5DXDA

Crystal structure of putative beta-glucanase (rv0315 ortholog) from mycobacterium abscessus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
233
structure length
233
Chain Sequence
GFVFRDEFDGPAGSAPDGSKWVAAKFRERIKNPVFWDRPENMGEYRDSRTNIFLDGNSNLVIRATKEGNKYFSGKLHGTFRGGMGHTFEARIKFNCLTDGCWPAWWLLNDNPERGGEIDMAEWYGNRDWPSGTTVHARLDGTSFETLPVPIDSNWHTWRCTWTEAGLYFWMDYHDGMEPYLTVDANSLDDWPFNDPGYTLQPMLNLAVAGSGGGDPAGGSYPAEMLVDYVRVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative beta-glucanase
publication title Crystal structure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abcesus
rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
total genus 56
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5dxdA00
1Q8VA 2OW4A 1CN1A 4FPKA 2JE7A 3B3QE 3FLPA 3AXDA 3T2TA 3RMYA 4P9WA 1UKGA 2C9AA 2D44A 2DVDA 1GKBA 3ILRA 4LBQD 3UJOA 1Q8PA 2NM1A 1ULCA 1SLCA 2D7FA 2R1DA 3O0WA 1V6KA 4YZ2A 1XQNA 4YZ1A 1GSLA 1W6MA 3OJBA 3M3OA 1SACA 2CY6A 4Y20B 3AZXA 1YI7A 1S1AA 3OPZA 2ZMLA 1S0DA 5HCBA 1ZA4A 1GV9A 4DPNA 1CVNA 1W6NB 2WSVA 2R0FA 3A4UA 1PZ9A 1GZWB 1R1ZA 1GICA 4OZXA 4R9DA 2D3SA 2R0HA 1AVBA 4GWNA 4UW3A 1WUVA 3POYA 2ZGPA 3MW2A 1VALA 4ISRA 1F5FA 1WLCA 2ZHNA 1JOJA 1UZZA 2EAKA 1G9CA 2YY1A 2DURA 1V00A 2ZHKA 3N36A 2Q5TA 4CZSA 2EF6A 2JDZA 4DQAA 4ITCA 3M2MA 2GNMA 2PHXA 2YZ4A 3WCSA 3WDTA 3IMNA 2CTVA 1QDCA 2WT2A 1JHNA 3OGGA 2DVAA 5GLVA 3A0NA 5H9PA 4Y20A 2B7YA 3AXEA 2DVBA 4FOQA 1IS3A 1KDKA 4FOWA 3WG4A 1LECA 3PJQA 3T1LA 2FHRA 2GN7A 4Q1RA 4XIOA 3A0KA 5JMCA 4FP3A 1GZWA 4YGCA 2Z42A 1G9FA 1N1VA 2A3WA 4R9AA 4NO4A 1SCRA 5JDBA 2VW1A 1QOOA 2EALA 5F5QA 3V64A 4ZKTB 3NV1A 4PQ9A 3VKNA 5KXBA 3ZSJA 1H30A 4RA0A 3WG3A 1MVEA 3ZXJA 1LOCA 1DFQA 1LENA 4FQ4A 4GKYA 4LBQB 3AK0A 3WG1A 1ULDA 3TB0A 1OFSA 3O12A 4FPOB 4AGGA 2LALA 1SBEA 1MS4A 2YXSA 1UAIA 4R9BA 1D0HA 2P3JA 3WHTA 2OUJA 1LHNA 1MVQA 3RQ0A 1GNZA 1VLNA 2VY0A 4FPHA 5T5PA 5EYYA 1QNWA 1JYIA 1GYKA 3N7LA 1G9DA 3M3EA 1MACA 1IS6A 3FLTA 4WVWA 3V0AB 5F9TA 4BQ1A 2A6YA 2E7TA 2GNTA 1WW4A 3BODA 4AVSA 1JYCA 3W58A 4DRVA 1LHUA 1CR7A 3MPPG 2A3XA 3AJYA 5T5LA 1CJPA 5IT6A 4HL0A 1QMJA 3MEPA 1MS8A 1AX0A 2WT0A 1URXA 1LGCA 2DYCA 3AX4A 2I2SA 2KM2A 2ZGUA 3GNEA 4LBNA 4YGEA 3R4UA 2ZMKA 4ISQA 1LESA 5E89A 1AXYA 4I30A 4XJ9A 3WOGA 5IK5A 1EPWA 2VU9A 4K1ZA 2NP0A 4P9YA 2ZKNA 1FNZA 1VIWB 1N3PA 1YO8A 3VKLA 4DRRA 1V6OA 1PZ8A 1W6OA 3W59A 4PBOA 3OY8B 1UZYA 3DUIA 3IN9A 4HANA 4L8QA 4ATFA 2D3RA 1B09A 1F9KA 4XHBA 1QDOA 1N1TA 5IUQA 4DS0A 2EXJA 1LOBA 4Q8KA 1W0PA 1W6MB 2PELA 5CA6A 3CNAA 4FPLA 2HYKA 2AREA 4AVVA 1IS4A 4Y1ZA 2CYFA 3IKWA 3PVEA 4XJAA 1CONA 3O5SA 2ZACA 4YM2A 2GMPA 1WW7A 1MS3A 2JECA 4Y26A 3UK9A 3R4SA 5GZGA 3I4IA 1CQ9A 3BTAA 1FATA 4YM1A 3D4KA 1WCSA 5T52A 3VKFC 1KJLA 1I3HA 3NV4A 3FLRA 4UW6A 3UJQA 1LOAA 5IK8A 3ZYPA 1AX2A 3R05A 4MYEA 4XTMA 3OY8A 2ZGLA 1QF3A 2ZHLA 3PVOA 1X50A 4FPEA 4XIKA 1V6MA 3IM0A 4H55A 5EWSA 4ZXKA 3AYEA 4WVVA 1AXZA 2ARBA 1OQ1A 5CAZA 4FOVA 4XJUA 2DUQA 1KITA 2WJSA 4TYSA 2D43A 4YGDA 4XMAA 2R49A 4LBOA 2A6VA 2SLIA 3LSEA 1JXNA 1A78A 1PZ7A 3HN1A 3WG2A 3LCPA 1WLWA 2VH9A 1ZM1A 2GMEA 1LOFC 5DUUA 3ZSLA 3WVJA 1DQ0A 1DQ2A 5DZGA 3QLQA 3AJZA 2OUHA 1CPNA 4C1XA 3AYDA 1S0CA 4XILA 3JU9A 1LOEA 3AP5A 4JC1A 1ULEA 1UMZA 5GZDA 1AXKA 1ENRA 1FAYA 2D6OX 2W08A 3NWKA 4GXLA 2CWSA 3OYWB 4XXAA 5E8AA 5T5JA 5GLWA 3SLIA 2P2KA 1MS5A 1N3OA 1DYKA 1SLLA 3ENRA 4KBBA 3TAYA 1KRIA 4YW5A 4Q2FA 2D3PA 3AZZA 2NMOA 1NXD1 1LU1A 2PHRA 1CPMA 2JKBA 2E7QA 2ENRA 1IOAA 2W39A 5DXDA 3OBRA 3KQRA 5GZEA 1I1EA 2DUPA 1IKQA 1LEDA 1KQRA 2EIGA 4Y1YA 1DQ4A 3VKMA 1O4ZA 1LJ7A 1A3KA 3SH4A 3ZXFA 2V73A 2ZGSA 1S0GA 3N7MA 1AJKA 5JVVA 1Z0HA 2W52A 1U0AA 3JUUA 2TEPA 4P9XA 5KXDA 1MS0A 4YM3A 1G86A 1ENSA 2NYYA 3OYWA 4FPCA 2DU0A 1GNHA 5JOYA 1MZ6A 1SLAA 1V6JA 5FREA 1V6LA 3D6EA 1TEIA 2AENA 4LBKA 3SISA 4SLIA 3FUQA 5DUXA 2NMNA 4GKXA 2DU1A 1DHKB 3BIWE 4YG6A 1IS5A 3AP9A 2BQPA 3M3QA 4P14A 4U36A 1YIFA 3ZXKA 1HQWA 1LOFA 1V6NA 2GNDA 1W6OB 2ZGMA 3HMYA 1FX5A 1UN1A 4K20A 1WBLA 2YV8A 1LTEA 4M3CF 1BJQA 1WD4A 1DLLA 4YG0A 3ZSMA 1AX1A 2DUOA 1CIWA 4Y22B 1JUIA 3FUOA 2XB6C 3I8TA 4UW5A 4XJWA 4K1YA 1RINA 4CTEA 3WNXA 2PHUA 2ZABA 2LTNA 4Y24A 1Y7BA 2ZZJA 2EXKA 4Q26A 2D6LX 4CRQA 4FPYA 1G9AA 1IKPA 1O4YA 4K21A 2DV9A 5GZFA 2AR6A 2ZGNA 2VW2A 4AGVA 3LSDA 5E88A 2GN3A 5SV8A 5IK4A 1BZWA 5DUWA 3ZVXA 3INAA 4FPJA 2E6VA 5JOZA 4M3CE 1C4RA 1N1SA 1GLHA 2CL2A 1G9BA 2DTYA 2WQZC 4NOTA 4Y22A 1DQ5A 1D2SA 1JN2P 3ZYRA 4F83A 1LHOA 4XBNA 1QKQA 4JCKA 2DTWA 1SBFA 2WLQA 4XYXA 5IK7A 5BYNA 2FMDA 1QGLA 3KM5A 4M01A 1BQPA 4Y1UA 2A75A 3ILFA 1G8WA 3AZVA 5DZFA 2P37A 3SH3A 5KXEA 1SLBA 2GDFA 4YG3A 4YFWA 2AUYA 2YMZA 5JOWA 4PCRA 4R9CA 1S0BA 2NN8A 3RSJA 3WCRA 2UWBA 3AP7A 4JRAA 1MR5A 2YROA 1NLSA 3BOPA 3NV3A 4FQZA 4Q27A 5HCFA 3SITA 4YM0A 1S0JA 3MW4A 3OBTA 3WV6A 4YW3A 5H9RA 1WW5A 1C1LA 4FPGA 1WD3A 3ZSKA 1MS9A 3N35A 1LODA 2WT1A 2ZGKA 4XTPA 5H9SA 1RIRA 2DVFA 1GZCA 1HKDA 4Q8LA 1LHVA 4FOYA 2VXRA 1WLDA 1QOTA 5GJ6A 2D6PA 2VW0A 2WKKA 4XZPA 3AP4A 3AP6A 2SBAA 4Y1XA 1Q8QA 2GALA 3RS6A 2XG3A 1APNA 2WSUA 4M3CB 1RITA 1AJOA 1MZ5A 2UWCA 3AFKA 4YZ5A 3VUOA 3M1HA 1DQ1A 1UPSA 3ILNA 5FRAA 1FV2A 2PHFA 3SH5A 2V5YA 3UL2A 1Q8OA 4PBPA 2PHWA 1BXHA 4AWDA 2A6WA 2JE9A 2A71A 3AZWA 1UX6A 1DGLA 2AYHA 5GZCA 1H9PA 1SLTA 3WLUA 5KXCA 4XDQA 3WDYA 1S0EA 2JJ6A 1A8DA 2H0BA 5GLTA 3FFZA 1J1TA 1AF9A 1SFYA 2A3YA 1QU0A 2CWMA 3NV2A 1ULGA 4YZ4A 5EXOA 1S0IA 2P3IA 3IPVB 3APBA 1UL9A 2D6MA 4M3CA 1LGNA 1YRZA 2A5ZA 4AVTA 3WDWA 4XJZA 2C5DA 2ZGQA 3ATGA 2DVGA 4XBQA 1V6IA 3VKOA 3WDVA 3DGTA 3VV1A 2D6NA 3T1MA 2AGSA 4TZDA 4M00A 1W6QB 1CESA 2OVUA 1F31A 1Q8SA 1Z78A 4XOGA 4XHXA 1S0FA 1LOGA 1AZDA 3QCWA 4FP2A 1W6PB 2ZMNA 3Q9OA 1VAVA 5GM0A 1GBGA 1W6NA 1QNYA 2R16A 1HQLA 3WUCA 5GALA 5T54A 2EXIA 3B00A 2AH2A 3RMXA 1N47A 5EYXA 3IPVA 4LBLA 3ZXLA 5GLUA 3C2UA 4BM8A 4BOWA 4XE9A 3B9CA 4C1WA 3V0BB 1JW6A 1BKZA 2CNAA 2RHPA 3WDUA 3AYCA 3AYAA 4AYUA 3N7JA 5AVAA 4Q1PA 3WDXA 3M3CA 1ONAA 1OKQA 1SCSA 4WV8A 2EXHA 4GA9A 4ASMB 1W6QA 1WBFA 2ZGTA 4IQPA 5LK5A 4BLJA 3GALA 4XBLA 3POSA 3ZXEA 2P34A 3RRDA 1W6PA 3USUB 4XMIA 1YYNA 4YZ3A 5T5OA 5L73A 3WZ1A 1G7YA 1LU2A 2W68A 2GNBA 3U4XA 5DG2A 4GALA 1FYUA 2ES3A 1C57A 3PVNA 4DFSA 3ZPYA 5CBLA 1LGBA 2ZGOA 4YLZA 3FBYA 2UWAA 1GANA 3PMEA 1HDKA 4BLIA 2D6KA 3B01A 1KJRA 3V0BA 4UW4A 4XJ8A 1N3QA 2R1BA 2A70A 3WHUA 3WUDA 3N3HA 4D69A 1GZ9A 4YW1A 4WZFA 3H0OA 4Y1VA 4LBQA 1BYHA 2ZHMA 1SLIA 4YW2A 2E53A 4YW4A 4ATEA 2A7AA 1QOSA 2E51A 2P3KA 4YGBA 4YFZA 4RL7A 4LBJA 4U2AA 5JLVA 1HLCA 4Z8BA 3B69A 3D5OA 1DQ6A 1W0OA 2UU8A 2UURA 3USUA 2ERFA 1C1FA 1SBDA 1ENQA 1DBNA 4PF5A 4AGRA 1KDMA 1MS1A 1LCLA 2A6ZA 5CNAA 4BMEA 5HCAA 5DG1A 1ULFA 3O0XA 3V65A 1FV3A 5DUVA 1VAMA 1DZQA 1LEMA 2VUAA 3POWA 2ZGRA 3AZYA 3ASIA 2WNEA 4FPFA 5GLZA 1H9WA 5H9QA 2ZAAA 2ZBJA 3V0AA 1DIWA 5T50A 3L2YA 1JBCA 5CB7A 4BPZA 5JOXA 1DYPA 2A6XA 4W65A 3HR9A 1FNYA 2JD4A 2NZ9A 4GWMA 3RG0A 3SNMA 5DZEA 4BMBA 5T55A 1LULA 2ARXA 1LHWA 4XXPA 1YXWA 2ZA9A 4FVVA 4LBMA 1N1YA 3N7KA 2GMMA 1WW6A 2DWRA 1Q56A 3O0VA 2PHTA 2G4IA 3MW3A
chains in the Genus database with same CATH superfamily
4WM7A 2OW4A 3ZR5A 5F32A 3RNSA 5C9AA 4CDUC 2DCZA 2C9AA 2DVDA 3O7OA 4IE6A 1XE7A 4P5HA 1SLCA 2R1DA 2OX0A 2VNOA 5IVFA 1H4HA 3KGZA 4IERA 2Y8KA 3WW2A 4YZ2A 1OOPC 4LULA 5A70A 2JG9B 5M0TA 1JZ7A 2R041 1GP6A 1H2MA 4NVPA 3AZXA 5L36A 3WW3A 5F3IA 4W6XA 3JZVA 4JX0A 5HCBA 4ARXA 4FBFA 1AYN2 3HNYM 5AFEA 1RUG2 1W6NB 3DPRC 5LA9A 3I2OA 1AR82 4BZ4A 3A4UA 2JDMA 1UOJA 4OHVA 1PHMA 1PO13 2DCKA 2R0HA 4QDQA 3HQUA 4OUMA 3KVBA 1OH4A 3S6PA 1WLCA 2ZHNA 1JOJA 3WX5A 4I3GA 4CXWA 4AHZA 1Y3TA 3VBOB 3N36A 3MYXA 3M2MA 3I2FA 4GZ9A 1D4VB 3H3ZA 3LIGA 4JHTA 5J1XA 5T3NA 3O1OA 2CTVA 3VL9A 2G1MA 3I3BA 5GLVA 4Y20A 1W8WA 3CBNA 1OQEA 2WFF3 3PJQA 2Q1MA 3TEWA 1QIQA 3T0DA 4ZHNA 3L9JT 1OQDA 5IWFA 5HXMA 5JMCA 2GU9A 2XVKA 3VBUA 4XUTA 3DPRB 1N1VA 2LW8A 1JHJA 5J3UA 2MEV2 1UOBA 4D94A 4LOSA 3V64A 4ZKTB 2HWE1 3LWCA 2PLV2 1K12A 5JIAA 4CP9B 3VKNA 4LHLA 5KXBA 2J22A 3ZXJA 3ZPOA 1LOCA 3ZOIA 1LENA 4GKYA 3SCGA 3VB9A 2XJVA 5FY7A 1DCSA 1TMF3 3WG1A 5A3WA 4EZHA 3TYJA 4B29A 5F1RA 2VCBA 4HSLA 4AQSA 4AGGA 2UYAA 4N9HA 2YXSA 1GQPA 4NIDA 1PM7A 4R9BA 2P3JA 3UYJA 4HPKA 1CX1A 2RDNA 4R4ZA 1PK6A 1NLQA 5T5PA 5DMYA 2G19A 4AFCA 1SQ4A 1GYKA 3NO8A 1TME2 4JDMA 3BTXA 1NCQA 1SFPA 2CGNA 1BK1A 3PVBB 5JXHA 5L9RA 1W2NA 1RJ7A 2GNTA 3BODA 4QPGC 1PO23 1OLMA 3W58A 1QQP2 4XW3A 4DRVA 1LHUA 5EJZB 1CR7A 5FYVA 5AC92 1GUIA 4JQRA 3V56A 5FZ3A 2XKOA 3MEPA 2W91A 3AX4A 3VD9A 3BPZA 3GNEA 1UQXA 4YGEA 5BNPC 1OF4A 2XHNA 2RM21 2E32A 3ACGA 3AL6A 1DU3D 2EAAA 3IAPA 4I30A 4IV1B 5E89A 5A32B 4BXSV 2JIJA 5HCHA 4AFAA 5KBFA 1S55A 2ZKNA 5FYZA 4LA3A 1N3PA 4DRRA 1XSRA 1V6OA 1I5PA 4XZUG 3S30A 4L8QA 1Y9GA 1QJEA 5FZIA 3CEWA 2FDGA 4XHBA 2Q1FA 3G7DA 1N1TA 4QX2A 4DMIA 4ZPIA 5FYTA 1IPKA 3PU3A 3EBRA 4AEMA 2P4EA 4NHLA 2XR4A 1PIV2 1TZOA 3IKWA 3MI8A 5FWJA 1JI6A 3B5LB 3PVEA 4QPGB 5JSOA 3O5SA 4YM2A 2WZR2 3KMHA 2E33A 4H7LA 4H7MA 2BDRA 3BTAA 1FATA 4KWKA 4YM1A 5A7NA 5CISA 1VBE3 5EP9A 3MGUA 3VKFC 1I3HA 3NV4A 2J1UA 2TNFA 4UW6A 5IVCA 2RS52 1AX2A 1RMU1 1XU1A 2WNVA 1XNCA 2Q30A 4HN1A 1DYOA 4QX0A 5EWSA 4XIKA 1X50A 1XNBA 1K42A 1G6NA 3IM0A 4ZXKA 2JDHA 3HT1A 4J25A 1GFF2 1AXZA 3GM8A 1SG3A 1RVF3 3NQHA 3TNQA 3J7HA 3MV11 2RS11 2D43A 4G9SB 4I3PA 4L0PA 3WNLA 4CE8A 4LBOA 1CGPA 4LHNA 2A6VA 2SLIA 1A78A 2VZSA 3WF3A 5FOJB 5LWBA 4LQRA 3ZSLA 1ZM1A 2W3JA 2VOWA 3WVJA 4RHV3 4BB3A 1YQ8A 2JKXA 2X29A 4IUGA 2WN2A 2JG8A 4DIQA 3BYWA 3AYDA 1NA1A 4XILA 1X8MA 2HWC2 2P5BA 3FFQA 3POGA 4JC1A 3WEZA 1ULEA 1J83A 3UETA 1POV0 4XXAA 2D6OX 2W08A 2FCVA 2CWSA 3OYWB 5E8AA 4XFHA 3K3OA 5GLWA 4QKDA 3WP3A 4BIOA 3TAYA 4O61A 3ZYFA 4AK3A 1YJKA 2NMOA 1NXD1 1X9TA 2FCUA 2PHRA 3E6DA 1CPMA 3J7LA 4Q4W3 2BVVA 1ACCA 3OG2A 1IOAA 2E9QA 4UF0A 3VL8A 3OBRA 4AI0A 3OPTA 4NJ4A 3P3NA 3U37A 5GZEA 5LBCA 1I1EA 1IKQA 3MDPA 1A8MA 2ILMA 3PURA 2EIGA 4Y1YA 1DQ4A 3VKMA 3ZXFA 3SH4A 4A7KA 4AI9A 4BISA 3C7OA 1U0AA 1DGRA 2ADDA 4EWAA 1BEV2 1XYOA 1MS0A 3PNAA 4NRMA 2PN5A 4P9XA 2NYYA 1WA6X 1S2EA 4MSVA 2PAMA 1GNHA 4JZRA 1CAVB 2XWBB 5A3TA 4E2QA 1SLAA 2V72A 3OGRA 5ACA3 1TEIA 2AENA 1VMJA 5C5TA 4GH4C 3FWEA 2WS91 5L7OB 2ZEXA 1VJ2A 4SLIA 3VZOA 3RI9A 3E1F1 1X8EA 2VZ1A 4GKXA 2DU1A 2IXIA 3I3QA 1DHKB 1PVXA 1EV12 1RUD3 2RG4A 3BIWE 4YG6A 3ZYJB 2RS51 3WXPA 3RGBA 3ZXKA 4CEYB 4HVQA 5CYYA 2Z69A 3OEBA 2ZGMA 3HMYA 3I3EA 3C7EA 1OT5A 2HWB1 5FWEA 1LTEA 4AVCA 3ROUA 4M3CF 3GJBA 1CZVA 4A45A 1BJQA 1VB4A 4GB32 2GC1A 4S2GA 3U1XA 1VRH2 4NAMA 4AHWA 3NNJA 1D7PM 1UY1A 5ISLA 1JH5A 2ZEYA 1X33A 1HN1A 4CUAA 1UWWA 1ZVFA 2LTNA 4QM9A 3KHCA 1DZRA 2ZZJA 4Q26A 3VBRA 4RQPA 2JIGA 3IB3A 3VDAA 5FUPA 1KD7A 1VBB2 3OEAA 1PM4A 3IDEA 2DV9A 4QQOA 2AR6A 1LAJA 4R52A 2HWC1 4N90A 1KS5A 2GN3A 3K2OA 4W4ZA 5E88A 5IK4A 1XOYA 3POEA 5JR7B 5FCCA 1UXZA 2ZJCA 1KS4A 3U0ZA 1GLHA 4Q4X2 4AVBA 5FZMA 3OUHA 4AHYA 2DTYA 1CZSA 2WQZC 4Y22A 3C8XA 1DQ5A 1AR62 1JN2P 1C8M3 1PVC3 3ZYRA 4Q4Y3 1JZ3A 4XYXA 4JCKA 2DTWA 1SBFA 3JD72 1VPHA 3W20A 4D0QA 1O6UA 2FMDA 3ZFEC 3B94A 1BQPA 4M01A 1OSGA 2DFCA 3LA2A 1HRI1 3AZVA 2W47A 1QEXA 1GQHA 1F4AA 4QMAA 3VBFA 5BNNA 1BMV2 4YG3A 1RUF3 5CU1A 4YFWA 5JOWA 4PCRA 4BYYA 3RJ2X 4D7YA 4BXFA 4SBVA 3NRUA 1NY72 3ELNA 3WP6A 3VD7A 1MR5A 3BOPA 1NLSA 4Q27A 4FQZA 2HJIA 4HONA 4YW3A 2W0XA 3W5MA 1WW5A 2RMU3 1EPZA 1HB1A 3ETQA 1JZ8A 2QQKA 5A1AA 2VQAA 3PUIA 2WT1A 2ZGKA 4NRQA 1CAWA 4JHZA 1LHVA 1QXJA 4GJZA 5FO9B 1QOTA 3Q8AA 1H2NA 4K7JA 2WL1A 2X05A 2R7EB 4A41A 2WKKA 4XZPA 1ZNPA 1UOFA 2Y60A 5CKQA 1YJLA 3IWZA 4COYA 4QB2A 2BNMA 1ND3A 4CCEA 3S57A 2QQNA 1MZ5A 2RJLA 2J42A 5SV5A 4AI3A 1CAXB 4YZ5A 1XNDA 5A7WA 1DQ1A 1W28A 3K48A 2OPWA 4LEJA 5A3NA 5JI7A 2PHFA 4HKLA 4A6SA 1Q8OA 2PFWA 1VRH1 1X36A 2QUOA 4J1XA 4XUPA 1OUXA 1BXHA 2Z79A 3NNFA 3Q8CA 4AWDA 2HBTA 3E97A 4CUGA 4N8MA 1BVP1 1H9PA 4XUOA 5KXCA 4XDQA 3JCIA 1JZ2A 4BJ0A 2W87A 2ORZA 3POFA 5FZ8A 4K8RB 4EV0A 3O1PA 3NKGA 1VBB1 1WZXA 1AYM2 4LR4A 1XNKA 2P3IA 1UL9A 4R8HA 2F4PA 1BK0A 3TWIA 3ETPA 3LA7A 4CCMA 4CDXA 3NNLA 4RS5B 3WDVA 3DGTA 4ASKA 4IEZA 5FMBA 3RWKX 1AR61 4Q29A 4TZDA 3WW1A 4RYDA 2YHJA 1Z78A 2VPVA 4JGYB 5A7SA 2CDPA 2LROA 5BNQA 4FP2A 1OVSA 1W6PB 4PDWA 2PAKA 2W1QA 4CPBA 4OHZA 3WQ0A 1BCXA 1AR92 2WNUA 5FZCA 5T54A 5FZ0A 2QQOA 3B00A 4MZUA 3LPGA 5KR7A 1H1MA 3PLQA 1HXS2 3SHRA 2VJXA 5IJRA 3B9CA 4GAZA 2VCAA 5BNOA 1TVGA 1RB8G 2QBXA 1HIXA 1JODA 3B9IA 4Q1PA 3WDXA 2K9ZA 2JDAA 3HVDA 2CGOA 1OKQA 1R091 1W2UA 1W99A 1TG7A 4LKDA 4ARYA 2BPA2 2EXHA 3A21A 3BN6A 1W9WA 1W6QA 2V09A 2YYOA 2BFUL 2W94A 2ZGTA 2J1VA 3HAGA 4WM7C 1SFNA 3B02A 4NPMA 4PF1A 3POIA 1RUE3 5C9AC 1G7YA 4BIFA 1ULPA 4LT5A 5DG2A 1FYUA 2ES3A 1ZRDA 5J09A 1LGBA 3C7FA 3KV5A 2Q4SA 3BB6A 4DUVA 5J96B 3CO2A 3FBYA 1R083 1HDKA 2JDYA 4FTEA 3OD4A 4Q4V3 4QGLA 4UW4A 4XJ8A 2YGMA 3NVCA 3EHKA 4AI2A 4B4RA 1N3QA 2RR11 2A70A 3DCQA 2VZ3A 4D69A 1JZ4A 3FX3A 5C3RA 4L11A 3ZKYA 4E27A 3NJVA 1YQCA 3TEZA 1AL22 1STMA 1W03A 1BYHA 2A7AA 5JLVA 2CU5A 3THCA 5LY2A 2RS32 4QU2A 1FOD3 4Z8BA 2Y26A 2UURA 3FBMA 2UU8A 2V4AA 1AYM1 2YU2A 2LUWA 1J1LA 3H1WA 3PIJA 1H6YA 4KGQA 4LO5B 4PF5A 4AGRA 4IEYA 1LCLA 5FMOL 4CP2A 1IZ3A 3E6BA 4HG6B 4UXAA 4WM8A 3T0BA 5CNAA 4ASLA 2IUWA 4OUEA 2FMYA 4BQWA 3T08A 5FXVA 5CG8A 1EAH1 3V65A 2VNRA 1FV3A 5F3CA 4MO3M 1LEMA 2ZGRA 3ASIA 4XUQA 3EB7A 1DIWA 5A3LA 1JBCA 2TBVA 1DYPA 2HEYF 1DF0A 1FNYA 1XBFA 2VOXA 3SNMA 3SQOA 4EE2A 4D6RA 3W9AA 4QHOA 3VBUC 1LHWA 1QJY3 4Z82A 3HWJA 4XXPA 1V9U1 2Y6KA 2KR2A 1N1YA 3LDRA 1W3XA 3N7KA 3O0VA 4FXGB 4KU8A 5FTTC 2Q8OA 3ZIWA 3MW3A 5F3EA 4EN0A 5FO8B 2GC3A 1RUI1 4JKKA 1HXS1 4QHZA 4FPKA 3B3QE 3FLPA 5ERLA 3AXDA 3RMYA 4P9WA 3ILRA 3SMHA 4ES8A 3HT2A 2NM1A 1P8JA 2Y64A 1WKYA 2D7FA 1CAUA 1O4TA 5LATA 1GSLA 1W6MA 3BTYA 3M3OA 3WP5A 3GBWA 1SACA 4Y20B 5FR3A 3CKHA 2B42B 4RSUA 4DINB 5GKAC 3OPZA 2ARAA 1U5IA 1OLME 4AI1A 1RUJ1 1ZA4A 1GV9A 4BQYA 2VTXA 1UYYA 2VL4A 2B9UA 4L99A 1PK6C 2R043 1PZ9A 1KFUL 4UOJA 3WQ7A 1R1ZA 3VBUB 4GWNA 1ULOA 1F4HA 1NCQC 4HMZA 4A7ZA 2ZGPA 1F5FA 1UZWA 4IEOA 4AQTA 2YY1A 1NZIA 4CXYA 2ZHKA 1E5IA 4IV3A 3DF0A 4ITCA 1ZZ9A 4LOTA 4C0HA 3HIFA 5EHDA 5J7MA 1NCRB 3AKQA 5H9PA 4AXOA 2IFRA 2RS31 2WIIB 5FPUA 1UU5A 1W8HA 2VTXJ 1IS3A 1ZYBA 2VO5A 3AXEA 1ASJ2 4Y4YA 3WG4A 5B2GB 3T2PA 2B46X 4LO4B 2GN7A 4NIGA 4Q1RA 4HPKB 4UFIA 4CXXA 1MQTB 2ORXA 1GZWA 4FP3A 2Z42A 4MXWB 4OQ9A 2FDIA 4R9AA 1PK6B 1Z7S2 5JDBA 2ZZQA 1COV1 3T2OA 3ZYGA 2EALA 4LKSA 5C8WA 4QD2A 3NV1A 3ABZA 1FPN2 3POJA 1GQGA 1H30A 3WG3A 2B45X 4IGOA 2HWE3 3VBSA 3E6CC 3NJYA 1DFQA 5FYHA 2OXBA 4LBQB 4TLFA 1Y9MA 4KG0A 1H1AA 3TN91 3VBHA 3KS7A 4COUA 4HVRA 3TB0A 5IVEA 3AMNA 3KB5A 1S2KA 4AL9A 1W9FA 3HPNA 3ALQA 4CDWA 2WNVC 4YW7A 5I0DA 4BQ5A 3S7EA 1D2QA 3MIDA 3M7AA 4Q0QA 5CFCA 2B4KA 4N43A 2IXJA 1OLRA 1QNWA 1JYIA 4GWJA 3G6JB 1VBA2 1IS6A 2B9VA 3SEEA 4QX3A 3V0AB 4BQ1A 3ES1A 3K3NA 4HOOA 2R071 4JTNA 5LBFA 4AVSA 1IPJA 1UY3A 4P00B 4KL1A 3MPPG 3NNGA 5FXWA 2A3XA 1L7RA 1HW5A 2MNGA 3AJYA 3NJXA 5T5LA 5IT6A 1MS8A 2WT0A 1XE8A 5HV4A 2DYCA 3WP4A 2ARCA 2JG8C 2I2SA 1QJX2 1A6CA 2ZGUA 3OGVA 2XQXA 4QHBA 4LBNA 1NA1C 5DABA 5FY0A 2ZMKA 2I45A 4CDQB 1MEC2 3A22A 5I0TA 3ZYHA 1D4M1 3AKPA 1O3RA 1AR83 3GHNA 4NWVA 2RV9A 1W8TA 2J1RA 3Q8BA 2LS6A 1X9PA 3O1TA 1NOVA 4AW7A 2RM23 5D8AA 2GZWA 4N53A 1W6OA 4PBOA 2I74A 1UW8A 2JENA 1B09A 3EO6A 4HXCA 2WBKA 3ZM8A 4DS0A 2BRTA 2XLFA 5F6KA 1X82A 1QJU1 2IVJA 2BV4A 3EYPA 4IEVA 4PHZA 4FPLA 5FP3A 2HYKA 2WO2A 4XFCA 2BBAA 1ODNA 3WNMA 4AVVA 4A3ZA 3PTYA 4MG2A 2JDKA 4DXRA 1OXCA 1CONA 3U4SA 4LUMA 4JDNA 1OA2A 2D97A 3UK9A 4QX1A 4B7KA 4TXWA 4YVSA 1VBC2 1ZZ8A 2UY8A 3LFMA 4K6BA 1B35A 5IK8A 3I49A 3IDCB 4ZU7A 1FPN1 2ZEZA 3ACFA 2Y0IA 1GOGA 2XDVA 4MYEA 4XTMA 3BU0A 2VBPA 3J9SA 5FK8A 1GNYA 1RMU3 1GMMA 2PLV3 2P17A 1JYVA 4QT6A 4EN6B 1AR72 3PUQA 4O9GA 2EVXA 5CAZA 4RGKA 5C8CA 1IQAA 3WW4A 1J59A 4TYSA 4OZOA 4ZU5A 4PIXA 2R062 4XMAA 4B8EA 1UYPA 2D93A 4UF0B 4O9EA 3O1MA 3LCPA 1NYWA 2VH9A 2GMEA 2RS13 3CDZB 5FZ4A 4WVZA 1DQ0A 3J8F2 3LDKA 3VZNA 1NKGA 1ZZCA 3ZDVA 1Q43A 3AVRA 3I7DA 4EN9B 3QLQA 2H6CA 2WLPA 1XXNA 3LD8A 2HEWF 2X10A 4PI2A 1W39A 3AP5A 5C71A 4NUBA 2HKXA 5GZDA 2XH6A 1AXKA 1E5RA 3ZLIA 4DEQA 3K75B 4CUCA 5FZFA 5LBEA 5T5JA 3JBG2 4CDUB 1BLZA 1YNAA 3DV8A 2P2KA 3H1MA 1DYKA 4KBBA 2BEOA 2AACA 2D3PA 3AZZA 3VBRC 5IAXA 4RQPC 5FQ0B 3S0MA 1MZFA 5A1FA 1OOPB 1BBT1 5DXDA 4KWJA 5FP8A 3DYOA 5HXVA 3WF4A 4XABA 1RHI1 1OA4A 3RZJA 1LJ7A 4FFFA 4CVUA 2ZGSA 2Y0OA 2WAOA 3IIAA 2NPIA 3OUJA 4IEQA 1VB2A 2QTWB 2TEPA 5FYMA 1PGL2 1VBD2 3R6SA 1G86A 4JVAA 4DY5A 2XMLA 2LM3A 2X09A 2B39A 2WNOA 2VMCA 4I01A 1K5MA 1WCUA 1MZ6A 5JOYA 3N9NA 5IVJA 1GP5A 1PMHX 4LBKA 4K8FA 3VBFC 2E26A 3SISA 1UY2A 5BNNC 4CCOA 3BCWA 3VBRB 3VLBB 3MZHA 4RQPB 5DUXA 4Q0VA 4CP0A 2D5HA 3ACLA 2WS93 3CZJA 4BA6A 2XJSA 3MO4A 4FCAA 1DG6A 1IPSA 3HD8B 1IS5A 2WA4A 2BQPA 3M3QA 4W6YA 4W8JA 2HWF2 1R64A 1LOFA 2E7AA 4IDZA 5C7GA 1RYYA 2B8MA 2GNDA 5LRSA 3O1SA 4K20A 1WBLA 1XNAA 4Q0UA 4B4QA 2RS53 1W9TA 3Q8FA 2PXJA 1HRV2 3KCXA 1WD4A 1YCIA 2DUOA 4Y22B 2DFBA 2HWB3 1JUIA 1OBNA 4WZCA 4E4SA 1GOFA 2QDNA 2WWUA 3BGAA 3CZUA 4K1YA 5FPAA 5A6XA 1ND2A 3GCXA 1RINA 2BWCA 4CTEA 1JZ6A 4RD7A 3WT3A 3WNXA 2WABA 1AYN1 1PO12 4XCAA 1RUG1 4IE5A 4GD4A 1ND3C 3J8F1 1AR81 3ZX7A 5ABJA 5JZGA 3VBFB 3TRSB 1F5JA 5E6HA 3LSDA 3BU7A 3WNPA 5JAXA 3I2GA 1BZWA 5DUWA 2VQTA 2R6QA 3DYPA 2W5FA 5A1LA 2HWC3 4FI9A 1EYBA 5FYYA 2J1AA 2WO7A 2VM9A 4Q0SA 3HQXA 3ME2A 4MGTA 1IQDC 2WFF2 4MGIE 1L3JA 4F83A 4FAGA 2WLQA 3ZKUA 4QPIA 2W2IA 4LK6A 3ACHA 4NPRA 2OT7A 2BFUS 4XFFA 2A75A 3ILFA 1G8WA 4UFKA 4RFT0 4KWLA 2QZ3A 2WO3A 1H2KA 4CCJA 4P9GA 3NW4A 1ND3B 4CDXC 1HRI3 1H8TA 2AUYA 2MEV1 2ZS6B 1WLTA 3WF1A 5BNPB 1RTVA 3BI3A 4XDPA 2PLV1 3LEIA 1W04A 2NN8A 3RSJA 3WCRA 1PGL1 1HV0A 1VBD1 2WWSA 2N7GA 2YROA 5HCFA 1TMF2 4YM0A 3OOXA 4PDWC 2IFWA 5H9RA 3FMGA 1C1LA 2WNUC 5A7QA 5JSRA 2PTMA 1MS9A 3N35A 1LODA 2WO1A 4XTPA 4AAXA 2DVFA 1GZCA 1WLDA 4AEDA 4BQ2A 5GJ6A 2W1SA 3IAQA 2D6PA 5F5CA 3ZN4A 5BNOC 2PQQA 4LITA 2SBAA 4YARA 1Q8QA 1QHDA 1SEFA 4IL7A 2GALA 5C6CA 1UPIA 2HWF1 2XG3A 2BNNA 4D6QA 4XUNA 1APNA 4XF4A 1RITA 4IE4A 1W9YA 2XJRA 2HWD2 3K4AA 2ZX2A 3AFKA 3FHQA 1SPPA 1UU6A 3M1HA 3OBAA 1TME1 1HRV1 2XGXA 1UYXA 1FV2A 2OKXA 3UL2A 1UZ0A 3DN7A 3AKTA 5IATA 1QQP1 4GB33 3AZWA 1T6GC 3C3VA 4NN0A 5AC91 1VRH3 3PUSA 4LO8A 4PDWB 4IGQA 3SXWA 2JJ6A 2H0BA 2WNUB 3L2HA 4J1WA 4A42A 1O3TA 2QFEA 4PI0A 1WMXA 2A3YA 3QACA 2CWMA 1QU0A 4QAWA 1ULGA 4YZ4A 4YYOA 4AFDA 1S0IA 2ZAHA 3K77A 4QPYA 5FZ6A 3LQCA 5A3UA 2XPJA 5BNOB 1VBB3 4IGPA 1ZRRA 4M3CA 2OQ7A 3DXUA 2BOJA 1XB9A 3I54A 1UY0A 3KWVA 3LOIA 4KWUA 5FPVA 3WDWA 3JB4C 3PIGA 2C5DA 4AVTA 2RE9A 1J3PA 3ATGA 2V5DA 4XBQA 5BY5A 2MPFA 5FBJA 2D6NA 1U5ZA 2WQ4A 4M00A 1W6QB 1OHFA 1ZBA2 3AVSA 4PIZA 4AZZA 4XOGA 2JG9A 5K9YA 1PIV1 1NX9A 3LDBA 1SZBA 1AR63 4CSWA 3QCWA 3MHZA 2W9XA 1UIJA 4CU7A 5LASA 5GM0A 1HX6A 3A23A 1GBGA 1W6NA 2R16A 4WM8C 4MGSA 2WZR1 3JD73 3WUCA 4LA2A 1O3QA 1QY4A 2A1XA 2XOMA 2AH2A 2OZJA 2Y6LA 4XDOA 3K4ZA 3MIFA 3DKWA 5EYXA 4XF3A 1H2LA 2OPKA 2AEZA 3DL3A 3ZXLA 4BM8A 1CJDA 1VMHA 2VGDA 4XE9A 1BKZA 4B7EA 4CPBD 5IFTA 4AYUA 1RC6A 1YUDA 1RVF2 3N7JA 4TSVA 4UAPA 3VBOA 4A4AA 1Q5OA 2CAVA 4EQVA 3OUIA 5LEKA 1ONAA 1SCSA 1XRUA 3VHPA 4GA9A 4OHXA 1RXFA 4DO0A 1R093 5LK5A 3Q8EA 1UU4A 3KGLA 4OI4A 1J58A 4MLOA 4RHV2 3VZMA 4FTBA 3CF6E 2CHHA 4GQ7A 2VZRA 4YWAA 3RRDA 2Q1ZB 4LK7A 4MH0E 4Y5Z0 1W8UA 2W68A 1Y4WA 2ZTNA 1UD1A 3CLPA 3P1IA 4QGNA 4QQPA 4X6RB 5FY4A 4GH4B 3U4XA 1C57A 2C1FA 1W2TA 2AC1A 4WM8B 3PVNA 4URAA 3CQOA 2HWD1 3CMGA 4YLZA 2UWAA 1GANA 3HQRA 4GIQA 4XURA 4BLIA 3UNPA 2D6KA 3V0BA 4CP9A 2AEYA 5CG9A 3MUZ1 4LXLA 4BQXA 4QGMA 4IETA 3WHUA 4IXLA 3N3HA 2XXZA 3JXSA 5FYIA 4YW1A 2BP6A 4HKOA 4MHRA 3KT7A 1OD5A 4ET7A 2RR13 2ZHMA 1JMUB 4LIVA 4X8PA 1RJ8A 1SLIA 2RDSA 4YGBA 3I2KA 5BUVA 4U2AA 1R1A2 1M06G 3D5OA 2IWGB 3USUA 3PL0A 4AQ6A 1C1FA 1U5YA 3U78A 2LRPA 1KDMA 4IV3C 4EYUA 1WA4A 1AYM3 3H8XA 2CSGA 2A6ZA 2GP3A 2Z4FA 4M4RA 3I2JA 5DG1A 1ULFA 1WMFA 2XBO2 4V2VA 1BEV1 2UY9A 4FFHA 2JB8A 2VUAA 3AZYA 5FUIA 1H9WA 2A73B 2ZAAA 2ZBJA 1ZBA1 1EAH3 4TLGA 5ACA2 4BPZA 3HR9A 2PHLA 2NZ9A 3RG0A 5DZEA 2QQPA 2GP5A 4QKBA 3GZAA 4QXHA 3TBDA 5EFUA 3KV6A 5FMDA 3RYRA 4I2OA 2IZWA 3OD0A 5EJ1B 1POV1 2Z2SB 2Q8CA 4GMP1 5A33B 1RUD2 4FVVA 3I3MA 4IV1A 1WCKA 4EN8B 2FDFA 1EV11 1Q8VA 3ZFEB 1V9U3 1W06A 2JE7A 2QQWA 3VBSC 5KC6A 2JDUA 3JB8A 4RGAA 2D40A 1WCQA 1RUI3 3VBHC 1HXS3 4LBQD 3UJOA 1ULCA 2JEMA 1UCXA 3O0WA 4GB31 1V6KA 4YZ1A 3OJBA 1T2XA 5KHGA 4NMIA 1S4CA 2CY6A 3U75A 4CDWC 2XKPA 4OFGA 3TEXA 1YI7A 3BALA 2ZMLA 4P5YA 2WUHA 3FN9A 1CVNA 4UFMA 5CFCC 4N43C 5JWPA 2WSVA 2ADEA 1BVVA 1GZWB 1GICA 3R0RA 1RUJ3 2D3SA 3CU7A 4PQQA 4R9DA 4UW3A 1WUVA 1VALA 2Y6JA 3NMBA 4ISRA 3VZLA 1PMIA 3P6BA 1UZZA 1G9CA 4QU1A 4QB1A 3ZSEA 2DURA 4Z2AA 2BZDA 1V00A 4CZSA 3C7GA 2Q5TA 4C91A 1LRHA 4DZGA 5FJKA 2JDZA 3VBSB 1C8M2 1GWLA 1PVC2 2GNMA 2PHXA 2YZ4A 4Q4X1 3VBHB 1ZRIA 3IMNA 1EP0A 3WCSA 3GHMA 2WT2A 1QDCA 3OGGA 5BXXA 1O7FA 3HNBM 4O7XA 1DLCA 3JD71 2DVBA 4FOQA 1KDKA 1R1A1 4FOWA 1LECA 3URFA 1LNSA 4CDWB 5D8AC 2VUDA 4I02A 4IESA 4N53C 2RS33 4P08A 1UO9A 4ZZ5A 1F35A 2VCCA 5AVPA 5CFCB 1G9FA 3IMMA 2A3WA 4N43B 3MFCA 3OSDA 2KXLA 1SCRA 1BMV1 2VW1A 3U07A 1QOOA 2XUMA 2ZX1A 2VMEA 4UWDA 4BDVB 1AUYA 1MPXA 1YI9A 2XBO1 1NY71 3LPFA 2PQSA 3IDBB 4YPJA 3ZR6A 3KQ4B 2RMU2 2ET7A 1ZZBA 3ZSJA 1COV3 1O5LA 4RA0A 1REEA 4Z1VA 3VDBA 3BKZA 3ZMOA 1AL0G 4UFJA 4FQ4A 3USSA 3AK0A 3D8CA 1H4GA 2BGOA 3RPQA 4BH9A 3OCPA 1VMFA 1PX4A 1ULDA 2JXAA 4YVSC 3UGFA 5I91A 1JUHA 3TN93 1B35C 2ZXQA 1GP4A 1SBEA 1MS4A 4KH9A 4L92A 1MZEA 3UV9A 5A6YA 1D0HA 4JQTA 4NIHA 2Y6HA 1L7LA 1LHNA 1LKNA 5E16A 4RR3A 4N53B 3RQ0A 1GNZA 5FXZA 1OC1A 4FPHA 1REFA 5EYYA 4YW6A 3S5AA 5C8CC 4JDOA 5IHRA 3MPBA 1G9DA 1MACA 4D8MA 5C3OA 5JUVA 3FLTA 3VHOA 4E8DA 2L9LA 1UMIA 4NHYA 2A6YA 3SCFA 5F9TA 4NIIA 3KCYA 4DNYA 2E7TA 1WW4A 1F8VA 2GC0A 2DBIA 1VP6A 1CAVA 3R4DB 2B5HA 2R073 1QMJA 1AX0A 4QXKA 3THTA 1URXA 5FY9A 4MVTA 5L7OA 2KM2A 4EZ4A 1RUH2 2GSYA 3PTRB 1FMD2 2D5FA 3R4UA 4YVSB 4ISQA 4QKFA 4BU2A 2HEVF 1LESA 4XJ9A 4QQLA 5E1RA 4XVHA 2VU9A 1ZBE2 4WM7B 1B35B 5EV7A 1KGYA 3S7IA 2NP0A 4CEYA 1FNZA 1VIWB 1YO8A 5DDJ2 4BK4A 3FC0A 4D6SA 1PZ8A 5C9AB 5DAXA 1D4M3 3IN9A 4JV4A 2JD9A 4V1PA 5CIRA 5FZLA 2D3RA 4ATFA 2F17A 3MF9A 1QDOA 5FZGA 2VVFA 4Q8KA 2OA2A 3HOBA 2JE8A 2YC4A 3QH6A 4E9KA 5C8CB 4UYBA 2PELA 1D0GA 2YG0A 1NT0A 3CNAA 2AREA 2IC1A 4E2GA 3D3AA 4PLOA 1RGSA 3GBGA 4LO6B 1JU3A 1IS4A 4JKMA 1NXMA 1QJU3 2CYFA 3N9LA 4Y1ZA 1GOHA 4XQ4A 4HK9A 4XJAA 1K5JA 2ZACA 1QH7A 2WN3A 1AR91 5FPZA 2JECA 4Y26A 3NKTA 4I0AA 4EWDA 3R4SA 4HETA 5GZGA 3H42B 5K7PA 1CQ9A 2BW8A 4RFRB 2WYSA 1JYWA 3NSTA 1J3QA 4RGGA 4BQ3A 2MHFA 3B93A 5FY1A 1KJLA 5T52A 2JB4A 3FLRA 4LTAA 5FZAA 1LOAA 2WZ8A 3K4DA 3R05A 4D7TA 1XYNA 3OY8A 4HBNA 1C5HA 1K5MC 2ZGLA 4FPEA 1V6MA 2VBBA 1FPN3 3AYEA 1QXPA 2ARBA 2BWAA 2QJVA 1OQ1A 4FOVA 4XJUA 1AHSA 2DUQA 2Q0AA 1KITA 2WJSA 2VZOA 2VZVA 4Y3OA 5FY5A 2R49A 1JZ5A 3VN4A 4DXSA 3LSEA 4FSJA 1PZ7A 3HN1A 4NHKA 1WLWA 3DEMA 4QPWA 1LOFC 3LEMA 3RFRA 1DQ2A 3N9PA 5DZGA 4D7SA 1R082 3K51A 3AJZA 5JSPA 2OUHA 2VZTA 5BPXA 5K4LA 3ZN6A 4A44A 1OMIA 5K0UA 4C1XA 2DBNA 4CCLA 4UT5A 1US3A 2PHDA 1NQJA 1UMZA 3NWKA 2ETEA 4GXLA 4AE2A 5CZKA 4S2FA 1ND2C 5JI9A 5DPNA 3H8UA 4HVOA 1MS5A 1N3OA 5FZ7A 5CADA 1YFWA 1KRIA 5CKMA 1AL21 1K5MB 4YW5A 4Q2FA 2C4XA 2BYVE 5ABJC 5KWRA 2IXLA 5LRRA 1LU1A 1HB3A 2Q8EA 4COZA 5CEHA 5JZGC 2E7QA 1KEXA 1RUH1 1OH3A 1W90A 2ENRA 2W39A 3UKTA 3AM2A 3KQRA 2DUPA 2XVLA 1LEDA 1ZBE1 3C7HA 1KQRA 1BBT3 1O4ZA 3EMRA 1A3KA 3B7MA 4QKNA 2V73A 5DDJ1 1RHI3 4L2NA 4UFLA 4Y5SA 1CAXA 3LF7A 5LK7B 1OF3A 3JUUA 3ECQA 1C3HA 1NCQB 1JYNA 4YM3A 3RWNA 4FPCA 4OULA 4QPIC 2ID4A 3PU8A 2DU0A 2VZPA 4WVMA 1QJY2 5B4XA 2E31A 5FREA 1V6JA 3T4VA 1V6LA 3D6EA 1FT9A 1NQDA 3NAPA 1NG0A 1W9SA 2HH9A 2GH8A 3ES4A 4HLTA 5ABJB 2IXHA 1H8TC 3FUQA 1FXZA 5JZGB 3WY6A 4AHXA 4CCKA 2GAUA 1YQ6A 2K0GA 5FO7B 2VUCA 1YIPA 3OTFA 3GYDA 1OPOA 5HV0A 3QBQA 3LGRA 4JTOA 4P14A 2DCYA 4U36A 1YIFA 4AOCA 1HQWA 3TEYA 4NAOA 1UN1A 4A2UA 1OPMA 1W05A 3EXUA 1PNGA 2YV8A 4BQ4A 2R32A 4QX8A 1QJFA 5C4WA 4RS5A 1OD3A 3ZSMA 4YG0A 3AMQA 4ZY9A 1VE0A 3FUOA 3A7QA 2XB6C 4XC9A 4QQ2A 4XJWA 4AEDC 5CVRA 4JGYA 1UZVA 4AFMA 1ZZ7A 2PA7A 3VZJA 5A6ZA 2ZABA 1RL3A 4Y24A 4A6OA 1DZTA 2VMFA 2EXKA 2QQJA 2D6LX 4CRQA 4CUBA 2DCJA 4FPYA 1AYN3 1O4YA 3SKJE 1RUG3 3J4UH 3J8F3 3RI8A 2VMDA 5LCWL 3WR0A 4AGVA 5JPMB 4LMFA 5SV8A 5JXJA 3VDDA 2WNVB 1Q3EA 1J84A 3RVHA 5FZOA 2E6VA 2WR9A 4M3CE 3WNOA 1C4RA 4KBZA 2YBPA 4ZONA 1N1SA 2VZUA 3GZEA 4HKWA 2G9GA 4MUVA 3HNMA 4P9IA 2VOKA 4NOTA 2VXJA 1GR3A 2CV6A 1ODMA 5FLIA 5FYCA 2QQVA 4GJYA 5I0SA 4XBNA 1QKQA 4FFGA 5FZBA 4AEDB 3BUCA 1ASJ1 1QGLA 4NR1A 5A3MA 4Y1UA 4ES9A 4NWWA 4COWA 5HI0A 2OYZA 5DZFA 1CZTA 5LZ6A 3SH3A 1SLBA 1Z7S1 2JG8B 4IEUA 3O14A 5IFPA 3WQ1A 1NA1B 3CJIA 1SPPB 2HWE2 4PT6A 2JG9C 2MEV3 3AP7A 2CGPA 3I59A 5FKCA 4XQWA 1I9RA 2PAEA 1S0JA 1L7QA 3MW4A 5FIXA 1VBD3 1GWKA 1LR5A 4FPGA 1WD3A 2BU9A 3CL1A 3ZSKA 2P6CA 5FJHA 1UKRA 5H9SA 3KT4A 1RIRA 4Q8LA 1SDDB 4YVWA 2XLAA 4Z92B 1O59A 2VCMA 5ANNA 3VHRA 2VW0A 3AP4A 3AP6A 4Y1XA 3ZYBA 3VBOC 4UI9L 4E4ZA 3PJYA 5F3GA 2QVSB 2WSUA 4M3CB 4E4HA 1DDLA 2BVBA 4W50A 3VUOA 1UPSA 2HWF3 5EQUA 1VBA1 3MIGA 2QDRA 3PUAA 1WMEA 2ZKLA 4XEZA 1WGPA 2P6HA 2PHWA 1TME3 4BWOA 1HRV3 1OA3A 2A6WA 3H3LA 3LEKA 3F95A 2A71A 3D0SA 3GGLA 4MGKE 1DGLA 5F6LB 2AYHA 1SMVA 5GZCA 1SLTA 3WLUA 5K8SA 1I5ZA 2V4VA 2Y38A 3HEIA 4NHXA 1QQP3 1S0EA 1A8DA 1QJX1 5GLTA 4B1LA 1H6XA 1NAEA 4O65A 5AC93 1RUOA 2HYXA 1QH6A 2RM22 1MEC1 2X5IA 1CX4A 3KV4A 1IG3A 3NV2A 4NHMA 3RJRA 4CCCA 5JCTA 3AC0A 5CKNA 3APBA 4C0BA 2C24A 2D6MA 4KU7A 4UBHA 2AZ5A 1YRZA 5G05L 2FCTA 2A5ZA 3RZKA 4XJZA 1NE6A 1U5XA 2DVGA 1ENXA 1RUC2 4NE9A 1V6IA 4UFHA 3VKOA 3VV1A 2RVAA 3T1MA 5C3QA 2VTFA 5JR2A 2ZPXA 2OVUA 5LEJA 1F31A 1Q8SA 4XHXA 3HBZA 3KZ4C 3CHXA 3FE5A 3POBA 4FTSA 1UY4A 1S0FA 3EJKA 3MICA 4BCUA 1LOGA 1AZDA 2YDEA 4P9JA 1VAVA 4P9LA 1NLRA 1PIV3 4A3XA 1HQLA 4XFIA 4CEWA 4EJRA 2EXIA 4MXVA 4AQ2A 3THDA 1VBC1 5D21A 3MF6A 5JXGA 2WZR3 3IPVA 2JX9A 4LBLA 5DAPA 4BOWA 2P1BA 4NRPA 3V0BB 1RMU2 2RHPA 4NROA 4XETA 3WDUA 3AYCA 2QQUA 4N7IA 4QWNA 5A3OA 1TNRA 3WNKA 1JS9A 5CFDA 3O1RA 3FJSA 3T09A 1AR71 4LIUA 4AG4A 1NCRA 2RS12 2R061 4IV1C 4BLJA 1QXRA 1V70A 2WFPA 3USUB 1A34A 2W92A 5L73A 4HSJA 1LU2A 4HZFA 2GNBA 1H8VA 2FDHA 1E5HA 3ST7A 1MQTA 2OIIA 2P3YA 4MXWA 4PLNA 5BNNB 5D2AA 4DFSA 1BHGA 3AB0A 3ZPYA 2ZGOA 5JPNB 3PMEA 3KF3A 3SC7X 2J1EA 3RZGA 4CA9A 4KI5M 2HWD3 2R1BA 3JBG1 2J1TA 4OUSA 1GZ9A 4WZFA 3ZFGA 2Z5WA 3ZN5A 4LBQA 3KF5A 2HBUA 2PMWB 5LW9A 1CD3G 4ATEA 1QOSA 2E51A 3E5UA 1CAWB 3IBMA 4NPLA 2QNKA 3WQBA 1HLCA 2BTVC 4UBGA 4A7YA 1S2BA 5J98B 2QQMA 3B69A 4OVEA 1UXXX 1W0OA 4XCBA 4JGZA 5FPXA 2ERFA 3CIHA 3RZLA 2XJQA 2F4LA 1MS1A 2VE1A 4KG8A 4KNCA 3PMSA 4BMEA 5HCAA 3H50A 5A7WB 5LA1A 3O1UA 1RUC1 1VAMA 1DZQA 2D98A 5KHHA 3T2TA 4XF1A 2YB7A 2WNEA 3ZFFA 3V0AA 4LLOA 5FOBB 4X8NA 3P3PA 3L2YA 4HFSA 1E57A 5JOXA 1CIYA 1BEV3 1KXGA 1CWPA 4W65A 2JD4A 2YBSA 3IDAA 4S2HA 1UNBA 3D0JA 1ZBA3 1LULA 4XAAA 2BUKA 2WS92 5ANQA 4XF9A 4CP1A 1YXWA 4I0WB 2CDOA 4CDQA 2GMMA 1WW6A 2DWRA 3KVAA 4C1WA 1POV3 1XE0A 1JU4A 3QOPA 4GMP3 3DKQA 1PGW2 3E5QA 1CN1A 2EA7A 3UKVA 3TOJA 1UKGA 2D44A 4ZZ8A 1EV13 1GKBA 1IG0A 2HWB2 2VUJA 1Q8PA 4XQDA 3ZYIB 4JAAA 2WDBA 2O0OA 1HB2A 4CDXB 1OVPA 4CYDA 4MOAA 1PO22 1HV1A 4HN0A 5FMOS 5I0RA 1XYPA 3IIIA 4WBBA 1XQNA 4URTA 1XSQA 4G3YC 3J26N 4N9IA 5F39A 3BTZA 1S1AA 1EUUA 1S0DA 1PO11 2VVEA 4DPNA 5FP7A 4RR3C 2R0FA 4RN5A 1YFXA 4OZXA 1AVBA 1JTZX 1WCDJ 3ZXDA 3POYA 2XWJB 3MW2A 3WSOA 4TWTA 1JYTA 2EAKA 2RJ2A 4Q0PA 2Q8DA 4GMP0 3GBFA 5F5AA 4M0NA 2EF6A 4IE7A 5FZ1A 4DQAA 3I3DA 3WDTA 3J7NA 5L7OC 1QJZA 5A80A 3LEGA 3RZHA 3BOWA 1JHNA 2DVAA 2WFF1 1DGWX 5BV6A 3A0NA 2BGPA 4Q5OA 3D82A 4Q4X3 1ST8A 1UMHA 2B7YA 3M3IA 2VBDA 2VVDA 4QX5A 3MIHA 5EPAA 5LA0A 4CEYC 3T1LA 1VBE2 2FHRA 2ATFA 4DXZA 1HRI2 4ZS3A 5FLJA 4XIOA 3A0KA 4N7UA 3KD4A 4FXKB 5C3PA 1R1A3 1ZREA 4OHWA 2ET1A 3OPWA 4YGCA 4RR3B 3VHNA 1XPWA 4NO4A 4E2SA 5FFOC 5F5QA 4GWIA 1ZRFA 4PQ9A 3FHIB 4OCTA 3OBZA 1MVEA 4H14A 4AR2A 1TMF1 2XBO3 4CDUA 3NL1A 4QM8A 2ZX4A 3LE0A 2X53S 3S5QA 4HT1T 5FQ0A 1SHWB 5HBAA 4CU9A 2H6BA 4AEKA 3LA3A 1DP0A 4DOUA 1OOPA 3H7YA 1OFSA 2NLRA 3O12A 4FPOB 5C3SA 1YFUA 2LALA 3KCCA 1XC6A 5FY8A 4OLLA 1UAIA 3U10A 4AVAA 1YHFA 2WINB 3M4FA 3WHTA 1PGW1 2OUJA 4KGGA 4YRDA 1MVQA 4ZS2A 3RZZA 4DUXA 3I2DA 3DPRA 4PJYA 2XVGA 3GXUA 1VLNA 1TQ5A 2VY0A 3I97A 5APAA 3LIHA 3GDBA 4IW3A 3LKJA 2VQ0A 3N7LA 3M3EA 1PO21 5DAVA 5FK7A 3GJAA 2BERA 4WVWA 2XHKA 5A7PA 4I09A 4Q4W2 1JYCA 4K9SA 2FBEA 1J3RA 1CJPA 1W3VA 4HL0A 5F5IA 1K45A 3GF6A 2FDKA 1LGCA 4D3WA 4YNIA 3VD3A 5K0UC 1O91A 4Y33A 5FYSA 1XNTA 1IGOA 1AXYA 5A7OA 2C0ZA 4META 3WOGA 4E4DX 1EPWA 5IK5A 3OGJA 4K1ZA 3SCHA 4OHYA 3BPSA 4P9YA 3KV9A 2KD7A 4OMCA 3VKLA 1OFNA 2VMIA 4F8AA 5LA2A 3W59A 3OY8B 1UZYA 3DUIA 1HJFA 1O8PA 4FO9A 4HANA 3O1VA 1F9KA 4XF0A 2G9FA 4LJHA 5IUQA 1POQA 3WD5A 3E5XA 1CAUB 2EXJA 1LOBA 2IVIB 3I2HA 5FV3A 1W0PA 4Z07A 1W6MB 5EIYB 5HPOA 3AMMA 5IVVA 3MFAA 3BIEA 2XL7A 4IE0A 3H9AA 3MLKA 1JOPA 1YC61 4CU8A 1ZRCA 2VD7A 1VBE1 2GMPA 2QCSB 1WW7A 5DAQA 1MS3A 3KHBA 1W8OA 1VRBA 3I4IA 3AKRA 3ZN6B 2HLEA 5A32A 1RUNA 4I0BA 2VNGA 3D4KA 1AR93 1WCSA 4KMQA 4PIYA 2FQPA 2VAUA 3UJQA 5K0UB 2YPDA 4S2DA 4EROA 3ZYPA 1YWKA 5I8SA 4IEWA 1HN0A 1Y9QA 1RVF1 4IV3B 1QF3A 2ZHLA 3PVOA 4XFBA 5F37A 4H55A 3W21A 1YFYA 1V0AA 4WVVA 1R092 3AFGA 3NAPC 4AEJA 3OGSA 2C9KA 2ZCWA 5C70A 2VC9A 1I6XA 2WWJA 4YGDA 5FP9A 4RHV1 4MGZE 4OI2A 2OS2A 1PGSA 1JXNA 1H1IA 3WINE 4QPGA 3WG2A 5DUUA 3U14A 5G04L 2C6SA 3VD5A 3WF2A 3IZOA 5IYYA 5L9VA 1CPNA 1GWMA 4RS5C 5C4WC 3H8OA 1ZX5A 4F7ZA 1S0CA 4DY3A 4W6WA 3JU9A 4M0HA 1LOEA 3RYPA 5BNPA 5C5UA 3ZDSA 4IEPA 1C5IA 2BJSA 2O8QA 4JGYC 1ENRA 1FAYA 2QKDA 4MADA 4QDSA 2RR12 5IW0A 3ZMNA 3BVCA 4ZXEA 3TNPB 2YBKA 5DAWA 3SLIA 3W5NA 3ENRA 1SLLA 4Q4W1 4WVMB 4Q4Y2 4XFGA 2RDQA 2E63A 1YLLA 2VMGA 3M8LA 3NAPB 4P02B 3DXTA 4MGQA 4MHUA 2EIDA 5FAXA 2JKBA 2IXCA 1AL23 2W95A 2Y33A 2YC0A 3GCWA 3MLJA 5FZHA 3VDDC 1RUF2 5A6QA 1KFXL 1RUH3 1T6BX 1FMD3 3T3YA 2WQ8A 2YC2A 5F7UA 2W46A 4NIAA 1S0GA 3N7MA 1AJKA 2XONA 3UGHA 5JVVA 1Z0HA 1ZBE3 1YEWA 2BGCA 4OQ8A 2W52A 4OI0A 1EAH2 3WNNA 3ZXGA 2EIBA 5C4WB 5DDJ3 5KXDA 3AKSA 1ENSA 3OYWA 3UKNA 5DN2A 5ACA1 3OB8A 5FYBA 3LB9A 3ACIA 4IEXA 2QQIA 2YUEA 3OF1A 2XQRA 3HBKA 4FT8A 1W2OA 1VR3A 2BNOA 2QZ2A 3UESA 1RUD1 3GZTB 3M70A 3KSCA 5KHKA 1V9U2 3CJIC 2ZEWA 1WMDA 1NUKA 2NMNA 5I93A 1RXGA 3N9OA 4TTGA 5D1IA 1XJAA 1RUI2 3AP9A 3PDQA 3VDDB 5IVYA 5D8AB 1V6NA 2GC2A 1W6OB 5LY1A 1FX5A 5FZOB 2JDPA 2VG9A 2Y6GA 3H3UA 3ZIXA 3ZXAC 1F15A 1DLLA 3HJRA 1AX1A 1OKOA 1CIWA 2W1WA 4QXCA 3PUHA 4YVWC 3I8TA 4UW5A 3RYKA 3UT0A 3VDCA 1E5SA 5JIUA 4YSFA 3T30A 2PHUA 2XUEA 3N9QA 3RDIA 1RUJ2 1Y7BA 1M4WA 4OI1A 2VNVA 1EY2A 3F2ZA 4DEVA 2BBVA 1DGRN 1JYXA 2XJUA 1G9AA 1IKPA 4K21A 2K46A 5GZFA 3CJIB 2ZGNA 2VW2A 4Z2WA 1NE4A 2VZQA 4KQ7A 5FZDA 3INAA 3ZVXA 2FZ2A 5AFBA 1OLQA 3DYMA 4FPJA 3I59B 1UF2C 3MV01 5DQ0A 5JOZA 2YU1A 1C8M1 1TNFA 4CCNA 1PVC1 2Y6FA 4Q4Y1 2CL2A 1G9BA 4QB6A 2ZOEB 1D2SA 5I8TA 5JMOA 2PYTA 2X5IC 3FHAA 3MUY1 1LHOA 2DF7A 2RDRA 3QH7A 4YVWB 5FKBA 4AI8A 3IT8A 5IVBA 5IK7A 5BYNA 4XPVA 1ZA7A 3KM5A 3EQEA 4INDA 5KC5A 2G9ZA 1RUF1 1UYZA 4LORA 2RJKA 3WF0A 4JKLA 2R30A 1JOBA 3MLLA 1ASJ3 2K2SA 4GH4A 1EUTA 2C26A 2P37A 5KXEA 4HK8A 2GDFA 2WC2A 3LFIA 2YMZA 5J48A 4V2WA 1COV2 4BK5A 3THPA 5FPBA 4R9CA 1W2AX 2WRAA 1HB4A 1U12A 1S0BA 3AL5A 1Z7S3 2UWBA 5TSWA 2RMU1 5J36A 5I0UA 4JRAA 2YPJA 3LOBA 3NV3A 3SITA 3SEPA 3WV6A 2W1UA 4QDRA 1F2NA 3OBTA 3ON7A 5I8YA 5FBZA 2WYFA 2VULA 3K46A 4OYUA 5FZKA 4LO7A 3TN92 4CEWC 3H7JA 4CCDA 1RUE2 4BHPA 4QXBA 1HKDA 1UIKA 3AMPA 4JRLA 4FOYA 2VXRA 2WAAA 1O5UA 2X5IB 2EICA 3X29B 2KA3A 1H0BA 1C8NA 5EJ3A 4AF9A 1HJGA 3RS6A 4X6QB 2GH2A 5CFDC 4Q4V2 5FXXA 1AJOA 5FZEA 2X8KA 2UWCA 2OZ6A 5FZ9A 1GU3A 4LHKA 3ILNA 1NCRC 3KT1A 5FRAA 1REDA 4C8DA 3SH5A 4E8CA 2V5YA 3RZMA 4PBPA 4EWEA 4DXTA 2R072 1VBA3 3PHMA 2QQLA 2JE9A 2FD8A 3MIEA 1UX6A 3H1YA 3SKVA 1OUSA 5FUNA 1FOD2 3VGIA 2ZX3A 5F2WA 4XACA 1MQTC 2F6BA 1LB2A 3WDYA 3I2IA 4DUWA 5A33A 4CEWB 3ZO0B 3FFZA 1FMD1 4M4PA 1J1TA 1AF9A 2JDNA 4MGYE 5F8PA 5IAVA 1SFYA 2YGLA 5FPLA 1YQ5A 3QD6A 1W8NA 5EXOA 1D4M2 4B4PA 1QJX3 2O8OA 3IPVB 3N4MA 3ZFEA 1MEC3 2WZEA 3ZFGC 1LGNA 2H0VA 4J6GA 2YFUA 5CFDB 1ALYA 2ZGQA 4K40A 4LPLA 4MX3A 4FAHA 1QJU2 2AGSA 1CESA 2FZ1A 1YQ2A 4LLFA 4JGZC 2JICA 1ND2B 1C28A 5L9BA 5A3PA 2EIEA 2J7MA 4H3WA 3MBWA 4QX7A 2ZMNA 3Q9OA 2ZX0A 4LHSA 4LKFA 1QNYA 4TN7A 1DGWA 5GALA 1W0NA 2CAUA 5F2SA 3RMXA 1N47A 1ZZ6A 2IXKA 4B1MA 1XU2A 4Y4RA 4EN7B 3ZFFC 5CA6A 5GLUA 3C2UA 5FYUA 1HQNA 1JW6A 1VBC3 2CNAA 5LB6A 1X7NA 1UOGA 2UYBA 3AYAA 4ONUA 2WA3A 5KHIA 5AVAA 2J1SA 2XL9A 2XJPA 1O8SA 4DB5A 3M3CA 3ZFGB 5FMCA 1OI6A 3GZUC 2WZPP 1PX3A 3ORJA 4WV8A 4ASMB 1GZTA 1OURA 2JWPA 3DECA 3AMHA 1WBFA 4CDQC 1FI2A 1RUE1 3U11A 4IQPA 4XFAA 1AR73 2R042 3LAGA 3GALA 1UX7A 3P5BA 4QPIB 3POSA 3FL7A 2P34A 4MV2A 4XBLA 3ZXEA 1W6PA 4JGZB 1TE1B 1YYNA 3JQWA 4FFIA 4XMIA 4YZ3A 5T5OA 3WZ1A 2R063 3VD4A 4OMDA 1R081 4GALA 4F3JA 5J37A 5LBBA 4Q4V1 4PLMA 4K3UA 2Y34A 1PNFA 5CBLA 4LKEA 1H8TB 4COVA 2OQ6A 3B01A 1KJRA 3NNMA 4R4XA 3UGGA 3NJZA 5JXIA 3ZFFB 4L97A 3T2QA 3WUDA 1VAKA 5B4NA 1US2A 4Y5TA 4C90A 2VECA 3H0OA 2YFZA 4ZU4A 1W8ZA 3VZKA 4Y1VA 5L19A 2O1QA 4LNVA 4GULA 1FOD1 4H2AA 4LE3A 2DDUA 3H8RA 3JBG3 2TUNA 4YW2A 2E53A 4YW4A 2FDJA 2DCTA 1IHMA 1K3IA 2P3KA 4ORFA 4YFZA 4RL7A 1NZCA 4LBJA 2VOVA 1BBT2 2BOIA 3FZ3A 1DQ6A 3J7MA 1RHI2 1SBDA 1ENQA 1Y43B 1DBNA 1WWYA 2I07B 1SDWA 2XLGA 3CJXA 1W8FA 4LUKA 2NQYA 4G4FA 3LZZA 4XAEA 4AAPA 4B3NA 2VR4A 2QE3A 1O3SA 3O0XA 3ITQA 5C33A 5DUVA 2VQUA 5KHJA 3POWA 3HN3A 4FPFA 4LE4A 5GLZA 5H9QA 4AFBA 1QWRA 4QQHA 5T50A 5FP4A 5CB7A 1RUC3 2A6XA 3T0AA 4CU6A 1QJY1 3KLSA 4GWMA 3MIBA 4BMBA 4L9BA 5T55A 2ARXA 5FDBA 2O14A 3JQXA 2ZA9A 3N9MA 2VOTA 5FLHA 5EZWA 2VMHA 4LBMA 3T4HB 1Q56A 1PMJX 2PHTA 4BE3A 2G4IA 2XJTA
chains in the Genus database with same CATH topology
4WM7A 2OW4A 3RNSA 5C9AA 4CDUC 2DCZA 2C9AA 2DVDA 3O7OA 1XE7A 4P5HA 1SLCA 2R1DA 2VNOA 1H4HA 3KGZA 4IERA 4YZ2A 3WW2A 1OOPC 4LULA 2JG9B 2R041 1H2MA 4NVPA 3AZXA 5L36A 3WW3A 4W6XA 3JZVA 5HCBA 4FBFA 5AFEA 1AYN2 1RUG2 1W6NB 3DPRC 1AR82 4BZ4A 3A4UA 4OHVA 1PHMA 1PO13 2DCKA 2R0HA 4OUMA 3S6PA 1WLCA 2ZHNA 1JOJA 3WX5A 4I3GA 4AHZA 1Y3TA 3VBOB 3N36A 3MYXA 3M2MA 1D4VB 3H3ZA 5T3NA 2CTVA 3VL9A 5GLVA 4Y20A 1OQEA 2WFF3 3PJQA 2Q1MA 3L9JT 1OQDA 5JMCA 2GU9A 2XVKA 3VBUA 3DPRB 1N1VA 5J3UA 2MEV2 4D94A 3V64A 4ZKTB 2HWE1 3LWCA 2PLV2 5JIAA 3VKNA 4LHLA 5KXBA 3ZXJA 1LOCA 1LENA 4GKYA 3SCGA 2XJVA 1TMF3 3WG1A 3TYJA 4B29A 5F1RA 4HSLA 4AQSA 4AGGA 2UYAA 4N9HA 2YXSA 1PM7A 4R9BA 2P3JA 4HPKA 4R4ZA 1PK6A 5T5PA 4AFCA 1SQ4A 1GYKA 3NO8A 1TME2 4JDMA 1NCQA 2CGNA 1BK1A 3PVBB 2GNTA 1RJ7A 3BODA 4QPGC 1PO23 3W58A 1QQP2 4XW3A 4DRVA 1LHUA 1CR7A 5AC92 4JQRA 3V56A 2XKOA 3MEPA 3AX4A 3BPZA 3GNEA 4YGEA 5BNPC 2RM21 4IV1B 5A32B 1DU3D 2EAAA 4I30A 5E89A 4AFAA 5KBFA 1S55A 2ZKNA 4LA3A 1N3PA 4DRRA 1V6OA 3S30A 4L8QA 3CEWA 4XHBA 3G7DA 1N1TA 4DMIA 1IPKA 3EBRA 4AEMA 4NHLA 1PIV2 3IKWA 3MI8A 3B5LB 3PVEA 4QPGB 5JSOA 3O5SA 4YM2A 2WZR2 3KMHA 4H7LA 4H7MA 3BTAA 4YM1A 1FATA 4KWKA 1VBE3 3MGUA 3VKFC 1I3HA 3NV4A 2TNFA 4UW6A 2RS52 1AX2A 1RMU1 1XU1A 2WNVA 1XNCA 2Q30A 4HN1A 5EWSA 4XIKA 1X50A 1XNBA 1G6NA 3IM0A 4ZXKA 3HT1A 1GFF2 1AXZA 1RVF3 3TNQA 2RS11 2D43A 4G9SB 4I3PA 4LBOA 1CGPA 4LHNA 2A6VA 2SLIA 1A78A 5FOJB 3ZSLA 1ZM1A 2VOWA 3WVJA 4RHV3 2X29A 2JG8A 3AYDA 1NA1A 4XILA 1X8MA 2HWC2 3FFQA 4JC1A 1ULEA 1POV0 4XXAA 2D6OX 2W08A 2CWSA 3OYWB 5E8AA 4XFHA 5GLWA 3WP3A 4BIOA 3TAYA 4AK3A 1YJKA 2NMOA 1NXD1 2PHRA 3E6DA 1CPMA 4Q4W3 2BVVA 1IOAA 2E9QA 3VL8A 4AI0A 3OBRA 3P3NA 5GZEA 1I1EA 1IKQA 3MDPA 1A8MA 2ILMA 2EIGA 4Y1YA 1DQ4A 3VKMA 3ZXFA 3SH4A 4A7KA 1U0AA 1DGRA 4EWAA 1BEV2 1XYOA 1MS0A 3PNAA 4P9XA 2PN5A 2NYYA 4MSVA 2PAMA 1GNHA 1CAVB 2XWBB 4E2QA 1SLAA 5ACA3 1TEIA 2AENA 4GH4C 3FWEA 2WS91 5L7OB 1VJ2A 4SLIA 3VZOA 3RI9A 1X8EA 4GKXA 2DU1A 2IXIA 1DHKB 1PVXA 1EV12 1RUD3 3BIWE 4YG6A 3ZYJB 3ZXKA 2RS51 3WXPA 4CEYB 4HVQA 2Z69A 2ZGMA 3HMYA 2HWB1 1LTEA 4AVCA 3ROUA 4M3CF 1BJQA 1VB4A 4GB32 2GC1A 4S2GA 1VRH2 4AHWA 1JH5A 1X33A 1ZVFA 2LTNA 4QM9A 1DZRA 2ZZJA 4Q26A 3VBRA 4RQPA 1KD7A 1VBB2 3IDEA 2DV9A 4QQOA 2AR6A 4R52A 2HWC1 4N90A 1KS5A 2GN3A 5E88A 5IK4A 5JR7B 5FCCA 2ZJCA 1KS4A 3U0ZA 1GLHA 4Q4X2 4AVBA 4AHYA 2DTYA 2WQZC 4Y22A 1DQ5A 1AR62 1JN2P 1C8M3 1PVC3 3ZYRA 4Q4Y3 4XYXA 4JCKA 2DTWA 1SBFA 3JD72 2FMDA 3ZFEC 3B94A 1BQPA 4M01A 1OSGA 2DFCA 3LA2A 1HRI1 3AZVA 1GQHA 4QMAA 3VBFA 5BNNA 1BMV2 4YG3A 1RUF3 5CU1A 4YFWA 5JOWA 4PCRA 4BYYA 3RJ2X 4D7YA 4SBVA 1NY72 3ELNA 3WP6A 1MR5A 3BOPA 1NLSA 4Q27A 4FQZA 2HJIA 4YW3A 2W0XA 1WW5A 2RMU3 1EPZA 3ETQA 2VQAA 2WT1A 2ZGKA 1CAWA 1LHVA 1QXJA 5FO9B 1QOTA 1H2NA 4K7JA 2WL1A 2WKKA 4XZPA 1ZNPA 1YJLA 3IWZA 4COYA 2BNMA 1ND3A 1MZ5A 2RJLA 5SV5A 4AI3A 1CAXB 4YZ5A 1XNDA 1DQ1A 3K48A 4LEJA 5JI7A 2PHFA 4HKLA 1Q8OA 2PFWA 1VRH1 1X36A 2QUOA 4J1XA 1BXHA 2Z79A 4AWDA 3E97A 1BVP1 1H9PA 5KXCA 1Q56A 4XDQA 3JCIA 4EV0A 3NKGA 1VBB1 1AYM2 4LR4A 1XNKA 2P3IA 1UL9A 4R8HA 2F4PA 3TWIA 3LA7A 4CDXA 4RS5B 3WDVA 3DGTA 4IEZA 4TZDA 1AR61 4Q29A 3WW1A 2YHJA 1Z78A 2VPVA 4JGYB 5BNQA 4FP2A 1W6PB 4PDWA 2PAKA 4OHZA 3WQ0A 1BCXA 1AR92 2WNUA 5T54A 3B00A 4MZUA 1H1MA 3PLQA 1HXS2 3SHRA 3B9CA 5BNOA 1RB8G 1HIXA 3B9IA 4Q1PA 3WDXA 2K9ZA 2CGOA 1OKQA 1R091 1W2UA 2BPA2 2EXHA 1W6QA 2V09A 2YYOA 2BFUL 2ZGTA 3HAGA 4WM7C 1SFNA 3B02A 1RUE3 5C9AC 1G7YA 4BIFA 4LT5A 5DG2A 1FYUA 2ES3A 1ZRDA 5J09A 1LGBA 5J96B 2Q4SA 3BB6A 3CO2A 3FBYA 1R083 1HDKA 4FTEA 3OD4A 4Q4V3 4QGLA 4UW4A 4XJ8A 2YGMA 3NVCA 3EHKA 4AI2A 4B4RA 1N3QA 2RR11 2A70A 4D69A 3FX3A 4L11A 4E27A 1AL22 1BYHA 2A7AA 5JLVA 2RS32 4QU2A 1FOD3 4Z8BA 2Y26A 2UURA 3FBMA 2UU8A 1AYM1 3H1WA 2LUWA 1J1LA 4KGQA 4LO5B 4PF5A 4AGRA 4IEYA 1LCLA 5FMOL 4CP2A 1IZ3A 3E6BA 4UXAA 4WM8A 4ASLA 5CNAA 2FMYA 5CG8A 1EAH1 3V65A 2VNRA 1FV3A 1LEMA 2ZGRA 3ASIA 1DIWA 5A3LA 1JBCA 2TBVA 1DYPA 2HEYF 1DF0A 1FNYA 3SNMA 2VOXA 3W9AA 3VBUC 1LHWA 1QJY3 4Z82A 3HWJA 4XXPA 1V9U1 1N1YA 3N7KA 3O0VA 4FXGB 4KU8A 4EN0A 5FO8B 5FTTC 2Q8OA 3ZIWA 3MW3A 2GC3A 1RUI1 1HXS1 4FPKA 3B3QE 3FLPA 3AXDA 3RMYA 4P9WA 3ILRA 3SMHA 4ES8A 3HT2A 2NM1A 2D7FA 1CAUA 1O4TA 1GSLA 1W6MA 3M3OA 3WP5A 3GBWA 1SACA 4Y20B 2B42B 4RSUA 4DINB 5GKAC 3OPZA 1U5IA 4AI1A 1RUJ1 1ZA4A 1GV9A 2B9UA 4L99A 1PK6C 2R043 1PZ9A 1KFUL 3WQ7A 1R1ZA 3VBUB 4GWNA 1NCQC 4HMZA 4A7ZA 2ZGPA 1F5FA 4IEOA 4AQTA 2YY1A 2ZHKA 4IV3A 3DF0A 4ITCA 1ZZ9A 4C0HA 3HIFA 5J7MA 1NCRB 3AKQA 5H9PA 4AXOA 2IFRA 2RS31 2WIIB 1UU5A 3AXEA 5B2GB 1IS3A 1ZYBA 4Y4YA 3WG4A 1ASJ2 2B46X 4LO4B 2GN7A 4Q1RA 4HPKB 1MQTB 4FP3A 1GZWA 4MXWB 2Z42A 4R9AA 1PK6B 1Z7S2 5JDBA 2ZZQA 1COV1 3ZYGA 5C8WA 2EALA 4QD2A 3NV1A 1FPN2 1GQGA 1H30A 3WG3A 2B45X 2HWE3 3VBSA 3E6CC 1DFQA 4LBQB 4TLFA 4KG0A 3VBHA 1H1AA 3TN91 3KS7A 4COUA 4HVRA 3TB0A 3AMNA 3KB5A 1S2KA 3ALQA 4CDWA 2WNVC 3S7EA 1D2QA 3MIDA 3M7AA 4Q0QA 5CFCA 4N43A 2IXJA 1OLRA 1QNWA 1JYIA 3G6JB 1VBA2 1IS6A 3V0AB 4BQ1A 3ES1A 2R071 4JTNA 4AVSA 1IPJA 4KL1A 3MPPG 2A3XA 3AJYA 1HW5A 2MNGA 5T5LA 5IT6A 1MS8A 2WT0A 1XE8A 2DYCA 3WP4A 2JG8C 2I2SA 1QJX2 1A6CA 2ZGUA 4QHBA 4LBNA 1NA1C 2ZMKA 2I45A 4CDQB 1MEC2 5I0TA 1D4M1 3AKPA 1O3RA 1AR83 3GHNA 4NWVA 1NOVA 4AW7A 2RM23 5D8AA 2GZWA 4N53A 1W6OA 4PBOA 2I74A 1UW8A 2JENA 1B09A 3EO6A 4DS0A 2XLFA 5F6KA 1X82A 1QJU1 5CA6A 4IEVA 4FPLA 2HYKA 4XFCA 4AVVA 3PTYA 1CONA 4LUMA 4JDNA 1OA2A 2D97A 3UK9A 4B7KA 4YVSA 1VBC2 1ZZ8A 2UY8A 4K6BA 1B35A 5IK8A 3IDCB 4ZU7A 1FPN1 2Y0IA 4MYEA 4XTMA 3J9SA 2PLV3 1RMU3 2P17A 4QT6A 4EN6B 1AR72 5CAZA 4O9GA 2EVXA 5C8CA 1IQAA 3WW4A 1J59A 4TYSA 4ZU5A 4PIXA 2R062 4XMAA 4B8EA 2D93A 4O9EA 3LCPA 1NYWA 2VH9A 2GMEA 2RS13 4WVZA 1DQ0A 3J8F2 3VZNA 4EN9B 1ZZCA 1Q43A 3I7DA 3QLQA 2H6CA 2WLPA 1XXNA 2HEWF 1W39A 3AP5A 2HKXA 5GZDA 2XH6A 1AXKA 5T5JA 3JBG2 4CDUB 1YNAA 3DV8A 3H1MA 2P2KA 1DYKA 4KBBA 2BEOA 2D3PA 3AZZA 3VBRC 4RQPC 5FQ0B 3S0MA 1MZFA 1OOPB 1BBT1 5DXDA 4KWJA 5HXVA 1RHI1 1OA4A 1LJ7A 2ZGSA 2Y0OA 3IIAA 2NPIA 4IEQA 1VB2A 2TEPA 1PGL2 1VBD2 3R6SA 1G86A 4JVAA 4DY5A 2LM3A 2B39A 4I01A 1K5MA 5JOYA 1MZ6A 4LBKA 4K8FA 3VBFC 5BNNC 3SISA 3BCWA 3VBRB 3VLBB 3MZHA 4RQPB 5DUXA 4Q0VA 4CP0A 2D5HA 3ACLA 2WS93 4BA6A 2XJSA 4FCAA 1DG6A 3HD8B 1IS5A 2WA4A 2BQPA 3M3QA 4W6YA 2HWF2 1LOFA 2E7AA 2B8MA 2GNDA 5LRSA 4K20A 1WBLA 4Q0UA 4B4QA 2RS53 1HRV2 3KCXA 1WD4A 1YCIA 2DUOA 4Y22B 2DFBA 2HWB3 1JUIA 4E4SA 4WZCA 2QDNA 4K1YA 1ND2A 1RINA 2BWCA 4CTEA 4RD7A 3WT3A 3WNXA 1AYN1 1PO12 1RUG1 1ND3C 3J8F1 1AR81 3ZX7A 5ABJA 5JZGA 3VBFB 3TRSB 1F5JA 3LSDA 3BU7A 5JAXA 1BZWA 5DUWA 2R6QA 2HWC3 1EYBA 4Q0SA 3HQXA 3ME2A 2WFF2 4MGIE 1L3JA 4F83A 4FAGA 2WLQA 4QPIA 4NPRA 2BFUS 4XFFA 2A75A 3ILFA 1G8WA 4RFT0 4KWLA 2QZ3A 1H2KA 4P9GA 3NW4A 1ND3B 4CDXC 1HRI3 1H8TA 2AUYA 2MEV1 2ZS6B 1WLTA 5BNPB 1RTVA 2PLV1 2NN8A 3RSJA 3WCRA 1PGL1 1HV0A 1VBD1 2WWSA 2N7GA 2YROA 5HCFA 1TMF2 4YM0A 4PDWC 2IFWA 5H9RA 3FMGA 1C1LA 2WNUC 5JSRA 2PTMA 1MS9A 3N35A 1LODA 4XTPA 2DVFA 1GZCA 1WLDA 4AEDA 5GJ6A 3ZN4A 5BNOC 2D6PA 2PQQA 2SBAA 4YARA 1Q8QA 1QHDA 1SEFA 4IL7A 2GALA 5C6CA 2XG3A 1UPIA 2HWF1 2BNNA 1APNA 4XF4A 1RITA 2XJRA 2HWD2 2ZX2A 3AFKA 1UU6A 3M1HA 1TME1 1HRV1 2XGXA 1FV2A 3UL2A 3DN7A 3AKTA 1QQP1 4GB33 3AZWA 1T6GC 3C3VA 4NN0A 5AC91 1VRH3 4LO8A 4PDWB 3SXWA 2JJ6A 2H0BA 2WNUB 3L2HA 4J1WA 1O3TA 2QFEA 3QACA 2A3YA 4YYOA 1QU0A 2CWMA 4YZ4A 1ULGA 4AFDA 1S0IA 2ZAHA 4QPYA 2XPJA 5BNOB 1VBB3 1ZRRA 4M3CA 3LOIA 3I54A 4AVTA 3WDWA 3JB4C 2C5DA 2RE9A 1J3PA 3ATGA 4XBQA 5BY5A 2MPFA 2D6NA 1U5ZA 2WQ4A 4M00A 1W6QB 1OHFA 1ZBA2 4PIZA 4XOGA 2JG9A 5K9YA 1PIV1 1AR63 3QCWA 1UIJA 5GM0A 1HX6A 1GBGA 1W6NA 2R16A 4WM8C 2WZR1 3JD73 3WUCA 4LA2A 1O3QA 1QY4A 2AH2A 2OZJA 3MIFA 3DKWA 5EYXA 4XF3A 1H2LA 2OPKA 3DL3A 3ZXLA 4BM8A 1CJDA 2VGDA 4XE9A 1BKZA 4B7EA 4AYUA 1RC6A 1YUDA 1RVF2 3N7JA 4TSVA 3VBOA