5DY7A

Crystal structure of the human brpf1 bromodomain in complex with seed4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
molecule keywords Peregrin
molecule tags Dna binding protein
source organism Homo sapiens
total genus 39
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dy7A00
4O76A 2DVQA 5CUDA 4N4GA 4YC9A 2I7KA 2RNXA 5ENIA 4WHUA 3G0JA 5A83A 4BW2A 5FE2A 5JWMA 4TYLA 4CUSA 3AADA 5FE1A 4QSQA 4TS8A 4BW3A 3IU6A 5I7YA 4LYWA 4PCIA 4HXLA 4UIUA 5DW1A 3U5PA 2RI7A 5F61A 5FFYA 4Q0NA 5DW2A 3IU5A 3U5KA 5DKDA 5F2PA 3DWYA 3MB4A 5FH6A 5CTLA 2DVSA 5EWHA 5L96A 4XUBA 5DFDA 5IGKA 5FDZA 3QZVA 3MULA 5D3PA 4BJXA 5A5SA 4IR6A 4UIZA 4N3WA 2YEKA 5DYUA 4A9KA 3S92A 5C85A 4HXOA 2YW5A 4UYGA 4Z1SA 4WIVA 5DKHA 4QYDA 2R0VA 2LSPB 2YELA 5C7NA 2E7OA 3U5NA 5F1LA 4IOQA 4UIYA 5HELA 2D82A 5H85A 4HXKA 3LQHA 3UVXA 3JVJA 5CRZA 4XY9A 4MR4A 3HMHA 5TB6A 5CQ7A 4CL9A 4LRGA 3DAIA 4TZ2A 5DX4A 3FKMX 5CUGA 5IBNA 4Z93A 4NRAA 5EWCA 3MQMA 4A9JA 5FBXA 5ENGA 5IGLA 5HENA 1E6IA 5E9IA 4Q0OA 4XUAA 5EPSA 5HM0A 5EPBA 2I8NA 4J0RA 5CGPA 5DYXA 4PY6A 3UVWA 2DVRA 4YYJA 2RO1A 4QSXA 4PKLA 3I3JA 5F5ZA 5DKCA 5E3GA 4YYGA 3U5JA 3UVDA 3GG3A 5CUAA 5LVQA 5H1TA 1ZS5A 4LYSA 4YH4A 4NR8A 4UITA 5ETDA 3RCWA 3K2JA 4QC3A 4CUTA 5CU8A 3MB3A 4XYAA 5EK9A 5EWWA 5I89A 5E9YA 5IIDA 5F36A 4CFLA 5HLSA 5CQ5A 2YYNA 3P1DA 5AMEA 5I29A 5FE0A 4N4HA 3ONIA 4Y03A 3O33A 4YBSA 5EPRA 5LUUA 4ZW1A 5EWDA 3Q2FA 2DWWA 2R0YA 5A5RA 4CFKA 1F68A 5D25A 4F3IA 4PTBA 5C89A 4KV1A 5A85A 4NR4A 5I80A 4IR3A 2YQDA 3Q2EA 4NQNA 4GPJA 5F63A 5EQ1A 4RVRA 5IGNA 4QUTA 5F62A 2FSAA 2RNWA 4LC2A 4NR6A 3JVLA 4HXPA 4YYMA 5F3AA 2YDWA 4YYIA 4MEQA 4QEVA 5HEMA 4HBXA 4IORA 5CQTA 5G4RA 5C87A 5EISA 5CQ4A 4A9MA 3P5OA 5II1A 5KTUA 5AD3A 4NRCA 5AD2A 4MR5A 4O70A 5LKTA 4YBMA 3LXJA 4YH3A 5CY9A 4KV4A 1JM4B 1WUGA 5I83A 4QSTA 1EQFA 5L98A 5E0RA 5H1VA 5E9LA 4OUFA 4AKNA 2R10A 4HXNA 4YK0A 2E3KA 5D3RA 4PCEA 5BT5A 3LJWA 5D7XA 4A9NA 4O7BA 5HJCA 5ETBA 5E73A 5I86A 2DKWA 5HRWA 3O37A 3U5LA 5CUEA 5HRXA 4A9HA 5EV9A 4YAXA 5D3LA 4NQMA 4O75A 5D0CA 4HXRA 3P1EA 4LZRA 5EU1A 2H60A 3U5OA 4NRBA 4HBVA 4YATA 5KTWA 5A5QA 4C66A 5DBMA 5COIA 4ZC9A 4LYIA 5ENCA 5EWVA 4QY4A 2L85A 5CRMA 4HXMA 5D24A 3P1FA 2OO1A 3UV5A 3U5MA 3HMEA 5DLXA 5FB0A 5C4QA 5CQ3A 4J1PA 2G4AA 4NUDA 5HCLA 5DY7A 4TZ8A 4QSUA 5F60A 4QR3A 4TTEA 3UV4A 4UYEA 4OGIA 5FE4A 4X2IA 5L8TA 5CPEA 4CUUA 5J0DA 4XY8A 5A7CA 5L8UA 5KO4A 4QSRA 4CURA 3SVHA 5EA1A 5JI8A 4PS5A 4MR6A 4UYDA 2OUOA 4NYWA 4UYFA 1JSPB 3SVGA 5HFQA 4IR5A 5TCMA 5ENBA 3ZYUA 4QNSA 4A9IA 3LQJA 5EICA 4J0SA 4QSSA 2WP2A 5L97A 2RNYA 4Z6IA 2MJVB 4HBWA 5E9VA 4OGJA 3O35A 5EM3A 4QBMA 5FE9A 4NUEA 5ENFA 4QSPA 3UVYA 4MEPA 5D3SA 4TT6A 4ALGA 4YYHA 4MENA 4LDFA 2YEMA 5HQ7A 2DATA 4NYVA 5A5OA 5KU3A 4Z6HA 4MEOA 4UIVA 5LJ2A 5KHMA 4FLPA 5A82A 3MUKA 4QC1A 5CS8A 4LR6A 4YY6A 5F25A 3NXBA 4O7CA 5A5PA 3UV2A 5FFWA 5E9MA 3JVKA 4QB3A 4BHWA 4HBYA 4YYNA 5ENHA 5E7DA 5BT3A 5CP5A 4C67A 2RFJA 4O74A 5LJ0A 3JVMA 5CUCA 5D3NA 5I1QA 4IOOA 4CUPA 5I40A 4TU4A 5DLZA 4O77A 2F6JA 4TU6A 3TLPA 4HXSA 4TQNA 4UYFB 1WUMA 5FG6A 5KTXA 5FH8A 4A9LA 5EVAA 3QZTA 4QZSA 5EP7A 4BW1A 5K29A 2L5EA 4QUUA 5FH7A 2GRCA 5EGUA 4QYLA 5E9KA 1X0JA 5A81A 3SVFA 5HQ5A 5F1HA 4YY4A 5LVRA 5DFBA 5EI4A 5L99A 3S91A 2D9EA 2L84A 5ENEA 5FG5A 5HQ6A 4N4IA 5E3DA 5CQAA 4NXJA 5CUBA 5D3TA 2NXBA 4TT2A 5DFCA 5FG4A 5LKXA 4LZSA 4O7EA 3LQIA 4QR5A 4E96A 2F6NA 4ALHA 2WP1A 5ENJA 5D3HA 4KCXA 4O72A 4QSVA 5I7XA 5LJ1A 4A9FA 3AQAA 3UW9A 4YYDA 5FFVA 3D7CA 3HMFA 5I88A 5FE8A 4ZQLA 4CLBA 4O78A 4A9EA 5H1UA 4QSWA 5DYCA 5ACYA 4NR9A 4MR3A 3QZSA 5A5NA 2RS9B 5HRVA 5CQ6A 2E7NA 4YABA 4Z1QA 4QEUA 5BT4A 4YADA 4BW4A 5DYAA 4J3IA 5FE3A 4YYKA 5D3JA 5CFWA 4LZ2A 4NUCA 4YBTA 2N9GA 4NR7A 4DONA 2R0SA 1N72A 4IR4A 5II2A 4UYHA 3G0LA 3O36A 4N4FA 5CZGA 4O7AA 5CQ8A 3P1CA 2OSSA 4O71A 5LKZA 4CUQA 4A9OA 5D26A 5HFRA 3O34A 5IGMA 4O7FA 4NS5A 5FE6A 5FE7A 4TT4A 3MXFA 2KTBB 4QR4A 5LKUA 4NYXA 5AMFA 4WHWA 4UIXA 5G4SA 5IG6A 2DVVA 5FB1A 5C8GA 5E74A 5FE5A 4UIWA 4QEWA 4NR5A
chains in the Genus database with same CATH superfamily
4O76A 2DVQA 5CUDA 4N4GA 4YC9A 2I7KA 2RNXA 5ENIA 4WHUA 3ERRA 3G0JA 5A83A 4BW2A 5FE2A 5JWMA 4TYLA 4CUSA 3AADA 5FE1A 4QSQA 4TS8A 4BW3A 3IU6A 5I7YA 4LYWA 4PCIA 4HXLA 4UIUA 5DW1A 3U5PA 2RI7A 5F61A 5FFYA 4Q0NA 5DW2A 3IU5A 3U5KA 5DKDA 5F2PA 3DWYA 3MB4A 5FH6A 5CTLA 2DVSA 5EWHA 5L96A 4XUBA 5DFDA 5IGKA 5FDZA 3QZVA 3MULA 5D3PA 4BJXA 5A5SA 4IR6A 4UIZA 4N3WA 2YEKA 5DYUA 4A9KA 3S92A 5C85A 4HXOA 2YW5A 4UYGA 4Z1SA 4WIVA 5DKHA 4QYDA 2R0VA 2LSPB 2YELA 5C7NA 4AKGA 2E7OA 3U5NA 5F1LA 4IOQA 4UIYA 5HELA 2D82A 5H85A 4HXKA 3LQHA 3UVXA 3JVJA 5CRZA 4XY9A 4MR4A 3HMHA 5TB6A 5CQ7A 4CL9A 4LRGA 3DAIA 4TZ2A 5DX4A 3FKMX 5CUGA 5IBNA 4Z93A 4NRAA 5EWCA 3MQMA 4A9JA 5FBXA 5ENGA 5IGLA 5HENA 1E6IA 5E9IA 4Q0OA 4XUAA 5EPSA 5HM0A 5EPBA 2I8NA 4J0RA 5CGPA 5DYXA 4PY6A 3UVWA 2DVRA 4YYJA 2RO1A 4QSXA 4PKLA 3I3JA 5F5ZA 5DKCA 5E3GA 4YYGA 3U5JA 3UVDA 3GG3A 5CUAA 5LVQA 5H1TA 1ZS5A 4LYSA 4YH4A 4NR8A 4UITA 5ETDA 3RCWA 3K2JA 4QC3A 4CUTA 5CU8A 3MB3A 4XYAA 5EK9A 5EWWA 5I89A 5E9YA 5IIDA 5F36A 4CFLA 5HLSA 5CQ5A 2YYNA 3P1DA 5AMEA 5I29A 5FE0A 4N4HA 3ONIA 4Y03A 3O33A 4YBSA 5EPRA 5LUUA 4ZW1A 3D1BA 5EWDA 3Q2FA 2DWWA 2R0YA 5A5RA 4CFKA 1F68A 5D25A 4F3IA 4PTBA 5C89A 4KV1A 5A85A 1ZKRA 4NR4A 5I80A 4IR3A 2YQDA 3Q2EA 4NQNA 4GPJA 5F63A 5EQ1A 4RVRA 5IGNA 4QUTA 5F62A 2FSAA 2RNWA 4LC2A 4NR6A 3JVLA 4HXPA 4YYMA 5F3AA 2YDWA 4YYIA 4MEQA 4QEVA 5HEMA 4HBXA 4AI6A 4IORA 5CQTA 5G4RA 5C87A 5EISA 5CQ4A 4A9MA 3P5OA 5II1A 5KTUA 5AD3A 4NRCA 5AD2A 4MR5A 4O70A 5LKTA 4YBMA 3LXJA 4YH3A 5CY9A 4KV4A 1JM4B 1WUGA 5I83A 4QSTA 1EQFA 5L98A 5E0RA 5H1VA 5E9LA 4OUFA 4AKNA 2R10A 4HXNA 4YK0A 2E3KA 5D3RA 4PCEA 5BT5A 3LJWA 5D7XA 4A9NA 3D1DA 4O7BA 5HJCA 5ETBA 5E73A 5I86A 2DKWA 5HRWA 3O37A 3U5LA 5CUEA 5HRXA 4A9HA 5EV9A 4YAXA 5D3LA 4NQMA 4O75A 5D0CA 4HXRA 3P1EA 4LZRA 5EU1A 2H60A 3U5OA 4NRBA 4HBVA 4YATA 5KTWA 5A5QA 4C66A 5DBMA 5COIA 4ZC9A 4LYIA 5ENCA 5EWVA 4QY4A 2L85A 5CRMA 4HXMA 5D24A 3P1FA 2OO1A 3UV5A 3U5MA 3HMEA 5DLXA 5FB0A 5C4QA 4AKIA 5CQ3A 4J1PA 2G4AA 4NUDA 5HCLA 5DY7A 4TZ8A 4QSUA 5F60A 4QR3A 4TTEA 3UV4A 4UYEA 4OGIA 5FE4A 4X2IA 5L8TA 5CPEA 4CUUA 5J0DA 4XY8A 5A7CA 5L8UA 5KO4A 4QSRA 4CURA 3SVHA 5EA1A 5JI8A 3VKHA 4PS5A 4MR6A 4UYDA 2OUOA 4NYWA 4UYFA 1JSPB 3SVGA 5HFQA 4IR5A 5TCMA 5ENBA 3ZYUA 4QNSA 4A9IA 3LQJA 5EICA 4J0SA 4QSSA 2WP2A 5L97A 2RNYA 4Z6IA 2MJVB 4HBWA 5E9VA 4OGJA 3O35A 5EM3A 4QBMA 5FE9A 4NUEA 5ENFA 4QSPA 3UVYA 4MEPA 5D3SA 4TT6A 4ALGA 4YYHA 4MENA 4LDFA 2YEMA 3VKGA 5HQ7A 2DATA 4NYVA 5A5OA 5KU3A 4Z6HA 4MEOA 4UIVA 5LJ2A 5KHMA 4FLPA 5A82A 3MUKA 4QC1A 5CS8A 4LR6A 4YY6A 5F25A 3NXBA 4O7CA 5A5PA 3UV2A 5FFWA 5E9MA 3JVKA 4QB3A 4BHWA 4HBYA 4YYNA 5ENHA 5E7DA 5BT3A 5CP5A 4C67A 2RFJA 4O74A 5LJ0A 3JVMA 5CUCA 5D3NA 5I1QA 4IOOA 4CUPA 5I40A 4TU4A 5DLZA 4O77A 2F6JA 4TU6A 3TLPA 4HXSA 4TQNA 4UYFB 1WUMA 5FG6A 5KTXA 5FH8A 4A9LA 5EVAA 3QZTA 4QZSA 5EP7A 4BW1A 5K29A 2L5EA 4QUUA 5FH7A 2GRCA 5EGUA 4QYLA 5E9KA 1X0JA 5A81A 3SVFA 5HQ5A 5F1HA 4YY4A 5LVRA 5DFBA 5EI4A 5L99A 3S91A 2D9EA 2L84A 5ENEA 5FG5A 5HQ6A 4N4IA 5E3DA 5CQAA 4NXJA 5CUBA 5D3TA 2NXBA 4TT2A 5DFCA 5FG4A 5LKXA 4LZSA 4O7EA 3LQIA 4QR5A 4E96A 2F6NA 4ALHA 2WP1A 5ENJA 5D3HA 4KCXA 4O72A 4QSVA 5I7XA 5LJ1A 4A9FA 3AQAA 3UW9A 4YYDA 5FFVA 3D7CA 3HMFA 5I88A 5FE8A 4ZQLA 4CLBA 4O78A 4A9EA 5H1UA 4QSWA 5DYCA 5ACYA 4NR9A 4MR3A 3QZSA 5A5NA 2RS9B 5HRVA 5CQ6A 2E7NA 4YABA 4Z1QA 4QEUA 5BT4A 4YADA 4BW4A 5DYAA 4J3IA 5FE3A 4YYKA 5D3JA 5CFWA 4LZ2A 1PUOA 4NUCA 2N9GA 4NR7A 4YBTA 4DONA 2R0SA 1N72A 4IR4A 5II2A 4UYHA 3G0LA 3O36A 4N4FA 5CZGA 4O7AA 5CQ8A 3P1CA 2OSSA 4O71A 5LKZA 4CUQA 4A9OA 5D26A 5HFRA 3O34A 5IGMA 4O7FA 2EJNA 4NS5A 5FE6A 5FE7A 4TT4A 3MXFA 2KTBB 4QR4A 5LKUA 4NYXA 5AMFA 4WHWA 4UIXA 5G4SA 5IG6A 2DVVA 5FB1A 5C8GA 4AKHA 5E74A 5FE5A 4UIWA 4QEWA 4NR5A
chains in the Genus database with same CATH topology
4O76A 2DVQA 5CUDA 4N4GA 4YC9A 2I7KA 2RNXA 5ENIA 4WHUA 3G0JA 5A83A 4BW2A 5FE2A 5JWMA 4TYLA 4CUSA 3AADA 5FE1A 4QSQA 4TS8A 4BW3A 3IU6A 5I7YA 4LYWA 4PCIA 4HXLA 4UIUA 5DW1A 3U5PA 2RI7A 5F61A 5FFYA 4Q0NA 5DW2A 3IU5A 3U5KA 5DKDA 5F2PA 3DWYA 3MB4A 5FH6A 5CTLA 2DVSA 5EWHA 5L96A 4XUBA 5DFDA 5IGKA 5FDZA 3QZVA 3MULA 5D3PA 4BJXA 5A5SA 4IR6A 4UIZA 4N3WA 2YEKA 5DYUA 4A9KA 3S92A 5C85A 4HXOA 2YW5A 4UYGA 4Z1SA 4WIVA 5DKHA 4QYDA 2R0VA 2LSPB 2YELA 5C7NA 2E7OA 3U5NA 5F1LA 4IOQA 4UIYA 5HELA 2D82A 5H85A 4HXKA 3LQHA 3UVXA 3JVJA 5CRZA 4XY9A 4MR4A 3HMHA 5TB6A 5CQ7A 4CL9A 4LRGA 3DAIA 4TZ2A 5DX4A 3FKMX 5CUGA 5IBNA 4Z93A 4NRAA 5EWCA 3MQMA 4A9JA 5FBXA 5ENGA 5IGLA 5HENA 1E6IA 5E9IA 4Q0OA 4XUAA 5EPSA 5HM0A 5EPBA 2I8NA 4J0RA 5CGPA 5DYXA 4PY6A 3UVWA 2DVRA 4YYJA 2RO1A 4QSXA 4PKLA 3I3JA 5F5ZA 5DKCA 5E3GA 4YYGA 3U5JA 3UVDA 3GG3A 5CUAA 5LVQA 5H1TA 1ZS5A 4LYSA 4YH4A 4NR8A 4UITA 5ETDA 3RCWA 3K2JA 4QC3A 4CUTA 5CU8A 3MB3A 4XYAA 5EK9A 5EWWA 5I89A 5E9YA 5IIDA 5F36A 4CFLA 5HLSA 5CQ5A 2YYNA 3P1DA 5AMEA 5I29A 5FE0A 4N4HA 3ONIA 4Y03A 3O33A 4YBSA 5EPRA 5LUUA 4ZW1A 5EWDA 3Q2FA 2DWWA 2R0YA 5A5RA 4CFKA 1F68A 5D25A 4F3IA 4PTBA 5C89A 4KV1A 5A85A 4NR4A 5I80A 4IR3A 2YQDA 3Q2EA 4NQNA 4GPJA 5F63A 5EQ1A 4RVRA 5IGNA 4QUTA 5F62A 2FSAA 2RNWA 4LC2A 4NR6A 3JVLA 4HXPA 4YYMA 5F3AA 2YDWA 4YYIA 4MEQA 4QEVA 5HEMA 4HBXA 4IORA 5CQTA 5G4RA 5C87A 5EISA 5CQ4A 4A9MA 3P5OA 5II1A 5KTUA 5AD3A 4NRCA 5AD2A 4MR5A 4O70A 5LKTA 4YBMA 3LXJA 4YH3A 5CY9A 4KV4A 1JM4B 1WUGA 5I83A 4QSTA 1EQFA 5L98A 5E0RA 5H1VA 5E9LA 4OUFA 4AKNA 2R10A 4HXNA 4YK0A 2E3KA 5D3RA 4PCEA 5BT5A 3LJWA 5D7XA 4A9NA 4O7BA 5HJCA 5ETBA 5E73A 5I86A 2DKWA 5HRWA 3O37A 3U5LA 5CUEA 5HRXA 4A9HA 5EV9A 4YAXA 5D3LA 4NQMA 4O75A 5D0CA 4HXRA 3P1EA 4LZRA 5EU1A 2H60A 3U5OA 4NRBA 4HBVA 4YATA 5KTWA 5A5QA 4C66A 5DBMA 5COIA 4ZC9A 4LYIA 5ENCA 5EWVA 4QY4A 2L85A 5CRMA 4HXMA 5D24A 3P1FA 2OO1A 3UV5A 3U5MA 3HMEA 5DLXA 5FB0A 5C4QA 5CQ3A 4J1PA 2G4AA 4NUDA 5HCLA 5DY7A 4TZ8A 4QSUA 5F60A 4QR3A 4TTEA 3UV4A 4UYEA 4OGIA 5FE4A 4X2IA 5L8TA 5CPEA 4CUUA 5J0DA 4XY8A 5A7CA 5L8UA 5KO4A 4QSRA 4CURA 3SVHA 5EA1A 5JI8A 4PS5A 4MR6A 4UYDA 2OUOA 4NYWA 4UYFA 1JSPB 3SVGA 5HFQA 4IR5A 5TCMA 5ENBA 3ZYUA 4QNSA 4A9IA 3LQJA 5EICA 4J0SA 4QSSA 2WP2A 5L97A 2RNYA 4Z6IA 2MJVB 4HBWA 5E9VA 4OGJA 3O35A 5EM3A 4QBMA 5FE9A 4NUEA 5ENFA 4QSPA 3UVYA 4MEPA 5D3SA 4TT6A 4ALGA 4YYHA 4MENA 4LDFA 2YEMA 5HQ7A 2DATA 4NYVA 5A5OA 5KU3A 4Z6HA 4MEOA 4UIVA 5LJ2A 5KHMA 4FLPA 5A82A 3MUKA 4QC1A 5CS8A 4LR6A 4YY6A 5F25A 3NXBA 4O7CA 5A5PA 3UV2A 5FFWA 5E9MA 3JVKA 4QB3A 4BHWA 4HBYA 4YYNA 5ENHA 5E7DA 5BT3A 5CP5A 4C67A 2RFJA 4O74A 5LJ0A 3JVMA 5CUCA 5D3NA 5I1QA 4IOOA 4CUPA 5I40A 4TU4A 5DLZA 4O77A 2F6JA 4TU6A 3TLPA 4HXSA 4TQNA 4UYFB 1WUMA 5FG6A 5KTXA 5FH8A 4A9LA 5EVAA 3QZTA 4QZSA 5EP7A 4BW1A 5K29A 2L5EA 4QUUA 5FH7A 2GRCA 5EGUA 4QYLA 5E9KA 1X0JA 5A81A 3SVFA 5HQ5A 5F1HA 4YY4A 5LVRA 5DFBA 5EI4A 5L99A 3S91A 2D9EA 2L84A 5ENEA 5FG5A 5HQ6A 4N4IA 5E3DA 5CQAA 4NXJA 5CUBA 5D3TA 2NXBA 4TT2A 5DFCA 5FG4A 5LKXA 4LZSA 4O7EA 3LQIA 4QR5A 4E96A 2F6NA 4ALHA 2WP1A 5ENJA 5D3HA 4KCXA 4O72A 4QSVA 5I7XA 5LJ1A 4A9FA 3AQAA 3UW9A 4YYDA 5FFVA 3D7CA 3HMFA 5I88A 5FE8A 4ZQLA 4CLBA 4O78A 4A9EA 5H1UA 4QSWA 5DYCA 5ACYA 4NR9A 4MR3A 3QZSA 5A5NA 2RS9B 5HRVA 5CQ6A 2E7NA 4YABA 4Z1QA 4QEUA 5BT4A 4YADA 4BW4A 5DYAA 4J3IA 5FE3A 4YYKA 5D3JA 5CFWA 4LZ2A 4NUCA 4YBTA 2N9GA 4NR7A 4DONA 2R0SA 1N72A 4IR4A 5II2A 4UYHA 3G0LA 3O36A 4N4FA 5CZGA 4O7AA 5CQ8A 3P1CA 2OSSA 4O71A 5LKZA 4CUQA 4A9OA 5D26A 5HFRA 3O34A 5IGMA 4O7FA 4NS5A 5FE6A 5FE7A 4TT4A 3MXFA 2KTBB 4QR4A 5LKUA 4NYXA 5AMFA 4WHWA 4UIXA 5G4SA 5IG6A 2DVVA 5FB1A 5C8GA 5E74A 5FE5A 4UIWA 4QEWA 4NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O76 A;  2DVQ A;  5CUD A;  4N4G A;  4YC9 A;  2I7K A;  2RNX A;  5ENI A;  4WHU A;  3G0J A;  5A83 A;  4BW2 A;  5FE2 A;  5JWM A;  4TYL A;  4CUS A;  3AAD A;  5FE1 A;  4QSQ A;  4TS8 A;  4BW3 A;  3IU6 A;  5I7Y A;  4LYW A;  4PCI A;  4HXL A;  4UIU A;  5DW1 A;  3U5P A;  2RI7 A;  5F61 A;  5FFY A;  4Q0N A;  5DW2 A;  3IU5 A;  3U5K A;  5DKD A;  5F2P A;  3DWY A;  3MB4 A;  5FH6 A;  5CTL A;  2DVS A;  5EWH A;  5L96 A;  4XUB A;  5DFD A;  5IGK A;  5FDZ A;  3QZV A;  3MUL A;  5D3P A;  4BJX A;  5A5S A;  4IR6 A;  4UIZ A;  4N3W A;  2YEK A;  5DYU A;  4A9K A;  3S92 A;  5C85 A;  4HXO A;  2YW5 A;  4UYG A;  4Z1S A;  4WIV A;  5DKH A;  4QYD A;  2R0V A;  2LSP B;  2YEL A;  5C7N A;  2E7O A;  3U5N A;  5F1L A;  4IOQ A;  4UIY A;  5HEL A;  2D82 A;  5H85 A;  4HXK A;  3LQH A;  3UVX A;  3JVJ A;  5CRZ A;  4XY9 A;  4MR4 A;  3HMH A;  5TB6 A;  5CQ7 A;  4CL9 A;  4LRG A;  3DAI A;  4TZ2 A;  5DX4 A;  3FKM X;  5CUG A;  5IBN A;  4Z93 A;  4NRA A;  5EWC A;  3MQM A;  4A9J A;  5FBX A;  5ENG A;  5IGL A;  5HEN A;  1E6I A;  5E9I A;  4Q0O A;  4XUA A;  5EPS A;  5HM0 A;  5EPB A;  2I8N A;  4J0R A;  5CGP A;  5DYX A;  4PY6 A;  3UVW A;  2DVR A;  4YYJ A;  2RO1 A;  4QSX A;  4PKL A;  3I3J A;  5F5Z A;  5DKC A;  5E3G A;  4YYG A;  3U5J A;  3UVD A;  3GG3 A;  5CUA A;  5LVQ A;  5H1T A;  1ZS5 A;  4LYS A;  4YH4 A;  4NR8 A;  4UIT A;  5ETD A;  3RCW A;  3K2J A;  4QC3 A;  4CUT A;  5CU8 A;  3MB3 A;  4XYA A;  5EK9 A;  5EWW A;  5I89 A;  5E9Y A;  5IID A;  5F36 A;  4CFL A;  5HLS A;  5CQ5 A;  2YYN A;  3P1D A;  5AME A;  5I29 A;  5FE0 A;  4N4H A;  3ONI A;  4Y03 A;  3O33 A;  4YBS A;  5EPR A;  5LUU A;  4ZW1 A;  5EWD A;  3Q2F A;  2DWW A;  2R0Y A;  5A5R A;  4CFK A;  1F68 A;  5D25 A;  4F3I A;  4PTB A;  5C89 A;  4KV1 A;  5A85 A;  4NR4 A;  5I80 A;  4IR3 A;  2YQD A;  3Q2E A;  4NQN A;  4GPJ A;  5F63 A;  5EQ1 A;  4RVR A;  5IGN A;  4QUT A;  5F62 A;  2FSA A;  2RNW A;  4LC2 A;  4NR6 A;  3JVL A;  4HXP A;  4YYM A;  5F3A A;  2YDW A;  4YYI A;  4MEQ A;  4QEV A;  5HEM A;  4HBX A;  4IOR A;  5CQT A;  5G4R A;  5C87 A;  5EIS A;  5CQ4 A;  4A9M A;  3P5O A;  5II1 A;  5KTU A;  5AD3 A;  4NRC A;  5AD2 A;  4MR5 A;  4O70 A;  5LKT A;  4YBM A;  3LXJ A;  4YH3 A;  5CY9 A;  4KV4 A;  1JM4 B;  1WUG A;  5I83 A;  4QST A;  1EQF A;  5L98 A;  5E0R A;  5H1V A;  5E9L A;  4OUF A;  4AKN A;  2R10 A;  4HXN A;  4YK0 A;  2E3K A;  5D3R A;  4PCE A;  5BT5 A;  3LJW A;  5D7X A;  4A9N A;  4O7B A;  5HJC A;  5ETB A;  5E73 A;  5I86 A;  2DKW A;  5HRW A;  3O37 A;  3U5L A;  5CUE A;  5HRX A;  4A9H A;  5EV9 A;  4YAX A;  5D3L A;  4NQM A;  4O75 A;  5D0C A;  4HXR A;  3P1E A;  4LZR A;  5EU1 A;  2H60 A;  3U5O A;  4NRB A;  4HBV A;  4YAT A;  5KTW A;  5A5Q A;  4C66 A;  5DBM A;  5COI A;  4ZC9 A;  4LYI A;  5ENC A;  5EWV A;  4QY4 A;  2L85 A;  5CRM A;  4HXM A;  5D24 A;  3P1F A;  2OO1 A;  3UV5 A;  3U5M A;  3HME A;  5DLX A;  5FB0 A;  5C4Q A;  5CQ3 A;  4J1P A;  2G4A A;  4NUD A;  5HCL A;  5DY7 A;  4TZ8 A;  4QSU A;  5F60 A;  4QR3 A;  4TTE A;  3UV4 A;  4UYE A;  4OGI A;  5FE4 A;  4X2I A;  5L8T A;  5CPE A;  4CUU A;  5J0D A;  4XY8 A;  5A7C A;  5L8U A;  5KO4 A;  4QSR A;  4CUR A;  3SVH A;  5EA1 A;  5JI8 A;  4PS5 A;  4MR6 A;  4UYD A;  2OUO A;  4NYW A;  4UYF A;  1JSP B;  3SVG A;  5HFQ A;  4IR5 A;  5TCM A;  5ENB A;  3ZYU A;  4QNS A;  4A9I A;  3LQJ A;  5EIC A;  4J0S A;  4QSS A;  2WP2 A;  5L97 A;  2RNY A;  4Z6I A;  2MJV B;  4HBW A;  5E9V A;  4OGJ A;  3O35 A;  5EM3 A;  4QBM A;  5FE9 A;  4NUE A;  5ENF A;  4QSP A;  3UVY A;  4MEP A;  5D3S A;  4TT6 A;  4ALG A;  4YYH A;  4MEN A;  4LDF A;  2YEM A;  5HQ7 A;  2DAT A;  4NYV A;  5A5O A;  5KU3 A;  4Z6H A;  4MEO A;  4UIV A;  5LJ2 A;  5KHM A;  4FLP A;  5A82 A;  3MUK A;  4QC1 A;  5CS8 A;  4LR6 A;  4YY6 A;  5F25 A;  3NXB A;  4O7C A;  5A5P A;  3UV2 A;  5FFW A;  5E9M A;  3JVK A;  4QB3 A;  4BHW A;  4HBY A;  4YYN A;  5ENH A;  5E7D A;  5BT3 A;  5CP5 A;  4C67 A;  2RFJ A;  4O74 A;  5LJ0 A;  3JVM A;  5CUC A;  5D3N A;  5I1Q A;  4IOO A;  4CUP A;  5I40 A;  4TU4 A;  5DLZ A;  4O77 A;  2F6J A;  4TU6 A;  3TLP A;  4HXS A;  4TQN A;  4UYF B;  1WUM A;  5FG6 A;  5KTX A;  5FH8 A;  4A9L A;  5EVA A;  3QZT A;  4QZS A;  5EP7 A;  4BW1 A;  5K29 A;  2L5E A;  4QUU A;  5FH7 A;  2GRC A;  5EGU A;  4QYL A;  5E9K A;  1X0J A;  5A81 A;  3SVF A;  5HQ5 A;  5F1H A;  4YY4 A;  5LVR A;  5DFB A;  5EI4 A;  5L99 A;  3S91 A;  2D9E A;  2L84 A;  5ENE A;  5FG5 A;  5HQ6 A;  4N4I A;  5E3D A;  5CQA A;  4NXJ A;  5CUB A;  5D3T A;  2NXB A;  4TT2 A;  5DFC A;  5FG4 A;  5LKX A;  4LZS A;  4O7E A;  3LQI A;  4QR5 A;  4E96 A;  2F6N A;  4ALH A;  2WP1 A;  5ENJ A;  5D3H A;  4KCX A;  4O72 A;  4QSV A;  5I7X A;  5LJ1 A;  4A9F A;  3AQA A;  3UW9 A;  4YYD A;  5FFV A;  3D7C A;  3HMF A;  5I88 A;  5FE8 A;  4ZQL A;  4CLB A;  4O78 A;  4A9E A;  5H1U A;  4QSW A;  5DYC A;  5ACY A;  4NR9 A;  4MR3 A;  3QZS A;  5A5N A;  2RS9 B;  5HRV A;  5CQ6 A;  2E7N A;  4YAB A;  4Z1Q A;  4QEU A;  5BT4 A;  4YAD A;  4BW4 A;  5DYA A;  4J3I A;  5FE3 A;  4YYK A;  5D3J A;  5CFW A;  4LZ2 A;  4NUC A;  4YBT A;  2N9G A;  4NR7 A;  4DON A;  2R0S A;  1N72 A;  4IR4 A;  5II2 A;  4UYH A;  3G0L A;  3O36 A;  4N4F A;  5CZG A;  4O7A A;  5CQ8 A;  3P1C A;  2OSS A;  4O71 A;  5LKZ A;  4CUQ A;  4A9O A;  5D26 A;  5HFR A;  3O34 A;  5IGM A;  4O7F A;  4NS5 A;  5FE6 A;  5FE7 A;  4TT4 A;  3MXF A;  2KTB B;  4QR4 A;  5LKU A;  4NYX A;  5AMF A;  4WHW A;  4UIX A;  5G4S A;  5IG6 A;  2DVV A;  5FB1 A;  5C8G A;  5E74 A;  5FE5 A;  4UIW A;  4QEW A;  4NR5 A; 
#chains in the Genus database with same CATH topology
 4O76 A;  2DVQ A;  5CUD A;  4N4G A;  4YC9 A;  2I7K A;  2RNX A;  5ENI A;  4WHU A;  3ERR A;  3G0J A;  5A83 A;  4BW2 A;  5FE2 A;  5JWM A;  4TYL A;  4CUS A;  3AAD A;  5FE1 A;  4QSQ A;  4TS8 A;  4BW3 A;  3IU6 A;  5I7Y A;  4LYW A;  4PCI A;  4HXL A;  4UIU A;  5DW1 A;  3U5P A;  2RI7 A;  5F61 A;  5FFY A;  4Q0N A;  5DW2 A;  3IU5 A;  3U5K A;  5DKD A;  5F2P A;  3DWY A;  3MB4 A;  5FH6 A;  5CTL A;  2DVS A;  5EWH A;  5L96 A;  4XUB A;  5DFD A;  5IGK A;  5FDZ A;  3QZV A;  3MUL A;  5D3P A;  4BJX A;  5A5S A;  4IR6 A;  4UIZ A;  4N3W A;  2YEK A;  5DYU A;  4A9K A;  3S92 A;  5C85 A;  4HXO A;  2YW5 A;  4UYG A;  4Z1S A;  4WIV A;  5DKH A;  4QYD A;  2R0V A;  2LSP B;  2YEL A;  5C7N A;  4AKG A;  2E7O A;  3U5N A;  5F1L A;  4IOQ A;  4UIY A;  5HEL A;  2D82 A;  5H85 A;  4HXK A;  3LQH A;  3UVX A;  3JVJ A;  5CRZ A;  4XY9 A;  4MR4 A;  3HMH A;  5TB6 A;  5CQ7 A;  4CL9 A;  4LRG A;  3DAI A;  4TZ2 A;  5DX4 A;  3FKM X;  5CUG A;  5IBN A;  4Z93 A;  4NRA A;  5EWC A;  3MQM A;  4A9J A;  5FBX A;  5ENG A;  5IGL A;  5HEN A;  1E6I A;  5E9I A;  4Q0O A;  4XUA A;  5EPS A;  5HM0 A;  5EPB A;  2I8N A;  4J0R A;  5CGP A;  5DYX A;  4PY6 A;  3UVW A;  2DVR A;  4YYJ A;  2RO1 A;  4QSX A;  4PKL A;  3I3J A;  5F5Z A;  5DKC A;  5E3G A;  4YYG A;  3U5J A;  3UVD A;  3GG3 A;  5CUA A;  5LVQ A;  5H1T A;  1ZS5 A;  4LYS A;  4YH4 A;  4NR8 A;  4UIT A;  5ETD A;  3RCW A;  3K2J A;  4QC3 A;  4CUT A;  5CU8 A;  3MB3 A;  4XYA A;  5EK9 A;  5EWW A;  5I89 A;  5E9Y A;  5IID A;  5F36 A;  4CFL A;  5HLS A;  5CQ5 A;  2YYN A;  3P1D A;  5AME A;  5I29 A;  5FE0 A;  4N4H A;  3ONI A;  4Y03 A;  3O33 A;  4YBS A;  5EPR A;  5LUU A;  4ZW1 A;  3D1B A;  5EWD A;  3Q2F A;  2DWW A;  2R0Y A;  5A5R A;  4CFK A;  1F68 A;  5D25 A;  4F3I A;  4PTB A;  5C89 A;  4KV1 A;  5A85 A;  1ZKR A;  4NR4 A;  5I80 A;  4IR3 A;  2YQD A;  3Q2E A;  4NQN A;  4GPJ A;  5F63 A;  5EQ1 A;  4RVR A;  5IGN A;  4QUT A;  5F62 A;  2FSA A;  2RNW A;  4LC2 A;  4NR6 A;  3JVL A;  4HXP A;  4YYM A;  5F3A A;  2YDW A;  4YYI A;  4MEQ A;  4QEV A;  5HEM A;  4HBX A;  4AI6 A;  4IOR A;  5CQT A;  5G4R A;  5C87 A;  5EIS A;  5CQ4 A;  4A9M A;  3P5O A;  5II1 A;  5KTU A;  5AD3 A;  4NRC A;  5AD2 A;  4MR5 A;  4O70 A;  5LKT A;  4YBM A;  3LXJ A;  4YH3 A;  5CY9 A;  4KV4 A;  1JM4 B;  1WUG A;  5I83 A;  4QST A;  1EQF A;  5L98 A;  5E0R A;  5H1V A;  5E9L A;  4OUF A;  4AKN A;  2R10 A;  4HXN A;  4YK0 A;  2E3K A;  5D3R A;  4PCE A;  5BT5 A;  3LJW A;  5D7X A;  4A9N A;  3D1D A;  4O7B A;  5HJC A;  5ETB A;  5E73 A;  5I86 A;  2DKW A;  5HRW A;  3O37 A;  3U5L A;  5CUE A;  5HRX A;  4A9H A;  5EV9 A;  4YAX A;  5D3L A;  4NQM A;  4O75 A;  5D0C A;  4HXR A;  3P1E A;  4LZR A;  5EU1 A;  2H60 A;  3U5O A;  4NRB A;  4HBV A;  4YAT A;  5KTW A;  5A5Q A;  4C66 A;  5DBM A;  5COI A;  4ZC9 A;  4LYI A;  5ENC A;  5EWV A;  4QY4 A;  2L85 A;  5CRM A;  4HXM A;  5D24 A;  3P1F A;  2OO1 A;  3UV5 A;  3U5M A;  3HME A;  5DLX A;  5FB0 A;  5C4Q A;  4AKI A;  5CQ3 A;  4J1P A;  2G4A A;  4NUD A;  5HCL A;  5DY7 A;  4TZ8 A;  4QSU A;  5F60 A;  4QR3 A;  4TTE A;  3UV4 A;  4UYE A;  4OGI A;  5FE4 A;  4X2I A;  5L8T A;  5CPE A;  4CUU A;  5J0D A;  4XY8 A;  5A7C A;  5L8U A;  5KO4 A;  4QSR A;  4CUR A;  3SVH A;  5EA1 A;  5JI8 A;  3VKH A;  4PS5 A;  4MR6 A;  4UYD A;  2OUO A;  4NYW A;  4UYF A;  1JSP B;  3SVG A;  5HFQ A;  4IR5 A;  5TCM A;  5ENB A;  3ZYU A;  4QNS A;  4A9I A;  3LQJ A;  5EIC A;  4J0S A;  4QSS A;  2WP2 A;  5L97 A;  2RNY A;  4Z6I A;  2MJV B;  4HBW A;  5E9V A;  4OGJ A;  3O35 A;  5EM3 A;  4QBM A;  5FE9 A;  4NUE A;  5ENF A;  4QSP A;  3UVY A;  4MEP A;  5D3S A;  4TT6 A;  4ALG A;  4YYH A;  4MEN A;  4LDF A;  2YEM A;  3VKG A;  5HQ7 A;  2DAT A;  4NYV A;  5A5O A;  5KU3 A;  4Z6H A;  4MEO A;  4UIV A;  5LJ2 A;  5KHM A;  4FLP A;  5A82 A;  3MUK A;  4QC1 A;  5CS8 A;  4LR6 A;  4YY6 A;  5F25 A;  3NXB A;  4O7C A;  5A5P A;  3UV2 A;  5FFW A;  5E9M A;  3JVK A;  4QB3 A;  4BHW A;  4HBY A;  4YYN A;  5ENH A;  5E7D A;  5BT3 A;  5CP5 A;  4C67 A;  2RFJ A;  4O74 A;  5LJ0 A;  3JVM A;  5CUC A;  5D3N A;  5I1Q A;  4IOO A;  4CUP A;  5I40 A;  4TU4 A;  5DLZ A;  4O77 A;  2F6J A;  4TU6 A;  3TLP A;  4HXS A;  4TQN A;  4UYF B;  1WUM A;  5FG6 A;  5KTX A;  5FH8 A;  4A9L A;  5EVA A;  3QZT A;  4QZS A;  5EP7 A;  4BW1 A;  5K29 A;  2L5E A;  4QUU A;  5FH7 A;  2GRC A;  5EGU A;  4QYL A;  5E9K A;  1X0J A;  5A81 A;  3SVF A;  5HQ5 A;  5F1H A;  4YY4 A;  5LVR A;  5DFB A;  5EI4 A;  5L99 A;  3S91 A;  2D9E A;  2L84 A;  5ENE A;  5FG5 A;  5HQ6 A;  4N4I A;  5E3D A;  5CQA A;  4NXJ A;  5CUB A;  5D3T A;  2NXB A;  4TT2 A;  5DFC A;  5FG4 A;  5LKX A;  4LZS A;  4O7E A;  3LQI A;  4QR5 A;  4E96 A;  2F6N A;  4ALH A;  2WP1 A;  5ENJ A;  5D3H A;  4KCX A;  4O72 A;  4QSV A;  5I7X A;  5LJ1 A;  4A9F A;  3AQA A;  3UW9 A;  4YYD A;  5FFV A;  3D7C A;  3HMF A;  5I88 A;  5FE8 A;  4ZQL A;  4CLB A;  4O78 A;  4A9E A;  5H1U A;  4QSW A;  5DYC A;  5ACY A;  4NR9 A;  4MR3 A;  3QZS A;  5A5N A;  2RS9 B;  5HRV A;  5CQ6 A;  2E7N A;  4YAB A;  4Z1Q A;  4QEU A;  5BT4 A;  4YAD A;  4BW4 A;  5DYA A;  4J3I A;  5FE3 A;  4YYK A;  5D3J A;  5CFW A;  4LZ2 A;  1PUO A;  4NUC A;  2N9G A;  4NR7 A;  4YBT A;  4DON A;  2R0S A;  1N72 A;  4IR4 A;  5II2 A;  4UYH A;  3G0L A;  3O36 A;  4N4F A;  5CZG A;  4O7A A;  5CQ8 A;  3P1C A;  2OSS A;  4O71 A;  5LKZ A;  4CUQ A;  4A9O A;  5D26 A;  5HFR A;  3O34 A;  5IGM A;  4O7F A;  2EJN A;  4NS5 A;  5FE6 A;  5FE7 A;  4TT4 A;  3MXF A;  2KTB B;  4QR4 A;  5LKU A;  4NYX A;  5AMF A;  4WHW A;  4UIX A;  5G4S A;  5IG6 A;  2DVV A;  5FB1 A;  5C8G A;  4AKH A;  5E74 A;  5FE5 A;  4UIW A;  4QEW A;  4NR5 A; 
#chains in the Genus database with same CATH homology
 4O76 A;  2DVQ A;  5CUD A;  4N4G A;  4YC9 A;  2I7K A;  2RNX A;  5ENI A;  4WHU A;  3G0J A;  5A83 A;  4BW2 A;  5FE2 A;  5JWM A;  4TYL A;  4CUS A;  3AAD A;  5FE1 A;  4QSQ A;  4TS8 A;  4BW3 A;  3IU6 A;  5I7Y A;  4LYW A;  4PCI A;  4HXL A;  4UIU A;  5DW1 A;  3U5P A;  2RI7 A;  5F61 A;  5FFY A;  4Q0N A;  5DW2 A;  3IU5 A;  3U5K A;  5DKD A;  5F2P A;  3DWY A;  3MB4 A;  5FH6 A;  5CTL A;  2DVS A;  5EWH A;  5L96 A;  4XUB A;  5DFD A;  5IGK A;  5FDZ A;  3QZV A;  3MUL A;  5D3P A;  4BJX A;  5A5S A;  4IR6 A;  4UIZ A;  4N3W A;  2YEK A;  5DYU A;  4A9K A;  3S92 A;  5C85 A;  4HXO A;  2YW5 A;  4UYG A;  4Z1S A;  4WIV A;  5DKH A;  4QYD A;  2R0V A;  2LSP B;  2YEL A;  5C7N A;  2E7O A;  3U5N A;  5F1L A;  4IOQ A;  4UIY A;  5HEL A;  2D82 A;  5H85 A;  4HXK A;  3LQH A;  3UVX A;  3JVJ A;  5CRZ A;  4XY9 A;  4MR4 A;  3HMH A;  5TB6 A;  5CQ7 A;  4CL9 A;  4LRG A;  3DAI A;  4TZ2 A;  5DX4 A;  3FKM X;  5CUG A;  5IBN A;  4Z93 A;  4NRA A;  5EWC A;  3MQM A;  4A9J A;  5FBX A;  5ENG A;  5IGL A;  5HEN A;  1E6I A;  5E9I A;  4Q0O A;  4XUA A;  5EPS A;  5HM0 A;  5EPB A;  2I8N A;  4J0R A;  5CGP A;  5DYX A;  4PY6 A;  3UVW A;  2DVR A;  4YYJ A;  2RO1 A;  4QSX A;  4PKL A;  3I3J A;  5F5Z A;  5DKC A;  5E3G A;  4YYG A;  3U5J A;  3UVD A;  3GG3 A;  5CUA A;  5LVQ A;  5H1T A;  1ZS5 A;  4LYS A;  4YH4 A;  4NR8 A;  4UIT A;  5ETD A;  3RCW A;  3K2J A;  4QC3 A;  4CUT A;  5CU8 A;  3MB3 A;  4XYA A;  5EK9 A;  5EWW A;  5I89 A;  5E9Y A;  5IID A;  5F36 A;  4CFL A;  5HLS A;  5CQ5 A;  2YYN A;  3P1D A;  5AME A;  5I29 A;  5FE0 A;  4N4H A;  3ONI A;  4Y03 A;  3O33 A;  4YBS A;  5EPR A;  5LUU A;  4ZW1 A;  5EWD A;  3Q2F A;  2DWW A;  2R0Y A;  5A5R A;  4CFK A;  1F68 A;  5D25 A;  4F3I A;  4PTB A;  5C89 A;  4KV1 A;  5A85 A;  4NR4 A;  5I80 A;  4IR3 A;  2YQD A;  3Q2E A;  4NQN A;  4GPJ A;  5F63 A;  5EQ1 A;  4RVR A;  5IGN A;  4QUT A;  5F62 A;  2FSA A;  2RNW A;  4LC2 A;  4NR6 A;  3JVL A;  4HXP A;  4YYM A;  5F3A A;  2YDW A;  4YYI A;  4MEQ A;  4QEV A;  5HEM A;  4HBX A;  4IOR A;  5CQT A;  5G4R A;  5C87 A;  5EIS A;  5CQ4 A;  4A9M A;  3P5O A;  5II1 A;  5KTU A;  5AD3 A;  4NRC A;  5AD2 A;  4MR5 A;  4O70 A;  5LKT A;  4YBM A;  3LXJ A;  4YH3 A;  5CY9 A;  4KV4 A;  1JM4 B;  1WUG A;  5I83 A;  4QST A;  1EQF A;  5L98 A;  5E0R A;  5H1V A;  5E9L A;  4OUF A;  4AKN A;  2R10 A;  4HXN A;  4YK0 A;  2E3K A;  5D3R A;  4PCE A;  5BT5 A;  3LJW A;  5D7X A;  4A9N A;  4O7B A;  5HJC A;  5ETB A;  5E73 A;  5I86 A;  2DKW A;  5HRW A;  3O37 A;  3U5L A;  5CUE A;  5HRX A;  4A9H A;  5EV9 A;  4YAX A;  5D3L A;  4NQM A;  4O75 A;  5D0C A;  4HXR A;  3P1E A;  4LZR A;  5EU1 A;  2H60 A;  3U5O A;  4NRB A;  4HBV A;  4YAT A;  5KTW A;  5A5Q A;  4C66 A;  5DBM A;  5COI A;  4ZC9 A;  4LYI A;  5ENC A;  5EWV A;  4QY4 A;  2L85 A;  5CRM A;  4HXM A;  5D24 A;  3P1F A;  2OO1 A;  3UV5 A;  3U5M A;  3HME A;  5DLX A;  5FB0 A;  5C4Q A;  5CQ3 A;  4J1P A;  2G4A A;  4NUD A;  5HCL A;  5DY7 A;  4TZ8 A;  4QSU A;  5F60 A;  4QR3 A;  4TTE A;  3UV4 A;  4UYE A;  4OGI A;  5FE4 A;  4X2I A;  5L8T A;  5CPE A;  4CUU A;  5J0D A;  4XY8 A;  5A7C A;  5L8U A;  5KO4 A;  4QSR A;  4CUR A;  3SVH A;  5EA1 A;  5JI8 A;  4PS5 A;  4MR6 A;  4UYD A;  2OUO A;  4NYW A;  4UYF A;  1JSP B;  3SVG A;  5HFQ A;  4IR5 A;  5TCM A;  5ENB A;  3ZYU A;  4QNS A;  4A9I A;  3LQJ A;  5EIC A;  4J0S A;  4QSS A;  2WP2 A;  5L97 A;  2RNY A;  4Z6I A;  2MJV B;  4HBW A;  5E9V A;  4OGJ A;  3O35 A;  5EM3 A;  4QBM A;  5FE9 A;  4NUE A;  5ENF A;  4QSP A;  3UVY A;  4MEP A;  5D3S A;  4TT6 A;  4ALG A;  4YYH A;  4MEN A;  4LDF A;  2YEM A;  5HQ7 A;  2DAT A;  4NYV A;  5A5O A;  5KU3 A;  4Z6H A;  4MEO A;  4UIV A;  5LJ2 A;  5KHM A;  4FLP A;  5A82 A;  3MUK A;  4QC1 A;  5CS8 A;  4LR6 A;  4YY6 A;  5F25 A;  3NXB A;  4O7C A;  5A5P A;  3UV2 A;  5FFW A;  5E9M A;  3JVK A;  4QB3 A;  4BHW A;  4HBY A;  4YYN A;  5ENH A;  5E7D A;  5BT3 A;  5CP5 A;  4C67 A;  2RFJ A;  4O74 A;  5LJ0 A;  3JVM A;  5CUC A;  5D3N A;  5I1Q A;  4IOO A;  4CUP A;  5I40 A;  4TU4 A;  5DLZ A;  4O77 A;  2F6J A;  4TU6 A;  3TLP A;  4HXS A;  4TQN A;  4UYF B;  1WUM A;  5FG6 A;  5KTX A;  5FH8 A;  4A9L A;  5EVA A;  3QZT A;  4QZS A;  5EP7 A;  4BW1 A;  5K29 A;  2L5E A;  4QUU A;  5FH7 A;  2GRC A;  5EGU A;  4QYL A;  5E9K A;  1X0J A;  5A81 A;  3SVF A;  5HQ5 A;  5F1H A;  4YY4 A;  5LVR A;  5DFB A;  5EI4 A;  5L99 A;  3S91 A;  2D9E A;  2L84 A;  5ENE A;  5FG5 A;  5HQ6 A;  4N4I A;  5E3D A;  5CQA A;  4NXJ A;  5CUB A;  5D3T A;  2NXB A;  4TT2 A;  5DFC A;  5FG4 A;  5LKX A;  4LZS A;  4O7E A;  3LQI A;  4QR5 A;  4E96 A;  2F6N A;  4ALH A;  2WP1 A;  5ENJ A;  5D3H A;  4KCX A;  4O72 A;  4QSV A;  5I7X A;  5LJ1 A;  4A9F A;  3AQA A;  3UW9 A;  4YYD A;  5FFV A;  3D7C A;  3HMF A;  5I88 A;  5FE8 A;  4ZQL A;  4CLB A;  4O78 A;  4A9E A;  5H1U A;  4QSW A;  5DYC A;  5ACY A;  4NR9 A;  4MR3 A;  3QZS A;  5A5N A;  2RS9 B;  5HRV A;  5CQ6 A;  2E7N A;  4YAB A;  4Z1Q A;  4QEU A;  5BT4 A;  4YAD A;  4BW4 A;  5DYA A;  4J3I A;  5FE3 A;  4YYK A;  5D3J A;  5CFW A;  4LZ2 A;  4NUC A;  4YBT A;  2N9G A;  4NR7 A;  4DON A;  2R0S A;  1N72 A;  4IR4 A;  5II2 A;  4UYH A;  3G0L A;  3O36 A;  4N4F A;  5CZG A;  4O7A A;  5CQ8 A;  3P1C A;  2OSS A;  4O71 A;  5LKZ A;  4CUQ A;  4A9O A;  5D26 A;  5HFR A;  3O34 A;  5IGM A;  4O7F A;  4NS5 A;  5FE6 A;  5FE7 A;  4TT4 A;  3MXF A;  2KTB B;  4QR4 A;  5LKU A;  4NYX A;  5AMF A;  4WHW A;  4UIX A;  5G4S A;  5IG6 A;  2DVV A;  5FB1 A;  5C8G A;  5E74 A;  5FE5 A;  4UIW A;  4QEW A;  4NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...