 4G8GB 4U6XB 2VO5A 1AGDA 5GQBA 1T7VA 4XP6L 2GITB 4MAYC 3R4DA 1YEEL 2IMMA 3QHFH 2EC9T 1ZHLB 1AH1A 3N0PB 2XY1A 4OBRA 4Z7WA 1X3DA 4WO4C 3V4UL 3K0WA 2ZKHH 1WT5A 2VLKB 3MLWL 3VXPA 4UZGA 1SYSA 1F13A 2Z31C 1UKSA 1GGYA 2BSSB 4XNYH 4BSVA 5L7XH 1OTUC 5CJQL 5C2UB 3SBWA 1LO2H 3SDCB 2VXVH 3QO0A 4NCDA 1OAXH 4IBLT 4KRLB 4OCRH 3O6FB 3TYGH 5JOFB 1BFVH 4ZSOA 2DQIH 1YDPA 4K9EC 5CD3A 2XICA 4HKBB 3CX2A 4OZ4A 5EPMB 5J06A 5CIPH 2ADJB 4QY8B 5C0IB 1S78D 3UTPE 1S9VB 15C8L 2VSDA 3W0WB 1A9BB 2ZNWA 5F97E 1X4XA 2MPAL 4PJIA 3WN5A 5T1KA 5IB5B 5L88H 2XYCA 2C26A 2BY1A 2Y07H 2P24A 3ZYOA 4M5YL 1DL7H 5FXCH 4JO3L 5DTFB 1ZTXL 1JF5A 4K71C 4YHNA 1OTSD 1IGML 3WS6C 5GHWL 3QO1A 3FN3A 2G2RA 3GSOA 1NLBH 5D7SL 3B2UC 3NCFB 1IC4L 4AEHL 3L5HA 1FBIH 4L4JA 4HWBA 5K59F 2CR3A 4GBXB 3FO9A 5LWYH 2BNRA 3BUYB 4PS4H 4QRPD 4QRSA 3MCKA 2FJHB 4K8RD 3PHSA 1ZSDB 1U2CA 2D0GA 5BS0B 2ZOLB 3CFEA 2C7UB 5SWSA 3TN0B 3C8DA 3U6RB 4YAQA 5A16A 3BP6B 1BWMA 5CUSH 1RU9H 1MFDH 3B9KB 1MLBB 5FUOH 2H8PB 4ZNCD 1F2QA 3P11H 4NKOA 3EO9L 3FB7A 4Z7VF 5T1DH 4F57L 3MRLB 3U79A 5JHDA 3BWUC 1JPGA 3I6LD 5BQ7B 1DN0A 2I5YL 5ACZB 5D70L 4KUZH 1DLFL 4HMDA 4NC2B 5IKCB 1WUNT 2D7MA 4NNPL 2V9RA 3QEUB 1CICC 5DVMA 5FCUL 5DC9B 3G6JA 1HHKB 3K4AA 4CKVX 2DQJL 1MCRA 4Y5VC 5LKNA 3S3JA 1EJ6A 4KRPB 2HN7B 3O41A 4HIIB 3QULA 1EO8H 1OQOA 3TO4B 1EMTL 1QKZL 1SEQH 2QHRH 1VFMA 4TN9A 3BD5A 3U7YL 3GO1L 3K2UH 1NCBL 5C0EB 2UWEE 3MBXL 5MENB 5AZ2H 3PGCB 1BAFH 5E5MA 1ACZA 4RIRA 2VL5B 5JLZA 5KVEL 3T1FB 3RX5A 1H3WM 3S3PA 1YEKL 25C8L 2VYRE 3U83A 2AJSH 1NC4B 5D5ME 1MIEL 4PJAA 2LE9A 4ORGB 4X5LA 3QG6A 4CW1A 5CWSA 5EB9A 3VGHA 1K6QL 5DC4B 1I1FB 3WSQL 2VE6B 4M6OH 4ZPTA 4LAJH 3UTQA 4M4RA 4YHPA 4QXGH 1BIHA 4N0RA 1B0RB 4NZTL 5T5NG 2NY0B 1A21A 4HEPG 3KDMA 4NQEB 3AXLB 4X8JA 3ZKXC 1MHPH 1A0QL 2NR6D 2PR4H 3MO1B 1C7SA 4GAGH 4F33B 3GBMH 4PJ8A 4Q97A 4ERSH 5IW1B 3MLZL 1KGCE 1NCWL 3O3AA 2W0FA 5EOTB 3P4LA 3E2HC 3U4AA 5E7FA 1E4XI 4MVBC 4YDIH 5BMFH 4JFXA 3IAPA 4NKMA 1CFNA 1DN2A 3MV7A 4RCAA 4OD1H 5E8DH 2PYFB 4LPWA 4HULB 3S6CA 5FYLL 1CT8A 5CSZB 3BIKA 1QSFA 3PGFL 3S97C 4NRYA 4GG6E 2EXYD 2F9BT 4P2QE 3D39D 1GGIL 1WGOA 1WAAA 4I77H 3BYTA 1HQ4B 3NFSH 4NQVA 1Q8MA 4HUXB 5T3ZH 3H9SA 1TTGA 2CO6B 2EEDA 5CCKL 5HVHC 4GW4B 1NUFA 2F19H 1MREH 4L8DA 4I2XA 4JDVB 4X80H 5I66B 4PP2A 1QBMH 3FRPG 3RI5K 2BNRD 5SWZE 4PJ7B 1VKXA 2IH1A 1Z2KA 3WFDL 2VDML 5J13B 4TRPH 4I5BA 4M61A 4Z95H 5SWSD 1R5VA 4F7MB 5L2JA 4XXCA 1S5IH 2OS7A 4PG9B 1IC5L 1SEBB 5C8JB 5BRZE 4LVHB 1FZMA 3QCUH 1U9KA 1XGUA 4V1DB 3L6FB 2G60H 2AJXH 5GS0D 2DOCA 3TBVA 5JHDD 1IAII 1Y0LA 3OAYH 2Z0BA 4OIIL 4DEPC 3X14B 1XGRB 2ZPKH 3TYFB 1JUFB 1KCVH 3D18B 1INEL 4FZ8L 4PV8B 3QISA 3W81A 4OQ1A 4OZFA 2NXZC 2H45A 4EUPG 5JXEA 4XPFL 4I1NB 2PYEB 4MDJA 4U3CA 4XGZB 4Y16A 5DA4A 4NZRH 4OUUB 1U58A 3UJIL 1Z3GL 2JKXA 3T4YB 1IQWL 3HA0A 3QUYC 3T2NH 5JPNB 4BSWB 4NHUA 2QSTA 1J11A 2FX8L 2A77L 4I4WA 1GC1L 1LD9A 3K46A 3RHWF 4L8BA 4IS6B 4AMKL 3MROA 2YR3A 1J0YA 4R97B 2OR7A 2MQCA 2DJSA 2VDNL 4NC1E 5J3HD 1KIPB 4QCIB 1ZHBB 1NAMB 3TC9A 4EBQH 5E70A 1P7KB 3NZHL 3REVA 4LCCC 2R1WA 2BC4B 3FO2B 3VH8G 2XN9E 3IDXH 1EEYB 2BVEA 1ACYL 1N5YH 1RSFA 3EHBC 4KVNH 4HX1A 1DQDL 5BZWB 4KK8D 4DUWA 2Z35B 2BSTA 2VLRA 3F62A 3ZTNL 3INUL 2GTZA 5JR1H 4ZUTA 3BP5B 2M8XA 2JCCA 3QFJD 3U0WL 1RJLA 2HFTA 3SDDC 3DVGB 3VI4F 3X3GH 2HRLA 3O6LL 4HCRL 3C8HA 1JZ3A 2GK0A 5I76A 4FQQB 3T0EA 4OZHA 1NGWA 4AYFA 1WZ1H 4RFNB 4LVNC 5FYKU 3CSGA 4RGOL 2CJUL 4PG2C 3JWOL 1J05B 3TT3L 3MV7D 4IIQC 3QZWA 4XZUB 3GIZH 5AAWA 4NCC2 4XP9H 2D2OA 1RPQA 1LDPL 1BREA 5EBGA 4L5FH 1YY8B 2HTKD 1FFNA 3SKMB 1QSFD 3V79C 4M43H 2EIEA 5IB1B 4HUVA 1VPOH 2EE2A 3QHTC 4K3JH 5EZIL 2C1OA 1LNUB 4NO0B 5EZOH 3KYAA 2VZUA 4ZFGL 4KRNA 3G6DL 3HC0A 4HC1L 5C0AB 1FNHA 5T1LB 4ORZC 4LCUB 4POZC 3AGVA 1IE5A 2CIIA 1N26A 3JTTB 3ES6A 3JWNC 4XPHH 4GRWH 2EKSB 4FQIL 3WCYA 1W72L 5TDOB 3SDYL 2VUOA 3TT1H 4UDUA 2P42B 3EBAA 1DCLA 4HXBH 3V7MA 3F12B 1WBXA 1N8ZA 4FQLH 2VDOH 5JUEL 1K4DB 4Z7QE 1R3IH 3NZ8B 4QOKD 1A4KA 3B3IB 4GMTL 4OFPA 3BEWA 3KPRE 4DTGL 1MFBL 4MD5A 4P57A 1C12A 3W9EA 3IXAB 5F9WC 3VGDA 1KV3A 3PF2A 1TETL 5IT2L 3OL2A 5FHAL 3X11A 1JWMB 1MVUA 5DHVA 4PJ5B 1YNKH 1U8OB 3CDGA 4PREB 5E8NB 4UT9L 1DP0A 2GSGB 4YH6A 1YZZA 5HVWA 2X4SB 4BK5A 1Z0MA 2WK2A 3VXRE 1IGFL 2X05A 1Q9WB 4D9RE 4Q6IB 4EN3D 5JXED 2ERJC 2IAMC 2MJWA 2LTQB 4K07A 4MWFB 4H0HB 4L4TA 1LE5B 4JANB 4RMUA 2DQHL 4CDGC 4KTDH 2HFFA 4Z76A 1R0AH 3HE7A 5FEBA 1UVQB 3HPLB 4UUJA 4MLIA 2IG2H 4TVPE 2ICWB 5IFAH 3WIFB 2E7HA 4TYUA 1DVFB 5INCB 3MJ7A 3IJSB 5C08E 3W5NA 3MRKA 3T2PA 1U3HC 4I48A 4MXQC 5EN2B 1RZIB 2NNAB 3MUGA 4GRLB 5EU4B 1BM3L 4N0FB 2JJVA 3GI9L 2OXHA 4OF7A 2H2SD 3TVMA 2VC2H 2QKIB 4LF3B 5T5NF 4QRRB 4PRHB 4KZDL 1JPFB 3ULVD 5J4MA 3VDAA 1XR9A 5HDOA 3V6ZB 2EH8L 5I1LA 2VLRD 3WMSA 1ADQH 4TTGA 5DHYB 4CN4A 3RVUD 3HUJE 1JP5A 3TGXA 1QBAA 1J8HE 2EDOA 4AL8L 4WFEE 3RBGA 2FX9L 2CKBA 1YEGL 4KK9D 4MNQB 1FLRH 1TNMA 4OIAA 3L3DA 5CIPB 2Y72A 4MQ7A 4GKZA 1PLGL 4EOWH 5CZVL 3L1OH 5GGSB 1MWAH 3F7PC 3RVTC 2D7QA 2H1PL 4NPYA 3BO8A 3T4AA 5H94A 3EOYG 1I9IL 5IF0A 2EICA 1RIVL 1REIA 5E4EB 2I24N 2QL1A 4PYHA 2C3WA 3P9MB 2ZCLH 4FFZH 1J0JA 1DBJL 3WS3B 4G7YL 5JDJA 5B8CB 3CK0H 4JO4H 4W68A 1X5FA 3MODH 3TFKC 2FB4L 3H3PL 1NGYB 1DBBH 3T8XA 5TDPB 1D7FA 1SY6A 4LSSH 5DJCA 5ICZB 4OIBA 2R4SH 2GW5A 5LBSH 1BEYL 1YEJH 4B7LA 2VQUA 5FK9B 2NXYC 4OJFL 2CH8A 5CGYC 1OGTB 1W0YT 1PZ5B 2C3VA 1IAKB 2ZJSH 2CXGA 1U93A 2YXMA 3PQYE 1RHHB 5D2NC 3UDWA 4U4BA 1OPGH 3T04D 2FRGP 3H9YA 4G42A 3UJTH 5JXAL 5C07E 3MGAA 1J87A 4JQIH 4M1GL 4RAUB 1ZHNB 1A3LL 1UJ3C 5ALBH 1JMXA 4R2GC 5KSAA 3HE6C 3WIHH 4DW2L 2Z31B 4HKJA 1KIRA 1KJ2A 1ZVYA 1A6AA 2EYTA 2VDKH 4DKEH 2W65B 1ZAGA 4PRAA 2B2XH 4LGRB 3ETBF 1FZJA 4LLWA 4QTHA 3RPKA 3U9PH 4F37K 3DO7B 1WBYB 4RGMC 1M1SA 1J10A 5GISH 1T66D 4ZS7H 1M7IA 1U8IB 3GMPB 3BH9B 5IB3A 3FFCA 4L4TD 3LAFA 5MI0B 3BN3B 4LLUB 5IM7B 3P4MA 2W9EH 2PKDA 5CP7B 1KTLB 4PV9B 3QCTH 4J3WA 3HE7D 3LVEA 1T83C 4HKZB 1GOFA 1JV5B 4M7JH 5EOCL 3GMMA 3ZE0E 3LQAC 1A7NL 2RCSH 4NNXB 1MIMH 1CD1A 1NPUA 3GK8H 4R6UA 5IOPB 3IVKA 1UM5H 1X6LA 2APWA 1CDHA 1K4CB 1QRNB 4FXGA 4RX4A 3LKOB 2L4OA 4U1SA 4RAVA 3EZ8A 4HPYL 4U1KA 4MA8L 2Q7YB 5GGQH 3GSQA 2N7BA 4J1UA 2P5EE 5KSBB 2ICCA 4Q2ZA 1U8MB 2PCPA 3CH8A 3PV7A 3CGTA 2F54E 4LLAA 2R0ZH 5I8KH 2BSRB 5GRXG 3SKNA 4KKCD 3HC4L 4PRID 3JWDC 4C56A 1J88A 3R06A 3NTCL 5E2WH 1KJMB 2DIAA 3MRFA 1ZANL 1A9EB 2YD1A 1WJ3A 2XZCH 5KS9B 1MJJA 4OGAC 3VWKC 3VFGL 1FGVL 1I7TB 4ODSH 5DA0B 1J12A 3HZVB 4JFHE 1A1OA 4M5ZH 2X6MA 3QZWG 1AJ7L 2ITDA 1KFAL 2EZ0C 5B3JF 4HGKC 5MERA 3VXUA 3B6SB 1JF6A 3GMOB 1T0MB 4LIQE 2NY4D 2Q8AL 3D0LA 1R5WA 1ZA3A 4DGIH 4LRIA 1BIIB 1N3NA 4NQCB 5ANMA 3V95A 2IMNA 4Y5VB 3N1FC 1F11A 4S11A 2YUVA 5DD5H 2F5AL 3TA3C 4P3WA 4FP8H 5ID1A 1JRHI 3WJLC 3MV9B 4UB0L 2EH7L 1JPTH 2XWTB 3BKCL 5HHOE 4PJBA 3MMEA 5T5FH 5F93C 4IMLA 2FHBA 1L9MA 3GHEL 5HHMB 4ODWA 3IDNA 3KAAA 4BQCA 3ZT7A 2FGZA 1HIMH 3PNWB 3CCHB 4YHZH 1CDIA 3KYMA 4XBGA 5DJAB 1QUNA 3MNVA 3EYQD 4L3CB 4LHQB 5B38A 4LSQH 43CAB 1LO4L 4H5SA 4AH2B 5HHXL 4HKXB 5D1ZA 4JHZA 1NGXA 4KDTC 3MRNB 5EZLA 5KSAD 4G8EB 5FYKE 1VFAA 1YNLL 3G5ZB 2BVUA 1F3JB 4R7NA 4G3YH 2EDJA 4X0KA 4M03A 3U2SA 5JA9A 3ZKXB 3PDDA 2DLFH 5FKPA 2Z91A 3MR9B 3QUZC 2VQ1A 3T0AA 3KLAA 5D1QB 5DQ9A 1OSZA 2IGFH 4CMHC 3DIFB 2FBOJ 1KLGA 3ZKMD 1YYLL 1OSPH 3PP4L 5AEAA 4K2UL 2QR0B 3FFCD 3WDJA 5IG7B 1CK0H 3L7EB 1KJ3H 5KVGH 4PJAF 5EU5A 3HMWH 5FKAA 3E2HB 5I8EB 2UUDK 3ROLA 4HUMB 4QNPE 4WU7B 3WE6B 3ALWA 4RRPA 2J3SA 2XPGA 1CFTA 1D5IH 5IBUG 1S78C 2F8OA 4U1MA 4P9ML 2HKHL 2RJMA 4YHIA 4BUHA 1KCKA 3QR2A 1DFBH 5F1SA 3KR3L 5I1IL 1NFKA 3QHZH 3EOTH 1MCIA 4LKCA 4FQ2L 4OCSH 1RJYA 1S5HB 3QDJE 4ZPVB 1RZ7L 4P5TC 3DVFA 2APXA 3D9AL 4XPGL 3Q48A 4IEFB 5DEGB 4R4FL 3H3KA 4OCWL 3L95A 5GGSY 3RAJH 1I7ZB 3TBSB 1B2WH 1IGJB 2HKFL 3WNLA 3IJYB 2B7DT 1JGEB 5D7JA 4BQ8A 3P4NB 4Q6YA 3RDTC 4LCWE 1OW0A 4X6FB 1P4BH 1QNZL 3FONA 4P23B 3OKNA 5D1XA 3RWGB 2QQKL 1MCPL 5A2KH 2WP3O 4DN3L 3U30C 4GOSA 1MRCH 3EOAB 4MXVF 4P9HC 5GS2H 3DMMA 3ZTJH 3V0WL 3DSFL 3VXUD 4JRXA 4NJ9H 4HDIA 1KJVA 2VIRB 3GKWH 5EWIL 4F80A 4HBCL 4PJXB 2F53A 1R3HB 4DEPB 3BISA 4WFHE 5IEHA 1CLYL 4JRYE 3MRRB 1EJOH 4DKDC 3N9GH 3OKEA 3OR7B 3MRMB 2HJKA 2LAGB 1TNNA 1AP2B 2XY2A 1CE1L 3KXFA 1A1MA 1R24B 2OR8A 4L9LC 4CU8A 1NGPL 3KJ6L 1YPZA 4GAFB 3WHXA 1ERNA 3R1GH 1CG9A 1T6VN 4YQXH 4JJ5A 1S7RA 1F90H 1T6WA 4W4NA 3ZDZE 2DQDH 4UINL 3O8XA 1Q1JL 2BCKA 2QEJA 4LFHD 3G08B 5ABDE 3NIGF 5TE6L 1PG7X 2GJZA 2R1XA 1NC2B 2HRPH 3Q2CA 1FVEA 4TSCL 1S7WA 3WFHB 4KDWA 3C08L 3C5ZD 1TZIB 3SDXB 1WV7T 1IFHL 2A73A 2X4UA 3QUXA 4WU5A 3SQOL 5CEZL 5D1ZD 2AI0H 2FX7H 4DZBB 4YXLL 5FB8B 2WBJA 4IM8A 1KNOA 1WT5C 2L0DA 3ARGD 3EIFA 3UC0L 2X70B 4BELD 1MI5D 3OPZH 3Q5TA 5EU6A 2VRAA 3JV4A 3SBWC 2CRYA 1JZ4A 4LGPB 1JNNH 4JM2B 3SDDB 2NR6C 3OWEA 4NQDD 1GGBH 5EORL 1AO7B 2UVEA 5FA4B 1KBGH 5FYJL 2I26N 2J4WH 5I0DA 1IMHC 5E2UH 4TVPH 1U3JA 4RGND 4LVNB 3E1F1 1MFCL 3P9WB 3HPJA 1QLFA 4X7CC 5I71C 1G9NH 4NYLA 3WKMH 2K3TA 4E41A 3VXQB 4D0CA 2MQ3A 1CLCA 3HC3H 3CPLA 3LEXA 1EEZB 5I1GL 1CGVA 1YEFH 5CKGA 3WL9A 4U2YA 2XZZA 1OB1A 3WN5C 1L6XA 2GJJA 1FVDB 3P40A 5L2KD 2EXYC 1XF4A 2F5BH 3KPMA 4JY5L 2BFVL 4FHBD 2HA1A 3QRGH 4WCYH 4HCRA 2KUTA 3D87B 3QPQD 4HWEL 3V8CA 4APQA 4FFWC 1A6ZB 3BKJH 3N50A 2X10A 4PJEA 3REWA 2X4RB 3NVQA 5L6YL 2UYLA 3TBYA 3FQRA 1VADB 2I9LA 5IVZB 4PLJC 3ZKQD 1FH5L 3EO0A 1Q9OB 3FO0H 4NKDB 4HUUA 1N64L 5FYLD 3N85L 5C0JA 3DARA 5IMMA 4PJFF 4OBSA 3HAEH 4RMTA 4ZYKB 1FN4A 3VD5A 5D1XD 1LEIA 4IRZL 5KSUA 1HOCB 1J1OH 4PTTB 1N5AA 4OFYA 3VXNB 3RL2A 4YHKL 2PXYB 2QSCH 3CLFH 4HC1A 4FFYL 2AK4D 3MYZA 4WHTB 1V7MH 4JRXD 2NY1D 5C3TA 3UTTA 1Q9KA 4F2MA 4G9FA 4NBZB 1ZVHA 1YMME 2X09A 3L3JB 2X4QB 3K8LA 4HV8B 4QRTA 1HYSD 4DK6A 5HYJD 3FT4A 1W72A 2BNUB 3NACL 5JZ7D 1CGXA 2FBJL 2K1MA 1LK3H 4QRUA 3OF6D 5F21B 3UJJL 1F6AB 1VGKA 1BOYA 3KPLB 1FYTA 4OZGB 1C5DB 2YSSA 4LFHG 2J88H 5MEOB 2BOCB 2ZUVA 2DLIA 3O8XD 4JCMA 4I0PA 4YBQD 4JKPH 5EO9A 1FGNH 3D1MC 3E3QC 1J1PL 2GUOA 4KMLB 4KROD 3UO1H 2ZUYA 3DROA 4PRNA 1MHCB 3O4LE 5CILH 5B38G 3IFOB 3MPCA 1FDLL 1B88A 4M93C 4ELMF 3A67H 5BXFB 4LCIL 4BSJA 2NY3B 3WFCL 5J3HC 5ISZA 4ONGH 3ZZ1A 3RWDA 3CX5J 1XGQB 3H42H 3LRSA 1XR8A 2WUBL 3QUXD 4NRXA 4EVNA 1T5WA 5KBNC 1HN1A 4TNWK 3SE3A 4OGZA 4JZJB 3QEGH 3OB8A 1E4JA 1WCBB 2DLTA 4KK8C 2XQYG 4NO3B 4JFFA 2O5XL 2UWEB 5EU6D 5CBAA 1W0VA 1F8TL 5K59E 4GXUN 2R2EA 5I19H 3IU4H 3P77A 1N0XH 1JNLL 4ONFH 3S35H 1AGEA 4NT6A 2VMFA 1KTRL 2JK5B 4PJ8C 2B1AH 2N1KA 5D5MB 3UROR 1Q72H 2LU7A 3LKQB 1HKLH 5D6CB 3RY5A 2VLJD 2X44D 5ADOH 3MUJA 2NY5C 1HHHB 1AXTL 2QADD 3VRJB 1IT9L 1URLA 4Z7VE 3Q6FB 1XF2B 1N6UA 4EQ3A 3HI1B 3RIFK 1MUJB 4H26A 2HTKC 1NDMB 2HTLD 3RX8A 4YFLI 1G9MC 4PLOB 4G9DB 3WEXA 5K9OA 4HJJL 1NFIB 3H3BC 4G43B 4S2SB 3HS0A 3BQUA 2E9WA 4JM4L 4U6VL 3R0MA 1J7VR 3KWWB 1P2CA 5FHBH 2NQCA 4NWTL 5CEYB 4G7VL 3ARSA 2HLAA 2K7QA 2QHLA 2FCBA 3ULUL 5ERWA 2RGSA 4UU9B 5TFSL 1A02N 2X1PA 1VACB 1G1CA 2NXYB 4UT7H 5DEFA 1EUTA 5H37H 3FQTA 5EUOB 5GRWA 2BVOB 3K3QA 3LEYH 1INQB 1NFDF 3MLSH 3QAZB 3O45A 1N2RB 3ALXA 3EYSH 2BOBB 3QXTA 4Z0XA 4DUVA 4ZODA 1I9RL 2Y5TB 3MRIA 3QHFL 5IROA 3TO2A 4GRMB 3WNPA 1E27B 4P2CG 3BGAA 4XXCC 1F3RB 2YEZB 1H5BB 2VB5A 1TVBB 4O51A 4LIQH 2ZKHL 1UJ3B 4WHYG 3UTTD 4PBVC 4N68A 3HE6B 5L7XL 1HKFA 1I7RB 3THMH 2O5YL 2YD3A 4HIJB 1YUHA 5F7FA 3RPIA 4AT6B 1LO2L 2YMXH 4P5MA 4YFEA 1LK2A 3QA3B 3GGWA 1P1ZA 3MXVH 4JAMA 4QRQA 3TESA 4RGMB 4OCRL 1MH5B 2DI8A 3LEVH 2I9TB 3TYGL 5JXEC 1NMAH 2DQIL 1MCKA 3NCCB 3DV4A 5SWZB 2DM4A 5ICXB 3QEQE 2CMRH 3VFOB 3BIAX 1CFQB 3MYJB 4Y16C 1INDH 4LARH 4Z5RA 4MSWB 5HHQA 1HQRA 4K94H 4I0PD 4H8WH 3I02A 1OM3L 2J8UA 2V2XA 3GSUB 5DVLA 3BGFB 1DLHA 1TZGH 1BZ7B 5BRZB 5L88L 2CLZB 3SKOA 4MA1C 4KJYA 3WHE1 4P46D 1MRFH 3X12B 2FJGB 1DL7L 2HT4D 5ACMA 1EBAA 3EJYD 1K5NB 4I9WD 2IPTH 1DQLH 3I3EA 3RWFB 2P46B 1R5IA 5FYKH 1NLBL 1VENA 5B39B 1OAUH 4ONHA 4U1NA 4OZIE 2VXSH 1FBIL 4EI6B 4X7TB 2WBKA 3ULVC 5LWYL 2IANB 4PS4L 2DBLH 2XWBB 1EHAA 4ZXBD 5TE7H 1DE4A 4JFFD 1OAYH 1BX2A 3QDHA 4F7TB 1PSKL 4HUKB 2AP2A 2DJUA 2UV3A 3VWKB 4N0UA 1LEKB 2DS4A 1PQZA 3MLXH 3C6LA 5CUSL 4D9QD 1RU9L 1MFDL 1QFPA 5FUOL 1Z0NA 4X9HA 3L3GB 3ARBA 3HZKA 3P11L 4KK9C 1ODAA 5T1DL 1QTYT 3T0EC 3KPTA 1JF1B 3BRDA 1EAPB 4JPKH 5BZDA 1CCZA 3CFBB 3BXNA 3OZ9L 4JVPA 2VZ1A 1RURH 1UB5B 5FCSH 3VCLA 4XBPB 5EU3A 1HHIA 2EE9A 4MD0A 4ZUWA 4A2MA 2XN9B 4D8PB 4HJ0C 4DKFH 4NO5B 3FN0H 2EXWC 1F4HA 1I3GH 3IKCB 3T0XA 3LS4H 4LP4A 1EO8L 3TIEB 1RVFL 1KCSH 2QHRL 3TA3B 4KK5D 2Y1VA 5EC1B 3EFDL 2EDTA 1BJ8A 2DM2A 4G8GA 5GRZA 4U6XA 3BQUD 1QYGH 5AZ2L 3E0GA 3LY6A 2GITA 3BD3A 4K9EL 5HVGB 1T04B 1TCMA 1U8PA 5HDLA 3T0VA 1OLZA 4MCYB 2R9HD 3RU8L 1G7LB 3O3EB 1EDQA 2VLKA 2O5ZH 4OV6F 3GSRB 4ZO9A 2E27H 4C55A 1LO5B 3SDCA 1ZT7B 4Z7UB 5BJTA 4FQJH 1LO3H 2VABA 3AMKA 4JFOB 2GQHA 2P7TA 3T65B 4QXGL 4PBXA 3ARRA 3O6FA 5JOFA 2W1NA 4KJQC 5E1AB 4HKBA 3D3VE 5E00B 5DUMH 5EPMA 5GGVY 2ADJA 5C0IA 2X9YA 2PR4L 5CLWA 2ICEB 3MFGB 1S9VA 3QUZB 4GAGL 4ZOAA 3GBML 5DQJB 2YZ1A 1A9BA 1U95B 4ERSL 5SWQB 1RI8A 4EXPX 4CNIB 1EH9A 5GXBB 2X41A 4OD1L 1J1XH 3NABH 4JR9H 4OCLC 4WFGD 3K2MC 2FH8A 3HE7C 4PRPB 1IGCH 5I1DB 4F3FB 1L0XA 5IHLB 2M1KA 2NY2B 2YD9A 5EH1A 5JHLH 4UTAH 5E8PA 1SYVB 5FO7B 4GBXA 4I77L 3NFSL 3RTQD 3F6LA 5T3ZL 4KJPD 3NCYP 4P5TB 1ZSDA 5BS0A 2DKMA 2ZOLA 5IUSA 4NRZB 2C7UA 1Z9OA 3VXRB 4KVCH 3TN0A 3QIUB 3NOIA 5T3XE 3L7FB 4ZFFB 3QQNA 3TVMC 1MREL 2E6QA 3BP6A 4HSQA 4X80L 1QBML 4MJID 3B9KA 1MLBA 2H8PA 2D4FA 1TTUA 4KKCC 2DQTH 3MRLA 1RK1B 4OAWB 4TRPL 4XP4H 4Z95L 3RDTB 1KIQA 3QPXH 4XC3H 5BQ7A 1C5BH 5ACZA 1S5IL 3VXSB 5IKCA 1YJDC 3C6LD 3DX6B 5EZJB 3QEUA 5C08B 5A1AA 3U30B 1JIBA 1HHKA 3QCUL 3U9UB 3PHQB 3VJ6B 4L1HA 2G60L 2AJXL 2HN7A 4HIIA 1HNGA 2DLEA 2NW2B 4RQQB 2BVYA 4NN5B 3TO4A 2FECI 3AS0A 2P8PB 2ZPKL 2FWOB 2YA2A 5C0EA 5HI3D 3FQXA 3IS0X 4NKIL 4NDMB 2NY4C 4UNUA 1CL7H 3T1FA 4X6EB 1YN7B 3UYRH 1Y6KR 3GSVB 2HJLB 4XVTH 1F97A 1NC4A 4L9LB 3EYFB 4NZRL 2F15A 3CD4A 1F5WA 3AVEA 2R56H 4G8GD 3SJVA 1MEXH 4HXAH 3T2NL 3STZB 2VWEC 1F58H 1I1FA 2JF1A 4BZ1H 2D7TH 3CLEL 4G8FA 4PUBH 5HY9B 2XI9A 2VLKD 4ZTOH 1U8HB 3NPSB 4Y4FA 3DNKA 3GSNB 4NQEA 4EBQL 3AXLA 3IU3B 4ENED 1OARH 3UDWC 3MO1A 2XTJC 3EYQC 4C57C 2CUHA 5F96H 2NZ9D 4F33A 1B4RA 2NLJB 3OBAA 1N5YL 5IW1A 2V5TA 3U1SH 3DUSB 4JZNA 4H1LH 4X6DF 1WWBX 3D0VA 5EOTA 4WFFD 5KSAC 4WJ5B 3VXPB 1YPZF 2H6PB 2YPLA 3CFKA 2DN7A 4N8VB 4NGHH 2DYPB 4MCZB 3W0WD 2ATKB 3X3GL 3QO0B 1PX3A 2GSIB 1GYAA 5CSZA 3HNSH 1UWGH 5GGUA 1G0DA 4XCEA 1WZ1L 4TULH 3WYRA 1HQ4A 1DUYB 4Y4HB 4HUXA 2ATPA 3FB8B 3GIZL 4LEXH 3EFFB 1D9KD 1VGEH 5C07B 5JMOC 2PETA 4GW4A 5C0FB 4O9HH 2ID5A 4O4YH 4X9FA 4M43L 2ADIB 1EBPA 4AM0B 3F7YB 4JDVA 2AVGA 5I66A 4GBXD 2R29H 8CGTA 1VPOL 5GGTH 1P4IH 5T1KB 2ORBL 4PJ7A 2WUCL 5MP6H 1LP9F 2P24B 1UA6H 1KACB 3ABZA 3TN0D 1UEYA 4F7MA 1YA5A 3MLUH 4LU5L 5FGRA 4QRPE 1LEGA 4XPHL 4PG9A 5DRNB 1SEBA 1AC6A 2G2RB 3B9KD 5C8JA 3NBNA 1DQQB 3SGDI 5I17B 5AAMA 4HXBL 4V1DA 4FQLL 2YRPA 2VDOL 2ZUSA 3PWJA 5EO0A 1NLDH 1XGRA 4KY1H 4MD4B 3TYFA 1JUFA 2APFA 3D18A 2BP3A 3MNZA 4PV8A 3CX5K 1Y18A 1K8DA 3RJQB 2WWKT 1FAIL 5C7XH 2IJ0C 3S5LG 1NCAH 4FRWA 4KRPD 4NQXB 2AQ1A 2PYEA 3DXAE 4PRDA 3U7WH 3TO4D 2VZTA 1FFPA 2P5EB 3ILPA 4OUUA 1ZLSL 1G6RH 2F54B 3T4YA 1RZ8B 5MEND 4RMRA 1DN0B 5CZXD 5JPNA 12E8H 4JQVA 4W6YB 4BSWA 1MCOH 2PW2B 4LRIC 4DGYH 1NEZG 4KTDL 1KIPA 3ZL4H 1R0AL 4QCIA 1ZHBA 4N8PA 2Y36H 2IG2L 2VLLB 2B8OT 5IFAL 5I9QB 1D5BB 2BC4A 3FO2A 4NN6C 1S9YB 3F7VA 3F8UB 1T21A 4JB9H 3DETD 1TCRB 1HCFX 5BZWA 4JO2H 2Z35A 3OXRB 3KG5A 3HFML 1JZ8A 2PTUA 3BP5A 4AEFA 3MRPA 5TDNB 3OHXB 2IQ9H 3QWOB 3QG6B 1CXIA 2D9CA 2OZ4H 3DVGA 4YHMH 4YHYC 2AGJH 5J11C 1G84A 2VZ3A 4OSUH 5HI5C 4FQQA 1ADQL 5ADPH 5TH2A 3VMPA 4X5WA 2HFEA 3SGKA 1J05A 2DKUA 4JEGB 2R8SH 3K81A 4F7EB 5E9DA 3OMZA 2C4FT 3FQUA 5ESQB 3M45A 3PDOB 5DEZA 1C08A 4JLRB 5HHOB 2BK8A 1YY8A 3SKMA 4PJ8B 35C8H 4EOWL 5IGXH 3DVIA 3GKZA 3O3AB 1LNUA 4JDTH 3TH3T 5CEZD 4RGNC 1QBLH 4S1QH 4MZ3A 1WFNA 5GSRA 3B43A 5C0AA 1CFNB 3BZ4A 4LCUA 4U6HB 2D4DA 5B3JE 3D39E 3JTTA 5F1NB 2ZCLL 4FFZL 5FYJU 1UYWH 4U7MA 2EKSA 3CK0L 5I1CH 2EKJA 5TDOA 2IALB 3K80A 3MODL 5D4QA 4X6CA 4Y19E 1MPAH 1V3LA 1DBBL 3F12A 4LSSL 1CWVA 3EJJX 3H9SB 1K4DA 2OLDA 2R4SL 3Q6GL 2JB6B 3NZ8A 3ESVF 1U8LB 5LBSL 5I6XC 4YC2C 3B3IA 1YEJL 2AV7B 5A2JH 3D6GA 3VFNB 2FEEI 1NBVH 3RUGF 1I8LA 3V5KB 3S37X 3DHMA 2Z8SA 4I2XB 3N1QC 3OB0H 2ZJSL 1S7UA 1JWMA 4V1DD 5GGVL 4PJ5A 3TNMB 4NZDA 3NA9H 3V6OA 5D7JC 1OPGL 2BY3A 4HS8H 4PREA 2GSGA 1OW0C 1TLKA 3K74B 4KHXH 1R5VB 4M7ZB 1Q9WA 4JQIL 4Q6IA 5L2JB 1NL0H 1X5AA 4PJHE 3WIHL 4MWFA 3DMMC 1LE5A 4JANA 3QDJB 4MYWB 4HAGA 5GSVB 2VDKL 2NY1C 1Y0LB 1GVIA 3U9PL 1UVQA 3HPLA 4KAQH 1BFOB 1HYSC 2DBJA 4I0KA 2VAJA 5GISL 3WIFA 1DVFA 3QQ9D 4JY6B 3IJSA 4JDZA 4FN0A 3TBTA 4LCWB 3QCTL 5EN2A 1RZIA 2NNAA 4I3GA 4GRLA 5EU4A 1U58B 4M7JL 4F58H 3CFCH 1CD8A 4YO0B 2E9IA 1MIML 3GK8L 4JG1L 1EO5A 4CJ1A 4NHUB 1UM5L 3CZJA 2QKIA 3O8XC 4LF3A 4QRRA 4PRHA 3DYOA 1JPFA 1TJGL 5DGQA 4XCFL 5E24E 1QR4A 3RWCB 1KOAA 5DHYA 2RHEA 2E5EA 2C5DC 1N7ML 4UTBL 3KPOB 3PIQB 4JRYB 3VFVB 2R0ZL 5I8KL 2IPKA 2ZCHL 1A47A 5CIPA 3QUXC 3PWUA 5M95B 5CINH 1W0WB 1PD6A 3QFJE 3BZDA 4UOW0 4FNLH 2A83A 2ARJQ 3P3YA 2WBJC 4PJDF 5E2WL 1Q9LA 5GGSA 2WIMA 3BDBA 3ELAT 4Y89A 2XZCL 3CH1B 3IGAA 3VI3F 5DD0H 2LQRA 4ODSL 5GRUH 4UQ3B 1FFRA 5EA0H 5ACLA 3P9MA 3PE9A 4FQCH 1NMBL 2VDQH 4IRJB 4E0RB 3WS3A 3FB5A 2UVFA 5B8CA 2MCPH 3VGAC 3T0EB 5I76B 3NGBC 4JO1H 4NO0D 4I3RL 4AK1A 2Q6WB 1TZHB 2JJTA 4WI7A 1NGYA 1GZPB 2R69L 5T1LD 5TDPA 3C09C 5ICZA 5E2TH 1P9MA 2HLFD 3NH7H 4XMKH 1UM6L 4DGIL 3KPSE 1FFNB 4A6YH 1KN2H 5FK9A 1JGLH 1JHLH 4U0RB 1OGTA 5DD5L 5T3XH 1DJSA 1P5UA 1IAKA 2HTLC 4Y8AA 2XZAH 4HUVB 1CDBA 4OCXH 1FJ1A 1T2QL 4P4KB 2FO1A 4OKVB 5F8RC 5F71A 5F9DC 5DZLA 4WI5A 1YEHH 4APQC 2CIIB 4QXTB 1EV2E 1OD9A 3LQAL 3SGDH 1T7XA 3JWOC 4PJ5D 1QHPA 4QOKE 3EYUL 1HIML 3SGJA 4PPTA 2P8MB 4U31A 4DN4H 2W07A 5I8CB 2W65A 1MVFA 1TJHH 1WBXB 3NIGE 1N8ZB 2W0LA 4IOIB 1CQYA 1L7IH 1W8NA 1CFSB 3DO7A 1WBYA 5C6WH 1FFOB 3S9DB 1G7MB 3P30L 4PJGA 4J6RH 3BEWB 4JGMA 4P57B 1U8IA 3BH9A 2P8LA 1EK3A 3GMPA 3W9EB 1K8IB 3BRGC 5C6PB 4LLUA 3EW3B 5CP7A 1KTLA 4PV9A 4OD2A 1DTUA 1L9NA 3JWDL 3H9ZA 1JV5A 1TQCC 4NNXA 4YNYB 2IGFL 1DVFD 2Z4QA 1OSPL 5IOPA 4HGMA 5HYSG 2Z92B 5B3NA 1CK0L 1K4CA 1KJ3L 1QRNA 1RZKH 3J8F7 1RK0A 1AHWA 3LKOA 4LSTH 2A6JA 1EX0A 1BD2D 4R90H 1LDSA 3CFJB 3GHBH 5LGKA 4WNQA 2Q7YA 3L5WB 4LSPH 4P59H 4GRLD 4XNUH 5KSBA 1U8MA 2YK1L 3NCJH 4Z76B 2JE8A 3QDGA 1DFBL 4I0PC 4QRRD 2BSRA 3QHZL 2I60H 4NFCA 3SEPA 3MJ7B 4DVRH 4OTXH 1O5DT 1RULH 3TH4T 4JPVH 4AEIH 3EYOB 3EDFA 1XT5A 2VJXA 1J9CT 1YMMB 1KJMA 4M9OA 3RZCB 1UJTA 4R96B 2HT4C 3OX8A 3EJYC 3MUGB 5KS9A 2AK1H 1NSNH 5KG9B 1I7TA 4MNQD 3HZVA 4XMPH 3TVMB 3OGOE 3PXHA 5AG9A 3LB6D 1JTOA 1WWCA 3SE3C 3L3OA 1AQKL 2Z93B 4YDLB 2EYSB 1TIUA 2OYPA 3S36L 1IEBB 3JUZA 1M6OB 3B6SA 2YPVH 2H2PC 1A7PL 1P4BL 3QJHB 1WIUA 5J12B 3GMOA 1T0MA 3I84A 1Y6MR 4GKOA 1MRCL 1BIIA 3A6BL 3HTLX 3DX8A 4PJFE 1ND0B 5ID0A 4MQ7B 1GGTA 4QGYA 3PWVA 4NQUA 2EEBA 1HILB 2EDHA 3K8MA 4EI5B 4DCQB 1EJOL 3MV9A 4NPYB 3N9GL 3T4AB 1AD0B 5H94B 1A3QA 2XWTA 3O0RH 4NUJB 5HTSA 5TQ0H 5IQ7H 3RNQA 2OK0H 3S35X 1BJ1H 4FXKB 3RZWA 3KJ4B 2EYRB 5DK2B 4K8RH 3PNWA 3CCHA 3R1GL 5D9SB 4XXDA 4YQXL 4KK5C 5DJAA 4BH7B 5DS8A 2ZUWA 3DGGB 1F90L 2DQDL 3ARUA 1S7TB 3BQUC 43CAA 3EOBB 2B4CC 5IVNA 4AH2A 1CGUA 2OCFD 4HKXA 4YX2H 1OL0A 3RI5F 3MRNA 2C4XA 2R9HC 1IC7H 3G5ZA 2DWEA 2Z31D 5ITFB 3PABB 1F3JA 1OTUD 4JY4B 1U93B 1II4E 5JIKA 1QOKA 4Z7VB 3QUMB 5IROC 5D1QA 2LVCA 4ELME 1VDGA 2AI0L 2FX7L 1NQBA 3GM0A 1LMKA 3WIIH 2QR0A 5J6GB 3RY4A 2LABA 3L7EA 4XB7A 5I8EA 4PD4J 4EUPH 4BFBD 3OPZL 3JUYA 1SM3L 4WU7A 3WE6A 2EYTB 5F7NC 1JNNL 1CZ8H 4PRAB 1GGBL 2R0WL 4LLWB 3O4OC 3TH2T 4QWWC 1AXSB 1KBGL 2P49B 1H3UA 1QRND 4AENB 5E2UL 2QLVB 1UWEL 3G9AB 4TVPL 4JFDE 1BFSA 1OP3H 4KQ4H 3LOWA 1S5HA 4NOFA 5DJZB 1G9NL 1BJ1J 2FD6H 2J6EH 4OLUH 1F4XH 5DEGA 3DV6B 3WKML 3U0TB 1PKQE 2AXHA 3HC3L 1XF5B 1YEFL 2DB8A 2DICA 1T0PB 5FIEA 1I7ZA 2KL6A 3IVKB 3TBSA 2EDXA 4KJWC 5DWUL 4XNXH 4M8VA 5FOBB 1IGJA 4RAVB 2F5BL 3IJYA 4X83A 4Y2DB 4N1HB 2AQ3A 3P4NA 3O9WA 3T3PF 3QRGL 4KJPC 4WCYL 3O2VH 1BPVA 4PRIE 2XRAH 3BKJL 5IMLB 2ZUQB 4P23A 3P2TA 3RWGA 1DQJB 5F9OH 2XNAB 5AWNH 1MFAL 4HEME 2NY7H 3EOAA 5L9DL 1QFUH 3FO0L 5DD3H 4AZ8A 2VIRA 4DZ8A 4WEMB 3DX7B 3R06B 1I8KB 3H6JA 3MRFB 4PJXA 1R3HA 3MV11 1OAKH 1UT9A 1MJJB 3JVGA 3QXDA 4YIQA 2YRLA 1NFDE 4NQCD 2BVQB 3OR7A 3MRMA 3CLFL 1A1OB 1V7ML 5DDHB 3ARBC 1AP2A 2OSLB 5I73B 5D71H 4XH2B 1ZEAL 1FL3B 4U1LB 3OXSB 3UZQA 5C9KA 1B6DA 3MV9D 5CJOH 4HG4K 4OZIB 5HI3C 5LG1A 1CTNA 1Z6JT 3G08A 2YPKB 4K3EH 2WQRA 5L8JB 4WW2A 5DQDH 4HIEB 4YDJB 5HHMD 2GAZB 1CR9H 1ZT1A 5EBWB 4ODUB 2J88L 2BVTA 2EDQA 3WFHA 4JKPL 5ID1B 1DEDA 1TZIA 3SDXA 3UO1L 3AS1A 2H3NB 5IMKB 4XX1G 3HHRB 3T0DA 1PGRB 2XG5A 5CILL 4UV7H 3FOLB 3VRLE 4DZBA 3A67L 3ZLQC 3KHQA 2P43B 4IMLB 5GS0H 5HDQL 4ONGL 5TPWL 2ZG1A 2X70A 2WMPA 3JV6B 5HGHB 4GS7B 4S1RH 2HMID 5D1QD 3O6MH 4ENEC 3SDCC 4JM2A 5GIRA 4AJ0A 1AO7A 4YHYB 5ENWB 4QTIL 5FA4A 3QEGL 5J11B 3ZHLA 4TUKH 4OF8A 1QLEH 3AREC 2WP3T 5CBEB 5A3IC 2DIBA 3O6FC 1NCTA 2CGRH 4L3ED 3OR6B 1MF2H 2FNBA 4X0KB 3VD9A 1T5XB 3KLSA 4XPAH 5I19L 3S35L 5FKPB 4ONFL 1J0ZA 3VXQA 4I0CC 5E8OB 3KLAB 4KXZI 1EEZA 2B1AL 3JV5A 2VDPH 1Q72L 2R39A 3SGEI 4LL9A 1GXEA 1HKLL 1FVDA 2DQCH 5EU5B 5FKAB 5ADOL 3A6CH 4G6MH 3RQ3A 3I85A 1A64A 1IAMA 3A6OA 2HVKA 1MCWW 2PO6B 1QZ1A 4KKNA 5DSCB 2C3HA 2XPGB 4OF6A 1ADQA 1A6ZA 2QSQA 3LIZH 1SJXA 1XGYL 2X4RA 2V5MA 4YHIB 1QEWB 4ALAH 2YD8A 1WK0A 5IVZA 1CIDA 1JGDB 1FP5A 4LKCB 4GBXC 3D3VB 4NKDA 2YN5A 4OT1H 2B5IB 2P47B 2FLRT 3GBNH 4S0SD 2WLZA 3VFPB 1P7QA 4G6KL 4ELKB 4P23D 4QT5B 3P73B 3TN0C 4YC2B 1HOCA 4PTTA 5D7LE 2PXYA 3B9KC 2ZG3A 3E6FB 4WHTA 4N5UA 3MLSL 1VB9A 4F7PA 3EYSL 3BE1H 3MTRA 3L3JA 2X4QA 3U7AA 5T33L 3NFNB 1XCTB 2BNUA 4G6FB 4OM0H 4LSUH 3OB0K 2NXZD 5JTWA 3MJ8B 4LIQL 1F6AA 3THML 2OXGA 2SEBB 4MB3A 3DMMB 4KRPC 1HNFA 2DQFB 3KPLA 4IRSA 4R0LB 2YMXL 1E4KA 1A4JA 5KVFH 1RJCA 3WNNA 3ZKSD 3TO4C 1C5DA 4TSAH 1PY9A 2P48B 3CDFA 4DKAA 2F53B 3MXVL 5MEOA 2BOCA 3QUYD 3LEVL 2ILLA 3WD5L 2PN5A 2AXJA 2A74A 1MHCA 2RBLA 3PV6A 3IFOA 2HJKB 4GUPA 5I8OH 1PX4A 1NC2D 4WY7H 2CMRL 2E9JA 2BHYA 3KXFB 5BXFA 4LSDA 1INDL 4LARL 1U91B 3IRPX 1R3KB 5GJSH 1VSCA 1XGQA 2XV6B 4K94L 3SO3C 3FZUD 4H8WL 1UENA 2VERN 1S7RB 2DAVA 3VFSB 3WIHA 2J2ZA 1JE6A 2X2YA 5CEXA 4EEEA 5I1HH 3AY4C 4JZJA 3S34H 3EHBD 1MRFL 2DQUH 2GJZB 2FZ3B 5GGRB 1VA9A 1DQLL 1WCBA 2BJMH 1UWXH 3DETC 3RKPA 4K3DL 4NO3A 3RHWK 4Y4FC 2NY0C 3ARQA 5FYKL 2UWEA 1G9ML 1A22B 5E0QA 3SDDD 1OAUL 3HZYA 2W60A 2VXSL 4NJAH 4S1DC 1AO7D 5IR1A 1I8IB 4YZFF 4MJ6B 2JK5A 2JELH 3HZMB 2DBLL 4LLYB 5D5MA 1MI5E 5TE7L 1RZFH 3GJFH 2WBJB 3U4BH 1IKFH 3LKQA 5CHNB 1DBMH 5D6CA 1AQDB 1OAYL 4NQDE 5IV2A 5JW5A 3D69B 1HHHA 4G80B 2BDNH 3VRJA 2E8ZA 3Q6FA 1XF2A 4R3SB 3HI1A 2R2HB 1KCUL 1MUJA 4X9GA 4C4KT 4K7PH 3ZE2E 2GJ6E 3PWLA 3NGBB 1LO0H 4G9DA 5EU7E 1NFIA 3LDBC 2J8OA 2XTLA 1RURL 3P0VH 4S2SA 1FNAA 1YEDA 4JKKA 3BH8A 3RVXD 1SJVA 4GT7A 3KWWA 3L5IA 4J23A 4NYLB 5CEYA 4DKFL 5L2KE 4D0CB 1I3GL 4UU9A 3LS4L 4FZEH 5HGBB 1H9VA 1VACA 1FAKT 1KCSL 5FOJA 4GQPH 4WV1B 1UH4A 1HHGB 2F58H 2BVOA 2L7JA 3CMOH 1NCDH 1ZLWH 4X7EC 1XF4B 1N2RA 2BOBA 2Y5TA 3BP4A 2YEZA 3X13B 1H5BA 4PJEB 4KMTH 4GG6A 2PXYD 1S9KC 4ODXA 4P2QA 3K4ZA 1FNEB 4M62H 5JO5A 4LVHC 2I9LB 1G6VK 2O5ZL 1OAZH 1I7RA 2A2QT 5K33A 4HIJA 2A9MH 3EO0B 2F74B 1GPOL 4AT6A 4FQJL 3EDEA 1FVCB 3QA3A 2AK4E 1MHHB 3BFOA 1FN4B 5ETUA 1MH5A 1T89C 2I9TA 3T2QA 5A2FA 1N5AB 1J86A 5HYJE 4PGBB 2D31B 5SWZA 2FYYB 5ICXA 5KAQG 3QSKB 4Y5YB 3F7QA 3QJFA 3MYJA 4LLMB 4X7SH 2F8XC 4YWGH 1IQDB 4MSWA 1I3VA 2YN3A 1TQCB 4X6DE 3GSUA 3FT4B 4JQVC 3BDYH 1BZ7A 5BV7H 3G5YA 5BRZA 5BVPH 3F65A 1H15B 2CLZA 3EDKA 1C16B 4R7DB 1GSMA 4R97C 3FT2A 2NY3D 4MXQD 3X12A 5KANI 1J1XL 4JR9L 4XNMA 1UZ8A 1HI6B 3RWFA 2Y6SD 1MLCA 2JIXB 2P5WE 1IGCL 3MFFB 5EOQH 2P1YA 4ZUVB 5EO9B 1QSZA 2CIKA 4UTAL 2GUOB 1QFWL 4EI6A 4X7TA 3DROB 3DXAB 1NKOA 1VFBA 8FABB 5DHVH 2EC8A 2D7OA 2XXMB 4PP1C 3GNMH 5ISZB 4KVCL 1MAKA 1LEKA 3KNBA 1RAMA 1LP9E 4WI4A 4X4ME 4CRPA 4TQEH 2AJVH 4LMQI 4LLQB 1QFHA 5I18L 5FUCE 5C1MB 1EAPA 1EERB 3QPXL 4RFNC 1QO3B 5DXWA 1C5BL 1F4YH 3SGKC 2DQGH 4L3AA 4LPCA 4XBPA 5INDB 1JHTB 2XN9A 1A7OH 1WQVT 1K2DB 3P77B 2VLJE 4NT6B 2AJ3A 5DT1H 2XQBH 5I30H 3TFKD 5C09E 3V4VL 4M1DH 3WUWG 5IHBA 1M4KA 3A0OA 5DURB 4MQSB 5KS9F 3VXTB 3WJLA 1BMGA 2J12B 1CL7L 3VH8B 1T04A 3IKKA 3EDDA 4UV4H 2HLFC 1N6VA 4MCYA 2HT3C 2NXYD 4MA3A 4XVTL 1G7LA 5DJ8B 5I1KL 3O3EA 2VH5H 5HPOA 2R56L 3GSRA 1ZKAA 4Z0BL 5JOEA 5I1JH 4HXAL 2GY5A 3AM8A 3BDXA 3S4SG 4U1GB 4D9LL 1VCAA 4KU1A 1C1EL 1ZT7A 3SE8H 1F58L 4E5XB 1NJ9B 3BOVA 1RIUH 4BZ1L 2D7TL 1P7HL 4JFOA 2PF6A 2FATH 3T65A 3CSYB 4ZTOL 1I8LC 3HE6D 2OR9H 4P5KB 5E1AA 4FQ1H 5CSGA 2YS4A 3V6OC 3DBXA 2ICEA 3O45B 3QWRA 1XIWB 5F96L 3D39B 4Z0XB 5J57B 5DQJA 1G9EA 3QUKA 4U6YA 2G9HB 2DQEH 5ESVB 1U95A 4Q6IC 1ZS8B 1EXUA 1TENA 2A6IA 1MCBA 5SWZD 4Y19B 5SWQA 3NIDF 2IBBA 1YEIH 3QDME 2BXYA 4DWHA 3CXDL 4WVRA 3Q1SL 3QIWA 4NGHL 2WBWB 1F6FB 4XPTH 1HEZB 2EDEA 3TJHC 3ULUC 1EZVY 3O4OB 3C2AL 4H88H 1UEMA 3KPRA 4F3FA 5HYQA 1HWGB 5BRZD 1GIGH 5GGRY 1DVFC 1CXFA 1UWGL 4N5EC 1JGVH 2N4IA 5FO7A 3PP3H 3KS0H 1C5CL 3KPNA 3BMVA 4ODTH 4TUOA 5DMIL 2DI7A 4EIGB 2A0LC 4PGDB 2PW1B 4NRZA 3VXRA 3VD7A 4Z5RB 4O4YL 5HHQB 1ONQB 3QIUA 2OTWA 3L7FA 2J8UB 2V2XB 4ZFFA 5MHSD 1Y6NR 4I9WE 4QXUH 2R29L 3G9VA 5DUBB 4PJHB 2IAND 2IH3A 2W59A 3D25A 5MP6L 4KJYB 1KJ2H 1RK1A 4O5LH 1UA6L 1WEJH 3RDTA 3VW3L 4LHUA 1B4JH 4OGAD 3VWKD 1HYRC 2YUXA 3MBEA 3MLUL 5F8QC 3DX6A 5EZJA 4PB9H 3PXJA 5C08A 1OCWH 4U1NB 3PWNB 3U9UA 3PHQA 3VJ6A 2EZ0D 4YBHA 1YEEH 2NW2A 4RQQA 5FFLA 1NAKH 1NLDL 1DE4B 2MCG1 3RUGE 2FWOA 4KY1L 4LDOB 4MAUL 2XN9D 2MKLC 4NDMA 1G7IA 5C7XL 1PQZB 4DJMA 1NCAL 1BF2A 5E4EC 1YN7A 1HXMB 3QUML 4Y1AE 3ARBB 3HZKB 2VN4A 1TDQA 1WSST 3TA3D 5C0NC 5B8CC 3HUJA 4YFLF 3T1WA 3KS0J 3KPQB 2JJTC 5JOPE 3BXNB 1J8HA 12E8L 3FL7A 4P2RE 5EU3B 1P9MC 1CXLA 1MCOL 1P53A 2JJSA 1RV6X 4DGYL 3QFJB 5HY9A 3HAEA 2YUZA 3PL6B 1U8HA 2BERA 2Y36L 2MPAH 1I1AC 3IU3A 3RVVD 1MFEL 1P6FA 1AGCA 4M8QA 5M94B 1XZ0B 2BRQA 1U8PB 2NLJA 2YC1B 4PTUA 4JB9L 4P2YA 3CIQA 1NH6A 5D7KE 3DUSA 4JO2L 3UMTA 5GHWH 3FTGB 2EE3A 2J7LA 4WJ5A 5D7SH 3SGJC 2V2TB 4AEHH 3QUZD 2H6PA 3ROOB 4N8VA 3VFMA 4XBEH 4YHML 2DYPA 4MCZA 2ATKA 5BJTB 5KAQF 2VABB 2GSIA 3KPSB 2FDBP 4M6NH 2H26B 5ADPL 2P7TB 3AREB 3MRGB 5AYUL 5F6HI 1RUAH 3PQYA 2CK0H 5IQ9B 5MI0C 3CAFA 1DUYA 5E2JA 4Y4HA 2D03H 3FB8A 4H25B 3EFFA 4P2OC 1I3UA 4PRPD 2W38A 5C07A 4PJDE 4KTEH 5C0FA 2NY2D 3MA7A 1UC6A 35C8L 3SKJH 2ADIA 4AM0A 3F7YA 1EZVX 3DYPA 3VI3E 4WFGE 4QOKB 3G5VB 4QHUA 3O11B 1KB9K 1AHWC 4XNZB 1WITA 5B39G 3VXME 3C2SA 1QBLL 4S1QL 4P5TD 1FZOB 4BQBA 3VA6A 3VXRD 5CJ8A 4U1JA 1AD9B 4D9RD 3QG7H 3QIUD 4UI2A 4OLWH 2BXZA 5DRNA 1AGFB 1EMTH 5I1CL 5CZKA 4BZ2H 3GO1H 3BKML 4F9LC 1DQQA 1NCBH 5E8PB 5I17A 1MPAL 2CUIA 2YKLH 3QXVA 3KVQA 5KVEH 3ECBB 3RDTD 3JV0A 5GJTL 4MJIE 1KC5H 3MCLL 25C8H 3GJFB 3VXSD 4MD4A 4AG4L 3DECA 1NBVL 4ZAKB 2HAZA 5E6IA 2HP4A 1LVEA 4NQXA 3NA9L 1G7JB 2WWMD 2VSCA 2XOTA 4M3JA 2P5EA 3JTSB 1Q0XL 4HWZA 4KHXL 1KIQB 2F54A 1XGPB 1RZ8A 1ZHKB 1J18A 4X4ZA 1NL0L 4DFHA 3LMJH 2FLBT 1JTPA 2PW2A 1A0QH 3ZO0A 3CZFB 1NMCB 3IDMA 4X9IA 4FTVD 4LPTA 4OLZL 1F4WL 1T0NA 1VFOA 4KAQL 2VLLA 2Q8BH 1D5BA 3CVHH 4G8IB 3FQXB 2KH2B 3MLVH 3BKYL 1S9YA 4OFKA 3MUHL 1KULA 3GM8A 1TCRA 3OXRA 1E6JH 2E7BA 2LFGA 3SO3B 5TDNA 3OHXA 3QWOA 3SJVB 5EIIB 2OL3H 1GOHA 4KKBC 3LS5H 1I75A 4HFWB 4PJFB 3BHBB 4WTZA 1JGUH 1OOAA 4G8FB 4Q9BA 5IW3A 4NP4H 7CGTA 5CCKH 4KDVA 4IMKA 1G0XA 2O61A 1FV1A 2Q20A 4OZGF 1OQXA 4QO1A 4Y4FB 3QT2A 3UYOD 1EO7A 4F7EA 4PFEA 4WHYH 3EO1B 4KPHH 5ESQA 2DYPD 3PDOA 3CFDA 4JN1L 4PJCE 4OLEA 2WWKO 2HMIC 5D1QC 4JLRA 4WFFE 5HHOA 1W8OA 4Y88A 4FNLL 1AR1C 1U8KB 3DOSA 4LRNH 4X7FC 2CRZA 1GH7A 3PGDA 3FFDB 4JZNB 3TWCH 3W0WE 2H9GB 3D0VB 4HFUH 5BV7B 2RQ8A 4PJ9A 5DD0L 5C07D 3GSWB 2YPLB 3LKPB 4U6HA 3CFKB 4Q9RL 3AB0C 3HLAB 5F1NA 3GJFK 2E7MA 4FQCL 2D0FA 1MNUH 2VDQL 4RWHA 2MCPL 1ULVA 3FO1B 4JO1L 2IALA 5T1KD 4A2LA 1J8KA 4OGYL 4RDQG 5GGUB 4XCEB 3WXWL 1INEH 3VFUB 4FZ8H 1GAFL 3LDBB 2OP4H 4Z8FL 3ARDB 4LBEB 2ATPB 4L4VE 5E2TL 4RBPK 2JB6A 5E94A 1U8LA 1VEMA 4FFWD 2W0PA 1T2JA 3S98A 2AV7A 1WIOA 1Q0YH 1KN2L 4A6YL 2YA1A 3VFNA 3UJIH 3HI5L 4OKDA 4F15C 1C7TA 3V5KA 5T3XL 5D5MF 4PLJD 5EULV 5EFIB 2ED9A 2FX8H 3TNMA 3ZDXF 1GC1H 5FO9B 4AMKH 2XACC 3O9WC 3GJEB 5HHPB 5DD6A 5J0BA 1YEHL 4GW1B 2VKXA 1FL5B 2YWZA 2GFBA 4PY7B 4P23C 4XVJL 1S7SB 1LEGB 1YMHB 4YUEH 4JFDB 1ZLWK 2XKNB 4NM4H 3QDJA 2VDRH 2P5ED 4NM8L 5GSVA 4DN4L 1NCUA 1CI5A 1TJHL 2W92A 2F54D 3PWJB 4H20H 1PKQB 5EO0B 1L7IL 1KTKE 1A6TB 1N6QH 1BFOA 1JK8A 4Q0XH 4J6RL 3JVGC 5IJKA 1I9JH 4JY6A 2WNGA 3MNZB 1Y18B 1K8DB 4I8DA 5MENE 1MCQA 5EUOF 4CDHA 4PRDB 3BPCA 3M8OL 4BA8A 4LCWA 3ZDYF 1FFPB 3ILPB 4AQOA 2DJ4A 4YO0A 4QGTA 4O02H 3HR5A 2DWDB 1T22B 1RZKL 4LSTL 4R90L 1FG9C 3GHBL 4WW2C 4QHNB 4LSPL 3RWCA 3AMLA 3ULSB 1SMAA 4P4RB 3NCJL 3KPOA 3PIQA 4JRYA 1AIFA 4TOYL 5IVXF 3VFVA 5DC0A 2PTVA 3FZUC 4R8WH 1NFDB 7FABH 5A2LH 4ZQKA 4DVRL 4OTXL 1W0WA 4JPVL 4AEIL 1A14L 3UPRB 3F7VB 1T21B 2B20A 4KI5E 5E1HB 2AEPL 3CH1A 3W5MA 4FQIH 2AK1L 5DJ0B 2V17H 1NSNL 2VXTH 3MRPB 3SDYH 4UQ3A 4XMPL 2R2BB 1F3DH 1ZWIA 4JM2C 4PJ8D 5DJ6B 3W11C 4ZFZB 1HH9B 4IRJA 4E0RA 1MSPA 1KXVC 2YPVL 5C0BE 2FGWH 5TH2B 2Q6WA 4GMTH 1TZHA 3KPPB 4DOHB 3KGRA 4DTGH 1GZPA 4JHAL 4X5WB 2HFEB 4M7KH 1KXTB 1TETH 3C5SB 1AY1L 5E9DB 5IT2H 5HDBE 3FQUB 1LILA 3T77B 5I0ZA 1C08B 1RY7B 5FYKD 4O2CB 3UBXA 5GRYA 5IBTH 3KLHC 5KJRH 4P4KA 3H9SD 4OKVA 4D0DA 5GSRB 4B7IA 1MQ8A 3RIAF 3RVXC 3BZ4B 3O0RL 2QQLH 4LPYA 5IQ7L 4HHAA 4QXTA 4ZO8A 4F7CB 5DD1H 1F02I 4ODVH 4Q58C 5E08H 1MCDA 2AW2A 2IEPA 4K8RL 3VMOA 4X6CB 5IVOA 1FSKB 2P8MA 2IPUG 5I8CA 1MCSA 4YGVB 3IF1B 4IOIA 4L8SC 4NN7B 1CFSA 5F6IB 2PTTB 1FFOA 1G7MA 1MCJA 4FXLA 5SV4A 2YHGA 3ZYIA 1S3KH 1F3DJ 1IC7L 2AABH 1K8IA 2PXYC 1XEDA 3QDJD 1S7UB 5CS7A 1FQ9C 4UOJA 4YNYA 3FKUS 3VWJA 5DJYA 4YK4B 1IGTB 4ACPA 3WIIL 2Z92A 4MQXC 4M00A 5ALCL 2CSPA 4P3DB 1ZE3C 4UQ2A 3CFJA 3L5WA 4IRSC 3ZSTA 4Y16D 1OGAE 3U82B 1E4KC 1CZ8L 1PLGH 2VZOA 4Z7UF 1IM9B 5D7LB 1BVLB 1G7HB 3EZJB 2H1PH 2APTA 4KQ4L 3EYOA 4JDZB 1MHEB 1RZJL 3IAQA 1YMMA 1IM3B 4CVWA 3TBTB 3RZCA 2J6EL 2NY3C 5H35B 4R96A 1MFNA 4WTZG 3N06B 4JRYD 1T80A 1HSAA 4H1LA 4HF5H 5KG9A 2Y6SC 3PP3K 2BNQE 2GTWB 3TZVC 1A5FH 4QHKI 1QFWM 1T2XA 4XNXL 4XAWH 2FEDC 2Z93A 1DQMH 4JZJC 2WV3A 2EYSA 4N90D 4Z78B