5DYMA

Crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
96
Chain Sequence
b'GYIDILIVSILEKKDCYGYEIAKQVRERSEFLKEGTMYLALKRMESKNLIKSYYSNEQSSGGRRKYYNLTNEGKDFLEIKKQEWRFIKKVMNQFLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PadR-family transcriptional regulator
publication title Crystal structure and DNA binding activity of a PadR family transcription regulator from hypervirulent Clostridium difficile R20291.
pubmed doi rcsb
source organism Peptoclostridium difficile (strain r20291)
molecule tags Dna binding protein
total genus 35
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dymA00
4IPAA 3GXOA 2FEZA 1YFHA 2UXNA 1O3TA 4CDGA 2W57A 4EJOA 4HF1A 3M7GA 1DPRA 1UFMA 4FHTA 4Z2YA 3FMSA 3WTZA 1U2WA 1HW2A 4OINF 2P4WA 3M1EA 4KN7X 3W6JB 4AWXB 5LHHA 1BJAA 3G73A 5CJ9A 4EJUA 2RDPA 2OAZA 4MTEA 3JW4A 4UVCA 3VEPA 4ENNA 4IHSA 1REPC 1KQ9A 4R79A 2NNNA 2XAFA 1XSXA 4KIGA 1BM9A 2M8EA 5HS9A 4A0XA 2VT3A 3F6VA 5FD6A 5FFZA 1FBUA 1SD4A 2RKHA 2QYOA 2O6GE 4OIPF 1MDMB 2YU3A 4RS8A 3VODA 2D45A 2ZO4A 1JGSA 5LEKA 3QAHA 4M71A 2F5EA 1LQ1A 1ONVA 4BQAA 2K7LA 4KN4X 1EH6A 2PBIA 3K69A 3OOPA 1USTA 2VOPA 4M6XA 2AXLA 3FHZA 4A5NA 2YX4A 5D4SA 3BP8A 3HUGA 3BPXA 3QRFF 1R36A 3HRUA 3G3ZA 4RAYA 5DD4A 2ZKZA 4U88A 1BI2A 4EJTA 1OPCA 1J59A 3L00A 3RI4A 3QU3A 5AIQA 2JPBA 3BDDA 2MH2A 2ZBKA 4LFUA 1YIOA 4UUVA 2R3SA 3K1PA 2M5WA 4FT8A 5ICCA 5J8CA 3WE2A 3FXUA 4L0ZB 1G3YA 3ZN1A 3WE3A 2FF4A 4FX0A 2XAQA 3WG9A 4P55A 2DU9A 4IJAA 4B09A 5CVJA 2HR3A 3FWEA 3TOBA 1PDNC 1QZZA 1W5TA 5DCMB 5L3BA 5CLSA 4YG2F 4ZYDA 5ERIA 3ML6A 1S8NA 1SFXA 1XGOA 4LB6B 3SQNA 3VFZA 3R0JA 2DTRA 1MZBA 3F8BA 1L0OC 4I01A 1QGPA 1IN7A 1V4RA 3F8FA 5A2QZ 2V1DA 1O3RA 1IAWA 1LVAA 1LJ9A 2ESHA 4UNOA 3GWZA 5EEHA 3BWGA 4HW0A 1KYZA 4MEXF 1IZ1A 2QBYA 3U1DA 4RGXA 3J80Z 2ZFWA 5DYMA 3HSRA 3ZP5A 2STTA 5TRDA 4HBLA 3CO6C 2CG4A 1GHCA 2CO5A 2KKOA 1YYVA 5AONA 3KZZA 4LLNA 2HQRA 1FP1D 3S2WA 4JK1X 1DPUA 2M45A 2EA2A 1YQAA 5IT9Z 1FT9A 2FNPA 2CFXA 1HQCA 1ZAOA 2UXXA 3I59B 3BROA 4L9VA 4QLCU 1OYWA 3C18A 3I58A 1U3EM 1T2KA 3GO5A 3V7SA 1HSJA 4K2EA 1W5SA 3NQOA 4LD5A 1WI9A 1UHWA 4RB0A 3KEQA 3L7WA 3CUOA 5BOXA 5BQTA 4HF2A 2Q2EA 3ISPA 2H6BA 2ACJA 5LHIA 2NAZA 2QLZA 1DDNA 3NEUA 4LMYA 3B02A 3JAMZ 4L0YB 3WTSC 3TO7A 1J9IA 5LRSA 3FXRA 4JBAA 2HGCA 2YSRA 4WX9A 1G6NA 5D6FA 2XRNA 3SZTA 1XSVA 3MZYA 3I59A 1RUOA 2F2EA 3MFKA 4AD9A 1X3UA 2STWA 1OYYA 4QWQA 4GCVA 4UV9A 3DQVC 2HYFA 2W85A 1BOAA 4MHGA 1IN5A 2A6HF 2Q8KA 4EJWA 1D8KA 2ELHA 4PDKA 1ZHFA 1B59A 5HDKA 3ABUA 2X0LA 2IJLA 2GZWA 1ZRFA 2IA1A 1MJAA 1ON2A 4EGZA 4M9XA 3KP4A 3WTYC 3FXQA 1USSA 3ECOA 1D8JA 4O3MA 4OIRF 3IC7A 2HEOA 1ZRDA 5H20A 4P9UA 5HLGA 1IXCA 1XB4A 1BI0A 3GZ5A 5DUKA 4U7DA 4MQ9F 2MA3A 2XV4S 1FSEA 3IL2A 3H92A 3MCZA 1J0RA 2L3DA 3ZMZA 3IRRA 4XLPF 5BMZA 3V8LA 1TNTA 5D5WB 3I54A 3E6MA 2IRFG 1Z6RA 3QU6A 2K02A 1P92A 3K1MA 4LLGF 4BHCA 1UCRA 3H3UA 3I0TA 4IVNA 4P96A 3E3VA 5DCFA 4ENKA 3DV8A 3FMRA 4DNCA 2QENA 2DO7A 1R00A 1S7AA 5LLQA 5HLIA 1GVJA 3WU1B 1HW1A 2JSCA 3QPHA 4LLLA 4G7HF 2BYVE 3LQRA 3KFWX 4UVBA 4XSZF 3TO9A 1G4DA 2R7FA 5J6XA 1LB2A 4N9HA 1MJBA 1FYMA 1FBQA 2VE8A 1O57A 3WGGA 5FLXZ 2LKPA 1ODDA 2MLKA 3I53A 3F3XA 3ABTA 3HHHA 3O6BB 2PEXA 1KU9A 4UVAA 4MTDA 4WF2A 3D5LA 1Z05A 3OV8A 2FE3A 3RKXA 3I64A 5CVVA 2VBWA 2EFWA 4XBFA 4ZYGA 5LGUA 1F9NA 4L9JA 3C7JA 2P6TA 4N0BA 5HDNA 2EV5A 3C3WA 2DK8A 2CSOA 3U2RA 1YTYA 2PG4A 1EV7A 4LGWA 5LBQA 4IRIA 1ZYRF 3E5UA 2Y48A 1YW8A 3RYPA 1O3SA 2XAJA 1P4WA 5CVRA 2ISYA 4EM1A 1T39A 5BPDA 1K78A 2XIGA 1WSUA 2FBHA 1FLIA 1YW9A 4EQQA 2H09A 3IKTA 3DPLC 2FU4A 2KIMA 4EJVA 1WQ2A 2FOKA 3GYHX 3F6OA 4A2UA 3LA3A 2CYYA 4G7OF 3GLXA 3IWFA 1FX7A 2FMLA 1MKMA 3JTGA 4LB5A 1NHAA 2V1XA 2DW4A 2VN2A 1XGMA 2RV8A 4U0WA 3LFKA 4ON0A 1Z1DA 1TW3A 5FFXA 4LG0A 1J7KA 3WTUC 5D5VB 4HQMA 2EWNA 3LQQA 1H9TA 1QPMA 2DT5A 1K6OA 1W7PB 3ERED 3TDZC 2K4JA 1DP7P 1A04A 2A61A 4O5VA 3BZ6A 5A2QK 2P5KA 3JSOA 2JTVA 1ZARA 3F23A 4EVIA 3HTUA 1FOKA 1KA8A 4BYYA 4Y17A 5FO5A 2HTJA 3IWZA 5ICFA 3TKYA 2E1NA 4U0YA 5ICEA 2G7HA 2NNYA 2LF7A 2FRHA 3RTRA 1IRFA 2XROA 3LSTA 1Q1HA 4ZH4F 3DXJF 2A68F 2GA1A 4OIOF 3V7CA 3VOEA 4CO8A 2IT0A 2FMYA 4M6YA 3GEZA 4M72A 4L9TA 2C6YA 2L02A 1BIBA 2GXBA 5L3DA 1STZA 2RNJA 1W7PA 4M74A 4KT5C 2KIUA 1BIAA 1OKRA 3RYRA 1MDMA 4CXFA 4CGZA 2NRAC 3JTHA 1Z6TA 2HKOA 2PLYA 1ZG1A 3GX4X 2AS5F 1O7LA 4H0EA 4RB1A 4YIIA 5LRRA 1FC3A 3O2PE 2XKOA 1OYIA 3T8RA 3ZPLA 4PCQA 4N9IA 3ZMUA 3LA2A 1JXSA 2H27A 2VODA 4MGRA 2GXGA 2EV6A 1YLFA 2F5CA 1J75A 3J7AO 1U78A 4KDPA 3JAMK 3N4MA 4GGGA 2QUFA 1U8RA 2IA2A 3KEOA 3NRVA 3PFIA 3ROUA 1O7FA 4NHJA 2RVCA 3F72A 5D5XB 4RB2C 2B0LA 3KLNA 4Q47A 4GYIA 1KU7A 3HRTA 2VONA 2PI0A 4HF0A 1R1UA 1XCBA 3MEXA 3V4GA 4EM0B 1RNLA 2OA4A 3T5XA 2IPQX 5D6EA 3ECHA 1D3YA 3LAPA 1LEBA 2FSWA 1TLHB 2ZXJA 3T0YA 3P7NA 2KJCA 4OIQF 2MC3A 4O6JA 2F5DA 2LSOA 1SAXA 5DCMA 3W6KB 4WXDA 2CQKA 4LK0F 3RDIA 2EFQA 1BC7C 2KJBA 5LGTA 2DQRA 1ZH5A 4KMUX 2PN6A 1TQPA 4A0ZA 2VC1A 3F8NA 1U5TC 3SXYA 1RIOH 5DUIA 3M8EA 5E20A 2W25A 4G7ZF 2OZUA 1Y0UA 4OMYA 3KP5A 5L3EA 1L3LA 2BE5F 1T0FA 5J8FA 4G6QA 3RIRA 4HX7A 1U5TB 4Q48A 3TGNA 3I71A 3RPUA 2H94A 5ILSA 3V8JA 5FB2A 4OOIA 2IP2A 1G3SA 4OMZA 2VC0A 1E2XA 1G3TA 5F1RA 2HTSA 1E17A 2DFIA 3CDHA 2FNAA 2WV0A 4WK8F 4ZZLA 1R5HA 1JE8A 5E8IA 3Q9VA 5E18F 2EFPA 3J81Z 3M8FA 3PQKA 1JHHA 1OMIA 3KP2A 4R1HA 3EUHA 1LDDA 1U6GA 3R6SA 4HDVA 3ZMVA 1IN6A 1AOYA 3TO6A 1PP7U 4Y15A 4IXAA 5FLXK 1KU3A 5ILUA 2MD5A 5ED4A 2A3SA 4A5MA 4AIKA 1D5VA 1TNSA 1WKMA 1MD0A 2DBBA 3EDPA 1FWZA 2QVOA 2D1VA 3KP7A 5DV5A 2HQNA 4I98B 6PAXA 3GF2A 2FQ3A 2BBYA 2XKPA 3SHFA 1S6LA 4KIFA 1H9GA 2HYGD 3K2ZA 3O3KA 4AIHA 1QBJA 2X4HA 5FD5A 2VOOA 4E70A 3GFLA 2Y0MA 2PJPA 2HS5A 3CUQC 1KU2A 2M1BA 4U7BA 2P6SA 2V6CA 3ZMDA 3QPTA 5FGMA 5F6FA 2JT1A 4JQFA 3PQJA 3HOTA 3E97A 4R8HA 3L2CA 3L9FA 1IXSB 4HYEA 3AAFA 4RGUA 5LHGA 2NYXA 4A6DA 1W7PD 3CUQB 2FBKA 3MWMA 1YW7A 3QP6A 4ESFA 2QM3A 2OQGA 1LNWA 5E8GA 2COMA 3GW2A 1SFUA 3ZMTA 5KVRA 3HTSB 1XCVA 1IN4A 4A0YA 2PMHA 5JR3A 2KRFA 4CICA 3KCCA 4WCGA 2A69F 4EGYA 4NQWA 2XUBA 2QQ9A 2YX7A 1IRGA 1B9MA 1ZGJA 3RKYA 2XHKA 3EQLF 1FP2A 3WTVC 2DLLA 3MZHA 2V79A 4TV7A 2XGXA 3CLOA 2EFNA 1XGSA 3HRMA 2GWRA 4LJZF 4BHPA 3N97A 2BV6A 2LDUA 1BI3A 5H6QA 1P2FA 4M9SA 3HIFA 3FMQA 3EETA 2W24A 3BJOA 2K27A 3CUQA 3LAJA 2G9WA 2BEOA 2Z3YA 1ZG3A 3MAJA 3GVAA 3I4PA 3VB2A 4ENMA 3HYIA 2OBPA 4HDUA 2DPDA 5HLHA 1ON1A 1HW5A 3Q9SA 4D0PA 1HBXG 3BJAA 2NS0A 4I0BA 1JHFA 2M87A 4P9FA 4L5JA 5CYVA 4NB5A 1FBSA 1TW2A 5K5OA 4KFCA 4U0VA 1FPQA 1LEAA 1MJ9A 2EFOA 1YS6A 1KQ0A 5D5UB 4KYWA 3QP5A 2L54A 3U9GA 3E5XA 1BC8C 4F7ZA 3RPQA 2XASA 5TJJA 1ZLJA 4RGRA 2DI3A 1Z91A 4MQVA 1HKQA 3KETA 4PZJA 3F8MA 2VT2A 5H6RA 2V9VA 5DDGA 2KIFA 1ZN2A 5HVQC 2O0YA 3R0AA 4BHBA 1S7OA 1R7JA 2E7WA 2RGVA 2YR2A 2ISZA 1P4AA 4HLXA 3IKVA 3RKWA 3P9IA 2J5PA 5JVTA 1KQ8A 4HZFA 4A6EA 2Z5UA 2IA0A 3RJPA 2GA2A 3CO7C 5BS6A 4XRFA 3TQNA 5CVIA 4YIFA 4CHUA 3KP6A 2MH9A 2OQRA 2P8TA 2RN7A 1ULYA 5K1YA 1K79A 3V8KA 3H3ZA 4IRGA 3KLOA 3GZ6A 1O3QA 3F8CA 5K5RA 2LNBA 2VBXA 3TDUC 2L4AA 3C1DA 3WGIA 4KUMA 3IRQA 4CZZA 1SMTA 4G6DA 1HXDA 1QQIA 4KA4A 1TBXA 4GO1A 4WWCA 1IW7F 5D4RA 3CJNA 3J80K 1R23A 4Y13A 3GFIA 1BI1A 4G8XA 2L01A 4L5IA 3BOQA 5DD8A 1H0MA 3V7RA 3DP7A 3WTWC 5BPIA 5E17F 1LDKB 2O61A 1S29A 5HDGA 5IT9K 2QWWA 2J5OA 4GXOA 4L18B 3IHUA 1QO0D 1IF1A 2O03A 4DQ2A 3R60A 1SD6A 3FZVA 4P5OA 2ZNZA 4LK1F 2IVMA 1R58A 2JRTA 1PP8F 4PGGA 1XMAA 3FX3A 1ZLKA 2HWVA 1ZRCA 1YS7A 3WTTC 4L9NA 2JZYA 2Z99A 1QNTA 2TDXA 2ZMEB 1T6SA 4UV8A 2ESNA 2HKXA 5CVUA 4HV5A 3L09A 2XVCA 4B8XA 3R4KA 4HV6A 2XAGA 5L3GA 3KP3A 2Y75A 1RUNA 2P7VB 1GXPA 2VE9A 3E6BA 5KK1A 1FSHA 5EEGA 3J81K 4KIBA 1T38A 3T1BA 2PFBA 4KNYA 1BBYA 4YFXF 2EA4A 4HX4A 4IF4A 5LGNA 5ICGA 2VBZA 3HSEA 4ESBA 2QBYB 1GXQA 1IN8A 3K9TA 5AIPA 2G7UA 2Q0OA 3HSFA 5JHUA 1W4MA 1G3WA 3ZN0A 3GFMA 1FYLA 1XD7A 2A6EF 2ZMEA 2ZCWA 4Q5SF 1IXRC 4YFNF 3ULQB 3K0LA 2XAHA 1HSTA 2Z33A 2DPUA 1QZYA 4BH9A 1XN7A 1SD7A 1TTYA 3E6DA 4I2OA 5ILVA 1YO5C 3KZYA 1ZG5A 1J2XA 2GQQA 2R7DA 5HS7A 4S04A 5K5QA 4IHTA 4PGHA 2A5YB 1R1VA 1T98A 4UXNA 1HKTA 1FZPB 2VBYA 1XSDA 3M9AA 2P5VA 2FA5A 4RAZA 4ZZDA 2HFHA 3COAC 1DUXC 1SMYF 1Z7UA 4ETSA 4UHTA 4AIJA 3FM3A 2DAOA 3GUDA 3KE2A 2DQLA 3E5QA 2ZJ2A 2D1HA 2M30A 1UHMA 5D8KB 2QQBA 4HAMA 1XDUA 2EJRA 1OR7A 2OU2A 5F64A 4XLNF 2A07F 3K1NA 3SZPA 5E1XA 4MEYF 1SFEA 1F4KA 4OU0A 2GAUA 3DF8A 2JPCA 5JI6A 2H6CA 1ZGAA 4XSXF 3DFGA 1B4AA 1XDSA 2WWYA 4WXCA 4KICA 4MNUA 1V3FA 3JSPA 1B9NA 1C0WA 2DK5A 1RZ4A 4I09A 1P6RA 3DKWA 4ZYEA 2O3FA 1WWXA 4M73A 3HRSA 2Z9OA 2ADUA 1CF7B 3P9KA 3LA7A 3ZQ7A 1FNNA 4HOBA 3MQ0A 3DPTA 2CW0F 4EM2A 3SFZA 4BXUA 3E6CC 2ETHA 1U5TA 2HZTA 2GIVA 2UZKA 3I5UA 2WC2A 3F22A 1I1SA 2P7CB 2QQAA 4I02A 3B73A 2FXAA 4BAYA 2W84A 1R22A 2EK5A 4S05A 2EB7A 1R1TA 4A12A 2WTEA 4HQEA 4EMSA 2O8XA 3LWFA 2K4BA 4I0AA 2OD5A 2RC4A 2D2WA 5HS8A 5IT3A 1IUYA 2CWEA 1CF7A 2MBFA 5L3FA 4BNCA 1R5GA 4RB3C 5HOOA 4YFKF 4HX8A 5L3CA 1WRJA 1FYKA 4KMFA 1CGPA 1BN5A 3WU0A 3P9CA 2BGCA 4I7HA 4ASNA 4EV0A 1UB9A 2P5LC 3HOSA 1P4XA 1KYWA 3ZMSA 4CYDA 1B1BA 3EYYA 4IRHA 2QZ8A 2PMUA 2EV0A 2VXZA 2F5FA 3HHGA 1EH8A 1Z9CA 1I5ZA 4G94A 4ENJA 1AWCA 2HDCA 3FF5A 1RI7A 1TQMA 2RQPA 3BJ6A 3QOPA 3CTAA 1ZREA 4Q4ZF 5E1WA 1B6AA 3D0SA 3GFJA 4G9YA 5E1ZB 2UWMA 4ZYHA 1FY7A 1I27A 1SD5A 2CGPA 1XGNA 5D8LB 3WGHA 1I1GA 2LF8A 3F21A 4FX4A 3BPVA 4HA8A 3FM5A 1TQIA 1HKSA 3WODF 4AVPA 2L4MA 3T8TA 3TOAA 5JFRA 1KGSA 2PQ8A 3Q5FA 1F1ZA 2V1UA 3WTXC 2MLGA 3DEUA 1K78B 3EYIA 2ZNYA 1MGTA 3R61A 2OZ6A 2E1CA 4GYGA 2YPRA 3ELKA 1S3JA 3BY6A 1EH7A 1YG2A 5DEQA 2K86A 1XMKA 2FBIA 4RGSA 4WXHA 1PUEE 1J5YA 4ESJA 4LG0B 1F5TA 2HOEA 4HLYA 1LDJA 5LEJA 1K7AA 4M9ZA 2E7XA 1I6XA 3REOA 2IW5A 1VTNC
chains in the Genus database with same CATH superfamily
1ETVA 4IPAA 3GXOA 2HOTA 5M3FJ 2FEZA 4IQ4A 2JA5J 1YFHA 4AYBA 3GTQJ 1Z0XA 2UXNA 2W48A 1O3TA 2R0QC 4CDGA 1UHSA 2W57A 1RKTA 2CMPA 3A02A 3ABMH 4AU7A 4EJOA 4HF1A 3M7GA 4C3IJ 1DPRA 3PIPF 3CDIA 1UFMA 2VIXA 4FHTA 1AHDP 4Z2YA 3FMSA 3WTZA 1U2WA 2KZVA 1HW2A 4OINF 2P4WA 1JT6A 3M1EA 4KN7X 5EG0B 3W6JB 4AWXB 3I4MJ 5LHHA 2DOEA 1BJAA 2K9MA 3G73A 2OJED 4X1EA 2ZC2A 5CJ9A 4EJUA 2RDPA 2OAZA 1MMAA 1Y8RB 3E7LA 4MTEA 1OCCH 2DTZA 1UAAA 2H8RA 2Y9ZA 5EDNA 2HVRA 3JW4A 1SEUA 4UVCA 2KZGA 4XKBA 2ZSHB 1NK2P 3VEPA 1P9QC 1X2NA 2Z16A 5C44J 1K6YA 4ENNA 4IHSA 1RC9A 1REPC 1KQ9A 4R79A 2NNNA 4IHXA 4BQOA 2XAFA 2I10A 1XSXA 4KIGA 1ZELA 3HZJA 1ETXA 2L5QA 3TP3A 3V42A 3TMOA 2OCEA 1BM9A 2M8EA 5HS9A 2LTPA 4A0XA 3LL7A 2F4OB 2IEKA 1ZTRA 2VT3A 1IRXA 4N4OB 5IP7J 3F6VA 5FD6A 5FFZA 1FBUA 1SD4A 2DJNA 3M3YJ 1IRZA 2RKHA 2QYOA 2X51A 2LY9A 2O6GE 1H89C 3ZGKA 4OIPF 1MDMB 1JKQC 3L2UA 1WJBA 2YU3A 3BZCA 3HM5A 4RS8A 5F04A 3VODA 4W97A 1VQ6I 2D45A 2LP0A 1MBFA 2ZO4A 1E0EA 4F55A 1W0UA 3TL4X 4II2A 3CCSI 1JGSA 1Z77A 3X2QH 5LEKA 3LOCA 3QAHA 4M71A 2F5EA 5IYBJ 1LQ1A 1ONVA 3LSGA 4BQAA 2K7LA 4KN4X 1EH6A 2Y69H 1RR7A 2PBIA 3K69A 2EZHA 2JA7J 3OOPA 3A2KA 2W82A 3QPSA 4GRIA 1OFCX 1USTA 2VOPA 1SVLA 3KYCB 4M6XA 2AXLA 3FHZA 3HKZN 3W3CA 2NS7A 4A5NA 2YX4A 5D4SA 3BP8A 2R5ZB 4A3DJ 3HUGA 3MD2A 1VQPI 3BPXA 4C30A 3QRFF 3PUBA 1DP3A 4D5FA 1R36A 3HRUA 3G3ZA 4L5EA 1VQ8I 1VQNI 1OCZH 4RAYA 5DD4A 2ZKZA 4Y4RA 4U88A 1ERDA 4M3EA 1BI2A 4DOZA 2KHMA 2R7WA 4EJTA 2GLOA 1OPCA 1WJDA 2ECCA 1J59A 1X2MA 3L00A 3RI4A 3QU3A 5AIQA 4CCKA 2CV0A 3RZOJ 1DU0A 1HOMA 2JPBA 3FXKA 3PM1A 3W2VA 5JLWA 4C2MJ 3BDDA 3S1QJ 2X6XA 1JUPA 1R5ID 2MH2A 2ZBKA 4LFUA 1YIOA 4UUVA 2H8WA 2Z2SB 3BR1A 5IP9J 2R3SA 3K1PA 4FQGA 1X1BA 2BOLA 5IPAA 2M5WA 4M3FA 3E1SA 4FT8A 5ICCA 5J8CA 3DWLE 3S93A 3S2HJ 4XIDA 3WE2A 3FXUA 2XRLA 2IGKA 3B6CA 1Y8QB 4L0ZB 2MD0A 2X1DA 1G3YA 3ZN1A 3WE3A 4BBSJ 2FF4A 4I6ZA 4FX0A 3DBRB 4Y52J 2XAQA 3WG9A 4P55A 1JJ8C 2DU9A 4IJAA 4B09A 1SAUA 5CVJA 1WZ2A 2HR3A 2R5ZA 3PSIA 4DW6A 2KP6A 2B7EA 3FWEA 3TOBA 1PDNC 1QZZA 3CMAI 1R9TJ 2DA4A 4BKXA 4KISA 1W5TA 5DCMB 5L3BA 5CLSA 3HXLA 3DKYA 4J01A 3HEFA 4M3GA 3CC7I 2BXYA 4YG2F 2L9NA 3OS2A 2O9LA 1T0FC 4ZYDA 3A1YA 4OAZA 5ERIA 3ML6A 1S8NA 1SFXA 1XGOA 1UG2A 4MFEA 3NWTA 4LB6B 4HRIA 2DA7A 4FE7A 4EATA 3G1OA 3DTEA 3SQNA 1OISA 3VFZA 3R0JA 5HLTA 3DPUA 2DTRA 1MZBA 3F8BA 1L0OC 4I01A 1QGPA 1IN7A 3DBLB 1V4RA 3F8FA 5A2QZ 2V1DA 5J47A 4XRSA 1N77A 4C2TA 3A0BC 1O3RA 1QZEA 4RBOA 1WJAA 1IAWA 1BL0A 5DM6F 5F0FA 1LVAA 4QTRA 5FKLA 1LJ9A 4ZC3A 2ESHA 3WHCA 4BS9A 4UNOA 3GWZA 2X9DA 2R7RA 5EEHA 2R7OA 3C2BA 3BT9A 3BWGA 4HW0A 1KYZA 3DU5A 4MEXF 1IZ1A 2VLAA 3U1DA 2RREA 2IGMA 2QBYA 2BHYA 3K4MA 4RGXA 3J80Z 2WAQN 2ZFWA 5DYMA 3OYDA 3HSRA 3ZP5A 2STTA 4HBLA 5TRDA 3HOVJ 3CO6C 2CG4A 1GDTA 1GHCA 4H4KC 2CO5A 1WI3A 2KKOA 1YYVA 2FOWA 3RKQA 5AONA 2WA0A 3KZZA 2Q2EB 4RA2A 2CV1A 2HQRA 3CCEI 4LLNA 3RQIA 1FP1D 1R4MB 4M3DA 1A36A 3S2WA 2MYSA 5F1JA 4JK1X 2GXAA 4C3JJ 1DGRM 2XPUA 2F6CA 5E3LA 1DPUA 2JSPA 2GIZA 2M45A 2EA2A 3SEZA 1YQAA 3HGGA 3OYLA 5IT9Z 5GTIC 2OTLI 3KIOA 3ZQLA 2VJ5A 4XICA 3JCUC 1FT9A 2FNPA 1HA8A 5H2FC 2CFXA 1HQCA 1ZAOA 1I39A 3G71I 2UXXA 3I59B 3BROA 4L9VA 3AG1H 2Q1ZB 1H8AC 1P7IA 4BE2A 4QLCU 2PMZA 5FJ8J 1OYWA 3C18A 3Q0WA 3I58A 3CCRI 5J4VA 1U3EM 1T2KA 3S32A 3IV5A 2X1EA 3AG3H 3GO5A 3V7SA 3OY9A 1HSJA 4K2EA 2Z1DA 3PSFA 1W5SA 3NQOA 1BOBA 4LD5A 2HQ5A 1WI9A 5BNGA 1UHWA 2WAQA 5HNFA 2L0KA 4RB0A 4BGDA 2CW7A 3KEQA 3L2VA 3L7WA 1XX5A 4IZZA 3CUOA 3S14J 5BOXA 5BQTA 2HVSA 4HF2A 2AHQA 2Q2EA 1D0YA 3JRBA 2MC4A 3ISPA 2BW3B 1LFPA 2M3AA 2H6BA 1AA7A 2HNHA 2ACJA 2V4JC 4HSTA 5LHIA 2NAZA 3OOUA 2QLZA 4PJ0C 1DDNA 2PJRB 3NEUA 4LMYA 5KHDA 3B02A 5K7HA 1BW5A 2E2HJ 2O5RA 3JAMZ 2LY1A 1W1WE 2AXTC 1OCPA 3HDDA 4L0YB 2KIQA 3WTSC 3TO7A 4DBQA 1J9IA 3PNTA 5LRSA 2WAEA 3FXRA 2CQNA 4JBAA 2DA2A 2ECBA 4ANJA 2HGCA 2YSRA 4GDFA 4WX9A 4XRMA 3VSKA 4HNUA 1G6NA 4A3KJ 5D6FA 2HDWA 2XRNA 3SZTA 1XSVA 2BHZA 2RQQA 4IO9F 3MZYA 3I59A 2CS3A 1RUOA 3LNQA 2LD5A 2F2EA 3BR3A 3CQZJ 2OCCH 3H35A 4B47A 3MFKA 4AD9A 5KAIC 1X3UA 3SDBA 2STWA 1P7JA 1PYVA 4RAGA 2WY7Q 1YJWI 1OYYA 4QWQA 1RETA 2KRHA 4GCVA 4IHWA 4UV9A 4YRVA 1UG0A 3DQVC 1LPQA 2HYFA 3GTOJ 2W85A 1BOAA 3BR2A 1IN5A 4MHGA 3CCMI 4UB6C 2A6HF 3FBIB 4BY1J 2Q8KA 4EJWA 3CMYA 1D8KA 3LSJA 2ELHA 2B9SA 4PDKA 2LLKA 1ZHFA 2XDVA 1LUJB 1B59A 5HDKA 3ABUA 2WADA 2X0LA 2IJLA 1TC3C 1FMVA 3IAM2 2GZWA 3K70C 1ZRFA 4XLFA 3FXOA 4B4CA 2R7ZJ 2IA1A 4ZTJA 1MJAA 1ON2A 1TZLA 4DJAA 4EGZA 4M9XA 2BW3A 3KP4A 3WTYC 3FXQA 2VJJA 1JKOC 1USSA 3ECOA 1D8JA 4O3MA 2CQQA 4OIRF 3IC7A 2HEOA 4A93J 1ZRDA 5H20A 4P9UA 5HLGA 5M5XJ 1IXCA 1XB4A 1BI0A 3GZ5A 5DUKA 4U7DA 3I4NJ 4MQ9F 2HPIA 4II3A 1VQ7I 1ZR2A 1D0ZA 2MA3A 2VQCA 2XV4S 5E3NA 3BTCA 1FSEA 5FROA 5GAEJ 2VKHA 3IL2A 3H92A 3MCZA 1J0RA 2V7FA 5HNHA 2L3DA 1IV6A 3ZMZA 2NXNB 3IRRA 2HXOA 1X4PA 4XLPF 5BMZA 3V8LA 1TNTA 3OSGA 3VYSB 5D5WB 3I54A 3E6MA 3UNGC 2IRFG 2MFZA 4A3CJ 1Z6RA 3WU2C 4CA0A 3QU6A 2K02A 1P92A 3K1MA 4LLGF 4BHCA 1UCRA 3A03A 3H3UA 3I0TA 4ZDLA 4IVNA 4P96A 3E3VA 4BY7J 3U1KA 1JKPC 3GTKJ 5DCFA 3J7AY 1YJNI 3HOUJ 4ENKA 3DV8A 3JRFA 1RRJA 3CF5F 2KFDA 3FMRA 3KPHA 1TWHJ 4XLCA 4HPQA 4DNCA 2QENA 4ZDPA 5E3MA 4J00A 2GBYA 2DO7A 1R00A 1S7AA 4NC7A 4CYCB 2BY3A 5LLQA 2QCOA 4IHVA 5HLIA 1GVJA 2DMTA 5FRNA 3WU1B 4DZPA 2X6OA 1HW1A 2JSCA 1MMDA 4GFBA 3I56I 2V9PA 2WV1A 1ZQ3P 3QPHA 4LLLA 4G7HF 2BYVE 2EZKA 3KZIC 2E5NA 3LQRA 3KFWX 4BACA 3ZQHA 2XAUA 4UVBA 4XSZF 2LKSA 3F9KA 4CCMA 1R6RA 2Y31A 3OIOA 3BCBA 3TO9A 5GPCA 1G4DA 1D1CA 2R7FA 5J6XA 4XR6A 1LB2A 3DTKA 4N9HA 1YITI 1MJBA 5IP6A 1FYMA 4PSXA 4NBQA 1FBQA 2VE8A 3QQAA 2M4KA 1O57A 1LFBA 3WGGA 5FKKA 1SFKA 3DBHB 2E5ZA 5FLXZ 2LKPA 4PJLA 4V2FA 1ODDA 1QHHD 2MLKA 3ABKH 3VYUB 3I53A 3F3XA 1A5JA 3E0JB 3ABTA 4S0HB 3HHHA 3O6BB 2PEXA 1KU9A 4XMYA 2A6TA 5F0HA 1QU3A 4UVAA 4MTDA 4WF2A 4BE0A 3S17J 3D5LA 1Z05A 3BTJA 4FCYA 3P5JA 3OV8A 1G2HA 2FE3A 4M3BA 5GAHJ 2M7BA 3RKXA 2VKVA 1RR8C 1ACIA 4JX6A 2EPFA 3I64A 2NOJB 2VBWA 5CVVA 2EFWA 1MH3A 1UELB 4XBFA 2WB1A 4E7HA 4ZYGA 5LGUA 2KDZA 3K4JA 1F9NA 4L9JA 3C7JA 2LBFB 1IJWC 2P6TA 3CJTB 3BTLA 4N0BA 5F08A 5HDNA 1VFCA 2EV5A 3C3WA 2VXDA 2LC2A 3H5RA 2XGDA 5JVGF 4Z6YA 2DK8A 2CSOA 3U2RA 1YTYA 2DA1A 2OV7A 2X1CA 3H0DA 1R49A 4FISA 2PG4A 1EV7A 4LGWA 5LBQA 4E7JA 4ABZA 5B3SH 4IRIA 2N8GA 1ZYRF 2K5CA 2Y0SA 2Y48A 3E5UA 5EYRA 1YW8A 2R5YB 3C2GA 3RYPA 1FOYA 2DXIA 1O3SA 2XAJA 1P4WA 5CVRA 3UR3C 2VUMJ 2ISYA 2L9SA 3ZOBA 4EM1A 1T39A 2CUJA 2KPMA 5BPDA 4MFDA 1K78A 4PJNA 2XIGA 1WSUA 2MGQA 2FBHA 3OS1A 1FLIA 4W1UA 5GADJ 1YW9A 4EQQA 4BEHB 2H09A 3SZGA 3IKTA 1FTTA 3DPLC 2FU4A 2KIMA 4EJVA 1WQ2A 5EZGA 1APLC 3CZ6A 2FOKA 4NC6A 3ABLH 5TISC 3Q3SA 3BR6A 2CUFA 2HI3A 4BQQA 3GYHX 2L7FP 2KRCA 3F6OA 2DFEA 1VI0A 2CYYA 3H36A 3LA3A 4A2UA 2R7TA 4G7OF 4V2GA 3GLXA 3IWFA 3OYIA 3BG6A 1MSFC 1FX7A 4A69C 2DDAA 2FMLA 2KLOA 3ZR8X 1MKMA 3JTGA 1MW7A 4LB5A 1YRNB 1OCRH 1NHAA 2V1XA 2ZB9A 2LBFA 4ZYAA 2DW4A 3FK6A 2BY0A 2H1KA 3EUKL 2K85A 2VN2A 4D7MA 1XGMA 2RV8A 4U0WA 3LFKA 4ON0A 4RLFA 1Z1DA 3WG7H 1TW3A 3LSKA 5FFXA 1XMXA 4LG0A 1J7KA 1MIJA 3WTUC 5D5VB 3CF2A 4HQMA 2EWNA 3LQQA 1H9TA 1QPMA 2DT5A 2M34A 3FDYA 1K6OA 1W7PB 3ERED 3TDZC 2K4JA 1DP7P 5JLXA 3OIPA 3JRIA 1ETWA 1A04A 2A61A 4O5VA 3BZ6A 2E2IJ 5A2QK 3L2WA 5IYCJ 2P5KA 1XS9A 3JSOA 2JTVA 3LSIA 1WGXA 1D5YA 1ZARA 1Z21A 3F23A 4HNTA 1BA5A 4E7SA 1LKXA 4EVIA 3OYKA 3QYFA 3D5RC 2EBIA 3G1LA 5J40A 3HTUA 1FOKA 2K9NA 2IS1A 1KA8A 2HU9A 4RMNA 4BYYA 4RAFA 4Y17A 1QVTA 5FO5A 2HTJA 3IWZA 5ICFA 3TKYA 2E1NA 3CJRB 3OR2C 5EG0A 3BLYA 5M5WJ 1TWFJ 1PUFB 4U0YA 3LSMA 1AKHB 5FKNA 2ELKA 4IEJA 4F52A 5ICEA 2G7HA 2NNYA 2MABA 1VQ4I 2LF7A 1WJEA 1FIAA 2FRHA 3OYNA 1YRNA 3RTRA 1IRFA 4XK4A 2MW8A 2XROA 3LSTA 1Q1HA 4ZH4F 4D1QA 3DXJF 2A68F 2GA1A 2R7XA 3JRDA 4OIOF 2M2EA 3V7CA 2W4SA 3VOEA 4CUGA 4NC8A 4CO8A 1MBJA 2IT0A 2FMYA 4M6YA 3GEZA 4M72A 2CJJA 4L9TA 3S3NA 2C6YA 2L02A 1BIBA 2GXBA 5L3DA 1STZA 4BBRJ 4CSWA 2RNJA 3S3MA 1ETOA 1W7PA 4UUTA 5C4XJ 2UUZA 2AQEA 5KCMA 5TGTA 3FISA 4M74A 4KT5C 2BXZA 4XKVA 1S9HA 3G6EI 2KIUA 1BIAA 4X0GA 1OKRA 3RYRA 1MDMA 2JRMA 1U0JA 5FRMA 4CXFA 2F5VA 1X1CA 4CGZA 3OS0A 3CESA 4I99C 4XOTA 1FEXA 2NRAC 1HDPA 3JTHA 3KYLA 1Z6TA 2HKOA 2PLYA 2DT7B 1X19A 1ZG1A 1WPKA 3S1MJ 3GX4X 2AS5F 1Z3XA 1O7LA 4H0EA 2LR8A 4RB1A 1V5EA 1D0XA 4YIIA 4YIRX 2NVTJ 5LRRA 3K6GA 1ZR4A 1FC3A 3O2PE 2BVMA 1N75A 2XKOA 1OYIA 2D5VA 3T8RA 4IOAF 3ZPLA 3HKZA 4PCQA 4N9IA 1ORKA 4FETA 3H3VK 3ZMUA 4KT6A 2O8KA 2L7KA 3LA2A 1B8IB 1JXSA 2H27A 3HOXJ 3VPRA 2VODA 3PO3J 4MGRA 2GXGA 3MKWB 2EV6A 1YLFA 2F5CA 2K9LA 2HQAA 2TCTA 3OYAA 1J75A 3J7AO 4AIDA 3AG4H 3OYGA 1U78A 1IUFA 4KDPA 3OYCA 3JAMK 3N4MA 1HF0A 4GGGA 2QUFA 1U8RA 2IA2A 3KEOA 1K4SA 3RZDJ 3NRVA 3PFIA 3ROUA 1PJRA 2IAIA 3WHBA 4JX4A 1O7FA 1VQOI 3I9V2 4XN3A 4NHJA 1NTCA 2RVCA 2CUEA 3F72A 3BCAA 4PUSA 4JP0A 3HPGA 5J1YA 2JK3A 5D5XB 4YELA 4RB2C 5K7ZA 3W2AA 2VKEA 1WH5A 2B0LA 1BR2A 1MMGA 3KLNA 4Q47A 4GYIA 1KU7A 3HRTA 2VONA 2VQHA 2DOFA 3PFYA 1U9NA 1YJ9I 3HOYJ 2QKLB 3K4KA 2PI0A 3MMYB 4HF0A 1R1UA 3CDLA 4B43A 1TWCJ 1XCBA 1MH4A 5F27A 3MEXA 3V4GA 4EM0B 1RNLA 2OA4A 2K9SA 2VJ4A 2IPQX 5D6EA 3ECHA 3T5XA 1D3YA 3LAPA 2ZXHA 3PNYA 2IS2A 2X48A 2MSYA 4P1WA 9ANTA 1LEBA 2FSWA 3DLAA 1TLHB 3FBNB 2ZXJA 3T0YA 1B72B 3P7NA 2KJCA 3K70D 1B8IA 4OIQF 3EUHC 3K4NA 2ME6A 2MC3A 3ZQCA 4O6JA 2F5DA 2LSOA 1SAXA 2HDDA 5DCMA 3W6KB 1MMSA 3NWSA 4WXDA 2CQKA 4LK0F 3RDIA 2IXSA 2EFQA 1BC7C 2KJBA 5LGTA 2P81A 2ZFUA 2DQRA 1ZH5A 2XF7A 4KMUX 1U8BA 2PN6A 1TQPA 4RLQA 3CLQA 2DOAA 4XN0A 4A0ZA 2GM4A 4RM2A 4XOPA 3VDXA 1EA3A 2VC1A 3F8NA 1TT5B 1U5TC 2DJIA 3SXYA 3H1CA 1RIOH 2NVUB 5DUIA 3M8EA 2CV2A 5E20A 4XLAA 1YIJI 2R7UA 2W25A 4G7ZF 2OZUA 1Y0UA 1EKEA 4OMYA 5B66C 2QSGX 2L9RA 3ZCOA 3KP5A 4QSHA 4QPQA 5L3EA 1L3LA 2BE5F 2L2OA 2VPRA 1T0FA 3MZ8A 5J8FA 2LG4A 4G6QA 3S15J 1VZ0A 3RIRA 2LKXA 1IV8A 4IQJA 2H1LA 3IH4A 2XGEA 3HPHA 4HX7A 1U5TB 4Q48A 3TGNA 3I71A 3RPUA 2H94A 2XF6A 3GTGJ 5ILSA 4CCLA 3V8JA 5FB2A 4OOIA 2B63J 2IP2A 4J19A 1G3SA 4OMZA 2VC0A 2X85A 1E2XA 2LK2A 1G3TA 5F1RA 4D9JA 4YEJA 2HTSA 1E17A 2DFIA 2CFOA 1I3AA 2A05A 3CDHA 1ETYA 2FNAA 3J7YJ 2DYSH 2WV0A 2YS9A 4BQNA 4WK8F 2R7SA 3MVPA 2LOOA 2BY2A 3BQYA 4ZZLA 1R5HA 1JE8A 5E8IA 3Q9VA 1G8XA 5E18F 3NARA 1GLNA 2EFPA 3J81Z 4CH7A 4XL9A 1LVKA 3M8FA 2PX9A 3M8JA 3PQKA 1JHHA 2JVHA 2VJIA 1OMIA 3KP2A 4R1HA 3CC2I 3EUHA 1LDDA 1U6GA 3R6SA 5EGOB 4HDVA 3ZMVA 1IN6A 2JUCA 1AOYA 3TO6A 1PP7U 4Y15A 4RDUA 4IXAA 3OMYA 5FLXK 3BG5A 2HOSA 1W5CC 3CCUI 1KZHA 4BDYA 1KU3A 2CW8A 5ILUA 2MD5A 5ED4A 1E3HA 2A3SA 3UKGA 4A5MA 4AIKA 2QGUA 1D5VA 3RSNA 2HPMA 3IUOA 2K3FA 3CC4I 2I8DA 2DA5A 1TNSA 1WKMA 3ZQGA 3K4CA 1MD0A 2DBBA 4KJZA 2DMQA 3BR0A 3EDPA 2MG4A 1FWZA 2DYRH 1IO2A 2QVOA 3DTIA 2DODA 2D1VA 3KP7A 1IDYA 2DA3A 4E7LA 5DV5A 2BY1A 2HQNA 4I98B 6PAXA 5E79C 1NH3A 3ONQA 5J1RA 3GF2A 2FQ3A 3JREA 4AUXA 2JA8J 1JJ6C 2BBYA 5CQEA 1HC8A 3VWBA 2XKPA 3SHFA 4C3HJ 3H0GJ 1S6LA 1A6QA 3ZXSA 5J4YA 2M8GX 4B3AA 5DM7F 4KIFA 1H9GA 2HYGD 2OPTA 3K2ZA 3O3KA 1WJFA 4AIHA 1QBJA 4A3MJ 2X4HA 4V19K 2L9VA 5FD5A 2VOOA 5B1BH 5CPRB 4E70A 4NQWB 3S3OA 2E71A 3GFLA 2M0MA 4PSWA 2Y0MA 2PJPA 3A01B 1O4XA 2PJRA 2WAFA 2CRGA 2EQRA 1ENHA 3SEQA 4XM3A 2HS5A 3CUQC 4BU2A 4MLOA 5EGOA 1KU2A 2M1BA 3VSLA 4U7BA 2P6SA 2V6CA 3I55I 3ZMDA 2TRTA 3QPTA 5FGMA 2ID6A 2JQ7A 1T95A 1BR1A 5F6FA 3OL3A 3GTMJ 5GAGJ 3K7AJ 2JT1A 2OC6A 3GLLA 4JQFA 4D5CA 3OYHA 2CUZA 3PQJA 3FIWA 5C3EJ 5IY5H 3S1NJ 3HOTA 3E97A 4R8HA 3L2CA 3L9FA 4UY8I 1V5GA 4PJMA 1IXSB 4HYEA 1OLTA 1R4NB 3GBGA 3Q0VA 4EEFG 1Y1VJ 1JUSA 3I3LA 3AAFA 4RGUA 5LHGA 2NYXA 4A6DA 1W7PD 3CUQB 2FBKA 3MWMA 5GP9A 1YW7A 1XG1A 3DKXA 3QP6A 2VPLA 1A31A 4ESFA 2QM3A 2OQGA 2QA4I 2XB5A 4ZJZA 3OYEA 3PJRA 1LNWA 5E8GA 2COMA 3GW2A 3ASOH 4XKWA 3CCLI 1Y6IA 1SFUA 3ZMTA 5KVRA 3HTSB 1XCVA 1IN4A 4A0YA 2PMHA 5JR3A 2DDBA 2KRFA 4CICA 1TL8A 3ZRGA 1T8IA 2DMPA 3KCCA 4MIMA 4WCGA 2A69F 1VF9A 4EGYA 2R93J 4NQWA 2XUBA 2QQ9A 1JGGA 3LSHA 2YX7A 3O8GA 5KNLA 4BE1A 1QHGA 2LYCA 1IRGA 1B9MA 1ZGJA 5C4JJ 1UJ8A 3RKYA 3RCOA 4B48A 2XHKA 3EQLF 3BQZA 1FP2A 5GTHC 2DLLA 4BUPA 3WTVC 4E7KA 3MZHA 2V79A 4RM3A 2XGXA 3AFHA 2XSJC 2EFNA 3CLOA 4TV7A 2W7NA 1XGSA 3HRMA 2GWRA 2V9KA 4LJZF 4BHPA 3N97A 4NDLA 2XB0X 1R71A 1FMWA 2JN6A 2BV6A 2LDUA 1BI3A 5H6QA 1I50J 1P2FA 4M9SA 3HIFA 3FMQA 1IGNA 1VQLI 3EETA 1CQTA 2W24A 3BJOA 2K27A 3CUQA 4DYQA 3LAJA 2G9WA 2BEOA 2Z3YA 4HEA2 5J1UA 3MKZA 1ZG3A 2XGCA 1IDZA 3MAJA 3GVAA 1Y56A 1TP4A 2VI6A 2DFFA 4DIQA 3I4PA 1MNEA 4HNVA 3VB2A 4ENMA 3HYIA 4AYBN 4E4HA 2OBPA 2R4GA 5HODA 4HDUA 2DPDA 1V54H 3JR9A 5HLHA 1W36C 1QPIA 3OR1C 4G12A 3RQ4A 1D1AA 1JT0A 4LIVA 1ON1A 2ID3A 1HW5A 3Q9SA 4LOCA 4CYCA 4D0PA 1HBXG 2QQ8A 2E1MC 3BJAA 3JRCA 3GZNB 2FJ1A 2NS0A 3G2BA 4I0BA 5M3MJ 4DYRA 1JHFA 2M87A 4P9FA 4L5JA 5CYVA 4A3EJ 3JRAA 4NB5A 1FBSA 1TW2A 5K5OA 4KFCA 4U0VA 1GT0C 1TWGJ 1FPQA 1LEAA 1MJ9A 1T33A 2EFOA 1YS6A 1KQ0A 5D5UB 4KYWA 3FKJA 3QP5A 4DYCA 2L54A 3U9GA 1YOVB 2F4IA 3E5XA 3OWTA 1BC8C 2WBMA 3QOEA 4F7ZA 4AM3A 4B1RA 3RPQA 1QA6A 2XASA 5TJJA 3HBLA 1X3WB 2K40A 2OF7A 1ZLJA 4RGRA 3CCJI 2DI3A 2E1MB 1Z91A 4MQVA 1HKQA 3KETA 1HCRA 4PZJA 3F8MA 3W2WA 2VT2A 5H6RA 3AKZA 2V9VA 1V55H 1YX5A 3K4BA 3KYDB 4BXFA 2KIFA 3BR5A 5DDGA 4C2UA 1ZN2A 2IBDA 4IOCF 1SC7A 5HVQC 1GV5A 2O7OA 2O0YA 3R0AA 4BHBA 1S7OA 3A0HC 1R7JA 2E19A 2EH3A 2E7WA 2RGVA 2YR2A 1VQ9I 2ISZA 3LSRA 1P4AA 4HLXA 4Y7NJ 3IKVA 2QF7A 3RKWA 3P9IA 2J5PA 5JVTA 1KQ8A 1S7EA 4HZFA 4Y33A 4A6EA 2Z5UA 4I76A 2IA0A 4B3XA 2RNGA 3RJPA 3HJEA 2GA2A 1VQ5I 3CO7C 5BS6A 1F43A 2DMNA 4XRFA 3BG7A 3TQNA 5CVIA 2ZJPF 4Y3OA 4YIFA 4CHUA 3KP6A 2AO9A 3LMMA 2MH9A 3OYMA 2OQRA 2P8TA 2RN7A 1ULYA 5K1YA 1WJCA 2NVYJ 1K79A 3V8KA 3H3ZA 4IRGA 3KLOA 1TWAJ 3GZ6A 3RPUD 3HUGB 2HZDA 3F8CA 1O3QA 5K5RA 2LNBA 5IOYA 1OCTC 2VBXA 3TDUC 2R5YA 4DZJA 2IS4A 2L4AA 3C1DA 2IS6A 1ZK8A 3WGIA 3H9QA 4KUMA 3IRQA 1BW6A 4CZZA 1JTXA 2LVSA 1SMTA 4G6DA 4XNFA 1HXDA 2UV1A 1QQIA 4KA4A 1TBXA 1F36A 2JA2A 1SVMA 5B5EC 3B6AA 4XKCA 4BEHA 4GO1A 3H5NA 4WWCA 1IW7F 1GV2A 5D4RA 5EEAA 3K10A 3TW7A 3BTIA 3CJNA 3J80K 1EF4A 1R23A 4Y13A 3JRGA 3QWLA 2ZXIA 3GFIA 1BI1A 5LFAA 4G8XA 2W1OA 2L01A 2DA6A 3BOQA 4L5IA 5DD8A 1H0MA 2M4GA 3V7RA 1K83J 1XPXA 1LE8B 4AVZA 1S72I 3BC8A 4F93B 3L2RA 5B1AH 1XC5A 3DP7A 4D7NA 3WTWC 1SANA 5BPIA 5E17F 2LREA 1LDKB 3L1PA 2IGOA 2O61A 1X1DA 1S29A 3OL4A 5HDGA 3HC7A 2NOGA 1OJLA 2ZMEC 1VNDA 5IT9K 4IHYA 3GTLJ 2P0WA 2QWWA 1DGWY 2J5OA 4GXOA 4L18B 3IHUA 2EIKH 1QO0D 3D5SC 1IF1A 4PK4A 1N25A 1WHUA 2O03A 3R60A 4DQ2A 3SDGA 1SD6A 2BVLA 3BZKA 3FZVA 4P5OA 4C9YA 2ZNZA 4FE4A 4LK1F 1E3PA 2IVMA 1R58A 3CP8A 5KAFC 2JMWA 2JRTA 1PP8F 4PGGA 1XMAA 1NG6A 4CCOA 3FX3A 1ZLKA 2HWVA 1ZRCA 1JTYA 3W6VA 1WJ5A 4BL0B 1YS7A 4XLHA 3WTTC 1T56A 3H9GA 4L9NA 3G1MA 4A3JJ 3PL8A 1I3QJ 1JKRC 2JZYA 4JOMA 2Z99A 5EZHA 1QNTA 2TDXA 2ZMEB 2ME0A 5FLVA 4A3IJ 1T6SA 4UV8A 2ESNA 2NVXJ 1EJ9A 3IP4B 1MNDA 1X3ZB 2HKXA 3ESWB 2M7AA 5CVUA 1PUFA 4HV5A 3L09A 1WVRA 2XVCA 1AKHA 4B8XA 3R4KA 4HV6A 2XAGA 3S16J 1XTAA 3Q0UA 5L3GA 4E7IA 1LE8A 3KP3A 1Y1WJ 2Y75A 1RUNA 3H9JA 2P7VB 3BG3A 1GXPA 2VE9A 3E6BA 5KK1A 1MBKA 1FSHA 3IAS2 5EEGA 2KQRA 2XPWA 3IH2A 3EPZA 3J81K 4KIBA 3CD6I 1T38A 2W00A 3T1BA 2PFBA 1AU7A 4KNYA 1BBYA 4YFXF 2EA4A 3GTPJ 4HX4A 4IF4A 5LGNA 2ZJRF 3HOZJ 4QIWN 5ICGA 2VBZA 3HSEA 4ESBA 1LFUP 1GUUA 2QBYB 1GXQA 1MBEA 1IN8A 3BG9A 3K9TA 3MN2A 5AIPA 3ZQQA 2G7UA 1PVEA 2GOXB 2Q0OA 3HSFA 4E7ZA 5JHUA 1TT0A 1W4MA 2XF5A 1G3WA 2DT6A 5DS9A 2EIJH 3L2QA 1T08B 1V5FA 3ZN0A 3A4CA 1OR7C 3GFMA 1FYLA 1SVOA 1XD7A 2QEXI 2A6EF 2HVQA 2ZMEA 4F3QA 2F4MB 5E3OA 2RAEA 2ZCWA 4Q5SF 1MNMC 1IXRC 4YFNF 3ULQB 2DCEA 4DBRA 2K9QA 5EF6A 3K0LA 2XAHA 1HSTA 2Z33A 2DPUA 1QZYA 2FX0A 4BH9A 1Z7LA 1RKWA 5CKTA 2ICWG 1XN7A 2BZTA 1SD7A 3M1CA 1TTYA 3E6DA 4I2OA 2JA6J 5ILVA 4BJ6C 1YO5C 3H5AA 1FTZA 1J09A 4NUBA 2LY2A 2I5UA 3KZYA 3IH3A 1ZG5A 1J2XA 2GQQA 1HDDC 3DU6A 1QRYA 2CQXA 2R7DA 2E36A 2PMZN 2OUMA 2EIMH 1WH7A 5HS7A 1MMNA 4S04A 5K5QA 3FHNA 5LD2C 4IHTA 4IKFA 4BJ5C 2JVGA 3J7ZI 5FKMA 3JRHA 1K4TA 1G59A 4PGHA 4QPOA 2A5YB 1MBGA 3DLLF 1R1VA 1T98A 4UXNA 3OSFA 1HKTA 1FZPB 2VBYA 1XSDA 3M9AA 2P5VA 3HGYA 1IC8A 2FA5A 4RAZA 4ZZDA 2HFHA 3COAC 4CCNA 2EINH 2HOAA 1DUXC 4BDZA 4KITB 2CU7A 1SMYF 1Z7UA 4ETSA 4IX7A 5DTDA 2OTJI 4UHTA 4AIJA 2ZSIB 2HYJA 3FM3A 3ZQIA 2KT0A 3M4OJ 2DAOA 3FK7A 3QYBA 2M9HA 3GUDA 3N05A 3SJMA 1K61A 2NVQJ 2KDOA 4UB8C 3KE2A 2QSHX 2DQLA 3E5QA 1YI2I 2ZJ2A 3FXMA 1RESA 2D1HA 2M30A 1UHMA 2LH9A 3KEYA 5D8KB 1I6HJ 2XPVA 2QQBA 4LIUA 2WY8Q 1HLVA 4HAMA 2EILH 3GCMA 1B72A 1Z3YA 1XDUA 3U21A 1FIPA 2E35A 2EJRA 1OR7A 4HSRA 2OU2A 2L7MP 5F64A 4XLNF 1ETKA 2A07F 3K1NA 3SZPA 5IYDJ 5E1XA 4MEYF 1SFEA 1F4KA 4OU0A 2GAUA 2L7ZA 3DF8A 2IGNA 2JPCA 3ERMA 3ZQFA 2V6EA 5JI6A 2EZIA 1OQYA 2XC7A 3PO2J 2E34A 1ETQA 2H6CA 4DGWB 1ZGAA 1RPWA 4XSXF 3DFGA 2ZJQF 2QSFX 1B4AA 1XDSA 3LFUA 4WXCA 2WWYA 1H88C 4A3LJ 4KICA 4MNUA 1V3FA 1X1PA 3JSPA 3DEWA 1B9NA 1X1AA 1X58A 1C0WA 3PIOF 2DK5A 1E3OC 2X6YA 2AQFA 1YE9A 5EJCA 1RZ4A 4I09A 4B44A 1UZCA 1P6RA 3DKWA 4ZYEA 2O3FA 1WWXA 4M73A 3HRSA 2Z9OA 2ADUA 3S2DJ 1CF7B 2NS8A 3M07A 4UUSB 3P9KA 3LA7A 1FJLA 2M0CA 2JJ7A 2LRDA 1Y0NA 1M1EB 1FNNA 2VB6A 3ZQ7A 4HOBA 3MQ0A 3DEEA 3DPTA 4XRSG 2CW0F 4EM2A 3SFZA 3TEDA 2KMUA 2V1NA 3ASNH 4BXUA 5JHFA 3E6CC 4HG2A 2ETHA 1U5TA 3C2HA 2HZTA 3PUFA 4A3FJ 2E1OA 2GIVA 2UZKA 2VKDA 5F0CA 2VASA 3I5UA 2YUSA 1W36D 2WC2A 3F22A 3MKLA 1I1SA 2P7CB 2QQAA 3CCQI 4I02A 5CQGA 2QKMB 3B73A 2FXAA 4BAYA 3D1NI 2W84A 1R22A 2Y2ZA 2EK5A 1VQKI 2E2JJ 4XONA 1JI8A 4S05A 2ELJA 2CQ7A 2EB7A 3QPLA 3OIQA 4BXXJ 1R1TA 4BJTA 4A12A 3SYTA 3HL2A 2WTEA 2R7VA 1ITYA 4HQEA 4EMSA 2O8XA 3LWFA 2K4BA 4I0AA 1VQMI 3AL0C 2OD5A 2RC4A 2D2WA 4PJJA 4X6AJ 3DCFA 1D1BA 2V26A 5HS8A 3VYRB 5IT3A 2CWEA 1CF7A 1IUYA 4UUSA 2MBFA 4XLEA 5L3FA 4BNCA 2VL8A 3HOWJ 4LITA 1R5GA 4RB3C 5HOOA 2HXIA 2GOMA 1QVUA 3QODA 4HX8A 4YFKF 1WRJA 5L3CA 3S1RJ 1FYKA 4KMFA 4JX5A 1CGPA 4FTHA 1BN5A 3K4LA 3WU0A 4AC0A 1FOXA 1DU6A 4MO7A 2FQ4A 3P9CA 3LSPA 2BGCA 2LFBA 1SFOJ 4I7HA 4ASNA 3AL0B 4EV0A 3CP2A 1UB9A 2P5LC 3HOSA 1BJZA 1P4XA 1KYWA 3ZMSA 4CYDA 1B1BA 3EYYA 4JYKA 2FD5A 4IRHA 2QZ8A 2DN0A 3SFIA 2LMDA 2PMUA 1W0TA 2EV0A 1GVDA 4CZCA 2VXZA 2F5FA 3HHGA 4ITVA 1EH8A 1Z9CA 1I5ZA 4G94A 3FKIJ 3HG9A 4ENJA 1AWCA 2HDCA 3FF5A 1RI7A 4E6KG 1TQMA 2A5WA 2RQPA 4XORA 3TBIA 3BJ6A 3EUAA 3QOPA 3CTAA 2ZXWH 4N4NB 4FASD 4ZTFA 1ZREA 4Q4ZF 2E60A 4A3GJ 1NK3P 3OYJA 5E1WA 1B6AA 3D0SA 3GFJA 4G9YA 3A01A 3G4SI 3KX2A 2FUG2 5E1ZB 3VYTB 4M6VA 2UWMA 3OYFA 4ZYHA 1MSEC 1FY7A 2F48A 2R7QA 1I27A 3TW6A 1SD5A 3AG2H 2WB1N 1Q1VA 2CGPA 1IG7A 1XGNA 5D8LB 3QYEA 3WGHA 1I1GA 3HB9A 2LF8A 2COBA 3NAUA 2DMUA 4F92B 3F21A 1WCMJ 3CMMA 3MKYB 4FX4A 2CH0A 1JUMA 1UMQA 2K3PA 3BPVA 2G0EA 4HA8A 3FM5A 4IL6C 1TQIA 3GTJJ 4LG3A 2Y9YA 5FLMJ 1HKSA 1POGA 1OCOH 3WODF 4AVPA 2VQGA 2KL4A 2L4MA 1WFXA 3T8TA 1MBHA 5FKOA 3TOAA 2VQLA 2R92J 5JFRA 2Y0SN 4G6TB 1S5LC 3GMEA 2JWTA 1NG7A 1KGSA 2PQ8A 4XQFA 4NNJA 1FOWA 1A35A 5J3LA 3K2AA 2KISA 3Q5FA 1F1ZA 2V1UA 3WTXC 4CCJA 3OYBA 2MLGA 3DEUA 1K78B 3EYIA 1DQUA 2ZNYA 1BR4A 3CCVI 1YX3A 1MGTA 1Z67A 3R61A 2OZ6A 4A3BJ 2E1CA 4PFOA 4GYGA 4OAYA 2YPRA 3FXJA 5M5YJ 5K7FA 3ELKA 1S3JA 5IOZA 4ZDOA 3BY6A 2XSDC 1EH7A 1KONA 2EZLA 3CCYA 1YG2A 3CMEI 5DEQA 3FXLA 2K86A 1XMKA 3PNVA 2YU9J 2X6WA 2FBIA 1U9OA 3F0CA 4RGSA 4U87A 1A6IA 2DFHA 4WXHA 1PUEE 4OWRB 3TP0A 1J5YA 4ESJA 1Y39A 1F5TA 4LG0B 2HOEA 4HLYA 1LDJA 2JUGA 5LEJA 3O8HA 1K7AA 3S8PA 1YHQI 4M9ZA 2Y30A 2E7XA 1N78A 1I6XA 1ZGWA 5GPAA 3REOA 1ZKGA 2IW5A 3CJQB 1X4OA 1VTNC 4F91B 4PFPA
chains in the Genus database with same CATH topology
4IPAA 3GXOA 2FEZA 1YFHA 2UXNA 1O3TA 4CDGA 2W57A 4EJOA 4HF1A 3M7GA 1DPRA 1UFMA 4FHTA 4Z2YA 3FMSA 3WTZA 1U2WA 1HW2A 4OINF 2P4WA 3M1EA 4KN7X 3W6JB 4AWXB 5LHHA 1BJAA 3G73A 5CJ9A 4EJUA 2RDPA 2OAZA 4MTEA 3JW4A 4UVCA 3VEPA 4ENNA 4IHSA 1REPC 1KQ9A 4R79A 2NNNA 2XAFA 1XSXA 4KIGA 1BM9A 2M8EA 5HS9A 4A0XA 2VT3A 3F6VA 5FD6A 5FFZA 1FBUA 1SD4A 2RKHA 2QYOA 2O6GE 4OIPF 1MDMB 2YU3A 4RS8A 3VODA 2D45A 2ZO4A 1JGSA 5LEKA 3QAHA 4M71A 2F5EA 1LQ1A 1ONVA 4BQAA 2K7LA 4KN4X 1EH6A 2PBIA 3K69A 3OOPA 1USTA 2VOPA 4M6XA 2AXLA 3FHZA 4A5NA 2YX4A 5D4SA 3BP8A 3HUGA 3BPXA 3QRFF 1R36A 3HRUA 3G3ZA 4RAYA 5DD4A 2ZKZA 4U88A 1BI2A 4EJTA 1OPCA 1J59A 3L00A 3RI4A 3QU3A 5AIQA 2JPBA 3BDDA 2MH2A 2ZBKA 4LFUA 1YIOA 4UUVA 2R3SA 3K1PA 2M5WA 4FT8A 5ICCA 5J8CA 3WE2A 3FXUA 4L0ZB 1G3YA 3ZN1A 3WE3A 2FF4A 4FX0A 2XAQA 3WG9A 4P55A 2DU9A 4IJAA 4B09A 5CVJA 2HR3A 3FWEA 3TOBA 1PDNC 1QZZA 1W5TA 5DCMB 5L3BA 5CLSA 4YG2F 4ZYDA 5ERIA 3ML6A 1S8NA 1SFXA 1XGOA 4LB6B 3SQNA 3VFZA 3R0JA 2DTRA 1MZBA 3F8BA 1L0OC 4I01A 1QGPA 1IN7A 1V4RA 3F8FA 5A2QZ 2V1DA 1O3RA 1IAWA 1LVAA 1LJ9A 2ESHA 4UNOA 3GWZA 5EEHA 3BWGA 4HW0A 1KYZA 4MEXF 1IZ1A 2QBYA 3U1DA 4RGXA 3J80Z 2ZFWA 5DYMA 3HSRA 3ZP5A 2STTA 5TRDA 4HBLA 3CO6C 2CG4A 1GHCA 2CO5A 2KKOA 1YYVA 5AONA 3KZZA 4LLNA 2HQRA 1FP1D 3S2WA 4JK1X 1DPUA 2M45A 2EA2A 1YQAA 5IT9Z 1FT9A 2FNPA 2CFXA 1HQCA 1ZAOA 2UXXA 3I59B 3BROA 4L9VA 4QLCU 1OYWA 3C18A 3I58A 1U3EM 1T2KA 3GO5A 3V7SA 1HSJA 4K2EA 1W5SA 3NQOA 4LD5A 1WI9A 1UHWA 4RB0A 3KEQA 3L7WA 3CUOA 5BOXA 5BQTA 4HF2A 2Q2EA 3ISPA 2H6BA 2ACJA 5LHIA 2NAZA 2QLZA 1DDNA 3NEUA 4LMYA 3B02A 3JAMZ 4L0YB 3WTSC 3TO7A 1J9IA 5LRSA 3FXRA 4JBAA 2HGCA 2YSRA 4WX9A 1G6NA 5D6FA 2XRNA 3SZTA 1XSVA 3MZYA 3I59A 1RUOA 2F2EA 3MFKA 4AD9A 1X3UA 2STWA 1OYYA 4QWQA 4GCVA 4UV9A 3DQVC 2HYFA 2W85A 1BOAA 4MHGA 1IN5A 2A6HF 2Q8KA 4EJWA 1D8KA 2ELHA 4PDKA 1ZHFA 1B59A 5HDKA 3ABUA 2X0LA 2IJLA 2GZWA 1ZRFA 2IA1A 1MJAA 1ON2A 4EGZA 4M9XA 3KP4A 3WTYC 3FXQA 1USSA 3ECOA 1D8JA 4O3MA 4OIRF 3IC7A 2HEOA 1ZRDA 5H20A 4P9UA 5HLGA 1IXCA 1XB4A 1BI0A 3GZ5A 5DUKA 4U7DA 4MQ9F 2MA3A 2XV4S 1FSEA 3IL2A 3H92A 3MCZA 1J0RA 2L3DA 3ZMZA 3IRRA 4XLPF 5BMZA 3V8LA 1TNTA 5D5WB 3I54A 3E6MA 2IRFG 1Z6RA 3QU6A 2K02A 1P92A 3K1MA 4LLGF 4BHCA 1UCRA 3H3UA 3I0TA 4IVNA 4P96A 3E3VA 5DCFA 4ENKA 3DV8A 3FMRA 4DNCA 2QENA 2DO7A 1R00A 1S7AA 5LLQA 5HLIA 1GVJA 3WU1B 1HW1A 2JSCA 3QPHA 4LLLA 4G7HF 2BYVE 3LQRA 3KFWX 4UVBA 4XSZF 3TO9A 1G4DA 2R7FA 5J6XA 1LB2A 4N9HA 1MJBA 1FYMA 1FBQA 2VE8A 1O57A 3WGGA 5FLXZ 2LKPA 1ODDA 2MLKA 3I53A 3F3XA 3ABTA 3HHHA 3O6BB 2PEXA 1KU9A 4UVAA 4MTDA 4WF2A 3D5LA 1Z05A 3OV8A 2FE3A 3RKXA 3I64A 5CVVA 2VBWA 2EFWA 4XBFA 4ZYGA 5LGUA 1F9NA 4L9JA 3C7JA 2P6TA 4N0BA 5HDNA 2EV5A 3C3WA 2DK8A 2CSOA 3U2RA 1YTYA 2PG4A 1EV7A 4LGWA 5LBQA 4IRIA 1ZYRF 3E5UA 2Y48A 1YW8A 3RYPA 1O3SA 2XAJA 1P4WA 5CVRA 2ISYA 4EM1A 1T39A 5BPDA 1K78A 2XIGA 1WSUA 2FBHA 1FLIA 1YW9A 4EQQA 2H09A 3IKTA 3DPLC 2FU4A 2KIMA 4EJVA 1WQ2A 2FOKA 3GYHX 3F6OA 4A2UA 3LA3A 2CYYA 4G7OF 3GLXA 3IWFA 1FX7A 2FMLA 1MKMA 3JTGA 4LB5A 1NHAA 2V1XA 2DW4A 2VN2A 1XGMA 2RV8A 4U0WA 3LFKA 4ON0A 1Z1DA 1TW3A 5FFXA 4LG0A 1J7KA 3WTUC 5D5VB 4HQMA 2EWNA 3LQQA 1H9TA 1QPMA 2DT5A 1K6OA 1W7PB 3ERED 3TDZC 2K4JA 1DP7P 1A04A 2A61A 4O5VA 3BZ6A 5A2QK 2P5KA 3JSOA 2JTVA 1ZARA 3F23A 4EVIA 3HTUA 1FOKA 1KA8A 4BYYA 4Y17A 5FO5A 2HTJA 3IWZA 5ICFA 3TKYA 2E1NA 4U0YA 5ICEA 2G7HA 2NNYA 2LF7A 2FRHA 3RTRA 1IRFA 2XROA 3LSTA 1Q1HA 4ZH4F 3DXJF 2A68F 2GA1A 4OIOF 3V7CA 3VOEA 4CO8A 2IT0A 2FMYA 4M6YA 3GEZA 4M72A 4L9TA 2C6YA 2L02A 1BIBA 2GXBA 5L3DA 1STZA 2RNJA 1W7PA 4M74A 4KT5C 2KIUA 1BIAA 1OKRA 3RYRA 1MDMA 4CXFA 4CGZA 2NRAC 3JTHA 1Z6TA 2HKOA 2PLYA 1ZG1A 3GX4X 2AS5F 1O7LA 4H0EA 4RB1A 4YIIA 5LRRA 1FC3A 3O2PE 2XKOA 1OYIA 3T8RA 3ZPLA 4PCQA 4N9IA 3ZMUA 3LA2A 1JXSA 2H27A 2VODA 4MGRA 2GXGA 2EV6A 1YLFA 2F5CA 1J75A 3J7AO 1U78A 4KDPA 3JAMK 3N4MA 4GGGA 2QUFA 1U8RA 2IA2A 3KEOA 3NRVA 3PFIA 3ROUA 1O7FA 4NHJA 2RVCA 3F72A 5D5XB 4RB2C 2B0LA 3KLNA 4Q47A 4GYIA 1KU7A 3HRTA 2VONA 2PI0A 4HF0A 1R1UA 1XCBA 3MEXA 3V4GA 4EM0B 1RNLA 2OA4A 3T5XA 2IPQX 5D6EA 3ECHA 1D3YA 3LAPA 1LEBA 2FSWA 1TLHB 2ZXJA 3T0YA 3P7NA 2KJCA 4OIQF 2MC3A 4O6JA 2F5DA 2LSOA 1SAXA 5DCMA 3W6KB 4WXDA 2CQKA 4LK0F 3RDIA 2EFQA 1BC7C 2KJBA 5LGTA 2DQRA 1ZH5A 4KMUX 2PN6A 1TQPA 4A0ZA 2VC1A 3F8NA 1U5TC 3SXYA 1RIOH 5DUIA 3M8EA 5E20A 2W25A 4G7ZF 2OZUA 1Y0UA 4OMYA 3KP5A 5L3EA 1L3LA 2BE5F 1T0FA 5J8FA 4G6QA 3RIRA 4HX7A 1U5TB 4Q48A 3TGNA 3I71A 3RPUA 2H94A 5ILSA 3V8JA 5FB2A 4OOIA 2IP2A 1G3SA 4OMZA 2VC0A 1E2XA 1G3TA 5F1RA 2HTSA 1E17A 2DFIA 3CDHA 2FNAA 2WV0A 4WK8F 4ZZLA 1R5HA 1JE8A 5E8IA 3Q9VA 5E18F 2EFPA 3J81Z 3M8FA 3PQKA 1JHHA 1OMIA 3KP2A 4R1HA 3EUHA 1LDDA 1U6GA 3R6SA 4HDVA 3ZMVA 1IN6A 1AOYA 3TO6A 1PP7U 4Y15A 4IXAA 5FLXK 1KU3A 5ILUA 2MD5A 5ED4A 2A3SA 4A5MA 4AIKA 1D5VA 1TNSA 1WKMA 1MD0A 2DBBA 3EDPA 1FWZA 2QVOA 2D1VA 3KP7A 5DV5A 2HQNA 4I98B 6PAXA 3GF2A 2FQ3A 2BBYA 2XKPA 3SHFA 1S6LA 4KIFA 1H9GA 2HYGD 3K2ZA 3O3KA 4AIHA 1QBJA 2X4HA 5FD5A 2VOOA 4E70A 3GFLA 2Y0MA 2PJPA 2HS5A 3CUQC 1KU2A 2M1BA 4U7BA 2P6SA 2V6CA 3ZMDA 3QPTA 5FGMA 5F6FA 2JT1A 4JQFA 3PQJA 3HOTA 3E97A 4R8HA 3L2CA 3L9FA 1IXSB 4HYEA 3AAFA 4RGUA 5LHGA 2NYXA 4A6DA 1W7PD 3CUQB 2FBKA 3MWMA 1YW7A 3QP6A 4ESFA 2QM3A 2OQGA 1LNWA 5E8GA 2COMA 3GW2A 1SFUA 3ZMTA 5KVRA 3HTSB 1XCVA 1IN4A 4A0YA 2PMHA 5JR3A 2KRFA 4CICA 3KCCA 4WCGA 2A69F 4EGYA 4NQWA 2XUBA 2QQ9A 2YX7A 1IRGA 1B9MA 1ZGJA 3RKYA 2XHKA 3EQLF 1FP2A 3WTVC 2DLLA 3MZHA 2V79A 4TV7A 2XGXA 3CLOA 2EFNA 1XGSA 3HRMA 2GWRA 4LJZF 4BHPA 3N97A 2BV6A 2LDUA 1BI3A 5H6QA 1P2FA 4M9SA 3HIFA 3FMQA 3EETA 2W24A 3BJOA 2K27A 3CUQA 3LAJA 2G9WA 2BEOA 2Z3YA 1ZG3A 3MAJA 3GVAA 3I4PA 3VB2A 4ENMA 3HYIA 2OBPA 4HDUA 2DPDA 5HLHA 1ON1A 1HW5A 3Q9SA 4D0PA 1HBXG 3BJAA 2NS0A 4I0BA 1JHFA 2M87A 4P9FA 4L5JA 5CYVA 4NB5A 1FBSA 1TW2A 5K5OA 4KFCA 4U0VA 1FPQA 1LEAA 1MJ9A 2EFOA 1YS6A 1KQ0A 5D5UB 4KYWA 3QP5A 2L54A 3U9GA 3E5XA 1BC8C 4F7ZA 3RPQA 2XASA 5TJJA 1ZLJA 4RGRA 2DI3A 1Z91A 4MQVA 1HKQA 3KETA 4PZJA 3F8MA 2VT2A 5H6RA 2V9VA 5DDGA 2KIFA 1ZN2A 5HVQC 2O0YA 3R0AA 4BHBA 1S7OA 1R7JA 2E7WA 2RGVA 2YR2A 2ISZA 1P4AA 4HLXA 3IKVA 3RKWA 3P9IA 2J5PA 5JVTA 1KQ8A 4HZFA 4A6EA 2Z5UA 2IA0A 3RJPA 2GA2A 3CO7C 5BS6A 4XRFA 3TQNA 5CVIA 4YIFA 4CHUA 3KP6A 2MH9A 2OQRA 2P8TA 2RN7A 1ULYA 5K1YA 1K79A 3V8KA 3H3ZA 4IRGA 3KLOA 3GZ6A 1O3QA 3F8CA 5K5RA 2LNBA 2VBXA 3TDUC 2L4AA 3C1DA 3WGIA 4KUMA 3IRQA 4CZZA 1SMTA 4G6DA 1HXDA 1QQIA 4KA4A 1TBXA 4GO1A 4WWCA 1IW7F 5D4RA 3CJNA 3J80K 1R23A 4Y13A 3GFIA 1BI1A 4G8XA 2L01A 4L5IA 3BOQA 5DD8A 1H0MA 3V7RA 3DP7A 3WTWC 5BPIA 5E17F 1LDKB 2O61A 1S29A 5HDGA 5IT9K 2QWWA 2J5OA 4GXOA 4L18B 3IHUA 1QO0D 1IF1A 2O03A 4DQ2A 3R60A 1SD6A 3FZVA 4P5OA 2ZNZA 4LK1F 2IVMA 1R58A 2JRTA 1PP8F 4PGGA 1XMAA 3FX3A 1ZLKA 2HWVA 1ZRCA 1YS7A 3WTTC 4L9NA 2JZYA 2Z99A 1QNTA 2TDXA 2ZMEB 1T6SA 4UV8A 2ESNA 2HKXA 5CVUA 4HV5A 3L09A 2XVCA 4B8XA 3R4KA 4HV6A 2XAGA 5L3GA 3KP3A 2Y75A 1RUNA 2P7VB 1GXPA 2VE9A 3E6BA 5KK1A 1FSHA 5EEGA 3J81K 4KIBA 1T38A 3T1BA 2PFBA 4KNYA 1BBYA 4YFXF 2EA4A 4HX4A 4IF4A 5LGNA 5ICGA 2VBZA 3HSEA 4ESBA 2QBYB 1GXQA 1IN8A 3K9TA 5AIPA 2G7UA 2Q0OA 3HSFA 5JHUA 1W4MA 1G3WA 3ZN0A 3GFMA 1FYLA 1XD7A 2A6EF 2ZMEA 2ZCWA 4Q5SF 1IXRC 4YFNF 3ULQB 3K0LA 2XAHA 1HSTA 2Z33A 2DPUA 1QZYA 4BH9A 1XN7A 1SD7A 1TTYA 3E6DA 4I2OA 5ILVA 1YO5C 3KZYA 1ZG5A 1J2XA 2GQQA 2R7DA 5HS7A 4S04A 5K5QA 4IHTA 4PGHA 2A5YB 1R1VA 1T98A 4UXNA 1HKTA 1FZPB 2VBYA 1XSDA 3M9AA 2P5VA 2FA5A 4RAZA 4ZZDA 2HFHA 3COAC 1DUXC 1SMYF 1Z7UA 4ETSA 4UHTA 4AIJA 3FM3A 2DAOA 3GUDA 3KE2A 2DQLA 3E5QA 2ZJ2A 2D1HA 2M30A 1UHMA 5D8KB 2QQBA 4HAMA 1XDUA 2EJRA 1OR7A 2OU2A 5F64A 4XLNF 2A07F 3K1NA 3SZPA 5E1XA 4MEYF 1SFEA 1F4KA 4OU0A 2GAUA 3DF8A 2JPCA 5JI6A 2H6CA 1ZGAA 4XSXF 3DFGA 1B4AA 1XDSA 2WWYA 4WXCA 4KICA 4MNUA 1V3FA 3JSPA 1B9NA 1C0WA 2DK5A 1RZ4A 4I09A 1P6RA 3DKWA 4ZYEA 2O3FA 1WWXA 4M73A 3HRSA 2Z9OA 2ADUA 1CF7B 3P9KA 3LA7A 3ZQ7A 1FNNA 4HOBA 3MQ0A 3DPTA 2CW0F 4EM2A 3SFZA 4BXUA 3E6CC 2ETHA 1U5TA 2HZTA 2GIVA 2UZKA 3I5UA 2WC2A 3F22A 1I1SA 2P7CB 2QQAA 4I02A 3B73A 2FXAA 4BAYA 2W84A 1R22A 2EK5A 4S05A 2EB7A 1R1TA 4A12A 2WTEA 4HQEA 4EMSA 2O8XA 3LWFA 2K4BA 4I0AA 2OD5A 2RC4A 2D2WA 5HS8A 5IT3A 1IUYA 2CWEA 1CF7A 2MBFA 5L3FA 4BNCA 1R5GA 4RB3C 5HOOA 4YFKF 4HX8A 5L3CA 1WRJA 1FYKA 4KMFA 1CGPA 1BN5A 3WU0A 3P9CA 2BGCA 4I7HA 4ASNA 4EV0A 1UB9A 2P5LC 3HOSA 1P4XA 1KYWA 3ZMSA 4CYDA 1B1BA 3EYYA 4IRHA 2QZ8A 2PMUA 2EV0A 2VXZA 2F5FA 3HHGA 1EH8A 1Z9CA 1I5ZA 4G94A 4ENJA 1AWCA 2HDCA 3FF5A 1RI7A 1TQMA 2RQPA 3BJ6A 3QOPA 3CTAA 1ZREA 4Q4ZF 5E1WA 1B6AA 3D0SA 3GFJA 4G9YA 5E1ZB 2UWMA 4ZYHA 1FY7A 1I27A 1SD5A 2CGPA 1XGNA 5D8LB 3WGHA 1I1GA 2LF8A 3F21A 4FX4A 3BPVA 4HA8A 3FM5A 1TQIA 1HKSA 3WODF 4AVPA 2L4MA 3T8TA 3TOAA 5JFRA 1KGSA 2PQ8A 3Q5FA 1F1ZA 2V1UA 3WTXC 2MLGA 3DEUA 1K78B 3EYIA 2ZNYA 1MGTA 3R61A 2OZ6A 2E1CA 4GYGA 2YPRA 3ELKA 1S3JA 3BY6A 1EH7A 1YG2A 5DEQA 2K86A 1XMKA 2FBIA 4RGSA 4WXHA 1PUEE 1J5YA 4ESJA 4LG0B 1F5TA 2HOEA 4HLYA 1LDJA 5LEJA 1K7AA 4M9ZA 2E7XA 1I6XA 3REOA 2IW5A 1VTNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  3GXO A;  2FEZ A;  1YFH A;  2UXN A;  1O3T A;  4CDG A;  2W57 A;  4EJO A;  4HF1 A;  3M7G A;  1DPR A;  1UFM A;  4FHT A;  4Z2Y A;  3FMS A;  3WTZ A;  1U2W A;  1HW2 A;  4OIN F;  2P4W A;  3M1E A;  4KN7 X;  3W6J B;  4AWX B;  5LHH A;  1BJA A;  3G73 A;  5CJ9 A;  4EJU A;  2RDP A;  2OAZ A;  4MTE A;  3JW4 A;  4UVC A;  3VEP A;  4ENN A;  4IHS A;  1REP C;  1KQ9 A;  4R79 A;  2NNN A;  2XAF A;  1XSX A;  4KIG A;  1BM9 A;  2M8E A;  5HS9 A;  4A0X A;  2VT3 A;  3F6V A;  5FD6 A;  5FFZ A;  1FBU A;  1SD4 A;  2RKH A;  2QYO A;  2O6G E;  4OIP F;  1MDM B;  2YU3 A;  4RS8 A;  3VOD A;  2D45 A;  2ZO4 A;  1JGS A;  5LEK A;  3QAH A;  4M71 A;  2F5E A;  1LQ1 A;  1ONV A;  4BQA A;  2K7L A;  4KN4 X;  1EH6 A;  2PBI A;  3K69 A;  3OOP A;  1UST A;  2VOP A;  4M6X A;  2AXL A;  3FHZ A;  4A5N A;  2YX4 A;  5D4S A;  3BP8 A;  3HUG A;  3BPX A;  3QRF F;  1R36 A;  3HRU A;  3G3Z A;  4RAY A;  5DD4 A;  2ZKZ A;  4U88 A;  1BI2 A;  4EJT A;  1OPC A;  1J59 A;  3L00 A;  3RI4 A;  3QU3 A;  5AIQ A;  2JPB A;  3BDD A;  2MH2 A;  2ZBK A;  4LFU A;  1YIO A;  4UUV A;  2R3S A;  3K1P A;  2M5W A;  4FT8 A;  5ICC A;  5J8C A;  3WE2 A;  3FXU A;  4L0Z B;  1G3Y A;  3ZN1 A;  3WE3 A;  2FF4 A;  4FX0 A;  2XAQ A;  3WG9 A;  4P55 A;  2DU9 A;  4IJA A;  4B09 A;  5CVJ A;  2HR3 A;  3FWE A;  3TOB A;  1PDN C;  1QZZ A;  1W5T A;  5DCM B;  5L3B A;  5CLS A;  4YG2 F;  4ZYD A;  5ERI A;  3ML6 A;  1S8N A;  1SFX A;  1XGO A;  4LB6 B;  3SQN A;  3VFZ A;  3R0J A;  2DTR A;  1MZB A;  3F8B A;  1L0O C;  4I01 A;  1QGP A;  1IN7 A;  1V4R A;  3F8F A;  5A2Q Z;  2V1D A;  1O3R A;  1IAW A;  1LVA A;  1LJ9 A;  2ESH A;  4UNO A;  3GWZ A;  5EEH A;  3BWG A;  4HW0 A;  1KYZ A;  4MEX F;  1IZ1 A;  2QBY A;  3U1D A;  4RGX A;  3J80 Z;  2ZFW A;  5DYM A;  3HSR A;  3ZP5 A;  2STT A;  5TRD A;  4HBL A;  3CO6 C;  2CG4 A;  1GHC A;  2CO5 A;  2KKO A;  1YYV A;  5AON A;  3KZZ A;  4LLN A;  2HQR A;  1FP1 D;  3S2W A;  4JK1 X;  1DPU A;  2M45 A;  2EA2 A;  1YQA A;  5IT9 Z;  1FT9 A;  2FNP A;  2CFX A;  1HQC A;  1ZAO A;  2UXX A;  3I59 B;  3BRO A;  4L9V A;  4QLC U;  1OYW A;  3C18 A;  3I58 A;  1U3E M;  1T2K A;  3GO5 A;  3V7S A;  1HSJ A;  4K2E A;  1W5S A;  3NQO A;  4LD5 A;  1WI9 A;  1UHW A;  4RB0 A;  3KEQ A;  3L7W A;  3CUO A;  5BOX A;  5BQT A;  4HF2 A;  2Q2E A;  3ISP A;  2H6B A;  2ACJ A;  5LHI A;  2NAZ A;  2QLZ A;  1DDN A;  3NEU A;  4LMY A;  3B02 A;  3JAM Z;  4L0Y B;  3WTS C;  3TO7 A;  1J9I A;  5LRS A;  3FXR A;  4JBA A;  2HGC A;  2YSR A;  4WX9 A;  1G6N A;  5D6F A;  2XRN A;  3SZT A;  1XSV A;  3MZY A;  3I59 A;  1RUO A;  2F2E A;  3MFK A;  4AD9 A;  1X3U A;  2STW A;  1OYY A;  4QWQ A;  4GCV A;  4UV9 A;  3DQV C;  2HYF A;  2W85 A;  1BOA A;  4MHG A;  1IN5 A;  2A6H F;  2Q8K A;  4EJW A;  1D8K A;  2ELH A;  4PDK A;  1ZHF A;  1B59 A;  5HDK A;  3ABU A;  2X0L A;  2IJL A;  2GZW A;  1ZRF A;  2IA1 A;  1MJA A;  1ON2 A;  4EGZ A;  4M9X A;  3KP4 A;  3WTY C;  3FXQ A;  1USS A;  3ECO A;  1D8J A;  4O3M A;  4OIR F;  3IC7 A;  2HEO A;  1ZRD A;  5H20 A;  4P9U A;  5HLG A;  1IXC A;  1XB4 A;  1BI0 A;  3GZ5 A;  5DUK A;  4U7D A;  4MQ9 F;  2MA3 A;  2XV4 S;  1FSE A;  3IL2 A;  3H92 A;  3MCZ A;  1J0R A;  2L3D A;  3ZMZ A;  3IRR A;  4XLP F;  5BMZ A;  3V8L A;  1TNT A;  5D5W B;  3I54 A;  3E6M A;  2IRF G;  1Z6R A;  3QU6 A;  2K02 A;  1P92 A;  3K1M A;  4LLG F;  4BHC A;  1UCR A;  3H3U A;  3I0T A;  4IVN A;  4P96 A;  3E3V A;  5DCF A;  4ENK A;  3DV8 A;  3FMR A;  4DNC A;  2QEN A;  2DO7 A;  1R00 A;  1S7A A;  5LLQ A;  5HLI A;  1GVJ A;  3WU1 B;  1HW1 A;  2JSC A;  3QPH A;  4LLL A;  4G7H F;  2BYV E;  3LQR A;  3KFW X;  4UVB A;  4XSZ F;  3TO9 A;  1G4D A;  2R7F A;  5J6X A;  1LB2 A;  4N9H A;  1MJB A;  1FYM A;  1FBQ A;  2VE8 A;  1O57 A;  3WGG A;  5FLX Z;  2LKP A;  1ODD A;  2MLK A;  3I53 A;  3F3X A;  3ABT A;  3HHH A;  3O6B B;  2PEX A;  1KU9 A;  4UVA A;  4MTD A;  4WF2 A;  3D5L A;  1Z05 A;  3OV8 A;  2FE3 A;  3RKX A;  3I64 A;  5CVV A;  2VBW A;  2EFW A;  4XBF A;  4ZYG A;  5LGU A;  1F9N A;  4L9J A;  3C7J A;  2P6T A;  4N0B A;  5HDN A;  2EV5 A;  3C3W A;  2DK8 A;  2CSO A;  3U2R A;  1YTY A;  2PG4 A;  1EV7 A;  4LGW A;  5LBQ A;  4IRI A;  1ZYR F;  3E5U A;  2Y48 A;  1YW8 A;  3RYP A;  1O3S A;  2XAJ A;  1P4W A;  5CVR A;  2ISY A;  4EM1 A;  1T39 A;  5BPD A;  1K78 A;  2XIG A;  1WSU A;  2FBH A;  1FLI A;  1YW9 A;  4EQQ A;  2H09 A;  3IKT A;  3DPL C;  2FU4 A;  2KIM A;  4EJV A;  1WQ2 A;  2FOK A;  3GYH X;  3F6O A;  4A2U A;  3LA3 A;  2CYY A;  4G7O F;  3GLX A;  3IWF A;  1FX7 A;  2FML A;  1MKM A;  3JTG A;  4LB5 A;  1NHA A;  2V1X A;  2DW4 A;  2VN2 A;  1XGM A;  2RV8 A;  4U0W A;  3LFK A;  4ON0 A;  1Z1D A;  1TW3 A;  5FFX A;  4LG0 A;  1J7K A;  3WTU C;  5D5V B;  4HQM A;  2EWN A;  3LQQ A;  1H9T A;  1QPM A;  2DT5 A;  1K6O A;  1W7P B;  3ERE D;  3TDZ C;  2K4J A;  1DP7 P;  1A04 A;  2A61 A;  4O5V A;  3BZ6 A;  5A2Q K;  2P5K A;  3JSO A;  2JTV A;  1ZAR A;  3F23 A;  4EVI A;  3HTU A;  1FOK A;  1KA8 A;  4BYY A;  4Y17 A;  5FO5 A;  2HTJ A;  3IWZ A;  5ICF A;  3TKY A;  2E1N A;  4U0Y A;  5ICE A;  2G7H A;  2NNY A;  2LF7 A;  2FRH A;  3RTR A;  1IRF A;  2XRO A;  3LST A;  1Q1H A;  4ZH4 F;  3DXJ F;  2A68 F;  2GA1 A;  4OIO F;  3V7C A;  3VOE A;  4CO8 A;  2IT0 A;  2FMY A;  4M6Y A;  3GEZ A;  4M72 A;  4L9T A;  2C6Y A;  2L02 A;  1BIB A;  2GXB A;  5L3D A;  1STZ A;  2RNJ A;  1W7P A;  4M74 A;  4KT5 C;  2KIU A;  1BIA A;  1OKR A;  3RYR A;  1MDM A;  4CXF A;  4CGZ A;  2NRA C;  3JTH A;  1Z6T A;  2HKO A;  2PLY A;  1ZG1 A;  3GX4 X;  2AS5 F;  1O7L A;  4H0E A;  4RB1 A;  4YII A;  5LRR A;  1FC3 A;  3O2P E;  2XKO A;  1OYI A;  3T8R A;  3ZPL A;  4PCQ A;  4N9I A;  3ZMU A;  3LA2 A;  1JXS A;  2H27 A;  2VOD A;  4MGR A;  2GXG A;  2EV6 A;  1YLF A;  2F5C A;  1J75 A;  3J7A O;  1U78 A;  4KDP A;  3JAM K;  3N4M A;  4GGG A;  2QUF A;  1U8R A;  2IA2 A;  3KEO A;  3NRV A;  3PFI A;  3ROU A;  1O7F A;  4NHJ A;  2RVC A;  3F72 A;  5D5X B;  4RB2 C;  2B0L A;  3KLN A;  4Q47 A;  4GYI A;  1KU7 A;  3HRT A;  2VON A;  2PI0 A;  4HF0 A;  1R1U A;  1XCB A;  3MEX A;  3V4G A;  4EM0 B;  1RNL A;  2OA4 A;  3T5X A;  2IPQ X;  5D6E A;  3ECH A;  1D3Y A;  3LAP A;  1LEB A;  2FSW A;  1TLH B;  2ZXJ A;  3T0Y A;  3P7N A;  2KJC A;  4OIQ F;  2MC3 A;  4O6J A;  2F5D A;  2LSO A;  1SAX A;  5DCM A;  3W6K B;  4WXD A;  2CQK A;  4LK0 F;  3RDI A;  2EFQ A;  1BC7 C;  2KJB A;  5LGT A;  2DQR A;  1ZH5 A;  4KMU X;  2PN6 A;  1TQP A;  4A0Z A;  2VC1 A;  3F8N A;  1U5T C;  3SXY A;  1RIO H;  5DUI A;  3M8E A;  5E20 A;  2W25 A;  4G7Z F;  2OZU A;  1Y0U A;  4OMY A;  3KP5 A;  5L3E A;  1L3L A;  2BE5 F;  1T0F A;  5J8F A;  4G6Q A;  3RIR A;  4HX7 A;  1U5T B;  4Q48 A;  3TGN A;  3I71 A;  3RPU A;  2H94 A;  5ILS A;  3V8J A;  5FB2 A;  4OOI A;  2IP2 A;  1G3S A;  4OMZ A;  2VC0 A;  1E2X A;  1G3T A;  5F1R A;  2HTS A;  1E17 A;  2DFI A;  3CDH A;  2FNA A;  2WV0 A;  4WK8 F;  4ZZL A;  1R5H A;  1JE8 A;  5E8I A;  3Q9V A;  5E18 F;  2EFP A;  3J81 Z;  3M8F A;  3PQK A;  1JHH A;  1OMI A;  3KP2 A;  4R1H A;  3EUH A;  1LDD A;  1U6G A;  3R6S A;  4HDV A;  3ZMV A;  1IN6 A;  1AOY A;  3TO6 A;  1PP7 U;  4Y15 A;  4IXA A;  5FLX K;  1KU3 A;  5ILU A;  2MD5 A;  5ED4 A;  2A3S A;  4A5M A;  4AIK A;  1D5V A;  1TNS A;  1WKM A;  1MD0 A;  2DBB A;  3EDP A;  1FWZ A;  2QVO A;  2D1V A;  3KP7 A;  5DV5 A;  2HQN A;  4I98 B;  6PAX A;  3GF2 A;  2FQ3 A;  2BBY A;  2XKP A;  3SHF A;  1S6L A;  4KIF A;  1H9G A;  2HYG D;  3K2Z A;  3O3K A;  4AIH A;  1QBJ A;  2X4H A;  5FD5 A;  2VOO A;  4E70 A;  3GFL A;  2Y0M A;  2PJP A;  2HS5 A;  3CUQ C;  1KU2 A;  2M1B A;  4U7B A;  2P6S A;  2V6C A;  3ZMD A;  3QPT A;  5FGM A;  5F6F A;  2JT1 A;  4JQF A;  3PQJ A;  3HOT A;  3E97 A;  4R8H A;  3L2C A;  3L9F A;  1IXS B;  4HYE A;  3AAF A;  4RGU A;  5LHG A;  2NYX A;  4A6D A;  1W7P D;  3CUQ B;  2FBK A;  3MWM A;  1YW7 A;  3QP6 A;  4ESF A;  2QM3 A;  2OQG A;  1LNW A;  5E8G A;  2COM A;  3GW2 A;  1SFU A;  3ZMT A;  5KVR A;  3HTS B;  1XCV A;  1IN4 A;  4A0Y A;  2PMH A;  5JR3 A;  2KRF A;  4CIC A;  3KCC A;  4WCG A;  2A69 F;  4EGY A;  4NQW A;  2XUB A;  2QQ9 A;  2YX7 A;  1IRG A;  1B9M A;  1ZGJ A;  3RKY A;  2XHK A;  3EQL F;  1FP2 A;  3WTV C;  2DLL A;  3MZH A;  2V79 A;  4TV7 A;  2XGX A;  3CLO A;  2EFN A;  1XGS A;  3HRM A;  2GWR A;  4LJZ F;  4BHP A;  3N97 A;  2BV6 A;  2LDU A;  1BI3 A;  5H6Q A;  1P2F A;  4M9S A;  3HIF A;  3FMQ A;  3EET A;  2W24 A;  3BJO A;  2K27 A;  3CUQ A;  3LAJ A;  2G9W A;  2BEO A;  2Z3Y A;  1ZG3 A;  3MAJ A;  3GVA A;  3I4P A;  3VB2 A;  4ENM A;  3HYI A;  2OBP A;  4HDU A;  2DPD A;  5HLH A;  1ON1 A;  1HW5 A;  3Q9S A;  4D0P A;  1HBX G;  3BJA A;  2NS0 A;  4I0B A;  1JHF A;  2M87 A;  4P9F A;  4L5J A;  5CYV A;  4NB5 A;  1FBS A;  1TW2 A;  5K5O A;  4KFC A;  4U0V A;  1FPQ A;  1LEA A;  1MJ9 A;  2EFO A;  1YS6 A;  1KQ0 A;  5D5U B;  4KYW A;  3QP5 A;  2L54 A;  3U9G A;  3E5X A;  1BC8 C;  4F7Z A;  3RPQ A;  2XAS A;  5TJJ A;  1ZLJ A;  4RGR A;  2DI3 A;  1Z91 A;  4MQV A;  1HKQ A;  3KET A;  4PZJ A;  3F8M A;  2VT2 A;  5H6R A;  2V9V A;  5DDG A;  2KIF A;  1ZN2 A;  5HVQ C;  2O0Y A;  3R0A A;  4BHB A;  1S7O A;  1R7J A;  2E7W A;  2RGV A;  2YR2 A;  2ISZ A;  1P4A A;  4HLX A;  3IKV A;  3RKW A;  3P9I A;  2J5P A;  5JVT A;  1KQ8 A;  4HZF A;  4A6E A;  2Z5U A;  2IA0 A;  3RJP A;  2GA2 A;  3CO7 C;  5BS6 A;  4XRF A;  3TQN A;  5CVI A;  4YIF A;  4CHU A;  3KP6 A;  2MH9 A;  2OQR A;  2P8T A;  2RN7 A;  1ULY A;  5K1Y A;  1K79 A;  3V8K A;  3H3Z A;  4IRG A;  3KLO A;  3GZ6 A;  1O3Q A;  3F8C A;  5K5R A;  2LNB A;  2VBX A;  3TDU C;  2L4A A;  3C1D A;  3WGI A;  4KUM A;  3IRQ A;  4CZZ A;  1SMT A;  4G6D A;  1HXD A;  1QQI A;  4KA4 A;  1TBX A;  4GO1 A;  4WWC A;  1IW7 F;  5D4R A;  3CJN A;  3J80 K;  1R23 A;  4Y13 A;  3GFI A;  1BI1 A;  4G8X A;  2L01 A;  4L5I A;  3BOQ A;  5DD8 A;  1H0M A;  3V7R A;  3DP7 A;  3WTW C;  5BPI A;  5E17 F;  1LDK B;  2O61 A;  1S29 A;  5HDG A;  5IT9 K;  2QWW A;  2J5O A;  4GXO A;  4L18 B;  3IHU A;  1QO0 D;  1IF1 A;  2O03 A;  4DQ2 A;  3R60 A;  1SD6 A;  3FZV A;  4P5O A;  2ZNZ A;  4LK1 F;  2IVM A;  1R58 A;  2JRT A;  1PP8 F;  4PGG A;  1XMA A;  3FX3 A;  1ZLK A;  2HWV A;  1ZRC A;  1YS7 A;  3WTT C;  4L9N A;  2JZY A;  2Z99 A;  1QNT A;  2TDX A;  2ZME B;  1T6S A;  4UV8 A;  2ESN A;  2HKX A;  5CVU A;  4HV5 A;  3L09 A;  2XVC A;  4B8X A;  3R4K A;  4HV6 A;  2XAG A;  5L3G A;  3KP3 A;  2Y75 A;  1RUN A;  2P7V B;  1GXP A;  2VE9 A;  3E6B A;  5KK1 A;  1FSH A;  5EEG A;  3J81 K;  4KIB A;  1T38 A;  3T1B A;  2PFB A;  4KNY A;  1BBY A;  4YFX F;  2EA4 A;  4HX4 A;  4IF4 A;  5LGN A;  5ICG A;  2VBZ A;  3HSE A;  4ESB A;  2QBY B;  1GXQ A;  1IN8 A;  3K9T A;  5AIP A;  2G7U A;  2Q0O A;  3HSF A;  5JHU A;  1W4M A;  1G3W A;  3ZN0 A;  3GFM A;  1FYL A;  1XD7 A;  2A6E F;  2ZME A;  2ZCW A;  4Q5S F;  1IXR C;  4YFN F;  3ULQ B;  3K0L A;  2XAH A;  1HST A;  2Z33 A;  2DPU A;  1QZY A;  4BH9 A;  1XN7 A;  1SD7 A;  1TTY A;  3E6D A;  4I2O A;  5ILV A;  1YO5 C;  3KZY A;  1ZG5 A;  1J2X A;  2GQQ A;  2R7D A;  5HS7 A;  4S04 A;  5K5Q A;  4IHT A;  4PGH A;  2A5Y B;  1R1V A;  1T98 A;  4UXN A;  1HKT A;  1FZP B;  2VBY A;  1XSD A;  3M9A A;  2P5V A;  2FA5 A;  4RAZ A;  4ZZD A;  2HFH A;  3COA C;  1DUX C;  1SMY F;  1Z7U A;  4ETS A;  4UHT A;  4AIJ A;  3FM3 A;  2DAO A;  3GUD A;  3KE2 A;  2DQL A;  3E5Q A;  2ZJ2 A;  2D1H A;  2M30 A;  1UHM A;  5D8K B;  2QQB A;  4HAM A;  1XDU A;  2EJR A;  1OR7 A;  2OU2 A;  5F64 A;  4XLN F;  2A07 F;  3K1N A;  3SZP A;  5E1X A;  4MEY F;  1SFE A;  1F4K A;  4OU0 A;  2GAU A;  3DF8 A;  2JPC A;  5JI6 A;  2H6C A;  1ZGA A;  4XSX F;  3DFG A;  1B4A A;  1XDS A;  2WWY A;  4WXC A;  4KIC A;  4MNU A;  1V3F A;  3JSP A;  1B9N A;  1C0W A;  2DK5 A;  1RZ4 A;  4I09 A;  1P6R A;  3DKW A;  4ZYE A;  2O3F A;  1WWX A;  4M73 A;  3HRS A;  2Z9O A;  2ADU A;  1CF7 B;  3P9K A;  3LA7 A;  3ZQ7 A;  1FNN A;  4HOB A;  3MQ0 A;  3DPT A;  2CW0 F;  4EM2 A;  3SFZ A;  4BXU A;  3E6C C;  2ETH A;  1U5T A;  2HZT A;  2GIV A;  2UZK A;  3I5U A;  2WC2 A;  3F22 A;  1I1S A;  2P7C B;  2QQA A;  4I02 A;  3B73 A;  2FXA A;  4BAY A;  2W84 A;  1R22 A;  2EK5 A;  4S05 A;  2EB7 A;  1R1T A;  4A12 A;  2WTE A;  4HQE A;  4EMS A;  2O8X A;  3LWF A;  2K4B A;  4I0A A;  2OD5 A;  2RC4 A;  2D2W A;  5HS8 A;  5IT3 A;  1IUY A;  2CWE A;  1CF7 A;  2MBF A;  5L3F A;  4BNC A;  1R5G A;  4RB3 C;  5HOO A;  4YFK F;  4HX8 A;  5L3C A;  1WRJ A;  1FYK A;  4KMF A;  1CGP A;  1BN5 A;  3WU0 A;  3P9C A;  2BGC A;  4I7H A;  4ASN A;  4EV0 A;  1UB9 A;  2P5L C;  3HOS A;  1P4X A;  1KYW A;  3ZMS A;  4CYD A;  1B1B A;  3EYY A;  4IRH A;  2QZ8 A;  2PMU A;  2EV0 A;  2VXZ A;  2F5F A;  3HHG A;  1EH8 A;  1Z9C A;  1I5Z A;  4G94 A;  4ENJ A;  1AWC A;  2HDC A;  3FF5 A;  1RI7 A;  1TQM A;  2RQP A;  3BJ6 A;  3QOP A;  3CTA A;  1ZRE A;  4Q4Z F;  5E1W A;  1B6A A;  3D0S A;  3GFJ A;  4G9Y A;  5E1Z B;  2UWM A;  4ZYH A;  1FY7 A;  1I27 A;  1SD5 A;  2CGP A;  1XGN A;  5D8L B;  3WGH A;  1I1G A;  2LF8 A;  3F21 A;  4FX4 A;  3BPV A;  4HA8 A;  3FM5 A;  1TQI A;  1HKS A;  3WOD F;  4AVP A;  2L4M A;  3T8T A;  3TOA A;  5JFR A;  1KGS A;  2PQ8 A;  3Q5F A;  1F1Z A;  2V1U A;  3WTX C;  2MLG A;  3DEU A;  1K78 B;  3EYI A;  2ZNY A;  1MGT A;  3R61 A;  2OZ6 A;  2E1C A;  4GYG A;  2YPR A;  3ELK A;  1S3J A;  3BY6 A;  1EH7 A;  1YG2 A;  5DEQ A;  2K86 A;  1XMK A;  2FBI A;  4RGS A;  4WXH A;  1PUE E;  1J5Y A;  4ESJ A;  4LG0 B;  1F5T A;  2HOE A;  4HLY A;  1LDJ A;  5LEJ A;  1K7A A;  4M9Z A;  2E7X A;  1I6X A;  3REO A;  2IW5 A;  1VTN C; 
#chains in the Genus database with same CATH topology
 1ETV A;  4IPA A;  3GXO A;  2HOT A;  5M3F J;  2FEZ A;  4IQ4 A;  2JA5 J;  1YFH A;  4AYB A;  3GTQ J;  1Z0X A;  2UXN A;  2W48 A;  1O3T A;  2R0Q C;  4CDG A;  1UHS A;  2W57 A;  1RKT A;  2CMP A;  3A02 A;  3ABM H;  4AU7 A;  4EJO A;  4HF1 A;  3M7G A;  4C3I J;  1DPR A;  3PIP F;  3CDI A;  1UFM A;  2VIX A;  4FHT A;  1AHD P;  4Z2Y A;  3FMS A;  3WTZ A;  1U2W A;  2KZV A;  1HW2 A;  4OIN F;  2P4W A;  1JT6 A;  3M1E A;  4KN7 X;  5EG0 B;  3W6J B;  4AWX B;  3I4M J;  5LHH A;  2DOE A;  1BJA A;  2K9M A;  3G73 A;  2OJE D;  4X1E A;  2ZC2 A;  5CJ9 A;  4EJU A;  2RDP A;  2OAZ A;  1MMA A;  1Y8R B;  3E7L A;  4MTE A;  1OCC H;  2DTZ A;  1UAA A;  2H8R A;  2Y9Z A;  5EDN A;  2HVR A;  3JW4 A;  1SEU A;  4UVC A;  2KZG A;  4XKB A;  2ZSH B;  1NK2 P;  3VEP A;  1P9Q C;  1X2N A;  2Z16 A;  5C44 J;  1K6Y A;  4ENN A;  4IHS A;  1RC9 A;  1REP C;  1KQ9 A;  4R79 A;  2NNN A;  4IHX A;  4BQO A;  2XAF A;  2I10 A;  1XSX A;  4KIG A;  1ZEL A;  3HZJ A;  1ETX A;  2L5Q A;  3TP3 A;  3V42 A;  3TMO A;  2OCE A;  1BM9 A;  2M8E A;  5HS9 A;  2LTP A;  4A0X A;  3LL7 A;  2F4O B;  2IEK A;  1ZTR A;  2VT3 A;  1IRX A;  4N4O B;  5IP7 J;  3F6V A;  5FD6 A;  5FFZ A;  1FBU A;  1SD4 A;  2DJN A;  3M3Y J;  1IRZ A;  2RKH A;  2QYO A;  2X51 A;  2LY9 A;  2O6G E;  1H89 C;  3ZGK A;  4OIP F;  1MDM B;  1JKQ C;  3L2U A;  1WJB A;  2YU3 A;  3BZC A;  3HM5 A;  4RS8 A;  5F04 A;  3VOD A;  4W97 A;  1VQ6 I;  2D45 A;  2LP0 A;  1MBF A;  2ZO4 A;  1E0E A;  4F55 A;  1W0U A;  3TL4 X;  4II2 A;  3CCS I;  1JGS A;  1Z77 A;  3X2Q H;  5LEK A;  3LOC A;  3QAH A;  4M71 A;  2F5E A;  5IYB J;  1LQ1 A;  1ONV A;  3LSG A;  4BQA A;  2K7L A;  4KN4 X;  1EH6 A;  2Y69 H;  1RR7 A;  2PBI A;  3K69 A;  2EZH A;  2JA7 J;  3OOP A;  3A2K A;  2W82 A;  3QPS A;  4GRI A;  1OFC X;  1UST A;  2VOP A;  1SVL A;  3KYC B;  4M6X A;  2AXL A;  3FHZ A;  3HKZ N;  3W3C A;  2NS7 A;  4A5N A;  2YX4 A;  5D4S A;  3BP8 A;  2R5Z B;  4A3D J;  3HUG A;  3MD2 A;  1VQP I;  3BPX A;  4C30 A;  3QRF F;  3PUB A;  1DP3 A;  4D5F A;  1R36 A;  3HRU A;  3G3Z A;  4L5E A;  1VQ8 I;  1VQN I;  1OCZ H;  4RAY A;  5DD4 A;  2ZKZ A;  4Y4R A;  4U88 A;  1ERD A;  4M3E A;  1BI2 A;  4DOZ A;  2KHM A;  2R7W A;  4EJT A;  2GLO A;  1OPC A;  1WJD A;  2ECC A;  1J59 A;  1X2M A;  3L00 A;  3RI4 A;  3QU3 A;  5AIQ A;  4CCK A;  2CV0 A;  3RZO J;  1DU0 A;  1HOM A;  2JPB A;  3FXK A;  3PM1 A;  3W2V A;  5JLW A;  4C2M J;  3BDD A;  3S1Q J;  2X6X A;  1JUP A;  1R5I D;  2MH2 A;  2ZBK A;  4LFU A;  1YIO A;  4UUV A;  2H8W A;  2Z2S B;  3BR1 A;  5IP9 J;  2R3S A;  3K1P A;  4FQG A;  1X1B A;  2BOL A;  5IPA A;  2M5W A;  4M3F A;  3E1S A;  4FT8 A;  5ICC A;  5J8C A;  3DWL E;  3S93 A;  3S2H J;  4XID A;  3WE2 A;  3FXU A;  2XRL A;  2IGK A;  3B6C A;  1Y8Q B;  4L0Z B;  2MD0 A;  2X1D A;  1G3Y A;  3ZN1 A;  3WE3 A;  4BBS J;  2FF4 A;  4I6Z A;  4FX0 A;  3DBR B;  4Y52 J;  2XAQ A;  3WG9 A;  4P55 A;  1JJ8 C;  2DU9 A;  4IJA A;  4B09 A;  1SAU A;  5CVJ A;  1WZ2 A;  2HR3 A;  2R5Z A;  3PSI A;  4DW6 A;  2KP6 A;  2B7E A;  3FWE A;  3TOB A;  1PDN C;  1QZZ A;  3CMA I;  1R9T J;  2DA4 A;  4BKX A;  4KIS A;  1W5T A;  5DCM B;  5L3B A;  5CLS A;  3HXL A;  3DKY A;  4J01 A;  3HEF A;  4M3G A;  3CC7 I;  2BXY A;  4YG2 F;  2L9N A;  3OS2 A;  2O9L A;  1T0F C;  4ZYD A;  3A1Y A;  4OAZ A;  5ERI A;  3ML6 A;  1S8N A;  1SFX A;  1XGO A;  1UG2 A;  4MFE A;  3NWT A;  4LB6 B;  4HRI A;  2DA7 A;  4FE7 A;  4EAT A;  3G1O A;  3DTE A;  3SQN A;  1OIS A;  3VFZ A;  3R0J A;  5HLT A;  3DPU A;  2DTR A;  1MZB A;  3F8B A;  1L0O C;  4I01 A;  1QGP A;  1IN7 A;  3DBL B;  1V4R A;  3F8F A;  5A2Q Z;  2V1D A;  5J47 A;  4XRS A;  1N77 A;  4C2T A;  3A0B C;  1O3R A;  1QZE A;  4RBO A;  1WJA A;  1IAW A;  1BL0 A;  5DM6 F;  5F0F A;  1LVA A;  4QTR A;  5FKL A;  1LJ9 A;  4ZC3 A;  2ESH A;  3WHC A;  4BS9 A;  4UNO A;  3GWZ A;  2X9D A;  2R7R A;  5EEH A;  2R7O A;  3C2B A;  3BT9 A;  3BWG A;  4HW0 A;  1KYZ A;  3DU5 A;  4MEX F;  1IZ1 A;  2VLA A;  3U1D A;  2RRE A;  2IGM A;  2QBY A;  2BHY A;  3K4M A;  4RGX A;  3J80 Z;  2WAQ N;  2ZFW A;  5DYM A;  3OYD A;  3HSR A;  3ZP5 A;  2STT A;  4HBL A;  5TRD A;  3HOV J;  3CO6 C;  2CG4 A;  1GDT A;  1GHC A;  4H4K C;  2CO5 A;  1WI3 A;  2KKO A;  1YYV A;  2FOW A;  3RKQ A;  5AON A;  2WA0 A;  3KZZ A;  2Q2E B;  4RA2 A;  2CV1 A;  2HQR A;  3CCE I;  4LLN A;  3RQI A;  1FP1 D;  1R4M B;  4M3D A;  1A36 A;  3S2W A;  2MYS A;  5F1J A;  4JK1 X;  2GXA A;  4C3J J;  1DGR M;  2XPU A;  2F6C A;  5E3L A;  1DPU A;  2JSP A;  2GIZ A;  2M45 A;  2EA2 A;  3SEZ A;  1YQA A;  3HGG A;  3OYL A;  5IT9 Z;  5GTI C;  2OTL I;  3KIO A;  3ZQL A;  2VJ5 A;  4XIC A;  3JCU C;  1FT9 A;  2FNP A;  1HA8 A;  5H2F C;  2CFX A;  1HQC A;  1ZAO A;  1I39 A;  3G71 I;  2UXX A;  3I59 B;  3BRO A;  4L9V A;  3AG1 H;  2Q1Z B;  1H8A C;  1P7I A;  4BE2 A;  4QLC U;  2PMZ A;  5FJ8 J;  1OYW A;  3C18 A;  3Q0W A;  3I58 A;  3CCR I;  5J4V A;  1U3E M;  1T2K A;  3S32 A;  3IV5 A;  2X1E A;  3AG3 H;  3GO5 A;  3V7S A;  3OY9 A;  1HSJ A;  4K2E A;  2Z1D A;  3PSF A;  1W5S A;  3NQO A;  1BOB A;  4LD5 A;  2HQ5 A;  1WI9 A;  5BNG A;  1UHW A;  2WAQ A;  5HNF A;  2L0K A;  4RB0 A;  4BGD A;  2CW7 A;  3KEQ A;  3L2V A;  3L7W A;  1XX5 A;  4IZZ A;  3CUO A;  3S14 J;  5BOX A;  5BQT A;  2HVS A;  4HF2 A;  2AHQ A;  2Q2E A;  1D0Y A;  3JRB A;  2MC4 A;  3ISP A;  2BW3 B;  1LFP A;  2M3A A;  2H6B A;  1AA7 A;  2HNH A;  2ACJ A;  2V4J C;  4HST A;  5LHI A;  2NAZ A;  3OOU A;  2QLZ A;  4PJ0 C;  1DDN A;  2PJR B;  3NEU A;  4LMY A;  5KHD A;  3B02 A;  5K7H A;  1BW5 A;  2E2H J;  2O5R A;  3JAM Z;  2LY1 A;  1W1W E;  2AXT C;  1OCP A;  3HDD A;  4L0Y B;  2KIQ A;  3WTS C;  3TO7 A;  4DBQ A;  1J9I A;  3PNT A;  5LRS A;  2WAE A;  3FXR A;  2CQN A;  4JBA A;  2DA2 A;  2ECB A;  4ANJ A;  2HGC A;  2YSR A;  4GDF A;  4WX9 A;  4XRM A;  3VSK A;  4HNU A;  1G6N A;  4A3K J;  5D6F A;  2HDW A;  2XRN A;  3SZT A;  1XSV A;  2BHZ A;  2RQQ A;  4IO9 F;  3MZY A;  3I59 A;  2CS3 A;  1RUO A;  3LNQ A;  2LD5 A;  2F2E A;  3BR3 A;  3CQZ J;  2OCC H;  3H35 A;  4B47 A;  3MFK A;  4AD9 A;  5KAI C;  1X3U A;  3SDB A;  2STW A;  1P7J A;  1PYV A;  4RAG A;  2WY7 Q;  1YJW I;  1OYY A;  4QWQ A;  1RET A;  2KRH A;  4GCV A;  4IHW A;  4UV9 A;  4YRV A;  1UG0 A;  3DQV C;  1LPQ A;  2HYF A;  3GTO J;  2W85 A;  1BOA A;  3BR2 A;  1IN5 A;  4MHG A;  3CCM I;  4UB6 C;  2A6H F;  3FBI B;  4BY1 J;  2Q8K A;  4EJW A;  3CMY A;  1D8K A;  3LSJ A;  2ELH A;  2B9S A;  4PDK A;  2LLK A;  1ZHF A;  2XDV A;  1LUJ B;  1B59 A;  5HDK A;  3ABU A;  2WAD A;  2X0L A;  2IJL A;  1TC3 C;  1FMV A;  3IAM 2;  2GZW A;  3K70 C;  1ZRF A;  4XLF A;  3FXO A;  4B4C A;  2R7Z J;  2IA1 A;  4ZTJ A;  1MJA A;  1ON2 A;  1TZL A;  4DJA A;  4EGZ A;  4M9X A;  2BW3 A;  3KP4 A;  3WTY C;  3FXQ A;  2VJJ A;  1JKO C;  1USS A;  3ECO A;  1D8J A;  4O3M A;  2CQQ A;  4OIR F;  3IC7 A;  2HEO A;  4A93 J;  1ZRD A;  5H20 A;  4P9U A;  5HLG A;  5M5X J;  1IXC A;  1XB4 A;  1BI0 A;  3GZ5 A;  5DUK A;  4U7D A;  3I4N J;  4MQ9 F;  2HPI A;  4II3 A;  1VQ7 I;  1ZR2 A;  1D0Z A;  2MA3 A;  2VQC A;  2XV4 S;  5E3N A;  3BTC A;  1FSE A;  5FRO A;  5GAE J;  2VKH A;  3IL2 A;  3H92 A;  3MCZ A;  1J0R A;  2V7F A;  5HNH A;  2L3D A;  1IV6 A;  3ZMZ A;  2NXN B;  3IRR A;  2HXO A;  1X4P A;  4XLP F;  5BMZ A;  3V8L A;  1TNT A;  3OSG A;  3VYS B;  5D5W B;  3I54 A;  3E6M A;  3UNG C;  2IRF G;  2MFZ A;  4A3C J;  1Z6R A;  3WU2 C;  4CA0 A;  3QU6 A;  2K02 A;  1P92 A;  3K1M A;  4LLG F;  4BHC A;  1UCR A;  3A03 A;  3H3U A;  3I0T A;  4ZDL A;  4IVN A;  4P96 A;  3E3V A;  4BY7 J;  3U1K A;  1JKP C;  3GTK J;  5DCF A;  3J7A Y;  1YJN I;  3HOU J;  4ENK A;  3DV8 A;  3JRF A;  1RRJ A;  3CF5 F;  2KFD A;  3FMR A;  3KPH A;  1TWH J;  4XLC A;  4HPQ A;  4DNC A;  2QEN A;  4ZDP A;  5E3M A;  4J00 A;  2GBY A;  2DO7 A;  1R00 A;  1S7A A;  4NC7 A;  4CYC B;  2BY3 A;  5LLQ A;  2QCO A;  4IHV A;  5HLI A;  1GVJ A;  2DMT A;  5FRN A;  3WU1 B;  4DZP A;  2X6O A;  1HW1 A;  2JSC A;  1MMD A;  4GFB A;  3I56 I;  2V9P A;  2WV1 A;  1ZQ3 P;  3QPH A;  4LLL A;  4G7H F;  2BYV E;  2EZK A;  3KZI C;  2E5N A;  3LQR A;  3KFW X;  4BAC A;  3ZQH A;  2XAU A;  4UVB A;  4XSZ F;  2LKS A;  3F9K A;  4CCM A;  1R6R A;  2Y31 A;  3OIO A;  3BCB A;  3TO9 A;  5GPC A;  1G4D A;  1D1C A;  2R7F A;  5J6X A;  4XR6 A;  1LB2 A;  3DTK A;  4N9H A;  1YIT I;  1MJB A;  5IP6 A;  1FYM A;  4PSX A;  4NBQ A;  1FBQ A;  2VE8 A;  3QQA A;  2M4K A;  1O57 A;  1LFB A;  3WGG A;  5FKK A;  1SFK A;  3DBH B;  2E5Z A;  5FLX Z;  2LKP A;  4PJL A;  4V2F A;  1ODD A;  1QHH D;  2MLK A;  3ABK H;  3VYU B;  3I53 A;  3F3X A;  1A5J A;  3E0J B;  3ABT A;  4S0H B;  3HHH A;  3O6B B;  2PEX A;  1KU9 A;  4XMY A;  2A6T A;  5F0H A;  1QU3 A;  4UVA A;  4MTD A;  4WF2 A;  4BE0 A;  3S17 J;  3D5L A;  1Z05 A;  3BTJ A;  4FCY A;  3P5J A;  3OV8 A;  1G2H A;  2FE3 A;  4M3B A;  5GAH J;  2M7B A;  3RKX A;  2VKV A;  1RR8 C;  1ACI A;  4JX6 A;  2EPF A;  3I64 A;  2NOJ B;  2VBW A;  5CVV A;  2EFW A;  1MH3 A;  1UEL B;  4XBF A;  2WB1 A;  4E7H A;  4ZYG A;  5LGU A;  2KDZ A;  3K4J A;  1F9N A;  4L9J A;  3C7J A;  2LBF B;  1IJW C;  2P6T A;  3CJT B;  3BTL A;  4N0B A;  5F08 A;  5HDN A;  1VFC A;  2EV5 A;  3C3W A;  2VXD A;  2LC2 A;  3H5R A;  2XGD A;  5JVG F;  4Z6Y A;  2DK8 A;  2CSO A;  3U2R A;  1YTY A;  2DA1 A;  2OV7 A;  2X1C A;  3H0D A;  1R49 A;  4FIS A;  2PG4 A;  1EV7 A;  4LGW A;  5LBQ A;  4E7J A;  4ABZ A;  5B3S H;  4IRI A;  2N8G A;  1ZYR F;  2K5C A;  2Y0S A;  2Y48 A;  3E5U A;  5EYR A;  1YW8 A;  2R5Y B;  3C2G A;  3RYP A;  1FOY A;  2DXI A;  1O3S A;  2XAJ A;  1P4W A;  5CVR A;  3UR3 C;  2VUM J;  2ISY A;  2L9S A;  3ZOB A;  4EM1 A;  1T39 A;  2CUJ A;  2KPM A;  5BPD A;  4MFD A;  1K78 A;  4PJN A;  2XIG A;  1WSU A;  2MGQ A;  2FBH A;  3OS1 A;  1FLI A;  4W1U A;  5GAD J;  1YW9 A;  4EQQ A;  4BEH B;  2H09 A;  3SZG A;  3IKT A;  1FTT A;  3DPL C;  2FU4 A;  2KIM A;  4EJV A;  1WQ2 A;  5EZG A;  1APL C;  3CZ6 A;  2FOK A;  4NC6 A;  3ABL H;  5TIS C;  3Q3S A;  3BR6 A;  2CUF A;  2HI3 A;  4BQQ A;  3GYH X;  2L7F P;  2KRC A;  3F6O A;  2DFE A;  1VI0 A;  2CYY A;  3H36 A;  3LA3 A;  4A2U A;  2R7T A;  4G7O F;  4V2G A;  3GLX A;  3IWF A;  3OYI A;  3BG6 A;  1MSF C;  1FX7 A;  4A69 C;  2DDA A;  2FML A;  2KLO A;  3ZR8 X;  1MKM A;  3JTG A;  1MW7 A;  4LB5 A;  1YRN B;  1OCR H;  1NHA A;  2V1X A;  2ZB9 A;  2LBF A;  4ZYA A;  2DW4 A;  3FK6 A;  2BY0 A;  2H1K A;  3EUK L;  2K85 A;  2VN2 A;  4D7M A;  1XGM A;  2RV8 A;  4U0W A;  3LFK A;  4ON0 A;  4RLF A;  1Z1D A;  3WG7 H;  1TW3 A;  3LSK A;  5FFX A;  1XMX A;  4LG0 A;  1J7K A;  1MIJ A;  3WTU C;  5D5V B;  3CF2 A;  4HQM A;  2EWN A;  3LQQ A;  1H9T A;  1QPM A;  2DT5 A;  2M34 A;  3FDY A;  1K6O A;  1W7P B;  3ERE D;  3TDZ C;  2K4J A;  1DP7 P;  5JLX A;  3OIP A;  3JRI A;  1ETW A;  1A04 A;  2A61 A;  4O5V A;  3BZ6 A;  2E2I J;  5A2Q K;  3L2W A;  5IYC J;  2P5K A;  1XS9 A;  3JSO A;  2JTV A;  3LSI A;  1WGX A;  1D5Y A;  1ZAR A;  1Z21 A;  3F23 A;  4HNT A;  1BA5 A;  4E7S A;  1LKX A;  4EVI A;  3OYK A;  3QYF A;  3D5R C;  2EBI A;  3G1L A;  5J40 A;  3HTU A;  1FOK A;  2K9N A;  2IS1 A;  1KA8 A;  2HU9 A;  4RMN A;  4BYY A;  4RAF A;  4Y17 A;  1QVT A;  5FO5 A;  2HTJ A;  3IWZ A;  5ICF A;  3TKY A;  2E1N A;  3CJR B;  3OR2 C;  5EG0 A;  3BLY A;  5M5W J;  1TWF J;  1PUF B;  4U0Y A;  3LSM A;  1AKH B;  5FKN A;  2ELK A;  4IEJ A;  4F52 A;  5ICE A;  2G7H A;  2NNY A;  2MAB A;  1VQ4 I;  2LF7 A;  1WJE A;  1FIA A;  2FRH A;  3OYN A;  1YRN A;  3RTR A;  1IRF A;  4XK4 A;  2MW8 A;  2XRO A;  3LST A;  1Q1H A;  4ZH4 F;  4D1Q A;  3DXJ F;  2A68 F;  2GA1 A;  2R7X A;  3JRD A;  4OIO F;  2M2E A;  3V7C A;  2W4S A;  3VOE A;  4CUG A;  4NC8 A;  4CO8 A;  1MBJ A;  2IT0 A;  2FMY A;  4M6Y A;  3GEZ A;  4M72 A;  2CJJ A;  4L9T A;  3S3N A;  2C6Y A;  2L02 A;  1BIB A;  2GXB A;  5L3D A;  1STZ A;  4BBR J;  4CSW A;  2RNJ A;  3S3M A;  1ETO A;  1W7P A;  4UUT A;  5C4X J;  2UUZ A;  2AQE A;  5KCM A;  5TGT A;  3FIS A;  4M74 A;  4KT5 C;  2BXZ A;  4XKV A;  1S9H A;  3G6E I;  2KIU A;  1BIA A;  4X0G A;  1OKR A;  3RYR A;  1MDM A;  2JRM A;  1U0J A;  5FRM A;  4CXF A;  2F5V A;  1X1C A;  4CGZ A;  3OS0 A;  3CES A;  4I99 C;  4XOT A;  1FEX A;  2NRA C;  1HDP A;  3JTH A;  3KYL A;  1Z6T A;  2HKO A;  2PLY A;  2DT7 B;  1X19 A;  1ZG1 A;  1WPK A;  3S1M J;  3GX4 X;  2AS5 F;  1Z3X A;  1O7L A;  4H0E A;  2LR8 A;  4RB1 A;  1V5E A;  1D0X A;  4YII A;  4YIR X;  2NVT J;  5LRR A;  3K6G A;  1ZR4 A;  1FC3 A;  3O2P E;  2BVM A;  1N75 A;  2XKO A;  1OYI A;  2D5V A;  3T8R A;  4IOA F;  3ZPL A;  3HKZ A;  4PCQ A;  4N9I A;  1ORK A;  4FET A;  3H3V K;  3ZMU A;  4KT6 A;  2O8K A;  2L7K A;  3LA2 A;  1B8I B;  1JXS A;  2H27 A;  3HOX J;  3VPR A;  2VOD A;  3PO3 J;  4MGR A;  2GXG A;  3MKW B;  2EV6 A;  1YLF A;  2F5C A;  2K9L A;  2HQA A;  2TCT A;  3OYA A;  1J75 A;  3J7A O;  4AID A;  3AG4 H;  3OYG A;  1U78 A;  1IUF A;  4KDP A;  3OYC A;  3JAM K;  3N4M A;  1HF0 A;  4GGG A;  2QUF A;  1U8R A;  2IA2 A;  3KEO A;  1K4S A;  3RZD J;  3NRV A;  3PFI A;  3ROU A;  1PJR A;  2IAI A;  3WHB A;  4JX4 A;  1O7F A;  1VQO I;  3I9V 2;  4XN3 A;  4NHJ A;  1NTC A;  2RVC A;  2CUE A;  3F72 A;  3BCA A;  4PUS A;  4JP0 A;  3HPG A;  5J1Y A;  2JK3 A;  5D5X B;  4YEL A;  4RB2 C;  5K7Z A;  3W2A A;  2VKE A;  1WH5 A;  2B0L A;  1BR2 A;  1MMG A;  3KLN A;  4Q47 A;  4GYI A;  1KU7 A;  3HRT A;  2VON A;  2VQH A;  2DOF A;  3PFY A;  1U9N A;  1YJ9 I;  3HOY J;  2QKL B;  3K4K A;  2PI0 A;  3MMY B;  4HF0 A;  1R1U A;  3CDL A;  4B43 A;  1TWC J;  1XCB A;  1MH4 A;  5F27 A;  3MEX A;  3V4G A;  4EM0 B;  1RNL A;  2OA4 A;  2K9S A;  2VJ4 A;  2IPQ X;  5D6E A;  3ECH A;  3T5X A;  1D3Y A;  3LAP A;  2ZXH A;  3PNY A;  2IS2 A;  2X48 A;  2MSY A;  4P1W A;  9ANT A;  1LEB A;  2FSW A;  3DLA A;  1TLH B;  3FBN B;  2ZXJ A;  3T0Y A;  1B72 B;  3P7N A;  2KJC A;  3K70 D;  1B8I A;  4OIQ F;  3EUH C;  3K4N A;  2ME6 A;  2MC3 A;  3ZQC A;  4O6J A;  2F5D A;  2LSO A;  1SAX A;  2HDD A;  5DCM A;  3W6K B;  1MMS A;  3NWS A;  4WXD A;  2CQK A;  4LK0 F;  3RDI A;  2IXS A;  2EFQ A;  1BC7 C;  2KJB A;  5LGT A;  2P81 A;  2ZFU A;  2DQR A;  1ZH5 A;  2XF7 A;  4KMU X;  1U8B A;  2PN6 A;  1TQP A;  4RLQ A;  3CLQ A;  2DOA A;  4XN0 A;  4A0Z A;  2GM4 A;  4RM2 A;  4XOP A;  3VDX A;  1EA3 A;  2VC1 A;  3F8N A;  1TT5 B;  1U5T C;  2DJI A;  3SXY A;  3H1C A;  1RIO H;  2NVU B;  5DUI A;  3M8E A;  2CV2 A;  5E20 A;  4XLA A;  1YIJ I;  2R7U A;  2W25 A;  4G7Z F;  2OZU A;  1Y0U A;  1EKE A;  4OMY A;  5B66 C;  2QSG X;  2L9R A;  3ZCO A;  3KP5 A;  4QSH A;  4QPQ A;  5L3E A;  1L3L A;  2BE5 F;  2L2O A;  2VPR A;  1T0F A;  3MZ8 A;  5J8F A;  2LG4 A;  4G6Q A;  3S15 J;  1VZ0 A;  3RIR A;  2LKX A;  1IV8 A;  4IQJ A;  2H1L A;  3IH4 A;  2XGE A;  3HPH A;  4HX7 A;  1U5T B;  4Q48 A;  3TGN A;  3I71 A;  3RPU A;  2H94 A;  2XF6 A;  3GTG J;  5ILS A;  4CCL A;  3V8J A;  5FB2 A;  4OOI A;  2B63 J;  2IP2 A;  4J19 A;  1G3S A;  4OMZ A;  2VC0 A;  2X85 A;  1E2X A;  2LK2 A;  1G3T A;  5F1R A;  4D9J A;  4YEJ A;  2HTS A;  1E17 A;  2DFI A;  2CFO A;  1I3A A;  2A05 A;  3CDH A;  1ETY A;  2FNA A;  3J7Y J;  2DYS H;  2WV0 A;  2YS9 A;  4BQN A;  4WK8 F;  2R7S A;  3MVP A;  2LOO A;  2BY2 A;  3BQY A;  4ZZL A;  1R5H A;  1JE8 A;  5E8I A;  3Q9V A;  1G8X A;  5E18 F;  3NAR A;  1GLN A;  2EFP A;  3J81 Z;  4CH7 A;  4XL9 A;  1LVK A;  3M8F A;  2PX9 A;  3M8J A;  3PQK A;  1JHH A;  2JVH A;  2VJI A;  1OMI A;  3KP2 A;  4R1H A;  3CC2 I;  3EUH A;  1LDD A;  1U6G A;  3R6S A;  5EGO B;  4HDV A;  3ZMV A;  1IN6 A;  2JUC A;  1AOY A;  3TO6 A;  1PP7 U;  4Y15 A;  4RDU A;  4IXA A;  3OMY A;  5FLX K;  3BG5 A;  2HOS A;  1W5C C;  3CCU I;  1KZH A;  4BDY A;  1KU3 A;  2CW8 A;  5ILU A;  2MD5 A;  5ED4 A;  1E3H A;  2A3S A;  3UKG A;  4A5M A;  4AIK A;  2QGU A;  1D5V A;  3RSN A;  2HPM A;  3IUO A;  2K3F A;  3CC4 I;  2I8D A;  2DA5 A;  1TNS A;  1WKM A;  3ZQG A;  3K4C A;  1MD0 A;  2DBB A;  4KJZ A;  2DMQ A;  3BR0 A;  3EDP A;  2MG4 A;  1FWZ A;  2DYR H;  1IO2 A;  2QVO A;  3DTI A;  2DOD A;  2D1V A;  3KP7 A;  1IDY A;  2DA3 A;  4E7L A;  5DV5 A;  2BY1 A;  2HQN A;  4I98 B;  6PAX A;  5E79 C;  1NH3 A;  3ONQ A;  5J1R A;  3GF2 A;  2FQ3 A;  3JRE A;  4AUX A;  2JA8 J;  1JJ6 C;  2BBY A;  5CQE A;  1HC8 A;  3VWB A;  2XKP A;  3SHF A;  4C3H J;  3H0G J;  1S6L A;  1A6Q A;  3ZXS A;  5J4Y A;  2M8G X;  4B3A A;  5DM7 F;  4KIF A;  1H9G A;  2HYG D;  2OPT A;  3K2Z A;  3O3K A;  1WJF A;  4AIH A;  1QBJ A;  4A3M J;  2X4H A;  4V19 K;  2L9V A;  5FD5 A;  2VOO A;  5B1B H;  5CPR B;  4E70 A;  4NQW B;  3S3O A;  2E71 A;  3GFL A;  2M0M A;  4PSW A;  2Y0M A;  2PJP A;  3A01 B;  1O4X A;  2PJR A;  2WAF A;  2CRG A;  2EQR A;  1ENH A;  3SEQ A;  4XM3 A;  2HS5 A;  3CUQ C;  4BU2 A;  4MLO A;  5EGO A;  1KU2 A;  2M1B A;  3VSL A;  4U7B A;  2P6S A;  2V6C A;  3I55 I;  3ZMD A;  2TRT A;  3QPT A;  5FGM A;  2ID6 A;  2JQ7 A;  1T95 A;  1BR1 A;  5F6F A;  3OL3 A;  3GTM J;  5GAG J;  3K7A J;  2JT1 A;  2OC6 A;  3GLL A;  4JQF A;  4D5C A;  3OYH A;  2CUZ A;  3PQJ A;  3FIW A;  5C3E J;  5IY5 H;  3S1N J;  3HOT A;  3E97 A;  4R8H A;  3L2C A;  3L9F A;  4UY8 I;  1V5G A;  4PJM A;  1IXS B;  4HYE A;  1OLT A;  1R4N B;  3GBG A;  3Q0V A;  4EEF G;  1Y1V J;  1JUS A;  3I3L A;  3AAF A;  4RGU A;  5LHG A;  2NYX A;  4A6D A;  1W7P D;  3CUQ B;  2FBK A;  3MWM A;  5GP9 A;  1YW7 A;  1XG1 A;  3DKX A;  3QP6 A;  2VPL A;  1A31 A;  4ESF A;  2QM3 A;  2OQG A;  2QA4 I;  2XB5 A;  4ZJZ A;  3OYE A;  3PJR A;  1LNW A;  5E8G A;  2COM A;  3GW2 A;  3ASO H;  4XKW A;  3CCL I;  1Y6I A;  1SFU A;  3ZMT A;  5KVR A;  3HTS B;  1XCV A;  1IN4 A;  4A0Y A;  2PMH A;  5JR3 A;  2DDB A;  2KRF A;  4CIC A;  1TL8 A;  3ZRG A;  1T8I A;  2DMP A;  3KCC A;  4MIM A;  4WCG A;  2A69 F;  1VF9 A;  4EGY A;  2R93 J;  4NQW A;  2XUB A;  2QQ9 A;  1JGG A;  3LSH A;  2YX7 A;  3O8G A;  5KNL A;  4BE1 A;  1QHG A;  2LYC A;  1IRG A;  1B9M A;  1ZGJ A;  5C4J J;  1UJ8 A;  3RKY A;  3RCO A;  4B48 A;  2XHK A;  3EQL F;  3BQZ A;  1FP2 A;  5GTH C;  2DLL A;  4BUP A;  3WTV C;  4E7K A;  3MZH A;  2V79 A;  4RM3 A;  2XGX A;  3AFH A;  2XSJ C;  2EFN A;  3CLO A;  4TV7 A;  2W7N A;  1XGS A;  3HRM A;  2GWR A;  2V9K A;  4LJZ F;  4BHP A;  3N97 A;  4NDL A;  2XB0 X;  1R71 A;  1FMW A;  2JN6 A;  2BV6 A;  2LDU A;  1BI3 A;  5H6Q A;  1I50 J;  1P2F A;  4M9S A;  3HIF A;  3FMQ A;  1IGN A;  1VQL I;  3EET A;  1CQT A;  2W24 A;  3BJO A;  2K27 A;  3CUQ A;  4DYQ A;  3LAJ A;  2G9W A;  2BEO A;  2Z3Y A;  4HEA 2;  5J1U A;  3MKZ A;  1ZG3 A;  2XGC A;  1IDZ A;  3MAJ A;  3GVA A;  1Y56 A;  1TP4 A;  2VI6 A;  2DFF A;  4DIQ A;  3I4P A;  1MNE A;  4HNV A;  3VB2 A;  4ENM A;  3HYI A;  4AYB N;  4E4H A;  2OBP A;  2R4G A;  5HOD A;  4HDU A;  2DPD A;  1V54 H;  3JR9 A;  5HLH A;  1W36 C;  1QPI A;  3OR1 C;  4G12 A;  3RQ4 A;  1D1A A;  1JT0 A;  4LIV A;  1ON1 A;  2ID3 A;  1HW5 A;  3Q9S A;  4LOC A;  4CYC A;  4D0P A;  1HBX G;  2QQ8 A;  2E1M C;  3BJA A;  3JRC A;  3GZN B;  2FJ1 A;  2NS0 A;  3G2B A;  4I0B A;  5M3M J;  4DYR A;  1JHF A;  2M87 A;  4P9F A;  4L5J A;  5CYV A;  4A3E J;  3JRA A;  4NB5 A;  1FBS A;  1TW2 A;  5K5O A;  4KFC A;  4U0V A;  1GT0 C;  1TWG J;  1FPQ A;  1LEA A;  1MJ9 A;  1T33 A;  2EFO A;  1YS6 A;  1KQ0 A;  5D5U B;  4KYW A;  3FKJ A;  3QP5 A;  4DYC A;  2L54 A;  3U9G A;  1YOV B;  2F4I A;  3E5X A;  3OWT A;  1BC8 C;  2WBM A;  3QOE A;  4F7Z A;  4AM3 A;  4B1R A;  3RPQ A;  1QA6 A;  2XAS A;  5TJJ A;  3HBL A;  1X3W B;  2K40 A;  2OF7 A;  1ZLJ A;  4RGR A;  3CCJ I;  2DI3 A;  2E1M B;  1Z91 A;  4MQV A;  1HKQ A;  3KET A;  1HCR A;  4PZJ A;  3F8M A;  3W2W A;  2VT2 A;  5H6R A;  3AKZ A;  2V9V A;  1V55 H;  1YX5 A;  3K4B A;  3KYD B;  4BXF A;  2KIF A;  3BR5 A;  5DDG A;  4C2U A;  1ZN2 A;  2IBD A;  4IOC F;  1SC7 A;  5HVQ C;  1GV5 A;  2O7O A;  2O0Y A;  3R0A A;  4BHB A;  1S7O A;  3A0H C;  1R7J A;  2E19 A;  2EH3 A;  2E7W A;  2RGV A;  2YR2 A;  1VQ9 I;  2ISZ A;  3LSR A;  1P4A A;  4HLX A;  4Y7N J;  3IKV A;  2QF7 A;  3RKW A;  3P9I A;  2J5P A;  5JVT A;  1KQ8 A;  1S7E A;  4HZF A;  4Y33 A;  4A6E A;  2Z5U A;  4I76 A;  2IA0 A;  4B3X A;  2RNG A;  3RJP A;  3HJE A;  2GA2 A;  1VQ5 I;  3CO7 C;  5BS6 A;  1F43 A;  2DMN A;  4XRF A;  3BG7 A;  3TQN A;  5CVI A;  2ZJP F;  4Y3O A;  4YIF A;  4CHU A;  3KP6 A;  2AO9 A;  3LMM A;  2MH9 A;  3OYM A;  2OQR A;  2P8T A;  2RN7 A;  1ULY A;  5K1Y A;  1WJC A;  2NVY J;  1K79 A;  3V8K A;  3H3Z A;  4IRG A;  3KLO A;  1TWA J;  3GZ6 A;  3RPU D;  3HUG B;  2HZD A;  3F8C A;  1O3Q A;  5K5R A;  2LNB A;  5IOY A;  1OCT C;  2VBX A;  3TDU C;  2R5Y A;  4DZJ A;  2IS4 A;  2L4A A;  3C1D A;  2IS6 A;  1ZK8 A;  3WGI A;  3H9Q A;  4KUM A;  3IRQ A;  1BW6 A;  4CZZ A;  1JTX A;  2LVS A;  1SMT A;  4G6D A;  4XNF A;  1HXD A;  2UV1 A;  1QQI A;  4KA4 A;  1TBX A;  1F36 A;  2JA2 A;  1SVM A;  5B5E C;  3B6A A;  4XKC A;  4BEH A;  4GO1 A;  3H5N A;  4WWC A;  1IW7 F;  1GV2 A;  5D4R A;  5EEA A;  3K10 A;  3TW7 A;  3BTI A;  3CJN A;  3J80 K;  1EF4 A;  1R23 A;  4Y13 A;  3JRG A;  3QWL A;  2ZXI A;  3GFI A;  1BI1 A;  5LFA A;  4G8X A;  2W1O A;  2L01 A;  2DA6 A;  3BOQ A;  4L5I A;  5DD8 A;  1H0M A;  2M4G A;  3V7R A;  1K83 J;  1XPX A;  1LE8 B;  4AVZ A;  1S72 I;  3BC8 A;  4F93 B;  3L2R A;  5B1A H;  1XC5 A;  3DP7 A;  4D7N A;  3WTW C;  1SAN A;  5BPI A;  5E17 F;  2LRE A;  1LDK B;  3L1P A;  2IGO A;  2O61 A;  1X1D A;  1S29 A;  3OL4 A;  5HDG A;  3HC7 A;  2NOG A;  1OJL A;  2ZME C;  1VND A;  5IT9 K;  4IHY A;  3GTL J;  2P0W A;  2QWW A;  1DGW Y;  2J5O A;  4GXO A;  4L18 B;  3IHU A;  2EIK H;  1QO0 D;  3D5S C;  1IF1 A;  4PK4 A;  1N25 A;  1WHU A;  2O03 A;  3R60 A;  4DQ2 A;  3SDG A;  1SD6 A;  2BVL A;  3BZK A;  3FZV A;  4P5O A;  4C9Y A;  2ZNZ A;  4FE4 A;  4LK1 F;  1E3P A;  2IVM A;  1R58 A;  3CP8 A;  5KAF C;  2JMW A;  2JRT A;  1PP8 F;  4PGG A;  1XMA A;  1NG6 A;  4CCO A;  3FX3 A;  1ZLK A;  2HWV A;  1ZRC A;  1JTY A;  3W6V A;  1WJ5 A;  4BL0 B;  1YS7 A;  4XLH A;  3WTT C;  1T56 A;  3H9G A;  4L9N A;  3G1M A;  4A3J J;  3PL8 A;  1I3Q J;  1JKR C;  2JZY A;  4JOM A;  2Z99 A;  5EZH A;  1QNT A;  2TDX A;  2ZME B;  2ME0 A;  5FLV A;  4A3I J;  1T6S A;  4UV8 A;  2ESN A;  2NVX J;  1EJ9 A;  3IP4 B;  1MND A;  1X3Z B;  2HKX A;  3ESW B;  2M7A A;  5CVU A;  1PUF A;  4HV5 A;  3L09 A;  1WVR A;  2XVC A;  1AKH A;  4B8X A;  3R4K A;  4HV6 A;  2XAG A;  3S16 J;  1XTA A;  3Q0U A;  5L3G A;  4E7I A;  1LE8 A;  3KP3 A;  1Y1W J;  2Y75 A;  1RUN A;  3H9J A;  2P7V B;  3BG3 A;  1GXP A;  2VE9 A;  3E6B A;  5KK1 A;  1MBK A;  1FSH A;  3IAS 2;  5EEG A;  2KQR A;  2XPW A;  3IH2 A;  3EPZ A;  3J81 K;  4KIB A;  3CD6 I;  1T38 A;  2W00 A;  3T1B A;  2PFB A;  1AU7 A;  4KNY A;  1BBY A;  4YFX F;  2EA4 A;  3GTP J;  4HX4 A;  4IF4 A;  5LGN A;  2ZJR F;  3HOZ J;  4QIW N;  5ICG A;  2VBZ A;  3HSE A;  4ESB A;  1LFU P;  1GUU A;  2QBY B;  1GXQ A;  1MBE A;  1IN8 A;  3BG9 A;  3K9T A;  3MN2 A;  5AIP A;  3ZQQ A;  2G7U A;  1PVE A;  2GOX B;  2Q0O A;  3HSF A;  4E7Z A;  5JHU A;  1TT0 A;  1W4M A;  2XF5 A;  1G3W A;  2DT6 A;  5DS9 A;  2EIJ H;  3L2Q A;  1T08 B;  1V5F A;  3ZN0 A;  3A4C A;  1OR7 C;  3GFM A;  1FYL A;  1SVO A;  1XD7 A;  2QEX I;  2A6E F;  2HVQ A;  2ZME A;  4F3Q A;  2F4M B;  5E3O A;  2RAE A;  2ZCW A;  4Q5S F;  1MNM C;  1IXR C;  4YFN F;  3ULQ B;  2DCE A;  4DBR A;  2K9Q A;  5EF6 A;  3K0L A;  2XAH A;  1HST A;  2Z33 A;  2DPU A;  1QZY A;  2FX0 A;  4BH9 A;  1Z7L A;  1RKW A;  5CKT A;  2ICW G;  1XN7 A;  2BZT A;  1SD7 A;  3M1C A;  1TTY A;  3E6D A;  4I2O A;  2JA6 J;  5ILV A;  4BJ6 C;  1YO5 C;  3H5A A;  1FTZ A;  1J09 A;  4NUB A;  2LY2 A;  2I5U A;  3KZY A;  3IH3 A;  1ZG5 A;  1J2X A;  2GQQ A;  1HDD C;  3DU6 A;  1QRY A;  2CQX A;  2R7D A;  2E36 A;  2PMZ N;  2OUM A;  2EIM H;  1WH7 A;  5HS7 A;  1MMN A;  4S04 A;  5K5Q A;  3FHN A;  5LD2 C;  4IHT A;  4IKF A;  4BJ5 C;  2JVG A;  3J7Z I;  5FKM A;  3JRH A;  1K4T A;  1G59 A;  4PGH A;  4QPO A;  2A5Y B;  1MBG A;  3DLL F;  1R1V A;  1T98 A;  4UXN A;  3OSF A;  1HKT A;  1FZP B;  2VBY A;  1XSD A;  3M9A A;  2P5V A;  3HGY A;  1IC8 A;  2FA5 A;  4RAZ A;  4ZZD A;  2HFH A;  3COA C;  4CCN A;  2EIN H;  2HOA A;  1DUX C;  4BDZ A;  4KIT B;  2CU7 A;  1SMY F;  1Z7U A;  4ETS A;  4IX7 A;  5DTD A;  2OTJ I;  4UHT A;  4AIJ A;  2ZSI B;  2HYJ A;  3FM3 A;  3ZQI A;  2KT0 A;  3M4O J;  2DAO A;  3FK7 A;  3QYB A;  2M9H A;  3GUD A;  3N05 A;  3SJM A;  1K61 A;  2NVQ J;  2KDO A;  4UB8 C;  3KE2 A;  2QSH X;  2DQL A;  3E5Q A;  1YI2 I;  2ZJ2 A;  3FXM A;  1RES A;  2D1H A;  2M30 A;  1UHM A;  2LH9 A;  3KEY A;  5D8K B;  1I6H J;  2XPV A;  2QQB A;  4LIU A;  2WY8 Q;  1HLV A;  4HAM A;  2EIL H;  3GCM A;  1B72 A;  1Z3Y A;  1XDU A;  3U21 A;  1FIP A;  2E35 A;  2EJR A;  1OR7 A;  4HSR A;  2OU2 A;  2L7M P;  5F64 A;  4XLN F;  1ETK A;  2A07 F;  3K1N A;  3SZP A;  5IYD J;  5E1X A;  4MEY F;  1SFE A;  1F4K A;  4OU0 A;  2GAU A;  2L7Z A;  3DF8 A;  2IGN A;  2JPC A;  3ERM A;  3ZQF A;  2V6E A;  5JI6 A;  2EZI A;  1OQY A;  2XC7 A;  3PO2 J;  2E34 A;  1ETQ A;  2H6C A;  4DGW B;  1ZGA A;  1RPW A;  4XSX F;  3DFG A;  2ZJQ F;  2QSF X;  1B4A A;  1XDS A;  3LFU A;  4WXC A;  2WWY A;  1H88 C;  4A3L J;  4KIC A;  4MNU A;  1V3F A;  1X1P A;  3JSP A;  3DEW A;  1B9N A;  1X1A A;  1X58 A;  1C0W A;  3PIO F;  2DK5 A;  1E3O C;  2X6Y A;  2AQF A;  1YE9 A;  5EJC A;  1RZ4 A;  4I09 A;  4B44 A;  1UZC A;  1P6R A;  3DKW A;  4ZYE A;  2O3F A;  1WWX A;  4M73 A;  3HRS A;  2Z9O A;  2ADU A;  3S2D J;  1CF7 B;  2NS8 A;  3M07 A;  4UUS B;  3P9K A;  3LA7 A;  1FJL A;  2M0C A;  2JJ7 A;  2LRD A;  1Y0N A;  1M1E B;  1FNN A;  2VB6 A;  3ZQ7 A;  4HOB A;  3MQ0 A;  3DEE A;  3DPT A;  4XRS G;  2CW0 F;  4EM2 A;  3SFZ A;  3TED A;  2KMU A;  2V1N A;  3ASN H;  4BXU A;  5JHF A;  3E6C C;  4HG2 A;  2ETH A;  1U5T A;  3C2H A;  2HZT A;  3PUF A;  4A3F J;  2E1O A;  2GIV A;  2UZK A;  2VKD A;  5F0C A;  2VAS A;  3I5U A;  2YUS A;  1W36 D;  2WC2 A;  3F22 A;  3MKL A;  1I1S A;  2P7C B;  2QQA A;  3CCQ I;  4I02 A;  5CQG A;  2QKM B;  3B73 A;  2FXA A;  4BAY A;  3D1N I;  2W84 A;  1R22 A;  2Y2Z A;  2EK5 A;  1VQK I;  2E2J J;  4XON A;  1JI8 A;  4S05 A;  2ELJ A;  2CQ7 A;  2EB7 A;  3QPL A;  3OIQ A;  4BXX J;  1R1T A;  4BJT A;  4A12 A;  3SYT A;  3HL2 A;  2WTE A;  2R7V A;  1ITY A;  4HQE A;  4EMS A;  2O8X A;  3LWF A;  2K4B A;  4I0A A;  1VQM I;  3AL0 C;  2OD5 A;  2RC4 A;  2D2W A;  4PJJ A;  4X6A J;  3DCF A;  1D1B A;  2V26 A;  5HS8 A;  3VYR B;  5IT3 A;  2CWE A;  1CF7 A;  1IUY A;  4UUS A;  2MBF A;  4XLE A;  5L3F A;  4BNC A;  2VL8 A;  3HOW J;  4LIT A;  1R5G A;  4RB3 C;  5HOO A;  2HXI A;  2GOM A;  1QVU A;  3QOD A;  4HX8 A;  4YFK F;  1WRJ A;  5L3C A;  3S1R J;  1FYK A;  4KMF A;  4JX5 A;  1CGP A;  4FTH A;  1BN5 A;  3K4L A;  3WU0 A;  4AC0 A;  1FOX A;  1DU6 A;  4MO7 A;  2FQ4 A;  3P9C A;  3LSP A;  2BGC A;  2LFB A;  1SFO J;  4I7H A;  4ASN A;  3AL0 B;  4EV0 A;  3CP2 A;  1UB9 A;  2P5L C;  3HOS A;  1BJZ A;  1P4X A;  1KYW A;  3ZMS A;  4CYD A;  1B1B A;  3EYY A;  4JYK A;  2FD5 A;  4IRH A;  2QZ8 A;  2DN0 A;  3SFI A;  2LMD A;  2PMU A;  1W0T A;  2EV0 A;  1GVD A;  4CZC A;  2VXZ A;  2F5F A;  3HHG A;  4ITV A;  1EH8 A;  1Z9C A;  1I5Z A;  4G94 A;  3FKI J;  3HG9 A;  4ENJ A;  1AWC A;  2HDC A;  3FF5 A;  1RI7 A;  4E6K G;  1TQM A;  2A5W A;  2RQP A;  4XOR A;  3TBI A;  3BJ6 A;  3EUA A;  3QOP A;  3CTA A;  2ZXW H;  4N4N B;  4FAS D;  4ZTF A;  1ZRE A;  4Q4Z F;  2E60 A;  4A3G J;  1NK3 P;  3OYJ A;  5E1W A;  1B6A A;  3D0S A;  3GFJ A;  4G9Y A;  3A01 A;  3G4S I;  3KX2 A;  2FUG 2;  5E1Z B;  3VYT B;  4M6V A;  2UWM A;  3OYF A;  4ZYH A;  1MSE C;  1FY7 A;  2F48 A;  2R7Q A;  1I27 A;  3TW6 A;  1SD5 A;  3AG2 H;  2WB1 N;  1Q1V A;  2CGP A;  1IG7 A;  1XGN A;  5D8L B;  3QYE A;  3WGH A;  1I1G A;  3HB9 A;  2LF8 A;  2COB A;  3NAU A;  2DMU A;  4F92 B;  3F21 A;  1WCM J;  3CMM A;  3MKY B;  4FX4 A;  2CH0 A;  1JUM A;  1UMQ A;  2K3P A;  3BPV A;  2G0E A;  4HA8 A;  3FM5 A;  4IL6 C;  1TQI A;  3GTJ J;  4LG3 A;  2Y9Y A;  5FLM J;  1HKS A;  1POG A;  1OCO H;  3WOD F;  4AVP A;  2VQG A;  2KL4 A;  2L4M A;  1WFX A;  3T8T A;  1MBH A;  5FKO A;  3TOA A;  2VQL A;  2R92 J;  5JFR A;  2Y0S N;  4G6T B;  1S5L C;  3GME A;  2JWT A;  1NG7 A;  1KGS A;  2PQ8 A;  4XQF A;  4NNJ A;  1FOW A;  1A35 A;  5J3L A;  3K2A A;  2KIS A;  3Q5F A;  1F1Z A;  2V1U A;  3WTX C;  4CCJ A;  3OYB A;  2MLG A;  3DEU A;  1K78 B;  3EYI A;  1DQU A;  2ZNY A;  1BR4 A;  3CCV I;  1YX3 A;  1MGT A;  1Z67 A;  3R61 A;  2OZ6 A;  4A3B J;  2E1C A;  4PFO A;  4GYG A;  4OAY A;  2YPR A;  3FXJ A;  5M5Y J;  5K7F A;  3ELK A;  1S3J A;  5IOZ A;  4ZDO A;  3BY6 A;  2XSD C;  1EH7 A;  1KON A;  2EZL A;  3CCY A;  1YG2 A;  3CME I;  5DEQ A;  3FXL A;  2K86 A;  1XMK A;  3PNV A;  2YU9 J;  2X6W A;  2FBI A;  1U9O A;  3F0C A;  4RGS A;  4U87 A;  1A6I A;  2DFH A;  4WXH A;  1PUE E;  4OWR B;  3TP0 A;  1J5Y A;  4ESJ A;  1Y39 A;  1F5T A;  4LG0 B;  2HOE A;  4HLY A;  1LDJ A;  2JUG A;  5LEJ A;  3O8H A;  1K7A A;  3S8P A;  1YHQ I;  4M9Z A;  2Y30 A;  2E7X A;  1N78 A;  1I6X A;  1ZGW A;  5GPA A;  3REO A;  1ZKG A;  2IW5 A;  3CJQ B;  1X4O A;  1VTN C;  4F91 B;  4PFP A; 
#chains in the Genus database with same CATH homology
 4IPA A;  3GXO A;  2FEZ A;  1YFH A;  2UXN A;  1O3T A;  4CDG A;  2W57 A;  4EJO A;  4HF1 A;  3M7G A;  1DPR A;  1UFM A;  4FHT A;  4Z2Y A;  3FMS A;  3WTZ A;  1U2W A;  1HW2 A;  4OIN F;  2P4W A;  3M1E A;  4KN7 X;  3W6J B;  4AWX B;  5LHH A;  1BJA A;  3G73 A;  5CJ9 A;  4EJU A;  2RDP A;  2OAZ A;  4MTE A;  3JW4 A;  4UVC A;  3VEP A;  4ENN A;  4IHS A;  1REP C;  1KQ9 A;  4R79 A;  2NNN A;  2XAF A;  1XSX A;  4KIG A;  1BM9 A;  2M8E A;  5HS9 A;  4A0X A;  2VT3 A;  3F6V A;  5FD6 A;  5FFZ A;  1FBU A;  1SD4 A;  2RKH A;  2QYO A;  2O6G E;  4OIP F;  1MDM B;  2YU3 A;  4RS8 A;  3VOD A;  2D45 A;  2ZO4 A;  1JGS A;  5LEK A;  3QAH A;  4M71 A;  2F5E A;  1LQ1 A;  1ONV A;  4BQA A;  2K7L A;  4KN4 X;  1EH6 A;  2PBI A;  3K69 A;  3OOP A;  1UST A;  2VOP A;  4M6X A;  2AXL A;  3FHZ A;  4A5N A;  2YX4 A;  5D4S A;  3BP8 A;  3HUG A;  3BPX A;  3QRF F;  1R36 A;  3HRU A;  3G3Z A;  4RAY A;  5DD4 A;  2ZKZ A;  4U88 A;  1BI2 A;  4EJT A;  1OPC A;  1J59 A;  3L00 A;  3RI4 A;  3QU3 A;  5AIQ A;  2JPB A;  3BDD A;  2MH2 A;  2ZBK A;  4LFU A;  1YIO A;  4UUV A;  2R3S A;  3K1P A;  2M5W A;  4FT8 A;  5ICC A;  5J8C A;  3WE2 A;  3FXU A;  4L0Z B;  1G3Y A;  3ZN1 A;  3WE3 A;  2FF4 A;  4FX0 A;  2XAQ A;  3WG9 A;  4P55 A;  2DU9 A;  4IJA A;  4B09 A;  5CVJ A;  2HR3 A;  3FWE A;  3TOB A;  1PDN C;  1QZZ A;  1W5T A;  5DCM B;  5L3B A;  5CLS A;  4YG2 F;  4ZYD A;  5ERI A;  3ML6 A;  1S8N A;  1SFX A;  1XGO A;  4LB6 B;  3SQN A;  3VFZ A;  3R0J A;  2DTR A;  1MZB A;  3F8B A;  1L0O C;  4I01 A;  1QGP A;  1IN7 A;  1V4R A;  3F8F A;  5A2Q Z;  2V1D A;  1O3R A;  1IAW A;  1LVA A;  1LJ9 A;  2ESH A;  4UNO A;  3GWZ A;  5EEH A;  3BWG A;  4HW0 A;  1KYZ A;  4MEX F;  1IZ1 A;  2QBY A;  3U1D A;  4RGX A;  3J80 Z;  2ZFW A;  5DYM A;  3HSR A;  3ZP5 A;  2STT A;  5TRD A;  4HBL A;  3CO6 C;  2CG4 A;  1GHC A;  2CO5 A;  2KKO A;  1YYV A;  5AON A;  3KZZ A;  4LLN A;  2HQR A;  1FP1 D;  3S2W A;  4JK1 X;  1DPU A;  2M45 A;  2EA2 A;  1YQA A;  5IT9 Z;  1FT9 A;  2FNP A;  2CFX A;  1HQC A;  1ZAO A;  2UXX A;  3I59 B;  3BRO A;  4L9V A;  4QLC U;  1OYW A;  3C18 A;  3I58 A;  1U3E M;  1T2K A;  3GO5 A;  3V7S A;  1HSJ A;  4K2E A;  1W5S A;  3NQO A;  4LD5 A;  1WI9 A;  1UHW A;  4RB0 A;  3KEQ A;  3L7W A;  3CUO A;  5BOX A;  5BQT A;  4HF2 A;  2Q2E A;  3ISP A;  2H6B A;  2ACJ A;  5LHI A;  2NAZ A;  2QLZ A;  1DDN A;  3NEU A;  4LMY A;  3B02 A;  3JAM Z;  4L0Y B;  3WTS C;  3TO7 A;  1J9I A;  5LRS A;  3FXR A;  4JBA A;  2HGC A;  2YSR A;  4WX9 A;  1G6N A;  5D6F A;  2XRN A;  3SZT A;  1XSV A;  3MZY A;  3I59 A;  1RUO A;  2F2E A;  3MFK A;  4AD9 A;  1X3U A;  2STW A;  1OYY A;  4QWQ A;  4GCV A;  4UV9 A;  3DQV C;  2HYF A;  2W85 A;  1BOA A;  4MHG A;  1IN5 A;  2A6H F;  2Q8K A;  4EJW A;  1D8K A;  2ELH A;  4PDK A;  1ZHF A;  1B59 A;  5HDK A;  3ABU A;  2X0L A;  2IJL A;  2GZW A;  1ZRF A;  2IA1 A;  1MJA A;  1ON2 A;  4EGZ A;  4M9X A;  3KP4 A;  3WTY C;  3FXQ A;  1USS A;  3ECO A;  1D8J A;  4O3M A;  4OIR F;  3IC7 A;  2HEO A;  1ZRD A;  5H20 A;  4P9U A;  5HLG A;  1IXC A;  1XB4 A;  1BI0 A;  3GZ5 A;  5DUK A;  4U7D A;  4MQ9 F;  2MA3 A;  2XV4 S;  1FSE A;  3IL2 A;  3H92 A;  3MCZ A;  1J0R A;  2L3D A;  3ZMZ A;  3IRR A;  4XLP F;  5BMZ A;  3V8L A;  1TNT A;  5D5W B;  3I54 A;  3E6M A;  2IRF G;  1Z6R A;  3QU6 A;  2K02 A;  1P92 A;  3K1M A;  4LLG F;  4BHC A;  1UCR A;  3H3U A;  3I0T A;  4IVN A;  4P96 A;  3E3V A;  5DCF A;  4ENK A;  3DV8 A;  3FMR A;  4DNC A;  2QEN A;  2DO7 A;  1R00 A;  1S7A A;  5LLQ A;  5HLI A;  1GVJ A;  3WU1 B;  1HW1 A;  2JSC A;  3QPH A;  4LLL A;  4G7H F;  2BYV E;  3LQR A;  3KFW X;  4UVB A;  4XSZ F;  3TO9 A;  1G4D A;  2R7F A;  5J6X A;  1LB2 A;  4N9H A;  1MJB A;  1FYM A;  1FBQ A;  2VE8 A;  1O57 A;  3WGG A;  5FLX Z;  2LKP A;  1ODD A;  2MLK A;  3I53 A;  3F3X A;  3ABT A;  3HHH A;  3O6B B;  2PEX A;  1KU9 A;  4UVA A;  4MTD A;  4WF2 A;  3D5L A;  1Z05 A;  3OV8 A;  2FE3 A;  3RKX A;  3I64 A;  5CVV A;  2VBW A;  2EFW A;  4XBF A;  4ZYG A;  5LGU A;  1F9N A;  4L9J A;  3C7J A;  2P6T A;  4N0B A;  5HDN A;  2EV5 A;  3C3W A;  2DK8 A;  2CSO A;  3U2R A;  1YTY A;  2PG4 A;  1EV7 A;  4LGW A;  5LBQ A;  4IRI A;  1ZYR F;  3E5U A;  2Y48 A;  1YW8 A;  3RYP A;  1O3S A;  2XAJ A;  1P4W A;  5CVR A;  2ISY A;  4EM1 A;  1T39 A;  5BPD A;  1K78 A;  2XIG A;  1WSU A;  2FBH A;  1FLI A;  1YW9 A;  4EQQ A;  2H09 A;  3IKT A;  3DPL C;  2FU4 A;  2KIM A;  4EJV A;  1WQ2 A;  2FOK A;  3GYH X;  3F6O A;  4A2U A;  3LA3 A;  2CYY A;  4G7O F;  3GLX A;  3IWF A;  1FX7 A;  2FML A;  1MKM A;  3JTG A;  4LB5 A;  1NHA A;  2V1X A;  2DW4 A;  2VN2 A;  1XGM A;  2RV8 A;  4U0W A;  3LFK A;  4ON0 A;  1Z1D A;  1TW3 A;  5FFX A;  4LG0 A;  1J7K A;  3WTU C;  5D5V B;  4HQM A;  2EWN A;  3LQQ A;  1H9T A;  1QPM A;  2DT5 A;  1K6O A;  1W7P B;  3ERE D;  3TDZ C;  2K4J A;  1DP7 P;  1A04 A;  2A61 A;  4O5V A;  3BZ6 A;  5A2Q K;  2P5K A;  3JSO A;  2JTV A;  1ZAR A;  3F23 A;  4EVI A;  3HTU A;  1FOK A;  1KA8 A;  4BYY A;  4Y17 A;  5FO5 A;  2HTJ A;  3IWZ A;  5ICF A;  3TKY A;  2E1N A;  4U0Y A;  5ICE A;  2G7H A;  2NNY A;  2LF7 A;  2FRH A;  3RTR A;  1IRF A;  2XRO A;  3LST A;  1Q1H A;  4ZH4 F;  3DXJ F;  2A68 F;  2GA1 A;  4OIO F;  3V7C A;  3VOE A;  4CO8 A;  2IT0 A;  2FMY A;  4M6Y A;  3GEZ A;  4M72 A;  4L9T A;  2C6Y A;  2L02 A;  1BIB A;  2GXB A;  5L3D A;  1STZ A;  2RNJ A;  1W7P A;  4M74 A;  4KT5 C;  2KIU A;  1BIA A;  1OKR A;  3RYR A;  1MDM A;  4CXF A;  4CGZ A;  2NRA C;  3JTH A;  1Z6T A;  2HKO A;  2PLY A;  1ZG1 A;  3GX4 X;  2AS5 F;  1O7L A;  4H0E A;  4RB1 A;  4YII A;  5LRR A;  1FC3 A;  3O2P E;  2XKO A;  1OYI A;  3T8R A;  3ZPL A;  4PCQ A;  4N9I A;  3ZMU A;  3LA2 A;  1JXS A;  2H27 A;  2VOD A;  4MGR A;  2GXG A;  2EV6 A;  1YLF A;  2F5C A;  1J75 A;  3J7A O;  1U78 A;  4KDP A;  3JAM K;  3N4M A;  4GGG A;  2QUF A;  1U8R A;  2IA2 A;  3KEO A;  3NRV A;  3PFI A;  3ROU A;  1O7F A;  4NHJ A;  2RVC A;  3F72 A;  5D5X B;  4RB2 C;  2B0L A;  3KLN A;  4Q47 A;  4GYI A;  1KU7 A;  3HRT A;  2VON A;  2PI0 A;  4HF0 A;  1R1U A;  1XCB A;  3MEX A;  3V4G A;  4EM0 B;  1RNL A;  2OA4 A;  3T5X A;  2IPQ X;  5D6E A;  3ECH A;  1D3Y A;  3LAP A;  1LEB A;  2FSW A;  1TLH B;  2ZXJ A;  3T0Y A;  3P7N A;  2KJC A;  4OIQ F;  2MC3 A;  4O6J A;  2F5D A;  2LSO A;  1SAX A;  5DCM A;  3W6K B;  4WXD A;  2CQK A;  4LK0 F;  3RDI A;  2EFQ A;  1BC7 C;  2KJB A;  5LGT A;  2DQR A;  1ZH5 A;  4KMU X;  2PN6 A;  1TQP A;  4A0Z A;  2VC1 A;  3F8N A;  1U5T C;  3SXY A;  1RIO H;  5DUI A;  3M8E A;  5E20 A;  2W25 A;  4G7Z F;  2OZU A;  1Y0U A;  4OMY A;  3KP5 A;  5L3E A;  1L3L A;  2BE5 F;  1T0F A;  5J8F A;  4G6Q A;  3RIR A;  4HX7 A;  1U5T B;  4Q48 A;  3TGN A;  3I71 A;  3RPU A;  2H94 A;  5ILS A;  3V8J A;  5FB2 A;  4OOI A;  2IP2 A;  1G3S A;  4OMZ A;  2VC0 A;  1E2X A;  1G3T A;  5F1R A;  2HTS A;  1E17 A;  2DFI A;  3CDH A;  2FNA A;  2WV0 A;  4WK8 F;  4ZZL A;  1R5H A;  1JE8 A;  5E8I A;  3Q9V A;  5E18 F;  2EFP A;  3J81 Z;  3M8F A;  3PQK A;  1JHH A;  1OMI A;  3KP2 A;  4R1H A;  3EUH A;  1LDD A;  1U6G A;  3R6S A;  4HDV A;  3ZMV A;  1IN6 A;  1AOY A;  3TO6 A;  1PP7 U;  4Y15 A;  4IXA A;  5FLX K;  1KU3 A;  5ILU A;  2MD5 A;  5ED4 A;  2A3S A;  4A5M A;  4AIK A;  1D5V A;  1TNS A;  1WKM A;  1MD0 A;  2DBB A;  3EDP A;  1FWZ A;  2QVO A;  2D1V A;  3KP7 A;  5DV5 A;  2HQN A;  4I98 B;  6PAX A;  3GF2 A;  2FQ3 A;  2BBY A;  2XKP A;  3SHF A;  1S6L A;  4KIF A;  1H9G A;  2HYG D;  3K2Z A;  3O3K A;  4AIH A;  1QBJ A;  2X4H A;  5FD5 A;  2VOO A;  4E70 A;  3GFL A;  2Y0M A;  2PJP A;  2HS5 A;  3CUQ C;  1KU2 A;  2M1B A;  4U7B A;  2P6S A;  2V6C A;  3ZMD A;  3QPT A;  5FGM A;  5F6F A;  2JT1 A;  4JQF A;  3PQJ A;  3HOT A;  3E97 A;  4R8H A;  3L2C A;  3L9F A;  1IXS B;  4HYE A;  3AAF A;  4RGU A;  5LHG A;  2NYX A;  4A6D A;  1W7P D;  3CUQ B;  2FBK A;  3MWM A;  1YW7 A;  3QP6 A;  4ESF A;  2QM3 A;  2OQG A;  1LNW A;  5E8G A;  2COM A;  3GW2 A;  1SFU A;  3ZMT A;  5KVR A;  3HTS B;  1XCV A;  1IN4 A;  4A0Y A;  2PMH A;  5JR3 A;  2KRF A;  4CIC A;  3KCC A;  4WCG A;  2A69 F;  4EGY A;  4NQW A;  2XUB A;  2QQ9 A;  2YX7 A;  1IRG A;  1B9M A;  1ZGJ A;  3RKY A;  2XHK A;  3EQL F;  1FP2 A;  3WTV C;  2DLL A;  3MZH A;  2V79 A;  4TV7 A;  2XGX A;  3CLO A;  2EFN A;  1XGS A;  3HRM A;  2GWR A;  4LJZ F;  4BHP A;  3N97 A;  2BV6 A;  2LDU A;  1BI3 A;  5H6Q A;  1P2F A;  4M9S A;  3HIF A;  3FMQ A;  3EET A;  2W24 A;  3BJO A;  2K27 A;  3CUQ A;  3LAJ A;  2G9W A;  2BEO A;  2Z3Y A;  1ZG3 A;  3MAJ A;  3GVA A;  3I4P A;  3VB2 A;  4ENM A;  3HYI A;  2OBP A;  4HDU A;  2DPD A;  5HLH A;  1ON1 A;  1HW5 A;  3Q9S A;  4D0P A;  1HBX G;  3BJA A;  2NS0 A;  4I0B A;  1JHF A;  2M87 A;  4P9F A;  4L5J A;  5CYV A;  4NB5 A;  1FBS A;  1TW2 A;  5K5O A;  4KFC A;  4U0V A;  1FPQ A;  1LEA A;  1MJ9 A;  2EFO A;  1YS6 A;  1KQ0 A;  5D5U B;  4KYW A;  3QP5 A;  2L54 A;  3U9G A;  3E5X A;  1BC8 C;  4F7Z A;  3RPQ A;  2XAS A;  5TJJ A;  1ZLJ A;  4RGR A;  2DI3 A;  1Z91 A;  4MQV A;  1HKQ A;  3KET A;  4PZJ A;  3F8M A;  2VT2 A;  5H6R A;  2V9V A;  5DDG A;  2KIF A;  1ZN2 A;  5HVQ C;  2O0Y A;  3R0A A;  4BHB A;  1S7O A;  1R7J A;  2E7W A;  2RGV A;  2YR2 A;  2ISZ A;  1P4A A;  4HLX A;  3IKV A;  3RKW A;  3P9I A;  2J5P A;  5JVT A;  1KQ8 A;  4HZF A;  4A6E A;  2Z5U A;  2IA0 A;  3RJP A;  2GA2 A;  3CO7 C;  5BS6 A;  4XRF A;  3TQN A;  5CVI A;  4YIF A;  4CHU A;  3KP6 A;  2MH9 A;  2OQR A;  2P8T A;  2RN7 A;  1ULY A;  5K1Y A;  1K79 A;  3V8K A;  3H3Z A;  4IRG A;  3KLO A;  3GZ6 A;  1O3Q A;  3F8C A;  5K5R A;  2LNB A;  2VBX A;  3TDU C;  2L4A A;  3C1D A;  3WGI A;  4KUM A;  3IRQ A;  4CZZ A;  1SMT A;  4G6D A;  1HXD A;  1QQI A;  4KA4 A;  1TBX A;  4GO1 A;  4WWC A;  1IW7 F;  5D4R A;  3CJN A;  3J80 K;  1R23 A;  4Y13 A;  3GFI A;  1BI1 A;  4G8X A;  2L01 A;  4L5I A;  3BOQ A;  5DD8 A;  1H0M A;  3V7R A;  3DP7 A;  3WTW C;  5BPI A;  5E17 F;  1LDK B;  2O61 A;  1S29 A;  5HDG A;  5IT9 K;  2QWW A;  2J5O A;  4GXO A;  4L18 B;  3IHU A;  1QO0 D;  1IF1 A;  2O03 A;  4DQ2 A;  3R60 A;  1SD6 A;  3FZV A;  4P5O A;  2ZNZ A;  4LK1 F;  2IVM A;  1R58 A;  2JRT A;  1PP8 F;  4PGG A;  1XMA A;  3FX3 A;  1ZLK A;  2HWV A;  1ZRC A;  1YS7 A;  3WTT C;  4L9N A;  2JZY A;  2Z99 A;  1QNT A;  2TDX A;  2ZME B;  1T6S A;  4UV8 A;  2ESN A;  2HKX A;  5CVU A;  4HV5 A;  3L09 A;  2XVC A;  4B8X A;  3R4K A;  4HV6 A;  2XAG A;  5L3G A;  3KP3 A;  2Y75 A;  1RUN A;  2P7V B;  1GXP A;  2VE9 A;  3E6B A;  5KK1 A;  1FSH A;  5EEG A;  3J81 K;  4KIB A;  1T38 A;  3T1B A;  2PFB A;  4KNY A;  1BBY A;  4YFX F;  2EA4 A;  4HX4 A;  4IF4 A;  5LGN A;  5ICG A;  2VBZ A;  3HSE A;  4ESB A;  2QBY B;  1GXQ A;  1IN8 A;  3K9T A;  5AIP A;  2G7U A;  2Q0O A;  3HSF A;  5JHU A;  1W4M A;  1G3W A;  3ZN0 A;  3GFM A;  1FYL A;  1XD7 A;  2A6E F;  2ZME A;  2ZCW A;  4Q5S F;  1IXR C;  4YFN F;  3ULQ B;  3K0L A;  2XAH A;  1HST A;  2Z33 A;  2DPU A;  1QZY A;  4BH9 A;  1XN7 A;  1SD7 A;  1TTY A;  3E6D A;  4I2O A;  5ILV A;  1YO5 C;  3KZY A;  1ZG5 A;  1J2X A;  2GQQ A;  2R7D A;  5HS7 A;  4S04 A;  5K5Q A;  4IHT A;  4PGH A;  2A5Y B;  1R1V A;  1T98 A;  4UXN A;  1HKT A;  1FZP B;  2VBY A;  1XSD A;  3M9A A;  2P5V A;  2FA5 A;  4RAZ A;  4ZZD A;  2HFH A;  3COA C;  1DUX C;  1SMY F;  1Z7U A;  4ETS A;  4UHT A;  4AIJ A;  3FM3 A;  2DAO A;  3GUD A;  3KE2 A;  2DQL A;  3E5Q A;  2ZJ2 A;  2D1H A;  2M30 A;  1UHM A;  5D8K B;  2QQB A;  4HAM A;  1XDU A;  2EJR A;  1OR7 A;  2OU2 A;  5F64 A;  4XLN F;  2A07 F;  3K1N A;  3SZP A;  5E1X A;  4MEY F;  1SFE A;  1F4K A;  4OU0 A;  2GAU A;  3DF8 A;  2JPC A;  5JI6 A;  2H6C A;  1ZGA A;  4XSX F;  3DFG A;  1B4A A;  1XDS A;  2WWY A;  4WXC A;  4KIC A;  4MNU A;  1V3F A;  3JSP A;  1B9N A;  1C0W A;  2DK5 A;  1RZ4 A;  4I09 A;  1P6R A;  3DKW A;  4ZYE A;  2O3F A;  1WWX A;  4M73 A;  3HRS A;  2Z9O A;  2ADU A;  1CF7 B;  3P9K A;  3LA7 A;  3ZQ7 A;  1FNN A;  4HOB A;  3MQ0 A;  3DPT A;  2CW0 F;  4EM2 A;  3SFZ A;  4BXU A;  3E6C C;  2ETH A;  1U5T A;  2HZT A;  2GIV A;  2UZK A;  3I5U A;  2WC2 A;  3F22 A;  1I1S A;  2P7C B;  2QQA A;  4I02 A;  3B73 A;  2FXA A;  4BAY A;  2W84 A;  1R22 A;  2EK5 A;  4S05 A;  2EB7 A;  1R1T A;  4A12 A;  2WTE A;  4HQE A;  4EMS A;  2O8X A;  3LWF A;  2K4B A;  4I0A A;  2OD5 A;  2RC4 A;  2D2W A;  5HS8 A;  5IT3 A;  1IUY A;  2CWE A;  1CF7 A;  2MBF A;  5L3F A;  4BNC A;  1R5G A;  4RB3 C;  5HOO A;  4YFK F;  4HX8 A;  5L3C A;  1WRJ A;  1FYK A;  4KMF A;  1CGP A;  1BN5 A;  3WU0 A;  3P9C A;  2BGC A;  4I7H A;  4ASN A;  4EV0 A;  1UB9 A;  2P5L C;  3HOS A;  1P4X A;  1KYW A;  3ZMS A;  4CYD A;  1B1B A;  3EYY A;  4IRH A;  2QZ8 A;  2PMU A;  2EV0 A;  2VXZ A;  2F5F A;  3HHG A;  1EH8 A;  1Z9C A;  1I5Z A;  4G94 A;  4ENJ A;  1AWC A;  2HDC A;  3FF5 A;  1RI7 A;  1TQM A;  2RQP A;  3BJ6 A;  3QOP A;  3CTA A;  1ZRE A;  4Q4Z F;  5E1W A;  1B6A A;  3D0S A;  3GFJ A;  4G9Y A;  5E1Z B;  2UWM A;  4ZYH A;  1FY7 A;  1I27 A;  1SD5 A;  2CGP A;  1XGN A;  5D8L B;  3WGH A;  1I1G A;  2LF8 A;  3F21 A;  4FX4 A;  3BPV A;  4HA8 A;  3FM5 A;  1TQI A;  1HKS A;  3WOD F;  4AVP A;  2L4M A;  3T8T A;  3TOA A;  5JFR A;  1KGS A;  2PQ8 A;  3Q5F A;  1F1Z A;  2V1U A;  3WTX C;  2MLG A;  3DEU A;  1K78 B;  3EYI A;  2ZNY A;  1MGT A;  3R61 A;  2OZ6 A;  2E1C A;  4GYG A;  2YPR A;  3ELK A;  1S3J A;  3BY6 A;  1EH7 A;  1YG2 A;  5DEQ A;  2K86 A;  1XMK A;  2FBI A;  4RGS A;  4WXH A;  1PUE E;  1J5Y A;  4ESJ A;  4LG0 B;  1F5T A;  2HOE A;  4HLY A;  1LDJ A;  5LEJ A;  1K7A A;  4M9Z A;  2E7X A;  1I6X A;  3REO A;  2IW5 A;  1VTN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...