5DYMA

Crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
97
structure length
96
Chain Sequence
GYIDILIVSILEKKDCYGYEIAKQVRERSEFLKEGTMYLALKRMESKNLIKSYYSNEQSSGGRRKYYNLTNEGKDFLEIKKQEWRFIKKVMNQFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PadR-family transcriptional regulator
publication title Crystal structure and DNA binding activity of a PadR family transcription regulator from hypervirulent Clostridium difficile R20291.
pubmed doi rcsb
source organism Peptoclostridium difficile (strain r20291)
molecule tags Dna binding protein
total genus 35
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dymA00
4P5OA 4G7OF 2H6BA 5D5VB 1HSJA 4PCQA 2XKOA 4YG2F 3RPUA 3F6OA 5EEHA 3TDZC 4M6YA 5CVRA 3MEXA 2WTEA 2ZNZA 4BNCA 3KP7A 2DQLA 3E6MA 1MZBA 5HLGA 2IP2A 4N0BA 2G7HA 1T98A 4KNYA 2MC3A 1XD7A 2O3FA 1G3SA 1Y0UA 3PQJA 4RAZA 2QENA 3DQVC 3VEPA 1XGNA 1EH8A 1QZZA 1I1SA 1JE8A 4A0ZA 3VOEA 2FE3A 3QPHA 4XBFA 3BJOA 3TDUC 1FC3A 2OA4A 2QUFA 4GCVA 4TV7A 2XIGA 1CF7A 4LLGF 2NNNA 1EV7A 1XSVA 3V7CA 1T6SA 4Q4ZF 1JGSA 2ZMEA 3HTUA 2MH9A 3FWEA 2PMHA 3HRTA 2MBFA 3TO7A 2FNPA 2P7CB 1ZG3A 2Z9OA 4YFNF 3BWGA 3F23A 2M30A 3GZ6A 3C7JA 3ERED 1MD0A 4BYYA 1OKRA 2FEZA 4HAMA 4OINF 1BC7C 1T0FA 1TNSA 4KMUX 3ZMDA 3K0LA 3WODF 1E17A 1YW7A 3I0TA 3LA2A 1QPMA 4ENKA 1PP8F 3ZMVA 3GW2A 1USSA 4YIFA 4IPAA 4I98B 4GYGA 3RYPA 2AS5F 4MGRA 2R3SA 1P92A 2RGVA 3BJ6A 4UV8A 4A2UA 2Z33A 4P96A 1KU7A 1G4DA 5CVIA 3CUQA 5DUKA 2VBWA 2AXLA 2P5VA 1ON1A 2VOOA 3IHUA 2NS0A 1REPC 2WV0A 3D0SA 3LQQA 5EEGA 1UB9A 1QGPA 3I4PA 1FZPB 1ODDA 5ICCA 1L0OC 1B4AA 3LA7A 2ZO4A 2F2EA 3Q5FA 3QP6A 4WCGA 3LAJA 2CYYA 2VE8A 5FGMA 2HEOA 4MTDA 5D5XB 4IVNA 3R61A 3ABTA 5D4SA 4WK8F 1XB4A 1IRGA 1KU2A 1IZ1A 4KICA 4MEYF 2HGCA 3REOA 3M8FA 3JW4A 5L3EA 2X4HA 4IRGA 4NHJA 3GFMA 4IHTA 2CWEA 2ELHA 2YPRA 1P4WA 2RNJA 3FX3A 4ASNA 3WE3A 5L3CA 4OIOF 3KP5A 1F4KA 2RN7A 5H6RA 1FNNA 2GIVA 4L9TA 2O03A 4ENMA 3VFZA 3M1EA 5FB2A 1MJ9A 2JPCA 3FM3A 2BGCA 3KZYA 4BHCA 5FO5A 4EJOA 1YS7A 1WQ2A 5JVTA 4OIQF 1XCVA 3H92A 1DPRA 1STZA 3L9FA 2ETHA 2D2WA 5L3DA 3EDPA 3V7RA 1Z05A 2ACJA 2O8XA 3F72A 4I01A 2UXXA 4P9UA 1BIBA 1SD7A 1TNTA 3HSFA 2KIFA 4EJUA 1EH7A 1IN7A 4Y17A 1UHMA 3ROUA 2O6GE 2TDXA 4LLLA 3O6BB 2EV6A 4ESFA 1K78A 2LF8A 3ZMUA 4LB5A 1P6RA 4HX8A 3RTRA 2QZ8A 2M5WA 2HS5A 1KYZA 4I0BA 4KMFA 1YFHA 3GYHX 2IW5A 2VT2A 3TGNA 3CDHA 3FXUA 1ZG5A 3HHHA 1YS6A 4HQMA 2O0YA 3DXJF 5BOXA 2FNAA 4D0PA 2QYOA 2P4WA 1R7JA 1HW5A 1WI9A 1BOAA 2HKXA 4P9FA 2PQ8A 3HIFA 2XVCA 1I6XA 4UXNA 2F5EA 3V8KA 3L7WA 2D1HA 1FBQA 2FMLA 4RGXA 1BI3A 3N4MA 2PJPA 2DO7A 2EB7A 2COMA 3DP7A 1YIOA 4HF2A 1FLIA 1R1TA 1W7PB 1U5TB 5KVRA 3CO7C 3QU3A 2EFWA 2EV0A 2K4JA 2A68F 3IKVA 1O7LA 3WU1B 4M6XA 5ICGA 5JR3A 1JHHA 5JFRA 4KFCA 2RV8A 2MH2A 1Z91A 3ABUA 2F5CA 5LLQA 1DPUA 3KEOA 2ZNYA 4A5MA 1KU3A 3LA3A 5LHIA 1TW2A 1IN4A 2HTJA 5FFZA 4Q5SF 3P9IA 2HWVA 3BPXA 2YR2A 1BI2A 5J6XA 3F22A 3K1MA 1D8KA 2FQ3A 4G94A 4DNCA 1ZH5A 4CXFA 2LNBA 1MJAA 5A2QK 1BN5A 5CYVA 4EGZA 3JTGA 3P7NA 2Z3YA 4IJAA 1J0RA 2F5DA 3E6BA 2HDCA 1B9NA 3U1DA 1T2KA 4YIIA 1B6AA 1BI0A 2DTRA 4ESBA 2P6SA 4EM2A 1W4MA 1ZARA 1Z6TA 2XKPA 1IXRC 1W7PD 3BY6A 2DFIA 3F8BA 4LG0A 1FPQA 4HV6A 1YW8A 5FD5A 3KP4A 3T8RA 3BROA 1YTYA 2C6YA 3L2CA 1V3FA 4JQFA 2NRAC 2ZJ2A 1ZG1A 2W84A 2HYFA 1FT9A 4IHSA 1MKMA 4N9IA 4Q47A 2XHKA 2E7XA 4HW0A 2GWRA 2WWYA 3I64A 2JPBA 2VBXA 2E1CA 2V1UA 2HZTA 4M72A 4EMSA 3W6JB 2VC0A 2Q8KA 4B09A 2QBYA 4M9SA 1OYYA 4KIFA 2DAOA 4A6EA 5DEQA 3ZMTA 1LEBA 1SAXA 1SD5A 4PZJA 2EK5A 2P6TA 3FMQA 3WTTC 4ZYGA 2DK8A 2ZMEB 4UV9A 5D5UB 4U7DA 1P4AA 1GXPA 3H3ZA 1J59A 3F21A 1DP7P 2KIUA 1FYLA 4WF2A 3QPTA 5DV5A 2QQBA 4IRHA 3WGGA 1G3TA 2MLKA 1TLHB 4XLPF 2E7WA 1XSXA 1XGMA 1QZYA 2W25A 3K9TA 1XCBA 3IWFA 4EQQA 1KGSA 1R5HA 2M87A 3BZ6A 1DDNA 1TQPA 3NQOA 4Q48A 5FD6A 2FMYA 1BIAA 1OPCA 4HOBA 4HLXA 5F64A 1IUYA 2XRNA 3KLNA 2OZUA 3COAC 4RB3C 4Z2YA 3GO5A 2QVOA 2XV4S 4RS8A 4HYEA 4G9YA 5F6FA 3K1NA 4MQ9F 2STWA 5H6QA 2FBKA 1F5TA 2D1VA 3IC7A 3CUQC 2YU3A 2VE9A 2PG4A 2JTVA 3JTHA 1ZLKA 4ZYEA 5D4RA 4HX4A 2DQRA 3BJAA 4HBLA 4AD9A 3RI4A 4HF1A 1HXDA 1RNLA 4OMZA 1FWZA 4AVPA 1SMTA 1G3YA 3GZ5A 5CLSA 1H9GA 4RGRA 5L3GA 1ZAOA 3FXRA 2QM3A 1KQ0A 1LVAA 5HOOA 2CO5A 4LK0F 3QRFF 2XAFA 3O3KA 2L3DA 3LWFA 3DEUA 5KK1A 4QWQA 5LGTA 1GXQA 2EA4A 3WGIA 4YFXF 2IJLA 4I7HA 5LGUA 5HS9A 2P8TA 3RKWA 1S6LA 3OV8A 5H20A 5LEKA 3HHGA 3JAMZ 2FSWA 2EFQA 3V7SA 4IRIA 2OQGA 3MQ0A 3RYRA 1XDUA 5E8IA 2Q2EA 2D45A 2V79A 4HF0A 3WTXC 4U7BA 3DKWA 2ZXJA 5DCMA 4NQWA 3BP8A 3GWZA 1U8RA 4OOIA 3L09A 5IT9Z 4HX7A 2ISZA 3V8LA 3JSPA 2Z5UA 3I59A 2DBBA 2A07F 4BHBA 5LHGA 3CJNA 1K78B 4JBAA 3P9CA 4U0WA 2HYGD 2V9VA 5DUIA 3Q9VA 4EM0B 3MZYA 1HKSA 2G7UA 1OYIA 4KA4A 1XGSA 3KP6A 2XGXA 3JAMK 2YX4A 1PUEE 2XAJA 4JK1X 2HQNA 3GF2A 5FFXA 4H0EA 2DI3A 1RIOH 4G7ZF 1DUXC 4EJTA 1D3YA 3F8NA 3DPTA 5L3FA 1S8NA 2XROA 4MTEA 3CUOA 2L4AA 2OD5A 3H3UA 4XSXF 2H09A 5IT9K 5K5QA 3KP3A 3CLOA 1L3LA 2H27A 5J8CA 2LKPA 3WU0A 3GVAA 2RKHA 5E18F 4AWXB 1KQ8A 3FMSA 2BEOA 3BPVA 1AOYA 1CGPA 1G6NA 1Z7UA 5E17F 2HQRA 2GA1A 3NRVA 4A6DA 4CO8A 3I53A 2J5PA 4S05A 2FXAA 3J7AO 1R36A 1AWCA 4A12A 1I5ZA 1MDMA 1O3RA 1HKTA 5E8GA 3K2ZA 4CYDA 2JSCA 4G8XA 1HKQA 2R7FA 5HLIA 1IN6A 5BQTA 3E6CC 4RGUA 1LNWA 2GA2A 1ONVA 4KIGA 1IAWA 1B59A 2KJCA 4ZH4F 1B1BA 3HYIA 2E1NA 2L4MA 5E1ZB 4FX4A 3E5UA 4ZZLA 3TOBA 3MFKA 5J8FA 1D8JA 3SHFA 3RDIA 5LBQA 5A2QZ 2LF7A 3ZPLA 3ELKA 1J7KA 1GHCA 3DFGA 1SFUA 1G3WA 2EFOA 4KDPA 5TJJA 3M7GA 5D5WB 2XAHA 1X3UA 1WKMA 3P9KA 4RB0A 4WXDA 2QWWA 1JXSA 1F1ZA 1JHFA 1QO0D 1FP1D 2KJBA 1SFEA 4DQ2A 4LG0B 2O61A 1LJ9A 1T39A 2IT0A 4LJZF 4F7ZA 4R79A 3K69A 3QOPA 3HTSB 4Y15A 1MJBA 4HLYA 1U3EM 2HFHA 1E2XA 4ETSA 2NYXA 1YO5C 2A6EF 5CVUA 4OIRF 2P7VB 1T38A 1J9IA 5D8KB 3KZZA 2FRHA 1LDKB 2STTA 4BQAA 1IXCA 2GAUA 1LDDA 4FX0A 3GFLA 5E20A 4EGYA 2B0LA 2P5KA 4L9JA 4YFKF 3F3XA 5ICFA 2QBYB 1YG2A 4ENNA 2MLGA 3HRSA 1HQCA 1EH6A 3MWMA 4ENJA 3TQNA 3EYIA 3HUGA 3KEQA 1Z1DA 3PQKA 3BDDA 3NEUA 2RQPA 2ESHA 3E97A 1C0WA 3C1DA 5D8LB 3V4GA 1BBYA 4L0ZB 2XASA 2VBYA 4O6JA 4A5NA 1J2XA 1A04A 2JRTA 2IPQX 4EJVA 5LRRA 1S29A 4UHTA 1ON2A 1K6OA 4UNOA 3WTVC 4MQVA 2VN2A 4CGZA 4RB1A 1ZRCA 2VXZA 1P4XA 2EWNA 2VT3A 3ZP5A 4K2EA 5E1XA 4HDUA 4PGGA 3HSEA 2MA3A 4XSZF 1UCRA 3ECOA 4PGHA 1BC8C 1Z6RA 1TBXA 1ZN2A 3WTWC 3KFWX 1HBXG 1S3JA 1WSUA 1TTYA 5BPIA 2A69F 5BMZA 1FYKA 3KLOA 3I54A 2PFBA 3IKTA 2IRFG 4HQEA 5AIQA 4I02A 1CF7B 1YW9A 1LEAA 4OMYA 4LD5A 3GLXA 1R1VA 4GGGA 4R1HA 3GUDA 1O7FA 1U78A 2XUBA 2W24A 1U6GA 3R6SA 1QQIA 1S7OA 2BYVE 4KN4X 5LGNA 3T5XA 2PN6A 3ZMZA 1ZGJA 1MGTA 3IWZA 3K1PA 3N97A 4L5JA 4ESJA 4HV5A 3SZPA 3WTZA 2BE5F 5LRSA 1O57A 4OIPF 3KP2A 4CICA 3M8EA 5CJ9A 3HRMA 2W57A 4OU0A 4UVCA 2RC4A 4L18B 1SD6A 1VTNC 2VBZA 2F5FA 4QLCU 4M73A 2CFXA 1IRFA 5HS7A 3V8JA 1YLFA 1ZHFA 4ZYHA 3GX4X 2BBYA 2CG4A 2K7LA 3WG9A 2K4BA 3SXYA 1LQ1A 2PLYA 5DCMB 1FSHA 3I58A 1K7AA 2EFNA 4AIJA 3CUQB 4L9VA 1TW3A 2K86A 2L02A 2OQRA 3ZQ7A 3FZVA 2QQAA 3I59B 4UUVA 3KE2A 4I0AA 5K5OA 4S04A 3GFIA 2NAZA 1ZLJA 3Q9SA 4O3MA 4U88A 3AAFA 1XN7A 2FBHA 3U9GA 3R4KA 2X0LA 2RDPA 3CO6C 3JSOA 1R00A 2ZBKA 2QLZA 2ZKZA 2VODA 3M9AA 2GXBA 3E5XA 1KU9A 3W6KB 4R8HA 3DPLC 3TO9A 4GO1A 3EYYA 3L00A 3U2RA 3HOTA 1UFMA 3WTUC 3F8MA 5HDNA 2PMUA 1ZGAA 2FBIA 1O3SA 3ZMSA 4P55A 4FHTA 5DD8A 4KYWA 4LK1F 2HTSA 3VB2A 1PDNC 4G6DA 2DW4A 3FMRA 1FSEA 4UVBA 2G9WA 5JHUA 2ESNA 4FT8A 1FBSA 1OR7A 2L01A 1XMAA 5AIPA 2UXNA 4ZYDA 3ECHA 1UHWA 3E5QA 3IRRA 3FXQA 3MZHA 3F8CA 5ILUA 1HW1A 2FU4A 4BAYA 3FF5A 1XDSA 2H6CA 4EJWA 4WXHA 4RGSA 1TQIA 3VODA 5HVQC 3J80Z 4EM1A 4L0YB 1ZRDA 4G6QA 4ON0A 1XMKA 4UVAA 4HA8A 1OYWA 2KIMA 1HSTA 3MCZA 1O3QA 1MDMB 3WTYC 4HDVA 3QP5A 3T1BA 4BXUA 3PFIA 2OBPA 3GEZA 4A0XA 2DK5A 3G73A 2P5LC 2FF4A 4GXOA 1WRJA 3ZN1A 3LSTA 3SFZA 1RI7A 2DT5A 4M9XA 2CQKA 1SFXA 3RIRA 1LDJA 1BM9A 3C18A 1B9MA 3S2WA 2GZWA 2OU2A 1Z9CA 1QBJA 1W5TA 2A3SA 4M74A 3CTAA 5F1RA 2LDUA 2V1XA 4A0YA 1YYVA 4LLNA 2YSRA 3HSRA 3WTSC 2JT1A 1FY7A 1IW7F 2VC1A 5LHHA 3J80K 2ISYA 4MEXF 1KYWA 4L5IA 1RUNA 2QQ9A 3BOQA 5DDGA 1FBUA 1SMYF 2UZKA 1FOKA 4MHGA 2EV5A 5E1WA 2EFPA 1FP2A 4WX9A 4CHUA 3TKYA 5D6EA 4PDKA 2YX7A 4CDGA 2HKOA 6PAXA 5JI6A 4KN7X 2OAZA 2Y48A 3ML6A 5HS8A 2M1BA 1ZRFA 2GQQA 1R22A 4N9HA 1WWXA 2PI0A 4KT5C 4AIKA 3LQRA 3KETA 1KQ9A 2ZCWA 2GXGA 5ILSA 2A61A 1IN5A 3FHZA 4RB2C 2EJRA 4G7HF 1IN8A 5FLXZ 1USTA 2A6HF 1U2WA 5LEJA 2RVCA 2IA2A 2M8EA 4L9NA 1SD4A 3EETA 4EV0A 1RZ4A 4GYIA 4I09A 4M71A 5D6FA 2FA5A 5ERIA 2K02A 1FYMA 3OOPA 3QU6A 3SZTA 1ZREA 4LMYA 1F9NA 2A5YB 3RJPA 4IF4A 5DYMA 3TO6A 3RKXA 2KKOA 2IA0A 3LAPA 4WXCA 3I5UA 4KUMA 2VOPA 5HDKA 2V6CA 3I71A 4LB6B 4M9ZA 1FX7A 1HW2A 2ADUA 5TRDA 2KRFA 4O5VA 3IL2A 1BI1A 4E70A 3GFJA 2JZYA 2R7DA 1U5TC 2Z99A 5HLHA 3DV8A 1P2FA 5FLXK 4EVIA 2CGPA 2L54A 2VONA 2ZFWA 2PBIA 3J81Z 2MD5A 1J5YA 2IA1A 3RKYA 3ZN0A 3C3WA 3F6VA 1J75A 2XAGA 4Y13A 3WGHA 4IXAA 1I27A 2PEXA 5ICEA 3B73A 1R23A 3E6DA 2XAQA 3R0JA 4ZZDA 5K1YA 3QAHA 5K5RA 1D5VA 3T8TA 4CZZA 3TOAA 1IXSB 3EUHA 1H9TA 2HR3A 5CVVA 1PP7U 4KIBA 4BH9A 2DPDA 1GVJA 2CSOA 5AONA 1Q1HA 4AIHA 4LGWA 4NB5A 2J5OA 3SQNA 1IF1A 1W5SA 3HOSA 2LSOA 1RUOA 3WE2A 1BJAA 2HOEA 4MNUA 3R0AA 1V4RA 4LFUA 1W7PA 4B8XA 3E3VA 1U5TA 4RAYA 3F8FA 1KA8A 1R58A 2EA2A 3J81K 4XLNF 2W85A 1LB2A 2DU9A 4BHPA 5IT3A 2Y0MA 3B02A 5BPDA 5HDGA 1K79A 1OMIA 3GXOA 2UWMA 3ULQB 1NHAA 3ISPA 2NNYA 3G3ZA 2DPUA 3FM5A 2WC2A 3R60A 3D5LA 2DLLA 1O3TA 2K27A 3LFKA 1R1UA 1ULYA 5CVJA 1S7AA 3EQLF 2BV6A 1XSDA 4U0YA 3MAJA 3DF8A 5DCFA 2V1DA 1YQAA 3RPQA 5BS6A 1H0MA 2Y75A 5L3BA 1TQMA 5ED4A 4I2OA 1XGOA 1I1GA 2FOKA 4WWCA 5ILVA 4U0VA 1ZYRF 2CW0F 4XRFA 3T0YA 2H94A 1R5GA 5DD4A 4HZFA 2M45A 2IVMA 3IRQA 3HRUA 1QNTA 3KCCA 2OZ6A 3O2PE 2Q0OA
chains in the Genus database with same CATH superfamily
5F0FA 4P5OA 4G7OF 2H6BA 5D5VB 3A0BC 1HSJA 4PCQA 2NS7A 4F52A 1XC5A 2XKOA 4YG2F 3RPUA 3F6OA 5EEHA 3TDZC 1ACIA 4M6YA 5CVRA 1VQ4I 3MEXA 2WTEA 1R4MB 2ZNZA 4XOTA 3KP7A 3M07A 4BNCA 1Y8RB 1VFCA 2HPMA 1ITYA 3CCEI 2DQLA 3E6MA 2DT7B 1MZBA 2NVYJ 5BNGA 2VASA 2QGUA 5HLGA 2IP2A 2R7QA 3DLAA 1OLTA 4N0BA 1OFCX 3CCRI 3L1PA 2DYRH 2WY7Q 2G7HA 1T98A 4KNYA 1DGWY 4XM3A 1QA6A 2MC3A 1XD7A 4KISA 2O3FA 1G3SA 4Y3OA 1Y0UA 2KDOA 3PQJA 2RREA 4RAZA 3OYKA 2KPMA 3JRIA 4ZTFA 3G1MA 2QENA 3DQVC 3VEPA 1XGNA 1EH8A 1IV6A 3WG7H 1QZZA 2DCEA 1I1SA 1JE8A 4A0ZA 1FMVA 5IYBJ 4DJAA 2BW3B 3VOEA 2FE3A 3QPHA 4XBFA 4UUSB 2E19A 1MBHA 3BJOA 3S3MA 3TDUC 2PMZN 2JQ7A 1FC3A 2OA4A 2QUFA 2AHQA 4GCVA 4TV7A 2XIGA 1TP4A 1CF7A 4LLGF 2NNNA 3GLLA 2VQHA 3G71I 2DJNA 5F08A 1EV7A 1A6IA 1XSVA 3V7CA 4KT6A 3OYGA 1T6SA 4Q4ZF 1IO2A 3CCUI 2VJJA 1JGSA 4W1UA 4OAYA 1N25A 1TWAJ 2ZMEA 5HNHA 1QU3A 3GZNB 1XPXA 2LC2A 3GBGA 3HTUA 2MH9A 1E3HA 3FWEA 2PMHA 3HRTA 3OIOA 2MBFA 3TO7A 2FNPA 2P7CB 1OCZH 2JA2A 3C2GA 3OYMA 1ZG3A 5J1UA 2AQEA 2Z9OA 1FOYA 1X4OA 1MMSA 4NC8A 2QA4I 3CMYA 3UNGC 1NTCA 3BWGA 3CP2A 2M30A 4YFNF 2MSYA 5GTIC 3F23A 3LFUA 5B5EC 3GZ6A 3C7JA 3ERED 1MD0A 2X6XA 4BYYA 1LFUP 1OKRA 1P7IA 1V5FA 2FEZA 1MMAA 3S32A 4II2A 4HAMA 2DA4A 4OINF 1BC7C 1T0FA 2DMPA 1TNSA 2IS4A 4KMUX 3HOZJ 4PFOA 3PO3J 4A3FJ 2LMDA 5LFAA 3FXLA 1X19A 3BTCA 2JA6J 3ZMDA 4A3IJ 5J4VA 3K0LA 3WODF 1E17A 1YW7A 2LK2A 4CYCA 4IQJA 2EZLA 1TWHJ 2OPTA 3I0TA 5F0CA 3LA2A 1QPMA 2XDVA 4ENKA 1PP8F 2GXAA 3ZMVA 3GW2A 1D0ZA 1FIPA 1USSA 4YIFA 4IPAA 4I98B 4GYGA 3RYPA 1YOVB 3IH2A 4HNTA 2AS5F 1K61A 2FD5A 4MGRA 2R3SA 1A6QA 1B72B 1P92A 2RGVA 3BJ6A 4UV8A 4A2UA 2Z33A 1WH7A 4P96A 1KU7A 1G4DA 5CVIA 2DFHA 1PUFA 1UG2A 1YJNI 3J7YJ 3CUQA 5DUKA 4LIVA 1ENHA 2VBWA 2AXLA 2P5VA 1ON1A 2GM4A 2ICWG 2VOOA 3E7LA 3IHUA 1TWFJ 3FXOA 4DZPA 2NS0A 2R7VA 1REPC 4JX6A 5EG0A 2WV0A 3D0SA 3LQQA 3I4MJ 2L9NA 3IH4A 5EEGA 1G2HA 4P1WA 1UB9A 1QGPA 3I4PA 2WAQA 2OC6A 3JRGA 1ODDA 5ICCA 1L0OC 1FZPB 1I6HJ 4PSXA 1B4AA 3LA7A 2WAQN 2ZO4A 2F2EA 3Q5FA 3QP6A 1Y56A 4WCGA 4N4OB 3G4SI 5J1YA 3LAJA 2MABA 1SANA 2CYYA 1DU6A 1JT0A 2VE8A 3ASNH 3VDXA 5FGMA 1QHHD 1D1BA 3FBIB 1Z7LA 2HEOA 4BXFA 4MTDA 4M3BA 5D5XB 4IVNA 2KDZA 3OWTA 3R61A 1BR2A 3ABTA 5D4SA 4XICA 3SEZA 4WK8F 1XB4A 1SVMA 2UV1A 1IRGA 1KU2A 1IZ1A 4NC7A 5B3SH 4KICA 4MEYF 2HGCA 5GP9A 3U21A 2OTJI 3REOA 3M8FA 3JW4A 5L3EA 1MBGA 2X4HA 1X1DA 2TCTA 4IRGA 2ZJRF 4NHJA 3GFMA 4IHTA 4B1RA 2CWEA 2ELHA 2QF7A 2YPRA 1P4WA 2RNJA 3FX3A 2LBFB 4ASNA 3WE3A 2XC7A 5L3CA 3PNYA 4PUSA 4OIOF 3KP5A 3BCAA 1F4KA 2PJRA 4KJZA 2RN7A 5H6RA 2M7BA 2HVQA 1FNNA 2GIVA 1Z21A 4L9TA 2V6EA 1IRZA 5FKKA 2O03A 4DW6A 4ENMA 3CCLI 1JTYA 2MC4A 4G6TB 3NAUA 2Z1DA 3VFZA 3M1EA 5FB2A 1MJ9A 2JPCA 3FM3A 2BGCA 3KZYA 4BHCA 5FO5A 4EJOA 1YS7A 1WQ2A 5JVTA 3CP8A 4XKCA 2R5YA 4OIQF 1XCVA 3H92A 1DPRA 3CZ6A 1STZA 3L9FA 2ETHA 4PJNA 2D2WA 3OS1A 5L3DA 5C4XJ 3EDPA 3V7RA 1Z05A 4W97A 2ACJA 2IS1A 1MSFC 2O8XA 3F72A 1VI0A 3LSJA 4I01A 2UXXA 4P9UA 3S1QJ 1BIBA 1SD7A 1UZCA 4FETA 5GPAA 4MIMA 5IOZA 2E1MB 1TNTA 3HSFA 2KIFA 4EJUA 1EH7A 2GBYA 1IN7A 3ZQGA 5J40A 4Y17A 1IJWC 1ZK8A 4IHXA 3PSFA 3HGYA 1UHMA 3ROUA 2O6GE 2TDXA 4LLLA 2K3FA 2E1MC 3O6BB 1VQKI 2EV6A 3GMEA 4ESFA 3DLLF 1K78A 2LF8A 2Q1ZB 3ZMUA 4LB5A 5EEAA 1P6RA 4HX8A 3OYJA 2H8RA 2AO9A 3RTRA 2QZ8A 2M5WA 2HS5A 4E7KA 3S3NA 1KYZA 4I0BA 4KMFA 1YFHA 3TW7A 3GYHX 4A3DJ 2OV7A 1OCOH 2IW5A 3ZQCA 5M3FJ 2VT2A 3GTJJ 1VQLI 3TGNA 2VKDA 1MIJA 3CDHA 4X1EA 3FXUA 1VQPI 1ZG5A 4BQQA 3HHHA 1JKOC 1YS6A 4HQMA 4CZCA 4IKFA 4BEHB 4YIRX 2E35A 1YX3A 2O0YA 3DXJF 5BOXA 2HOTA 2FNAA 3BLYA 1TT0A 1K4TA 4D0PA 2QYOA 3PM1A 3JR9A 3H3VK 2P4WA 3HL2A 2MG4A 3MVPA 1R7JA 4IHVA 3RZDJ 1VQMI 3ZCOA 1B8IA 1FTTA 1HW5A 1WI9A 1BOAA 3MD2A 4LOCA 2PX9A 4BKXA 4XK4A 2QKMB 2XF7A 1MNDA 3DTEA 5JVGF 2HKXA 4P9FA 2PQ8A 1X58A 3CMEI 1WFXA 2BXZA 3HIFA 2XVCA 2JA8J 1I6XA 4UXNA 1ZQ3P 3G6EI 3EUHC 2F5EA 2XSJC 3V8KA 1VQOI 4QSHA 1MBKA 2LR8A 3L7WA 2D1HA 3PO2J 2XB0X 2E36A 1JKQC 1FBQA 3QYFA 1LE8B 3L2QA 2FMLA 3HXLA 4RGXA 1GDTA 3SDGA 1BI3A 2RAEA 2R7WA 3N4MA 2PJPA 1IGNA 2DO7A 1YHQI 2EB7A 1R9TJ 2DJIA 2COMA 3DEWA 2NOGA 3DP7A 1APLC 1YIOA 4HF2A 1FLIA 3BR5A 2QSHX 3KYDB 2CQ7A 1R1TA 3TBIA 1W7PB 4NBQA 2VPLA 1U5TB 3S1MJ 5KVRA 4D5FA 4M6VA 1ETOA 3QU3A 3TMOA 3MKYB 3CO7C 2EV0A 2K4JA 2OCEA 2EFWA 2CV0A 2A68F 3IKVA 3A01A 1O7LA 3WU1B 2YU9J 4M6XA 5ICGA 5JR3A 1JTXA 2HOAA 1JHHA 5F27A 3H9QA 5JFRA 1JUPA 2DDAA 4KFCA 5HLTA 2RV8A 1FOXA 2KL4A 2MH2A 4V19K 3HB9A 1Z91A 3ABUA 2F5CA 5LLQA 1DPUA 3KEOA 2ZNYA 3K2AA 1HCRA 4A5MA 1OCRH 1WVRA 1KU3A 1POGA 2HZDA 3LA3A 5LHIA 1TW2A 1IN4A 2HTJA 5FFZA 1J09A 4Q5SF 3P9IA 3QYBA 4RLQA 2HWVA 3CC2I 3BPXA 2YR2A 1BI2A 1X3WB 5J6XA 2JRMA 3F22A 3K1MA 1YE9A 1D8KA 2JK3A 2FQ3A 4G94A 2Y9YA 4DNCA 2DFFA 1ZH5A 4XL9A 5J4YA 4CXFA 2LNBA 2LOOA 1MJAA 1LFPA 5EGOB 3RKQA 5A2QK 1BN5A 5CYVA 4EGZA 2W4SA 3JTGA 2Z2SB 3P7NA 2X6YA 2Z3YA 2A5WA 4IJAA 3M4OJ 5B1BH 1J0RA 3JCUC 2F5DA 2CUJA 3E6BA 2HQAA 2HDCA 1B9NA 1U9NA 2KRHA 1HOMA 2XF6A 3U1DA 2ME6A 3S14J 2VIXA 1T2KA 4BU2A 4YIIA 1B6AA 1BI0A 2HVSA 2DTRA 4A3MJ 3CCYA 4C30A 2M8GX 1Y1WJ 4ESBA 2VJ5A 1AKHB 2P6SA 4EM2A 3IAS2 4IHWA 3B6AA 1W4MA 1ZARA 4B3AA 1Z6TA 2XKPA 1IXRC 1EKEA 3S1RJ 4QTRA 3RZOJ 2KQRA 1W7PD 2KT0A 3IH3A 3CC4I 3BY6A 1S9HA 2NVQJ 2CQQA 2DFIA 3F8BA 4LG0A 1IDZA 2CS3A 1FPQA 3OYIA 4HV6A 1ZKGA 5CKTA 1YW8A 5FD5A 4BS9A 3KP4A 5HNFA 1HF0A 3T8RA 5B1AH 2HXOA 2EIKH 3BROA 4KITB 3CCQI 2I8DA 2R5ZA 3CCVI 5EF6A 5F04A 1YTYA 2C6YA 1E0EA 3KIOA 5EJCA 4CCOA 1TT5B 1E3PA 3L2CA 1V3FA 4JQFA 2NRAC 2ME0A 2ZJ2A 1ZG1A 2W84A 2HYFA 1FT9A 4IHSA 2LRDA 1MKMA 2Y69H 3H35A 3SZGA 2KZVA 4I99C 4N9IA 4Q47A 2XHKA 3PNTA 3SYTA 3ZRGA 3M3YJ 2E7XA 4HW0A 2GWRA 2WWYA 3K10A 2K9QA 3I64A 2JPBA 5E3OA 2VBXA 2E1CA 2V1UA 5IP9J 3QYEA 3JRBA 2HZTA 4M72A 2DA6A 4EMSA 1ZR4A 4RAFA 2Y0SA 5DM7F 3W6JB 2VC0A 2Q8KA 4B09A 2QBYA 4M9SA 2Y0SN 1OYYA 1UELB 4DYQA 4KIFA 3RQIA 3OYAA 2DAOA 2DDBA 3KZIC 2UUZA 4A6EA 1V5EA 4B44A 5DEQA 4F92B 3ZMTA 3IV5A 1LEBA 1SAXA 1SD5A 2M4GA 4B48A 4PZJA 2EK5A 2P6TA 3FMQA 3WTTC 5TGTA 5LD2C 4ZYGA 2DK8A 2ZMEB 4UV9A 5D5UB 4U7DA 1HDDC 1P4AA 3ZQHA 1HC8A 1GXPA 1RR8C 2ZB9A 4NNJA 4HG2A 3J7ZI 3H3ZA 3AKZA 2DA7A 3OL4A 1J59A 4C3JJ 5K7HA 3F21A 1DP7P 2KIUA 3AG4H 1FYLA 4WF2A 3QPTA 5DV5A 2QQBA 4IRHA 3WGGA 4X0GA 3OSGA 1G3TA 2MLKA 3S15J 1BW5A 1NG7A 3O8GA 4Y52J 4XLCA 1TLHB 2X1EA 2MGQA 2FQ4A 4XLPF 2E7WA 2K3PA 1XSXA 1XGMA 1QZYA 2W25A 3K9TA 3QPSA 1XCBA 3OYCA 3LSRA 1BJZA 4D7MA 3IWFA 2EPFA 4AU7A 1KGSA 1R5HA 3MZ8A 4EQQA 2GOXB 1WZ2A 2LH9A 2N8GA 1RKTA 1U9OA 4CYCB 2M87A 1GT0C 3ABKH 1T0FC 3BZ6A 4C3HJ 1SAUA 2LY9A 4U87A 2V26A 3JRHA 1Y8QB 2BOLA 1O4XA 1ETWA 1DDNA 2IGMA 3RPUD 1QZEA 1TQPA 3NQOA 2F48A 4ZJZA 2HOSA 2V4JC 3KYLA 4Q48A 2XGCA 5FD6A 2HI3A 3FXMA 2FMYA 1BIAA 4V2GA 1OPCA 1WJDA 4HOBA 5IP6A 2LFBA 4HLXA 5F64A 2Y9ZA 1IUYA 2DTZA 2XRNA 2ZXIA 2EIMH 3KLNA 2OZUA 3COAC 4IX7A 2QQ8A 4HPQA 4RB3C 4Z2YA 3GO5A 1PJRA 2QVOA 2XV4S 2CUEA 4RS8A 4HYEA 1PUFB 4G9YA 4E7HA 5F6FA 3BCBA 3NWTA 3ABMH 2PMZA 3K1NA 4MQ9F 5M5WJ 2Y30A 2STWA 4CCKA 5H6QA 2FBKA 1S72I 1F5TA 3K4CA 2K5CA 5EG0B 5F0HA 2D1VA 1T33A 1WJFA 3IC7A 2XF5A 1JKRC 2E60A 3CUQC 2YU3A 1ZR2A 3VWBA 4IEJA 2VE9A 2PG4A 3AFHA 1GUUA 2JTVA 3JTHA 1ZLKA 4ZYEA 5D4RA 4HX4A 2DQRA 2L9RA 3BJAA 4HBLA 4AD9A 3PL8A 4MO7A 2VLAA 4LG3A 3RI4A 4HF1A 1HXDA 1RNLA 5FJ8J 4OMZA 2R92J 4AC0A 3CMMA 1FWZA 2DMTA 3A1YA 4AVPA 1SMTA 1G3YA 3GZ5A 5CLSA 1MBFA 1H9GA 3JREA 5EZGA 3AG1H 1JI8A 4RGRA 5L3GA 1H89C 3BZCA 1ZAOA 1P7JA 3FXRA 3OS2A 2QM3A 5IP7J 1KQ0A 1LVAA 2X48A 5HOOA 3LSHA 4CCLA 2CO5A 4LK0F 3QRFF 1VQ9I 3TP3A 3HKZA 4L5EA 2DN0A 2XAFA 3O3KA 3HKZN 2WAEA 1G59A 3K70C 3GTQJ 2L3DA 2MYSA 2YS9A 3LWFA 3DEUA 3LSPA 1ETYA 5KK1A 3TP0A 4M3EA 4NDLA 4RLFA 1XX5A 1K6YA 1WJBA 4QWQA 2X85A 5LGTA 3BQZA 1GXQA 3OYNA 2EA4A 3WGIA 4YFXF 2IJLA 3DKXA 4I7HA 5LGUA 5HS9A 2P8TA 4CCNA 3RKWA 1S6LA 3OV8A 1P9QC 2PJRB 1QVUA 5H20A 1YITI 2DFEA 2P0WA 5LEKA 1TZLA 4ZTJA 1FTZA 3HHGA 5EZHA 3L2RA 3JAMZ 3BR1A 2VL8A 2FSWA 2EFQA 1UJ8A 3V7SA 3H9JA 3Q0VA 4IRIA 2OQGA 3HJEA 3MQ0A 3RYRA 1XDUA 5GAGJ 5E8IA 3CF5F 1NH3A 1UMQA 2Q2EA 2D45A 4CA0A 2V79A 4HF0A 3WTXC 1T56A 4RM2A 2R5YB 1X1AA 3ZQIA 1HA8A 4U7BA 1I3AA 3DKWA 2ZXJA 1WCMJ 4A3BJ 5DCMA 3AG2H 4NQWA 3BP8A 2G0EA 3GWZA 1U8RA 4OOIA 2OJED 4J00A 1IV8A 1XG1A 2ZSIB 3L09A 1RKWA 4UB6C 5IT9Z 4HX7A 2W7NA 3E0JB 3ZQLA 2ISZA 3BR2A 2H1LA 3V8LA 3JSPA 2Z5UA 3I59A 5M5XJ 2DBBA 1V54H 2IBDA 2OUMA 3DTKA 1X1PA 2A07F 4BHBA 3P5JA 5LHGA 4FASD 2JJ7A 3CJNA 1K78B 2BVLA 4JBAA 3BR3A 3J7AY 2E2JJ 2GLOA 3K4JA 3Q0UA 4BJ6C 3P9CA 4U0WA 3ZXSA 2CV2A 4LIUA 2HYGD 2V9VA 2M9HA 5DUIA 3Q9VA 2HVRA 4EM0B 3MZYA 5IY5H 1DQUA 2VPRA 1HKSA 4GFBA 3HOYJ 2G7UA 1OYIA 3BTJA 4QPOA 4E7ZA 4KA4A 1XGSA 4BDYA 3GTKJ 3H5NA 3KP6A 1VNDA 2XGXA 3JAMK 2YX4A 3I4NJ 1PUEE 4HNVA 5KHDA 3G2BA 1I39A 2XAJA 2F4OB 3VPRA 4JK1X 2HQNA 3GF2A 5FFXA 3K4LA 4M3FA 4H0EA 5DM6F 2DI3A 2XPUA 3BG9A 1RIOH 4G7ZF 3LMMA 2CRGA 1B8IB 2X1DA 2JA5J 4XKBA 1DUXC 2X6OA 1D3YA 4EJTA 3F8NA 2FJ1A 3DPTA 4ZDLA 5L3FA 1S8NA 2L7FP 2XROA 4MTEA 2JN6A 3CUOA 3K4KA 1QVTA 2L4AA 3BTIA 2B9SA 2OD5A 1OCTC 3H3UA 2IEKA 4XSXF 2H09A 5IT9K 3F9KA 5K5QA 3KP3A 3BR0A 2K40A 3CLOA 3OR2C 1L3LA 3AL0C 2H27A 5J8CA 2LKPA 3H0GJ 3WU0A 1V55H 3GVAA 3LOCA 3HOVJ 1WJEA 3DU5A 2RKHA 5E18F 3HOWJ 3H5AA 2EIJH 4AWXB 2LKXA 3C2HA 1RPWA 2AXTC 3JRDA 1KQ8A 9ANTA 3FMSA 3VYSB 4BE2A 3MKZA 2BEOA 1EA3A 3BPVA 1WJAA 2NVXJ 1T95A 3KEYA 3L2VA 1AOYA 3A01B 1CGPA 1WJ5A 2IAIA 1G6NA 1Z7UA 4MFDA 3PUBA 2HQRA 4CSWA 2GA1A 1U8BA 5E17F 1D1AA 1NG6A 3NRVA 4A6DA 4CO8A 3I53A 2J5PA 3DBLB 4S05A 4BUPA 2FXAA 3J7AO 1R36A 1AWCA 4A12A 3FKIJ 4RM3A 5JLWA 2DA5A 1I5ZA 1MDMA 4A3EJ 3PIPF 1O3RA 1HKTA 2Y2ZA 5E8GA 2BY0A 2LLKA 3K2ZA 4Y33A 4CYDA 3OY9A 2JSCA 3PIOF 4G8XA 1HKQA 3H5RA 2R7FA 3C2BA 1YJ9I 5HLIA 1G8XA 1EF4A 1IN6A 5DS9A 1F36A 5BQTA 1R6RA 4LITA 3TW6A 1YI2I 3E6CC 1JJ8C 1TWGJ 4XMYA 3S17J 1W1WE 3ZR8X 4RGUA 1LNWA 1BL0A 4ZDPA 2GA2A 4XORA 5C4JJ 4IOAF 2JUCA 1ONVA 5IYDJ 4E7SA 3OYEA 4KIGA 3DKYA 2GOMA 1GLNA 2MD0A 1IAWA 2KIQA 4XRSG 1B59A 1AA7A 2KJCA 4ZH4F 1B1BA 4E7IA 3D5SC 3HYIA 2VQCA 3UR3C 2E1NA 1MNEA 2RNGA 4BACA 2L4MA 5E1ZB 1S5LC 4FX4A 2LVSA 3E5UA 2AQFA 4ZZLA 2B63J 4UY8I 3TOBA 3FIWA 3MFKA 5J8FA 1W0UA 1D8JA 3SHFA 4XIDA 2L7ZA 3L2WA 3RDIA 2BVMA 5LBQA 5A2QZ 1YRNA 5K7ZA 2LF7A 1Z3YA 1H8AC 1A5JA 4UUTA 2EBIA 3ZPLA 4DBQA 3ELKA 1J7KA 3CJTB 1GHCA 3DFGA 3O8HA 3HM5A 1SFUA 1G3WA 2EFOA 4F3QA 5TJJA 2NS8A 4KDPA 3M7GA 5D5WB 3S8PA 5FRMA 1FMWA 2XAHA 1X3UA 1WKMA 3P9KA 3LL7A 4RB0A 1E3OC 4WXDA 4D9JA 2QWWA 4XN3A 1JXSA 1VQ7I 5GAEJ 4XN0A 1F1ZA 3GCMA 1MSEC 4DOZA 4I6ZA 1JHFA 1QO0D 1FP1D 2KJBA 1SFEA 2ZXWH 4DQ2A 2X9DA 4LG0B 2O61A 1X1BA 3TEDA 1LJ9A 1T39A 2IT0A 4LJZF 3NARA 2A05A 1SFKA 1UG0A 4F7ZA 4DYRA 1LUJB 5EDNA 4R79A 2NVTJ 3K69A 3QOPA 3HTSB 2VJIA 2R5ZB 3GTLJ 2IS6A 2E2HJ 3OIPA 1MJBA 4Y15A 4HLYA 2L7KA 3QODA 1U3EM 2HFHA 1E2XA 3DU6A 2WA0A 4ETSA 2NYXA 1YO5C 2A6EF 5CVUA 4S0HB 4OIRF 2P7VB 2VQLA 2CQNA 1SC7A 1R5ID 1T38A 1J9IA 5D8KB 3KZZA 2FRHA 1D0YA 1LDKB 2K9MA 2STTA 1X2NA 3S16J 4BQAA 4M3GA 1IXCA 2GAUA 1LDDA 3WHBA 2XGEA 4FX0A 1R49A 3GFLA 5E20A 4EGYA 2B0LA 2P5KA 3PSIA 4DGWB 2ZXHA 4L9JA 3CF2A 4XR6A 3ZOBA 3ERMA 3F3XA 4YFKF 1RRJA 5ICFA 2QBYB 4A3LJ 1YG2A 3U1KA 1VQ6I 4ENNA 2MLGA 2CUFA 3FK7A 2WB1A 5J3LA 2OTLI 3HRSA 1QHGA 4B47A 1HQCA 1EH6A 3MWMA 4ENJA 2WB1N 3M8JA 2LD5A 4XOPA 3TQNA 1H88C 3EYIA 3OMYA 4RMNA 3HUGA 2L7MP 3KEQA 1Z1DA 3PQKA 4BE1A 2O8KA 3BDDA 3NEUA 2RQPA 2ESHA 3QOEA 3E97A 3EUKL 1C0WA 3LSGA 3C1DA 3I56I 5D8LB 5GTHC 2EZKA 3HDDA 2HDWA 3V4GA 3HC7A 3MMYB 5KAFC 2BY3A 1BBYA 1S7EA 3ZQFA 4L0ZB 2XASA 5FLVA 2VBYA 4O6JA 2KFDA 1D0XA 4A5NA 2XSDC 1BA5A 1J2XA 1A04A 4HEA2 3W2VA 2DOFA 2JRTA 3OYHA 2R0QC 1LE8A 2IPQX 4BJTA 4EJVA 5LRRA 2LTPA 2VXDA 2R7SA 1S29A 4UHTA 2B7EA 2FUG2 1ETKA 2BZTA 4Y4RA 1ON2A 2FX0A 3ZQQA 1K6OA 3AG3H 4UNOA 2LKSA 3WTVC 3QQAA 3HBLA 3OS0A 4MQVA 2VN2A 3A4CA 3S3OA 4PJLA 4CGZA 4MFEA 3WU2C 3HOXJ 5TISC 4RB1A 1ZRCA 1AHDP 2VXZA 1P4XA 2EWNA 3A2KA 2VT3A 3ZP5A 4K2EA 5DTDA 2WY8Q 5E1XA 1PYVA 4HDUA 2M4KA 1MNMC 1A31A 4PGGA 3HSEA 3PNVA 2MA3A 2KP6A 4CCJA 4XSZF 1UCRA 2IGNA 3ECOA 4M3DA 4PGHA 1BC8C 3CMAI 2O9LA 3OYFA 4B3XA 1Z6RA 1UHSA 1TBXA 2W48A 4BGDA 1RESA 5FKOA 2K85A 1ZN2A 3WTWC 3KFWX 1HBXG 1BW6A 1S3JA 1WSUA 1TTYA 4AYBN 5BPIA 2A69F 4XKVA 5BMZA 1FYKA 3KLOA 3I54A 2PFBA 4B4CA 3IKTA 4C2TA 2IRFG 2E5ZA 4HQEA 1ZELA 1EJ9A 5AIQA 4I02A 1CF7B 4IL6C 5FLMJ 1YW9A 1LEAA 4OMYA 4LD5A 3GLXA 1R1VA 2DMQA 4GGGA 4R1HA 1M1EB 3GUDA 3G1LA 1O7FA 4JP0A 1U78A 4CCMA 3BG5A 1Z77A 4XLFA 2XUBA 2W24A 2KISA 1BR1A 2XPWA 1U6GA 3BG7A 3R6SA 1QQIA 1S7OA 2WBMA 1OCCH 2RQQA 2BYVE 2F5VA 4KN4X 5E3LA 1YX5A 3OR1C 5LGNA 1V5GA 3T5XA 2PN6A 3ZMZA 1ZGJA 2DA2A 3H1CA 1MGTA 3IWZA 3K1PA 3N97A 1DP3A 4L5JA 4ESJA 3VYRB 3VYUB 3ESWB 4HV5A 5KCMA 2HQ5A 3SZPA 5GADJ 3HZJA 3WTZA 3H0DA 3GTPJ 2BE5F 5LRSA 4D1QA 3VSLA 1O57A 2ZFUA 4I76A 4OIPF 2HPIA 3KP2A 4CICA 2W82A 4FISA 4XRMA 2M3AA 3M8EA 5CJ9A 3HRMA 4XONA 2W57A 4OU0A 3BC8A 4UVCA 3W2AA 3NWSA 2MW8A 1JGGA 3W3CA 1I3QJ 3Q3SA 1ETXA 4DBRA 3ABLH 2RC4A 2DA3A 4L18B 2R7RA 4BBRJ 3BR6A 3JRFA 1SD6A 1VTNC 5KNLA 4A93J 2VBZA 2F5FA 3FK6A 4QLCU 2EZIA 2M7AA 1GVDA 2WAFA 4M73A 3FKJA 4FTHA 4IHYA 1VQ8I 4JOMA 4QPQA 1R71A 1IUFA 2CFXA 2Q2EB 1IRFA 5HS7A 3V8JA 1YLFA 1ZHFA 4ZYHA 3GX4X 2BBYA 2CG4A 2K7LA 3WG9A 2K4BA 1YIJI 4CUGA 3SXYA 3LNQA 3SEQA 1X3ZB 1LQ1A 2PLYA 5DCMB 5M5YJ 4OWRB 4NQWB 1FSHA 3I58A 1K7AA 1Y0NA 2EFNA 4AIJA 3CUQB 3K4BA 1TW3A 4L9VA 3N05A 2K86A 2L02A 1VQ5I 1BOBA 2OQRA 2XB5A 3ZQ7A 3FZVA 2QQAA 3DBRB 2HNHA 1OR7C 1JUMA 2R7OA 3I59B 4DYCA 4UUVA 4AVZA 5CQEA 2QKLB 3HG9A 3KE2A 2OCCH 3QPLA 4I0AA 4ZYAA 5H2FC 4F91B 5K5OA 4S04A 3B6CA 3IAM2 1ETQA 3GFIA 4BBSJ 4YRVA 3OSFA 5GPCA 2NAZA 1ZLJA 3OIQA 1PVEA 4HSRA 4DIQA 3Q9SA 1AU7A 4O3MA 4U88A 3AAFA 2R7TA 4ANJA 1XN7A 3PJRA 2FBHA 3DWLE 3U9GA 1TL8A 3R4KA 2X0LA 2JSPA 3DPUA 4PSWA 2CFOA 4E7JA 2RDPA 3CO6C 3JSOA 4FQGA 1R00A 2WADA 1WH5A 2ZBKA 2QLZA 2ZKZA 2DT6A 4C3IJ 2VODA 3M9AA 2GXBA 3E5XA 2BXYA 3JRCA 3D1NI 1KU9A 3S2DJ 3FXJA 3W6KB 4BY7J 2L9SA 1Y6IA 4R8HA 3IUOA 3DPLC 3TO9A 4GO1A 2M0CA 3EYYA 3L00A 3U2RA 4RDUA 1UFMA 3WTUC 3HOTA 2ZJPF 3GTOJ 4E4HA 3RSNA 2E1OA 3F8MA 5FRNA 3VYTB 5HDNA 2PMUA 1ZGAA 4II3A 2FBIA 3X2QH 1O3SA 1SFOJ 1WI3A 3ZMSA 4P55A 2E34A 2CUZA 4FHTA 5DD8A 1WJCA 4H4KC 4N4NB 4KYWA 4LK1F 3ASOH 2HTSA 3CJQB 3VB2A 1PDNC 4G6DA 2DW4A 3FMRA 1FSEA 2BHYA 1JT6A 5JLXA 1A36A 4UVBA 1N77A 1D5YA 2G9WA 1HDPA 2ESNA 2HYJA 2KMUA 5JHUA 4FT8A 1FBSA 5C44J 1A35A 4XRSA 1OR7A 2L01A 1XMAA 1MBJA 5AIPA 2UXNA 1W36C 2CMPA 3ECHA 3KPHA 4ZYDA 1UHWA 3E5QA 3IRRA 1U0JA 4YEJA 3FXQA 3MZHA 3F8CA 1MMDA 5ILUA 1FOWA 1HW1A 2FU4A 4D7NA 4BAYA 3FF5A 3A02A 1XDSA 2Y31A 2H6CA 4EJWA 2LY2A 4AM3A 4RBOA 4WXHA 5FKLA 3WHCA 4J19A 4RGSA 1TQIA 2VB6A 3SFIA 3VODA 5HVQC 5HODA 2QSGX 2BW3A 2JA7J 3J80Z 1TC3C 4EM1A 4UUSA 4L0YB 2TRTA 1ZRDA 2ZJQF 4G6QA 3ONQA 4ON0A 1XMKA 2CQXA 4UVAA 4HA8A 1OYWA 2I5UA 2M0MA 4IO9F 2KIMA 1HSTA 3MCZA 1O3QA 1MDMB 2R7XA 3M1CA 2LP0A 3WTYC 4HDVA 3QP5A 3T1BA 4FCYA 2KZGA 1W0TA 4BXUA 3PFIA 2K9SA 1NK2P 2OBPA 3GEZA 2L0KA 1Q1VA 3BG3A 5C3EJ 2Z16A 2DK5A 4A0XA 3G73A 2BY1A 2P5LC 2DYSH 2FF4A 3HPHA 2QEXI 4GXOA 3K70D 1WRJA 3ZN1A 3LSTA 3SFZA 3L2UA 1RI7A 2DT5A 1WPKA 1R4NB 4M9XA 4MLOA 2CQKA 4D5CA 4HSTA 3SJMA 1SFXA 3RIRA 2EZHA 2ECBA 1LDJA 2W00A 1BM9A 3C18A 2IXSA 1B9MA 3OYBA 3S2WA 4G12A 2GZWA 3H9GA 2L2OA 2OU2A 2M2EA 1Z9CA 3AL0B 1OISA 2W1OA 1QBJA 3CCJI 1TWCJ 1W5TA 2A3SA 4M74A 3CTAA 5F1RA 2LDUA 2V1XA 3OOUA 4A0YA 1YYVA 2E71A 2O5RA 4LLNA 3D5RC 2YSRA 5K7FA 2JMWA 4BY1J 1T8IA 3HSRA 4IQ4A 4A69C 3WTSC 2BY2A 2JT1A 1FY7A 1YRNB 1IW7F 3CD6I 4X6AJ 2JUGA 2VC1A 1RETA 2VKVA 4NC6A 5LHHA 1HLVA 3KYCB 1W36D 3J80K 4RA2A 2ISYA 4AIDA 4MEXF 1KYWA 3CC7I 4L5IA 1I50J 4J01A 1NK3P 1VQNI 1B72A 2K9NA 1RUNA 5CPRB 2QQ9A 4XQFA 1MMGA 1X1CA 3K4NA 4E6KG 2LG4A 1SVLA 3BOQA 5DDGA 3BQYA 1LPQA 3I3LA 1FBUA 1SMYF 2UZKA 4XLHA 3MN2A 1T08B 4GDFA 2VQGA 3MKLA 3V42A 1FOKA 4MHGA 1SEUA 3OYLA 2EV5A 3FISA 5E1WA 2F4MB 2IGOA 1Z0XA 2V1NA 2VJ4A 2EFPA 4PJJA 4BQNA 1FP2A 4UB8C 4WX9A 2VI6A 4CHUA 5KAIC 3TKYA 2X1CA 1K83J 5D6EA 4IOCF 2E2IJ 1Z67A 4PDKA 2YX7A 4CDGA 2HKOA 6PAXA 5FKNA 5JI6A 4PK4A 2YUSA 3BG6A 3Q0WA 4E7LA 4KN7X 2OAZA 2Y48A 3ML6A 5HS8A 1BR4A 2M1BA 3LSKA 1RR7A 2BHZA 1ZRFA 2GQQA 1R22A 3HEFA 1WWXA 4N9HA 2PI0A 4PJMA 2D5VA 4KT5C 4AIKA 3LQRA 3KETA 1KQ9A 2ZCWA 1IRXA 2GXGA 5ILSA 2A61A 2DODA 1W5CC 1UAAA 1IN5A 3FHZA 2M34A 4C2UA 5B66C 4RB2C 1WGXA 3FXKA 2EJRA 1JKPC 5IPAA 4G7HF 1X2MA 1IN8A 4IZZA 5FLXZ 1XMXA 3ZGKA 3G1OA 1USTA 3CQZJ 2A6HF 3A0HC 3OL3A 1JJ6C 1N78A 3CDLA 3I55I 1U2WA 3IP4B 5LEJA 1Y39A 2RVCA 1F43A 2LBFA 3HUGB 2IA2A 2K9LA 3CCSI 2M8EA 4L9NA 1SD4A 2CH0A 3EETA 5IOYA 4EV0A 4XLEA 3S2HJ 1RZ4A 4GYIA 2FOWA 5E3NA 4I09A 3RQ4A 4M71A 5D6FA 3RCOA 2FA5A 4A3JJ 5ERIA 2K02A 1FIAA 1FYMA 4ABZA 3VSKA 3OOPA 3QU6A 2H1KA 3A03A 4JX4A 3SZTA 3GTGJ 3FHNA 4XNFA 1ZREA 4LMYA 1F9NA 2VUMJ 3CESA 3E1SA 2A5YB 2E5NA 3RJPA 3EUAA 4IF4A 5DYMA 2XGDA 3BT9A 4NUBA 4F93B 3K6GA 5IYCJ 4C9YA 3TO6A 3RKXA 2KKOA 2IA0A 2KRCA 3LAPA 3BZKA 1DU0A 4WXCA 1LFBA 3I5UA 4KUMA 1JUSA 2DOAA 2VOPA 2NXNB 2ELKA 2I10A 2HU9A 5J47A 5M3MJ 5HDKA 1FEXA 2ID3A 2JVGA 2V6CA 3I71A 2L5QA 4LB6B 4M9ZA 1FX7A 5CQGA 2V7FA 3BTLA 1HW2A 3PUFA 4XLAA 1RC9A 2ADUA 2CU7A 5TRDA 4DZJA 2COBA 2KRFA 5EYRA 2A6TA 1MH3A 4O5VA 1BI1A 4E70A 3IL2A 3CLQA 5J1RA 4RAGA 3GFJA 2JZYA 3S93A 2R7DA 4PFPA 1U5TC 2Z99A 4QIWN 3FBNB 5HLHA 1KONA 3GTMJ 1YJWI 2QCOA 4F55A 2O7OA 3DV8A 1P2FA 1VF9A 5FLXK 2P81A 2LREA 2CW8A 4EVIA 1K4SA 2CGPA 2NOJB 2L54A 4V2FA 2VONA 2JWTA 2ZFWA 4OAZA 3DTIA 1MW7A 2PBIA 5JHFA 3J81Z 2MD5A 1J5YA 2IA1A 2XRLA 3RKYA 4A3KJ 3ZN0A 3C3WA 3F6VA 4Y7NJ 1J75A 2XAGA 2NVUB 4A3GJ 2ECCA 4Y13A 3WGHA 3HOUJ 1QPIA 4JX5A 4BEHA 4IXAA 1I27A 3JRAA 3HPGA 5E3MA 3PFYA 5FKMA 2PEXA 2KHMA 4XKWA 4B43A 5ICEA 1LVKA 1OCPA 3B73A 1R23A 3E6DA 2R7UA 2XAQA 3R0JA 4ZZDA 5K1YA 3QAHA 5K5RA 1IG7A 1OJLA 4BDZA 1D5VA 3T8TA 3DBHB 4CZZA 3TOAA 5GAHJ 2MFZA 4BL0B 1IXSB 1ERDA 1QRYA 2R4GA 3DCFA 3EUHA 1H9TA 2HR3A 5CVVA 1PP7U 4KIBA 1D1CA 2DXIA 3HGGA 3CJRB 2ZSHB 4BH9A 3K7AJ 5E79C 2VKHA 2DPDA 2QSFX 1GVJA 1MBEA 2CSOA 5AONA 1Q1HA 4AIHA 4LGWA 4NB5A 1N75A 3TL4X 2J5OA 1WHUA 3SQNA 1W5SA 3HOSA 1IF1A 4BQOA 2R93J 2LSOA 3LSIA 1RUOA 3WE2A 1BJAA 1FJLA 2HOEA 3W6VA 1DGRM 4HNUA 4MNUA 3H36A 3R0AA 1V4RA 4LFUA 1ETVA 1W7PA 4B8XA 1GV5A 3E3VA 1U5TA 2CJJA 4RAYA 3F8FA 3OYDA 1VZ0A 1KA8A 1R58A 2EA2A 3J81K 2ID6A 4EEFG 2EINH 2W85A 4XLNF 1LB2A 2LYCA 3KX2A 2DU9A 4BHPA 2CW7A 5IT3A 2Y0MA 3B02A 5BPDA 4EATA 2ELJA 1Y1VJ 5HDGA 1K79A 2DMNA 1LKXA 2DA1A 2F6CA 1OMIA 3GXOA 1ZTRA 2UWMA 2KLOA 3ULQB 2WV1A 1NHAA 3UKGA 3ISPA 1MMNA 2NNYA 2EH3A 3G3ZA 2X51A 2DPUA 3SDBA 2F4IA 2WC2A 3FM5A 1SVOA 1KZHA 3R60A 3CCMI 1CQTA 1OQYA 4AYBA 3D5LA 1Z3XA 2DLLA 1O3TA 2K27A 3LFKA 4BE0A 2CV1A 1R1UA 1ULYA 3K4MA 3LSMA 5CVJA 1S7AA 3EQLF 2BV6A 1XSDA 2IS2A 4U0YA 3QWLA 2X6WA 3I9V2 3MAJA 1MH4A 3DF8A 4GRIA 5DCFA 4ZC3A 1ORKA 2R7ZJ 2V1DA 1YQAA 3RPQA 4Z6YA 5BS6A 1H0MA 2Y75A 4ZDOA 2EQRA 3FDYA 2H8WA 4A3CJ 2HXIA 2XAUA 5L3BA 1TQMA 2DMUA 3W2WA 5EGOA 5ED4A 1GV2A 4I2OA 1XGOA 2ZC2A 1IC8A 1I1GA 1XTAA 2L9VA 2FOKA 3S1NJ 2V9PA 3DEEA 4FE4A 2EILH 4CH7A 5F1JA 5ILVA 4WWCA 1XS9A 4JYKA 4U0VA 1ZYRF 2CW0F 4C2MJ 3CDIA 4XRFA 3T0YA 2GIZA 2H94A 3EPZA 2OF7A 4PJ0C 1IDYA 2ZMEC 1R5GA 1AKHA 2VKEA 4FE7A 2V9KA 2XPVA 2JVHA 5DD4A 4HZFA 2IGKA 4AUXA 2M45A 3F0CA 4BJ5C 2IVMA 1ZGWA 3IRQA 3HRUA 1QNTA 4BXXJ 4HRIA 2LY1A 5FROA 1X4PA 3KCCA 2DOEA 2OZ6A 4ITVA 4YELA 3O2PE 2Q0OA 3MKWB 2HDDA
chains in the Genus database with same CATH topology
4P5OA 4G7OF 2H6BA 5D5VB 1HSJA 4PCQA 2XKOA 4YG2F 3RPUA 3F6OA 5EEHA 3TDZC 4M6YA 5CVRA 3MEXA 2WTEA 2ZNZA 4BNCA 3KP7A 2DQLA 3E6MA 1MZBA 5HLGA 2IP2A 4N0BA 2G7HA 1T98A 4KNYA 2MC3A 1XD7A 2O3FA 1G3SA 1Y0UA 3PQJA 4RAZA 2QENA 3DQVC 3VEPA 1XGNA 1EH8A 1QZZA 1I1SA 1JE8A 4A0ZA 3VOEA 2FE3A 3QPHA 4XBFA 3BJOA 3TDUC 1FC3A 2OA4A 2QUFA 4GCVA 4TV7A 2XIGA 1CF7A 4LLGF 2NNNA 1EV7A 1XSVA 3V7CA 1T6SA 4Q4ZF 1JGSA 2ZMEA 3HTUA 2MH9A 3FWEA 2PMHA 3HRTA 2MBFA 3TO7A 2FNPA 2P7CB 1ZG3A 2Z9OA 4YFNF 3BWGA 3F23A 2M30A 3GZ6A 3C7JA 3ERED 1MD0A 4BYYA 1OKRA 2FEZA 4HAMA 4OINF 1BC7C 1T0FA 1TNSA 4KMUX 3ZMDA 3K0LA 3WODF 1E17A 1YW7A 3I0TA 3LA2A 1QPMA 4ENKA 1PP8F 3ZMVA 3GW2A 1USSA 4YIFA 4IPAA 4I98B 4GYGA 3RYPA 2AS5F 4MGRA 2R3SA 1P92A 2RGVA 3BJ6A 4UV8A 4A2UA 2Z33A 4P96A 1KU7A 1G4DA 5CVIA 3CUQA 5DUKA 2VBWA 2AXLA 2P5VA 1ON1A 2VOOA 3IHUA 2NS0A 1REPC 2WV0A 3D0SA 3LQQA 5EEGA 1UB9A 1QGPA 3I4PA 1FZPB 1ODDA 5ICCA 1L0OC 1B4AA 3LA7A 2ZO4A 2F2EA 3Q5FA 3QP6A 4WCGA 3LAJA 2CYYA 2VE8A 5FGMA 2HEOA 4MTDA 5D5XB 4IVNA 3R61A 3ABTA 5D4SA 4WK8F 1XB4A 1IRGA 1KU2A 1IZ1A 4KICA 4MEYF 2HGCA 3REOA 3M8FA 3JW4A 5L3EA 2X4HA 4IRGA 4NHJA 3GFMA 4IHTA 2CWEA 2ELHA 2YPRA 1P4WA 2RNJA 3FX3A 4ASNA 3WE3A 5L3CA 4OIOF 3KP5A 1F4KA 2RN7A 5H6RA 1FNNA 2GIVA 4L9TA 2O03A 4ENMA 3VFZA 3M1EA 5FB2A 1MJ9A 2JPCA 3FM3A 2BGCA 3KZYA 4BHCA 5FO5A 4EJOA 1YS7A 1WQ2A 5JVTA 4OIQF 1XCVA 3H92A 1DPRA 1STZA 3L9FA 2ETHA 2D2WA 5L3DA 3EDPA 3V7RA 1Z05A 2ACJA 2O8XA 3F72A 4I01A 2UXXA 4P9UA 1BIBA 1SD7A 1TNTA 3HSFA 2KIFA 4EJUA 1EH7A 1IN7A 4Y17A 1UHMA 3ROUA 2O6GE 2TDXA 4LLLA 3O6BB 2EV6A 4ESFA 1K78A 2LF8A 3ZMUA 4LB5A 1P6RA 4HX8A 3RTRA 2QZ8A 2M5WA 2HS5A 1KYZA 4I0BA 4KMFA 1YFHA 3GYHX 2IW5A 2VT2A 3TGNA 3CDHA 3FXUA 1ZG5A 3HHHA 1YS6A 4HQMA 2O0YA 3DXJF 5BOXA 2FNAA 4D0PA 2QYOA 2P4WA 1R7JA 1HW5A 1WI9A 1BOAA 2HKXA 4P9FA 2PQ8A 3HIFA 2XVCA 1I6XA 4UXNA 2F5EA 3V8KA 3L7WA 2D1HA 1FBQA 2FMLA 4RGXA 1BI3A 3N4MA 2PJPA 2DO7A 2EB7A 2COMA 3DP7A 1YIOA 4HF2A 1FLIA 1R1TA 1W7PB 1U5TB 5KVRA 3CO7C 3QU3A 2EFWA 2EV0A 2K4JA 2A68F 3IKVA 1O7LA 3WU1B 4M6XA 5ICGA 5JR3A 1JHHA 5JFRA 4KFCA 2RV8A 2MH2A 1Z91A 3ABUA 2F5CA 5LLQA 1DPUA 3KEOA 2ZNYA 4A5MA 1KU3A 3LA3A 5LHIA 1TW2A 1IN4A 2HTJA 5FFZA 4Q5SF 3P9IA 2HWVA 3BPXA 2YR2A 1BI2A 5J6XA 3F22A 3K1MA 1D8KA 2FQ3A 4G94A 4DNCA 1ZH5A 4CXFA 2LNBA 1MJAA 5A2QK 1BN5A 5CYVA 4EGZA 3JTGA 3P7NA 2Z3YA 4IJAA 1J0RA 2F5DA 3E6BA 2HDCA 1B9NA 3U1DA 1T2KA 4YIIA 1B6AA 1BI0A 2DTRA 4ESBA 2P6SA 4EM2A 1W4MA 1ZARA 1Z6TA 2XKPA 1IXRC 1W7PD 3BY6A 2DFIA 3F8BA 4LG0A 1FPQA 4HV6A 1YW8A 5FD5A 3KP4A 3T8RA 3BROA 1YTYA 2C6YA 3L2CA 1V3FA 4JQFA 2NRAC 2ZJ2A 1ZG1A 2W84A 2HYFA 1FT9A 4IHSA 1MKMA 4N9IA 4Q47A 2XHKA 2E7XA 4HW0A 2GWRA 2WWYA 3I64A 2JPBA 2VBXA 2E1CA 2V1UA 2HZTA 4M72A 4EMSA 3W6JB 2VC0A 2Q8KA 4B09A 2QBYA 4M9SA 1OYYA 4KIFA 2DAOA 4A6EA 5DEQA 3ZMTA 1LEBA 1SAXA 1SD5A 4PZJA 2EK5A 2P6TA 3FMQA 3WTTC 4ZYGA 2DK8A 2ZMEB 4UV9A 5D5UB 4U7DA 1P4AA 1GXPA 3H3ZA 1J59A 3F21A 1DP7P 2KIUA 1FYLA 4WF2A 3QPTA 5DV5A 2QQBA 4IRHA 3WGGA 1G3TA 2MLKA 1TLHB 4XLPF 2E7WA 1XSXA 1XGMA 1QZYA 2W25A 3K9TA 1XCBA 3IWFA 4EQQA 1KGSA 1R5HA 2M87A 3BZ6A 1DDNA 1TQPA 3NQOA 4Q48A 5FD6A 2FMYA 1BIAA 1OPCA 4HOBA 4HLXA 5F64A 1IUYA 2XRNA 3KLNA 2OZUA 3COAC 4RB3C 4Z2YA 3GO5A 2QVOA 2XV4S 4RS8A 4HYEA 4G9YA 5F6FA 3K1NA 4MQ9F 2STWA 5H6QA 2FBKA 1F5TA 2D1VA 3IC7A 3CUQC 2YU3A 2VE9A 2PG4A 2JTVA 3JTHA 1ZLKA 4ZYEA 5D4RA 4HX4A 2DQRA 3BJAA 4HBLA 4AD9A 3RI4A 4HF1A 1HXDA 1RNLA 4OMZA 1FWZA 4AVPA 1SMTA 1G3YA 3GZ5A 5CLSA 1H9GA 4RGRA 5L3GA 1ZAOA 3FXRA 2QM3A 1KQ0A 1LVAA 5HOOA 2CO5A 4LK0F 3QRFF 2XAFA 3O3KA 2L3DA 3LWFA 3DEUA 5KK1A 4QWQA 5LGTA 1GXQA 2EA4A 3WGIA 4YFXF 2IJLA 4I7HA 5LGUA 5HS9A 2P8TA 3RKWA 1S6LA 3OV8A 5H20A 5LEKA 3HHGA 3JAMZ 2FSWA 2EFQA 3V7SA 4IRIA 2OQGA 3MQ0A 3RYRA 1XDUA 5E8IA 2Q2EA 2D45A 2V79A 4HF0A 3WTXC 4U7BA 3DKWA 2ZXJA 5DCMA 4NQWA 3BP8A 3GWZA 1U8RA 4OOIA 3L09A 5IT9Z 4HX7A 2ISZA 3V8LA 3JSPA 2Z5UA 3I59A 2DBBA 2A07F 4BHBA 5LHGA 3CJNA 1K78B 4JBAA 3P9CA 4U0WA 2HYGD 2V9VA 5DUIA 3Q9VA 4EM0B 3MZYA 1HKSA 2G7UA 1OYIA 4KA4A 1XGSA 3KP6A 2XGXA 3JAMK 2YX4A 1PUEE 2XAJA 4JK1X 2HQNA 3GF2A 5FFXA 4H0EA 2DI3A 1RIOH 4G7ZF 1DUXC 4EJTA 1D3YA 3F8NA 3DPTA 5L3FA 1S8NA 2XROA 4MTEA 3CUOA 2L4AA 2OD5A 3H3UA 4XSXF 2H09A 5IT9K 5K5QA 3KP3A 3CLOA 1L3LA 2H27A 5J8CA 2LKPA 3WU0A 3GVAA 2RKHA 5E18F 4AWXB 1KQ8A 3FMSA 2BEOA 3BPVA 1AOYA 1CGPA 1G6NA 1Z7UA 5E17F 2HQRA 2GA1A 3NRVA 4A6DA 4CO8A 3I53A 2J5PA 4S05A 2FXAA 3J7AO 1R36A 1AWCA 4A12A 1I5ZA 1MDMA 1O3RA 1HKTA 5E8GA 3K2ZA 4CYDA 2JSCA 4G8XA 1HKQA 2R7FA 5HLIA 1IN6A 5BQTA 3E6CC 4RGUA 1LNWA 2GA2A 1ONVA 4KIGA 1IAWA 1B59A 2KJCA 4ZH4F 1B1BA 3HYIA 2E1NA 2L4MA 5E1ZB 4FX4A 3E5UA 4ZZLA 3TOBA 3MFKA 5J8FA 1D8JA 3SHFA 3RDIA 5LBQA 5A2QZ 2LF7A 3ZPLA 3ELKA 1J7KA 1GHCA 3DFGA 1SFUA 1G3WA 2EFOA 4KDPA 5TJJA 3M7GA 5D5WB 2XAHA 1X3UA 1WKMA 3P9KA 4RB0A 4WXDA 2QWWA 1JXSA 1F1ZA 1JHFA 1QO0D 1FP1D 2KJBA 1SFEA 4DQ2A 4LG0B 2O61A 1LJ9A 1T39A 2IT0A 4LJZF 4F7ZA 4R79A 3K69A 3QOPA 3HTSB 4Y15A 1MJBA 4HLYA 1U3EM 2HFHA 1E2XA 4ETSA 2NYXA 1YO5C 2A6EF 5CVUA 4OIRF 2P7VB 1T38A 1J9IA 5D8KB 3KZZA 2FRHA 1LDKB 2STTA 4BQAA 1IXCA 2GAUA 1LDDA 4FX0A 3GFLA 5E20A 4EGYA 2B0LA 2P5KA 4L9JA 4YFKF 3F3XA 5ICFA 2QBYB 1YG2A 4ENNA 2MLGA 3HRSA 1HQCA 1EH6A 3MWMA 4ENJA 3TQNA 3EYIA 3HUGA 3KEQA 1Z1DA 3PQKA 3BDDA 3NEUA 2RQPA 2ESHA 3E97A 1C0WA 3C1DA 5D8LB 3V4GA 1BBYA 4L0ZB 2XASA 2VBYA 4O6JA 4A5NA 1J2XA 1A04A 2JRTA 2IPQX 4EJVA 5LRRA 1S29A 4UHTA 1ON2A 1K6OA 4UNOA 3WTVC 4MQVA 2VN2A 4CGZA 4RB1A 1ZRCA 2VXZA 1P4XA 2EWNA 2VT3A 3ZP5A 4K2EA 5E1XA 4HDUA 4PGGA 3HSEA 2MA3A 4XSZF 1UCRA 3ECOA 4PGHA 1BC8C 1Z6RA 1TBXA 1ZN2A 3WTWC 3KFWX 1HBXG 1S3JA 1WSUA 1TTYA 5BPIA 2A69F 5BMZA 1FYKA 3KLOA 3I54A 2PFBA 3IKTA 2IRFG 4HQEA 5AIQA 4I02A 1CF7B 1YW9A 1LEAA 4OMYA 4LD5A 3GLXA 1R1VA 4GGGA 4R1HA 3GUDA 1O7FA 1U78A 2XUBA 2W24A 1U6GA 3R6SA 1QQIA 1S7OA 2BYVE 4KN4X 5LGNA 3T5XA 2PN6A 3ZMZA 1ZGJA 1MGTA 3IWZA 3K1PA 3N97A 4L5JA 4ESJA 4HV5A 3SZPA 3WTZA 2BE5F 5LRSA 1O57A 4OIPF 3KP2A 4CICA 3M8EA 5CJ9A 3HRMA 2W57A 4OU0A 4UVCA 2RC4A 4L18B 1SD6A 1VTNC 2VBZA 2F5FA 4QLCU 4M73A 2CFXA 1IRFA 5HS7A 3V8JA 1YLFA 1ZHFA 4ZYHA 3GX4X 2BBYA 2CG4A 2K7LA 3WG9A 2K4BA 3SXYA 1LQ1A 2PLYA 5DCMB 1FSHA 3I58A 1K7AA 2EFNA 4AIJA 3CUQB 4L9VA 1TW3A 2K86A 2L02A 2OQRA 3ZQ7A 3FZVA 2QQAA 3I59B 4UUVA 3KE2A 4I0AA 5K5OA 4S04A 3GFIA 2NAZA 1ZLJA 3Q9SA 4O3MA 4U88A 3AAFA 1XN7A 2FBHA 3U9GA 3R4KA 2X0LA 2RDPA 3CO6C 3JSOA 1R00A 2ZBKA 2QLZA 2ZKZA 2VODA 3M9AA 2GXBA 3E5XA 1KU9A 3W6KB 4R8HA 3DPLC 3TO9A 4GO1A 3EYYA 3L00A 3U2RA 3HOTA 1UFMA 3WTUC 3F8MA 5HDNA 2PMUA 1ZGAA 2FBIA 1O3SA 3ZMSA 4P55A 4FHTA 5DD8A 4KYWA 4LK1F 2HTSA 3VB2A 1PDNC 4G6DA 2DW4A 3FMRA 1FSEA 4UVBA 2G9WA 5JHUA 2ESNA 4FT8A 1FBSA 1OR7A 2L01A 1XMAA 5AIPA 2UXNA 4ZYDA 3ECHA 1UHWA 3E5QA 3IRRA 3FXQA 3MZHA 3F8CA 5ILUA 1HW1A 2FU4A 4BAYA 3FF5A 1XDSA 2H6CA 4EJWA 4WXHA 4RGSA 1TQIA 3VODA 5HVQC 3J80Z 4EM1A 4L0YB 1ZRDA 4G6QA 4ON0A 1XMKA 4UVAA 4HA8A 1OYWA 2KIMA 1HSTA 3MCZA 1O3QA 1MDMB 3WTYC 4HDVA 3QP5A 3T1BA 4BXUA 3PFIA 2OBPA 3GEZA 4A0XA 2DK5A 3G73A 2P5LC 2FF4A 4GXOA 1WRJA 3ZN1A 3LSTA 3SFZA 1RI7A 2DT5A 4M9XA 2CQKA 1SFXA 3RIRA 1LDJA 1BM9A 3C18A 1B9MA 3S2WA 2GZWA 2OU2A 1Z9CA 1QBJA 1W5TA 2A3SA 4M74A 3CTAA 5F1RA 2LDUA 2V1XA 4A0YA 1YYVA 4LLNA 2YSRA 3HSRA 3WTSC 2JT1A 1FY7A 1IW7F 2VC1A 5LHHA 3J80K 2ISYA 4MEXF 1KYWA 4L5IA 1RUNA 2QQ9A 3BOQA 5DDGA 1FBUA 1SMYF 2UZKA 1FOKA 4MHGA 2EV5A 5E1WA 2EFPA 1FP2A 4WX9A 4CHUA 3TKYA 5D6EA 4PDKA 2YX7A 4CDGA 2HKOA 6PAXA 5JI6A 4KN7X 2OAZA 2Y48A 3ML6A 5HS8A 2M1BA 1ZRFA 2GQQA 1R22A 4N9HA 1WWXA 2PI0A 4KT5C 4AIKA 3LQRA 3KETA 1KQ9A 2ZCWA 2GXGA 5ILSA 2A61A 1IN5A 3FHZA 4RB2C 2EJRA 4G7HF 1IN8A 5FLXZ 1USTA 2A6HF 1U2WA 5LEJA 2RVCA 2IA2A 2M8EA 4L9NA 1SD4A 3EETA 4EV0A 1RZ4A 4GYIA 4I09A 4M71A 5D6FA 2FA5A 5ERIA 2K02A 1FYMA 3OOPA 3QU6A 3SZTA 1ZREA 4LMYA 1F9NA 2A5YB 3RJPA 4IF4A 5DYMA 3TO6A 3RKXA 2KKOA 2IA0A 3LAPA 4WXCA 3I5UA 4KUMA 2VOPA 5HDKA 2V6CA 3I71A 4LB6B 4M9ZA 1FX7A 1HW2A 2ADUA 5TRDA 2KRFA 4O5VA 3IL2A 1BI1A 4E70A 3GFJA 2JZYA 2R7DA 1U5TC 2Z99A 5HLHA 3DV8A 1P2FA 5FLXK 4EVIA 2CGPA 2L54A 2VONA 2ZFWA 2PBIA 3J81Z 2MD5A 1J5YA 2IA1A 3RKYA 3ZN0A 3C3WA 3F6VA 1J75A 2XAGA 4Y13A 3WGHA 4IXAA 1I27A 2PEXA 5ICEA 3B73A 1R23A 3E6DA 2XAQA 3R0JA 4ZZDA 5K1YA 3QAHA 5K5RA 1D5VA 3T8TA 4CZZA 3TOAA 1IXSB 3EUHA 1H9TA 2HR3A 5CVVA 1PP7U 4KIBA 4BH9A 2DPDA 1GVJA 2CSOA 5AONA 1Q1HA 4AIHA 4LGWA 4NB5A 2J5OA 3SQNA 1IF1A 1W5SA 3HOSA 2LSOA 1RUOA 3WE2A 1BJAA 2HOEA 4MNUA 3R0AA 1V4RA 4LFUA 1W7PA 4B8XA 3E3VA 1U5TA 4RAYA 3F8FA 1KA8A 1R58A 2EA2A 3J81K 4XLNF 2W85A 1LB2A 2DU9A 4BHPA 5IT3A 2Y0MA 3B02A 5BPDA 5HDGA 1K79A 1OMIA 3GXOA 2UWMA 3ULQB 1NHAA 3ISPA 2NNYA 3G3ZA 2DPUA 3FM5A 2WC2A 3R60A 3D5LA 2DLLA 1O3TA 2K27A 3LFKA 1R1UA 1ULYA 5CVJA 1S7AA 3EQLF 2BV6A 1XSDA 4U0YA 3MAJA 3DF8A 5DCFA 2V1DA 1YQAA 3RPQA 5BS6A 1H0MA 2Y75A 5L3BA 1TQMA 5ED4A 4I2OA 1XGOA 1I1GA 2FOKA 4WWCA 5ILVA 4U0VA 1ZYRF 2CW0F 4XRFA 3T0YA 2H94A 1R5GA 5DD4A 4HZFA 2M45A 2IVMA 3IRQA 3HRUA 1QNTA 3KCCA 2OZ6A 3O2PE 2Q0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O A;  4G7O F;  2H6B A;  5D5V B;  1HSJ A;  4PCQ A;  2XKO A;  4YG2 F;  3RPU A;  3F6O A;  5EEH A;  3TDZ C;  4M6Y A;  5CVR A;  3MEX A;  2WTE A;  2ZNZ A;  4BNC A;  3KP7 A;  2DQL A;  3E6M A;  1MZB A;  5HLG A;  2IP2 A;  4N0B A;  2G7H A;  1T98 A;  4KNY A;  2MC3 A;  1XD7 A;  2O3F A;  1G3S A;  1Y0U A;  3PQJ A;  4RAZ A;  2QEN A;  3DQV C;  3VEP A;  1XGN A;  1EH8 A;  1QZZ A;  1I1S A;  1JE8 A;  4A0Z A;  3VOE A;  2FE3 A;  3QPH A;  4XBF A;  3BJO A;  3TDU C;  1FC3 A;  2OA4 A;  2QUF A;  4GCV A;  4TV7 A;  2XIG A;  1CF7 A;  4LLG F;  2NNN A;  1EV7 A;  1XSV A;  3V7C A;  1T6S A;  4Q4Z F;  1JGS A;  2ZME A;  3HTU A;  2MH9 A;  3FWE A;  2PMH A;  3HRT A;  2MBF A;  3TO7 A;  2FNP A;  2P7C B;  1ZG3 A;  2Z9O A;  4YFN F;  3BWG A;  3F23 A;  2M30 A;  3GZ6 A;  3C7J A;  3ERE D;  1MD0 A;  4BYY A;  1OKR A;  2FEZ A;  4HAM A;  4OIN F;  1BC7 C;  1T0F A;  1TNS A;  4KMU X;  3ZMD A;  3K0L A;  3WOD F;  1E17 A;  1YW7 A;  3I0T A;  3LA2 A;  1QPM A;  4ENK A;  1PP8 F;  3ZMV A;  3GW2 A;  1USS A;  4YIF A;  4IPA A;  4I98 B;  4GYG A;  3RYP A;  2AS5 F;  4MGR A;  2R3S A;  1P92 A;  2RGV A;  3BJ6 A;  4UV8 A;  4A2U A;  2Z33 A;  4P96 A;  1KU7 A;  1G4D A;  5CVI A;  3CUQ A;  5DUK A;  2VBW A;  2AXL A;  2P5V A;  1ON1 A;  2VOO A;  3IHU A;  2NS0 A;  1REP C;  2WV0 A;  3D0S A;  3LQQ A;  5EEG A;  1UB9 A;  1QGP A;  3I4P A;  1FZP B;  1ODD A;  5ICC A;  1L0O C;  1B4A A;  3LA7 A;  2ZO4 A;  2F2E A;  3Q5F A;  3QP6 A;  4WCG A;  3LAJ A;  2CYY A;  2VE8 A;  5FGM A;  2HEO A;  4MTD A;  5D5X B;  4IVN A;  3R61 A;  3ABT A;  5D4S A;  4WK8 F;  1XB4 A;  1IRG A;  1KU2 A;  1IZ1 A;  4KIC A;  4MEY F;  2HGC A;  3REO A;  3M8F A;  3JW4 A;  5L3E A;  2X4H A;  4IRG A;  4NHJ A;  3GFM A;  4IHT A;  2CWE A;  2ELH A;  2YPR A;  1P4W A;  2RNJ A;  3FX3 A;  4ASN A;  3WE3 A;  5L3C A;  4OIO F;  3KP5 A;  1F4K A;  2RN7 A;  5H6R A;  1FNN A;  2GIV A;  4L9T A;  2O03 A;  4ENM A;  3VFZ A;  3M1E A;  5FB2 A;  1MJ9 A;  2JPC A;  3FM3 A;  2BGC A;  3KZY A;  4BHC A;  5FO5 A;  4EJO A;  1YS7 A;  1WQ2 A;  5JVT A;  4OIQ F;  1XCV A;  3H92 A;  1DPR A;  1STZ A;  3L9F A;  2ETH A;  2D2W A;  5L3D A;  3EDP A;  3V7R A;  1Z05 A;  2ACJ A;  2O8X A;  3F72 A;  4I01 A;  2UXX A;  4P9U A;  1BIB A;  1SD7 A;  1TNT A;  3HSF A;  2KIF A;  4EJU A;  1EH7 A;  1IN7 A;  4Y17 A;  1UHM A;  3ROU A;  2O6G E;  2TDX A;  4LLL A;  3O6B B;  2EV6 A;  4ESF A;  1K78 A;  2LF8 A;  3ZMU A;  4LB5 A;  1P6R A;  4HX8 A;  3RTR A;  2QZ8 A;  2M5W A;  2HS5 A;  1KYZ A;  4I0B A;  4KMF A;  1YFH A;  3GYH X;  2IW5 A;  2VT2 A;  3TGN A;  3CDH A;  3FXU A;  1ZG5 A;  3HHH A;  1YS6 A;  4HQM A;  2O0Y A;  3DXJ F;  5BOX A;  2FNA A;  4D0P A;  2QYO A;  2P4W A;  1R7J A;  1HW5 A;  1WI9 A;  1BOA A;  2HKX A;  4P9F A;  2PQ8 A;  3HIF A;  2XVC A;  1I6X A;  4UXN A;  2F5E A;  3V8K A;  3L7W A;  2D1H A;  1FBQ A;  2FML A;  4RGX A;  1BI3 A;  3N4M A;  2PJP A;  2DO7 A;  2EB7 A;  2COM A;  3DP7 A;  1YIO A;  4HF2 A;  1FLI A;  1R1T A;  1W7P B;  1U5T B;  5KVR A;  3CO7 C;  3QU3 A;  2EFW A;  2EV0 A;  2K4J A;  2A68 F;  3IKV A;  1O7L A;  3WU1 B;  4M6X A;  5ICG A;  5JR3 A;  1JHH A;  5JFR A;  4KFC A;  2RV8 A;  2MH2 A;  1Z91 A;  3ABU A;  2F5C A;  5LLQ A;  1DPU A;  3KEO A;  2ZNY A;  4A5M A;  1KU3 A;  3LA3 A;  5LHI A;  1TW2 A;  1IN4 A;  2HTJ A;  5FFZ A;  4Q5S F;  3P9I A;  2HWV A;  3BPX A;  2YR2 A;  1BI2 A;  5J6X A;  3F22 A;  3K1M A;  1D8K A;  2FQ3 A;  4G94 A;  4DNC A;  1ZH5 A;  4CXF A;  2LNB A;  1MJA A;  5A2Q K;  1BN5 A;  5CYV A;  4EGZ A;  3JTG A;  3P7N A;  2Z3Y A;  4IJA A;  1J0R A;  2F5D A;  3E6B A;  2HDC A;  1B9N A;  3U1D A;  1T2K A;  4YII A;  1B6A A;  1BI0 A;  2DTR A;  4ESB A;  2P6S A;  4EM2 A;  1W4M A;  1ZAR A;  1Z6T A;  2XKP A;  1IXR C;  1W7P D;  3BY6 A;  2DFI A;  3F8B A;  4LG0 A;  1FPQ A;  4HV6 A;  1YW8 A;  5FD5 A;  3KP4 A;  3T8R A;  3BRO A;  1YTY A;  2C6Y A;  3L2C A;  1V3F A;  4JQF A;  2NRA C;  2ZJ2 A;  1ZG1 A;  2W84 A;  2HYF A;  1FT9 A;  4IHS A;  1MKM A;  4N9I A;  4Q47 A;  2XHK A;  2E7X A;  4HW0 A;  2GWR A;  2WWY A;  3I64 A;  2JPB A;  2VBX A;  2E1C A;  2V1U A;  2HZT A;  4M72 A;  4EMS A;  3W6J B;  2VC0 A;  2Q8K A;  4B09 A;  2QBY A;  4M9S A;  1OYY A;  4KIF A;  2DAO A;  4A6E A;  5DEQ A;  3ZMT A;  1LEB A;  1SAX A;  1SD5 A;  4PZJ A;  2EK5 A;  2P6T A;  3FMQ A;  3WTT C;  4ZYG A;  2DK8 A;  2ZME B;  4UV9 A;  5D5U B;  4U7D A;  1P4A A;  1GXP A;  3H3Z A;  1J59 A;  3F21 A;  1DP7 P;  2KIU A;  1FYL A;  4WF2 A;  3QPT A;  5DV5 A;  2QQB A;  4IRH A;  3WGG A;  1G3T A;  2MLK A;  1TLH B;  4XLP F;  2E7W A;  1XSX A;  1XGM A;  1QZY A;  2W25 A;  3K9T A;  1XCB A;  3IWF A;  4EQQ A;  1KGS A;  1R5H A;  2M87 A;  3BZ6 A;  1DDN A;  1TQP A;  3NQO A;  4Q48 A;  5FD6 A;  2FMY A;  1BIA A;  1OPC A;  4HOB A;  4HLX A;  5F64 A;  1IUY A;  2XRN A;  3KLN A;  2OZU A;  3COA C;  4RB3 C;  4Z2Y A;  3GO5 A;  2QVO A;  2XV4 S;  4RS8 A;  4HYE A;  4G9Y A;  5F6F A;  3K1N A;  4MQ9 F;  2STW A;  5H6Q A;  2FBK A;  1F5T A;  2D1V A;  3IC7 A;  3CUQ C;  2YU3 A;  2VE9 A;  2PG4 A;  2JTV A;  3JTH A;  1ZLK A;  4ZYE A;  5D4R A;  4HX4 A;  2DQR A;  3BJA A;  4HBL A;  4AD9 A;  3RI4 A;  4HF1 A;  1HXD A;  1RNL A;  4OMZ A;  1FWZ A;  4AVP A;  1SMT A;  1G3Y A;  3GZ5 A;  5CLS A;  1H9G A;  4RGR A;  5L3G A;  1ZAO A;  3FXR A;  2QM3 A;  1KQ0 A;  1LVA A;  5HOO A;  2CO5 A;  4LK0 F;  3QRF F;  2XAF A;  3O3K A;  2L3D A;  3LWF A;  3DEU A;  5KK1 A;  4QWQ A;  5LGT A;  1GXQ A;  2EA4 A;  3WGI A;  4YFX F;  2IJL A;  4I7H A;  5LGU A;  5HS9 A;  2P8T A;  3RKW A;  1S6L A;  3OV8 A;  5H20 A;  5LEK A;  3HHG A;  3JAM Z;  2FSW A;  2EFQ A;  3V7S A;  4IRI A;  2OQG A;  3MQ0 A;  3RYR A;  1XDU A;  5E8I A;  2Q2E A;  2D45 A;  2V79 A;  4HF0 A;  3WTX C;  4U7B A;  3DKW A;  2ZXJ A;  5DCM A;  4NQW A;  3BP8 A;  3GWZ A;  1U8R A;  4OOI A;  3L09 A;  5IT9 Z;  4HX7 A;  2ISZ A;  3V8L A;  3JSP A;  2Z5U A;  3I59 A;  2DBB A;  2A07 F;  4BHB A;  5LHG A;  3CJN A;  1K78 B;  4JBA A;  3P9C A;  4U0W A;  2HYG D;  2V9V A;  5DUI A;  3Q9V A;  4EM0 B;  3MZY A;  1HKS A;  2G7U A;  1OYI A;  4KA4 A;  1XGS A;  3KP6 A;  2XGX A;  3JAM K;  2YX4 A;  1PUE E;  2XAJ A;  4JK1 X;  2HQN A;  3GF2 A;  5FFX A;  4H0E A;  2DI3 A;  1RIO H;  4G7Z F;  1DUX C;  4EJT A;  1D3Y A;  3F8N A;  3DPT A;  5L3F A;  1S8N A;  2XRO A;  4MTE A;  3CUO A;  2L4A A;  2OD5 A;  3H3U A;  4XSX F;  2H09 A;  5IT9 K;  5K5Q A;  3KP3 A;  3CLO A;  1L3L A;  2H27 A;  5J8C A;  2LKP A;  3WU0 A;  3GVA A;  2RKH A;  5E18 F;  4AWX B;  1KQ8 A;  3FMS A;  2BEO A;  3BPV A;  1AOY A;  1CGP A;  1G6N A;  1Z7U A;  5E17 F;  2HQR A;  2GA1 A;  3NRV A;  4A6D A;  4CO8 A;  3I53 A;  2J5P A;  4S05 A;  2FXA A;  3J7A O;  1R36 A;  1AWC A;  4A12 A;  1I5Z A;  1MDM A;  1O3R A;  1HKT A;  5E8G A;  3K2Z A;  4CYD A;  2JSC A;  4G8X A;  1HKQ A;  2R7F A;  5HLI A;  1IN6 A;  5BQT A;  3E6C C;  4RGU A;  1LNW A;  2GA2 A;  1ONV A;  4KIG A;  1IAW A;  1B59 A;  2KJC A;  4ZH4 F;  1B1B A;  3HYI A;  2E1N A;  2L4M A;  5E1Z B;  4FX4 A;  3E5U A;  4ZZL A;  3TOB A;  3MFK A;  5J8F A;  1D8J A;  3SHF A;  3RDI A;  5LBQ A;  5A2Q Z;  2LF7 A;  3ZPL A;  3ELK A;  1J7K A;  1GHC A;  3DFG A;  1SFU A;  1G3W A;  2EFO A;  4KDP A;  5TJJ A;  3M7G A;  5D5W B;  2XAH A;  1X3U A;  1WKM A;  3P9K A;  4RB0 A;  4WXD A;  2QWW A;  1JXS A;  1F1Z A;  1JHF A;  1QO0 D;  1FP1 D;  2KJB A;  1SFE A;  4DQ2 A;  4LG0 B;  2O61 A;  1LJ9 A;  1T39 A;  2IT0 A;  4LJZ F;  4F7Z A;  4R79 A;  3K69 A;  3QOP A;  3HTS B;  4Y15 A;  1MJB A;  4HLY A;  1U3E M;  2HFH A;  1E2X A;  4ETS A;  2NYX A;  1YO5 C;  2A6E F;  5CVU A;  4OIR F;  2P7V B;  1T38 A;  1J9I A;  5D8K B;  3KZZ A;  2FRH A;  1LDK B;  2STT A;  4BQA A;  1IXC A;  2GAU A;  1LDD A;  4FX0 A;  3GFL A;  5E20 A;  4EGY A;  2B0L A;  2P5K A;  4L9J A;  4YFK F;  3F3X A;  5ICF A;  2QBY B;  1YG2 A;  4ENN A;  2MLG A;  3HRS A;  1HQC A;  1EH6 A;  3MWM A;  4ENJ A;  3TQN A;  3EYI A;  3HUG A;  3KEQ A;  1Z1D A;  3PQK A;  3BDD A;  3NEU A;  2RQP A;  2ESH A;  3E97 A;  1C0W A;  3C1D A;  5D8L B;  3V4G A;  1BBY A;  4L0Z B;  2XAS A;  2VBY A;  4O6J A;  4A5N A;  1J2X A;  1A04 A;  2JRT A;  2IPQ X;  4EJV A;  5LRR A;  1S29 A;  4UHT A;  1ON2 A;  1K6O A;  4UNO A;  3WTV C;  4MQV A;  2VN2 A;  4CGZ A;  4RB1 A;  1ZRC A;  2VXZ A;  1P4X A;  2EWN A;  2VT3 A;  3ZP5 A;  4K2E A;  5E1X A;  4HDU A;  4PGG A;  3HSE A;  2MA3 A;  4XSZ F;  1UCR A;  3ECO A;  4PGH A;  1BC8 C;  1Z6R A;  1TBX A;  1ZN2 A;  3WTW C;  3KFW X;  1HBX G;  1S3J A;  1WSU A;  1TTY A;  5BPI A;  2A69 F;  5BMZ A;  1FYK A;  3KLO A;  3I54 A;  2PFB A;  3IKT A;  2IRF G;  4HQE A;  5AIQ A;  4I02 A;  1CF7 B;  1YW9 A;  1LEA A;  4OMY A;  4LD5 A;  3GLX A;  1R1V A;  4GGG A;  4R1H A;  3GUD A;  1O7F A;  1U78 A;  2XUB A;  2W24 A;  1U6G A;  3R6S A;  1QQI A;  1S7O A;  2BYV E;  4KN4 X;  5LGN A;  3T5X A;  2PN6 A;  3ZMZ A;  1ZGJ A;  1MGT A;  3IWZ A;  3K1P A;  3N97 A;  4L5J A;  4ESJ A;  4HV5 A;  3SZP A;  3WTZ A;  2BE5 F;  5LRS A;  1O57 A;  4OIP F;  3KP2 A;  4CIC A;  3M8E A;  5CJ9 A;  3HRM A;  2W57 A;  4OU0 A;  4UVC A;  2RC4 A;  4L18 B;  1SD6 A;  1VTN C;  2VBZ A;  2F5F A;  4QLC U;  4M73 A;  2CFX A;  1IRF A;  5HS7 A;  3V8J A;  1YLF A;  1ZHF A;  4ZYH A;  3GX4 X;  2BBY A;  2CG4 A;  2K7L A;  3WG9 A;  2K4B A;  3SXY A;  1LQ1 A;  2PLY A;  5DCM B;  1FSH A;  3I58 A;  1K7A A;  2EFN A;  4AIJ A;  3CUQ B;  4L9V A;  1TW3 A;  2K86 A;  2L02 A;  2OQR A;  3ZQ7 A;  3FZV A;  2QQA A;  3I59 B;  4UUV A;  3KE2 A;  4I0A A;  5K5O A;  4S04 A;  3GFI A;  2NAZ A;  1ZLJ A;  3Q9S A;  4O3M A;  4U88 A;  3AAF A;  1XN7 A;  2FBH A;  3U9G A;  3R4K A;  2X0L A;  2RDP A;  3CO6 C;  3JSO A;  1R00 A;  2ZBK A;  2QLZ A;  2ZKZ A;  2VOD A;  3M9A A;  2GXB A;  3E5X A;  1KU9 A;  3W6K B;  4R8H A;  3DPL C;  3TO9 A;  4GO1 A;  3EYY A;  3L00 A;  3U2R A;  3HOT A;  1UFM A;  3WTU C;  3F8M A;  5HDN A;  2PMU A;  1ZGA A;  2FBI A;  1O3S A;  3ZMS A;  4P55 A;  4FHT A;  5DD8 A;  4KYW A;  4LK1 F;  2HTS A;  3VB2 A;  1PDN C;  4G6D A;  2DW4 A;  3FMR A;  1FSE A;  4UVB A;  2G9W A;  5JHU A;  2ESN A;  4FT8 A;  1FBS A;  1OR7 A;  2L01 A;  1XMA A;  5AIP A;  2UXN A;  4ZYD A;  3ECH A;  1UHW A;  3E5Q A;  3IRR A;  3FXQ A;  3MZH A;  3F8C A;  5ILU A;  1HW1 A;  2FU4 A;  4BAY A;  3FF5 A;  1XDS A;  2H6C A;  4EJW A;  4WXH A;  4RGS A;  1TQI A;  3VOD A;  5HVQ C;  3J80 Z;  4EM1 A;  4L0Y B;  1ZRD A;  4G6Q A;  4ON0 A;  1XMK A;  4UVA A;  4HA8 A;  1OYW A;  2KIM A;  1HST A;  3MCZ A;  1O3Q A;  1MDM B;  3WTY C;  4HDV A;  3QP5 A;  3T1B A;  4BXU A;  3PFI A;  2OBP A;  3GEZ A;  4A0X A;  2DK5 A;  3G73 A;  2P5L C;  2FF4 A;  4GXO A;  1WRJ A;  3ZN1 A;  3LST A;  3SFZ A;  1RI7 A;  2DT5 A;  4M9X A;  2CQK A;  1SFX A;  3RIR A;  1LDJ A;  1BM9 A;  3C18 A;  1B9M A;  3S2W A;  2GZW A;  2OU2 A;  1Z9C A;  1QBJ A;  1W5T A;  2A3S A;  4M74 A;  3CTA A;  5F1R A;  2LDU A;  2V1X A;  4A0Y A;  1YYV A;  4LLN A;  2YSR A;  3HSR A;  3WTS C;  2JT1 A;  1FY7 A;  1IW7 F;  2VC1 A;  5LHH A;  3J80 K;  2ISY A;  4MEX F;  1KYW A;  4L5I A;  1RUN A;  2QQ9 A;  3BOQ A;  5DDG A;  1FBU A;  1SMY F;  2UZK A;  1FOK A;  4MHG A;  2EV5 A;  5E1W A;  2EFP A;  1FP2 A;  4WX9 A;  4CHU A;  3TKY A;  5D6E A;  4PDK A;  2YX7 A;  4CDG A;  2HKO A;  6PAX A;  5JI6 A;  4KN7 X;  2OAZ A;  2Y48 A;  3ML6 A;  5HS8 A;  2M1B A;  1ZRF A;  2GQQ A;  1R22 A;  4N9H A;  1WWX A;  2PI0 A;  4KT5 C;  4AIK A;  3LQR A;  3KET A;  1KQ9 A;  2ZCW A;  2GXG A;  5ILS A;  2A61 A;  1IN5 A;  3FHZ A;  4RB2 C;  2EJR A;  4G7H F;  1IN8 A;  5FLX Z;  1UST A;  2A6H F;  1U2W A;  5LEJ A;  2RVC A;  2IA2 A;  2M8E A;  4L9N A;  1SD4 A;  3EET A;  4EV0 A;  1RZ4 A;  4GYI A;  4I09 A;  4M71 A;  5D6F A;  2FA5 A;  5ERI A;  2K02 A;  1FYM A;  3OOP A;  3QU6 A;  3SZT A;  1ZRE A;  4LMY A;  1F9N A;  2A5Y B;  3RJP A;  4IF4 A;  5DYM A;  3TO6 A;  3RKX A;  2KKO A;  2IA0 A;  3LAP A;  4WXC A;  3I5U A;  4KUM A;  2VOP A;  5HDK A;  2V6C A;  3I71 A;  4LB6 B;  4M9Z A;  1FX7 A;  1HW2 A;  2ADU A;  5TRD A;  2KRF A;  4O5V A;  3IL2 A;  1BI1 A;  4E70 A;  3GFJ A;  2JZY A;  2R7D A;  1U5T C;  2Z99 A;  5HLH A;  3DV8 A;  1P2F A;  5FLX K;  4EVI A;  2CGP A;  2L54 A;  2VON A;  2ZFW A;  2PBI A;  3J81 Z;  2MD5 A;  1J5Y A;  2IA1 A;  3RKY A;  3ZN0 A;  3C3W A;  3F6V A;  1J75 A;  2XAG A;  4Y13 A;  3WGH A;  4IXA A;  1I27 A;  2PEX A;  5ICE A;  3B73 A;  1R23 A;  3E6D A;  2XAQ A;  3R0J A;  4ZZD A;  5K1Y A;  3QAH A;  5K5R A;  1D5V A;  3T8T A;  4CZZ A;  3TOA A;  1IXS B;  3EUH A;  1H9T A;  2HR3 A;  5CVV A;  1PP7 U;  4KIB A;  4BH9 A;  2DPD A;  1GVJ A;  2CSO A;  5AON A;  1Q1H A;  4AIH A;  4LGW A;  4NB5 A;  2J5O A;  3SQN A;  1IF1 A;  1W5S A;  3HOS A;  2LSO A;  1RUO A;  3WE2 A;  1BJA A;  2HOE A;  4MNU A;  3R0A A;  1V4R A;  4LFU A;  1W7P A;  4B8X A;  3E3V A;  1U5T A;  4RAY A;  3F8F A;  1KA8 A;  1R58 A;  2EA2 A;  3J81 K;  4XLN F;  2W85 A;  1LB2 A;  2DU9 A;  4BHP A;  5IT3 A;  2Y0M A;  3B02 A;  5BPD A;  5HDG A;  1K79 A;  1OMI A;  3GXO A;  2UWM A;  3ULQ B;  1NHA A;  3ISP A;  2NNY A;  3G3Z A;  2DPU A;  3FM5 A;  2WC2 A;  3R60 A;  3D5L A;  2DLL A;  1O3T A;  2K27 A;  3LFK A;  1R1U A;  1ULY A;  5CVJ A;  1S7A A;  3EQL F;  2BV6 A;  1XSD A;  4U0Y A;  3MAJ A;  3DF8 A;  5DCF A;  2V1D A;  1YQA A;  3RPQ A;  5BS6 A;  1H0M A;  2Y75 A;  5L3B A;  1TQM A;  5ED4 A;  4I2O A;  1XGO A;  1I1G A;  2FOK A;  4WWC A;  5ILV A;  4U0V A;  1ZYR F;  2CW0 F;  4XRF A;  3T0Y A;  2H94 A;  1R5G A;  5DD4 A;  4HZF A;  2M45 A;  2IVM A;  3IRQ A;  3HRU A;  1QNT A;  3KCC A;  2OZ6 A;  3O2P E;  2Q0O A; 
#chains in the Genus database with same CATH topology
 5F0F A;  4P5O A;  4G7O F;  2H6B A;  5D5V B;  3A0B C;  1HSJ A;  4PCQ A;  2NS7 A;  4F52 A;  1XC5 A;  2XKO A;  4YG2 F;  3RPU A;  3F6O A;  5EEH A;  3TDZ C;  1ACI A;  4M6Y A;  5CVR A;  1VQ4 I;  3MEX A;  2WTE A;  1R4M B;  2ZNZ A;  4XOT A;  3KP7 A;  3M07 A;  4BNC A;  1Y8R B;  1VFC A;  2HPM A;  1ITY A;  3CCE I;  2DQL A;  3E6M A;  2DT7 B;  1MZB A;  2NVY J;  5BNG A;  2VAS A;  2QGU A;  5HLG A;  2IP2 A;  2R7Q A;  3DLA A;  1OLT A;  4N0B A;  1OFC X;  3CCR I;  3L1P A;  2DYR H;  2WY7 Q;  2G7H A;  1T98 A;  4KNY A;  1DGW Y;  4XM3 A;  1QA6 A;  2MC3 A;  1XD7 A;  4KIS A;  2O3F A;  1G3S A;  4Y3O A;  1Y0U A;  2KDO A;  3PQJ A;  2RRE A;  4RAZ A;  3OYK A;  2KPM A;  3JRI A;  4ZTF A;  3G1M A;  2QEN A;  3DQV C;  3VEP A;  1XGN A;  1EH8 A;  1IV6 A;  3WG7 H;  1QZZ A;  2DCE A;  1I1S A;  1JE8 A;  4A0Z A;  1FMV A;  5IYB J;  4DJA A;  2BW3 B;  3VOE A;  2FE3 A;  3QPH A;  4XBF A;  4UUS B;  2E19 A;  1MBH A;  3BJO A;  3S3M A;  3TDU C;  2PMZ N;  2JQ7 A;  1FC3 A;  2OA4 A;  2QUF A;  2AHQ A;  4GCV A;  4TV7 A;  2XIG A;  1TP4 A;  1CF7 A;  4LLG F;  2NNN A;  3GLL A;  2VQH A;  3G71 I;  2DJN A;  5F08 A;  1EV7 A;  1A6I A;  1XSV A;  3V7C A;  4KT6 A;  3OYG A;  1T6S A;  4Q4Z F;  1IO2 A;  3CCU I;  2VJJ A;  1JGS A;  4W1U A;  4OAY A;  1N25 A;  1TWA J;  2ZME A;  5HNH A;  1QU3 A;  3GZN B;  1XPX A;  2LC2 A;  3GBG A;  3HTU A;  2MH9 A;  1E3H A;  3FWE A;  2PMH A;  3HRT A;  3OIO A;  2MBF A;  3TO7 A;  2FNP A;  2P7C B;  1OCZ H;  2JA2 A;  3C2G A;  3OYM A;  1ZG3 A;  5J1U A;  2AQE A;  2Z9O A;  1FOY A;  1X4O A;  1MMS A;  4NC8 A;  2QA4 I;  3CMY A;  3UNG C;  1NTC A;  3BWG A;  3CP2 A;  2M30 A;  4YFN F;  2MSY A;  5GTI C;  3F23 A;  3LFU A;  5B5E C;  3GZ6 A;  3C7J A;  3ERE D;  1MD0 A;  2X6X A;  4BYY A;  1LFU P;  1OKR A;  1P7I A;  1V5F A;  2FEZ A;  1MMA A;  3S32 A;  4II2 A;  4HAM A;  2DA4 A;  4OIN F;  1BC7 C;  1T0F A;  2DMP A;  1TNS A;  2IS4 A;  4KMU X;  3HOZ J;  4PFO A;  3PO3 J;  4A3F J;  2LMD A;  5LFA A;  3FXL A;  1X19 A;  3BTC A;  2JA6 J;  3ZMD A;  4A3I J;  5J4V A;  3K0L A;  3WOD F;  1E17 A;  1YW7 A;  2LK2 A;  4CYC A;  4IQJ A;  2EZL A;  1TWH J;  2OPT A;  3I0T A;  5F0C A;  3LA2 A;  1QPM A;  2XDV A;  4ENK A;  1PP8 F;  2GXA A;  3ZMV A;  3GW2 A;  1D0Z A;  1FIP A;  1USS A;  4YIF A;  4IPA A;  4I98 B;  4GYG A;  3RYP A;  1YOV B;  3IH2 A;  4HNT A;  2AS5 F;  1K61 A;  2FD5 A;  4MGR A;  2R3S A;  1A6Q A;  1B72 B;  1P92 A;  2RGV A;  3BJ6 A;  4UV8 A;  4A2U A;  2Z33 A;  1WH7 A;  4P96 A;  1KU7 A;  1G4D A;  5CVI A;  2DFH A;  1PUF A;  1UG2 A;  1YJN I;  3J7Y J;  3CUQ A;  5DUK A;  4LIV A;  1ENH A;  2VBW A;  2AXL A;  2P5V A;  1ON1 A;  2GM4 A;  2ICW G;  2VOO A;  3E7L A;  3IHU A;  1TWF J;  3FXO A;  4DZP A;  2NS0 A;  2R7V A;  1REP C;  4JX6 A;  5EG0 A;  2WV0 A;  3D0S A;  3LQQ A;  3I4M J;  2L9N A;  3IH4 A;  5EEG A;  1G2H A;  4P1W A;  1UB9 A;  1QGP A;  3I4P A;  2WAQ A;  2OC6 A;  3JRG A;  1ODD A;  5ICC A;  1L0O C;  1FZP B;  1I6H J;  4PSX A;  1B4A A;  3LA7 A;  2WAQ N;  2ZO4 A;  2F2E A;  3Q5F A;  3QP6 A;  1Y56 A;  4WCG A;  4N4O B;  3G4S I;  5J1Y A;  3LAJ A;  2MAB A;  1SAN A;  2CYY A;  1DU6 A;  1JT0 A;  2VE8 A;  3ASN H;  3VDX A;  5FGM A;  1QHH D;  1D1B A;  3FBI B;  1Z7L A;  2HEO A;  4BXF A;  4MTD A;  4M3B A;  5D5X B;  4IVN A;  2KDZ A;  3OWT A;  3R61 A;  1BR2 A;  3ABT A;  5D4S A;  4XIC A;  3SEZ A;  4WK8 F;  1XB4 A;  1SVM A;  2UV1 A;  1IRG A;  1KU2 A;  1IZ1 A;  4NC7 A;  5B3S H;  4KIC A;  4MEY F;  2HGC A;  5GP9 A;  3U21 A;  2OTJ I;  3REO A;  3M8F A;  3JW4 A;  5L3E A;  1MBG A;  2X4H A;  1X1D A;  2TCT A;  4IRG A;  2ZJR F;  4NHJ A;  3GFM A;  4IHT A;  4B1R A;  2CWE A;  2ELH A;  2QF7 A;  2YPR A;  1P4W A;  2RNJ A;  3FX3 A;  2LBF B;  4ASN A;  3WE3 A;  2XC7 A;  5L3C A;  3PNY A;  4PUS A;  4OIO F;  3KP5 A;  3BCA A;  1F4K A;  2PJR A;  4KJZ A;  2RN7 A;  5H6R A;  2M7B A;  2HVQ A;  1FNN A;  2GIV A;  1Z21 A;  4L9T A;  2V6E A;  1IRZ A;  5FKK A;  2O03 A;  4DW6 A;  4ENM A;  3CCL I;  1JTY A;  2MC4 A;  4G6T B;  3NAU A;  2Z1D A;  3VFZ A;  3M1E A;  5FB2 A;  1MJ9 A;  2JPC A;  3FM3 A;  2BGC A;  3KZY A;  4BHC A;  5FO5 A;  4EJO A;  1YS7 A;  1WQ2 A;  5JVT A;  3CP8 A;  4XKC A;  2R5Y A;  4OIQ F;  1XCV A;  3H92 A;  1DPR A;  3CZ6 A;  1STZ A;  3L9F A;  2ETH A;  4PJN A;  2D2W A;  3OS1 A;  5L3D A;  5C4X J;  3EDP A;  3V7R A;  1Z05 A;  4W97 A;  2ACJ A;  2IS1 A;  1MSF C;  2O8X A;  3F72 A;  1VI0 A;  3LSJ A;  4I01 A;  2UXX A;  4P9U A;  3S1Q J;  1BIB A;  1SD7 A;  1UZC A;  4FET A;  5GPA A;  4MIM A;  5IOZ A;  2E1M B;  1TNT A;  3HSF A;  2KIF A;  4EJU A;  1EH7 A;  2GBY A;  1IN7 A;  3ZQG A;  5J40 A;  4Y17 A;  1IJW C;  1ZK8 A;  4IHX A;  3PSF A;  3HGY A;  1UHM A;  3ROU A;  2O6G E;  2TDX A;  4LLL A;  2K3F A;  2E1M C;  3O6B B;  1VQK I;  2EV6 A;  3GME A;  4ESF A;  3DLL F;  1K78 A;  2LF8 A;  2Q1Z B;  3ZMU A;  4LB5 A;  5EEA A;  1P6R A;  4HX8 A;  3OYJ A;  2H8R A;  2AO9 A;  3RTR A;  2QZ8 A;  2M5W A;  2HS5 A;  4E7K A;  3S3N A;  1KYZ A;  4I0B A;  4KMF A;  1YFH A;  3TW7 A;  3GYH X;  4A3D J;  2OV7 A;  1OCO H;  2IW5 A;  3ZQC A;  5M3F J;  2VT2 A;  3GTJ J;  1VQL I;  3TGN A;  2VKD A;  1MIJ A;  3CDH A;  4X1E A;  3FXU A;  1VQP I;  1ZG5 A;  4BQQ A;  3HHH A;  1JKO C;  1YS6 A;  4HQM A;  4CZC A;  4IKF A;  4BEH B;  4YIR X;  2E35 A;  1YX3 A;  2O0Y A;  3DXJ F;  5BOX A;  2HOT A;  2FNA A;  3BLY A;  1TT0 A;  1K4T A;  4D0P A;  2QYO A;  3PM1 A;  3JR9 A;  3H3V K;  2P4W A;  3HL2 A;  2MG4 A;  3MVP A;  1R7J A;  4IHV A;  3RZD J;  1VQM I;  3ZCO A;  1B8I A;  1FTT A;  1HW5 A;  1WI9 A;  1BOA A;  3MD2 A;  4LOC A;  2PX9 A;  4BKX A;  4XK4 A;  2QKM B;  2XF7 A;  1MND A;  3DTE A;  5JVG F;  2HKX A;  4P9F A;  2PQ8 A;  1X58 A;  3CME I;  1WFX A;  2BXZ A;  3HIF A;  2XVC A;  2JA8 J;  1I6X A;  4UXN A;  1ZQ3 P;  3G6E I;  3EUH C;  2F5E A;  2XSJ C;  3V8K A;  1VQO I;  4QSH A;  1MBK A;  2LR8 A;  3L7W A;  2D1H A;  3PO2 J;  2XB0 X;  2E36 A;  1JKQ C;  1FBQ A;  3QYF A;  1LE8 B;  3L2Q A;  2FML A;  3HXL A;  4RGX A;  1GDT A;  3SDG A;  1BI3 A;  2RAE A;  2R7W A;  3N4M A;  2PJP A;  1IGN A;  2DO7 A;  1YHQ I;  2EB7 A;  1R9T J;  2DJI A;  2COM A;  3DEW A;  2NOG A;  3DP7 A;  1APL C;  1YIO A;  4HF2 A;  1FLI A;  3BR5 A;  2QSH X;  3KYD B;  2CQ7 A;  1R1T A;  3TBI A;  1W7P B;  4NBQ A;  2VPL A;  1U5T B;  3S1M J;  5KVR A;  4D5F A;  4M6V A;  1ETO A;  3QU3 A;  3TMO A;  3MKY B;  3CO7 C;  2EV0 A;  2K4J A;  2OCE A;  2EFW A;  2CV0 A;  2A68 F;  3IKV A;  3A01 A;  1O7L A;  3WU1 B;  2YU9 J;  4M6X A;  5ICG A;  5JR3 A;  1JTX A;  2HOA A;  1JHH A;  5F27 A;  3H9Q A;  5JFR A;  1JUP A;  2DDA A;  4KFC A;  5HLT A;  2RV8 A;  1FOX A;  2KL4 A;  2MH2 A;  4V19 K;  3HB9 A;  1Z91 A;  3ABU A;  2F5C A;  5LLQ A;  1DPU A;  3KEO A;  2ZNY A;  3K2A A;  1HCR A;  4A5M A;  1OCR H;  1WVR A;  1KU3 A;  1POG A;  2HZD A;  3LA3 A;  5LHI A;  1TW2 A;  1IN4 A;  2HTJ A;  5FFZ A;  1J09 A;  4Q5S F;  3P9I A;  3QYB A;  4RLQ A;  2HWV A;  3CC2 I;  3BPX A;  2YR2 A;  1BI2 A;  1X3W B;  5J6X A;  2JRM A;  3F22 A;  3K1M A;  1YE9 A;  1D8K A;  2JK3 A;  2FQ3 A;  4G94 A;  2Y9Y A;  4DNC A;  2DFF A;  1ZH5 A;  4XL9 A;  5J4Y A;  4CXF A;  2LNB A;  2LOO A;  1MJA A;  1LFP A;  5EGO B;  3RKQ A;  5A2Q K;  1BN5 A;  5CYV A;  4EGZ A;  2W4S A;  3JTG A;  2Z2S B;  3P7N A;  2X6Y A;  2Z3Y A;  2A5W A;  4IJA A;  3M4O J;  5B1B H;  1J0R A;  3JCU C;  2F5D A;  2CUJ A;  3E6B A;  2HQA A;  2HDC A;  1B9N A;  1U9N A;  2KRH A;  1HOM A;  2XF6 A;  3U1D A;  2ME6 A;  3S14 J;  2VIX A;  1T2K A;  4BU2 A;  4YII A;  1B6A A;  1BI0 A;  2HVS A;  2DTR A;  4A3M J;  3CCY A;  4C30 A;  2M8G X;  1Y1W J;  4ESB A;  2VJ5 A;  1AKH B;  2P6S A;  4EM2 A;  3IAS 2;  4IHW A;  3B6A A;  1W4M A;  1ZAR A;  4B3A A;  1Z6T A;  2XKP A;  1IXR C;  1EKE A;  3S1R J;  4QTR A;  3RZO J;  2KQR A;  1W7P D;  2KT0 A;  3IH3 A;  3CC4 I;  3BY6 A;  1S9H A;  2NVQ J;  2CQQ A;  2DFI A;  3F8B A;  4LG0 A;  1IDZ A;  2CS3 A;  1FPQ A;  3OYI A;  4HV6 A;  1ZKG A;  5CKT A;  1YW8 A;  5FD5 A;  4BS9 A;  3KP4 A;  5HNF A;  1HF0 A;  3T8R A;  5B1A H;  2HXO A;  2EIK H;  3BRO A;  4KIT B;  3CCQ I;  2I8D A;  2R5Z A;  3CCV I;  5EF6 A;  5F04 A;  1YTY A;  2C6Y A;  1E0E A;  3KIO A;  5EJC A;  4CCO A;  1TT5 B;  1E3P A;  3L2C A;  1V3F A;  4JQF A;  2NRA C;  2ME0 A;  2ZJ2 A;  1ZG1 A;  2W84 A;  2HYF A;  1FT9 A;  4IHS A;  2LRD A;  1MKM A;  2Y69 H;  3H35 A;  3SZG A;  2KZV A;  4I99 C;  4N9I A;  4Q47 A;  2XHK A;  3PNT A;  3SYT A;  3ZRG A;  3M3Y J;  2E7X A;  4HW0 A;  2GWR A;  2WWY A;  3K10 A;  2K9Q A;  3I64 A;  2JPB A;  5E3O A;  2VBX A;  2E1C A;  2V1U A;  5IP9 J;  3QYE A;  3JRB A;  2HZT A;  4M72 A;  2DA6 A;  4EMS A;  1ZR4 A;  4RAF A;  2Y0S A;  5DM7 F;  3W6J B;  2VC0 A;  2Q8K A;  4B09 A;  2QBY A;  4M9S A;  2Y0S N;  1OYY A;  1UEL B;  4DYQ A;  4KIF A;  3RQI A;  3OYA A;  2DAO A;  2DDB A;  3KZI C;  2UUZ A;  4A6E A;  1V5E A;  4B44 A;  5DEQ A;  4F92 B;  3ZMT A;  3IV5 A;  1LEB A;  1SAX A;  1SD5 A;  2M4G A;  4B48 A;  4PZJ A;  2EK5 A;  2P6T A;  3FMQ A;  3WTT C;  5TGT A;  5LD2 C;  4ZYG A;  2DK8 A;  2ZME B;  4UV9 A;  5D5U B;  4U7D A;  1HDD C;  1P4A A;  3ZQH A;  1HC8 A;  1GXP A;  1RR8 C;  2ZB9 A;  4NNJ A;  4HG2 A;  3J7Z I;  3H3Z A;  3AKZ A;  2DA7 A;  3OL4 A;  1J59 A;  4C3J J;  5K7H A;  3F21 A;  1DP7 P;  2KIU A;  3AG4 H;  1FYL A;  4WF2 A;  3QPT A;  5DV5 A;  2QQB A;  4IRH A;  3WGG A;  4X0G A;  3OSG A;  1G3T A;  2MLK A;  3S15 J;  1BW5 A;  1NG7 A;  3O8G A;  4Y52 J;  4XLC A;  1TLH B;  2X1E A;  2MGQ A;  2FQ4 A;  4XLP F;  2E7W A;  2K3P A;  1XSX A;  1XGM A;  1QZY A;  2W25 A;  3K9T A;  3QPS A;  1XCB A;  3OYC A;  3LSR A;  1BJZ A;  4D7M A;  3IWF A;  2EPF A;  4AU7 A;  1KGS A;  1R5H A;  3MZ8 A;  4EQQ A;  2GOX B;  1WZ2 A;  2LH9 A;  2N8G A;  1RKT A;  1U9O A;  4CYC B;  2M87 A;  1GT0 C;  3ABK H;  1T0F C;  3BZ6 A;  4C3H J;  1SAU A;  2LY9 A;  4U87 A;  2V26 A;  3JRH A;  1Y8Q B;  2BOL A;  1O4X A;  1ETW A;  1DDN A;  2IGM A;  3RPU D;  1QZE A;  1TQP A;  3NQO A;  2F48 A;  4ZJZ A;  2HOS A;  2V4J C;  3KYL A;  4Q48 A;  2XGC A;  5FD6 A;  2HI3 A;  3FXM A;  2FMY A;  1BIA A;  4V2G A;  1OPC A;  1WJD A;  4HOB A;  5IP6 A;  2LFB A;  4HLX A;  5F64 A;  2Y9Z A;  1IUY A;  2DTZ A;  2XRN A;  2ZXI A;  2EIM H;  3KLN A;  2OZU A;  3COA C;  4IX7 A;  2QQ8 A;  4HPQ A;  4RB3 C;  4Z2Y A;  3GO5 A;  1PJR A;  2QVO A;  2XV4 S;  2CUE A;  4RS8 A;  4HYE A;  1PUF B;  4G9Y A;  4E7H A;  5F6F A;  3BCB A;  3NWT A;  3ABM H;  2PMZ A;  3K1N A;  4MQ9 F;  5M5W J;  2Y30 A;  2STW A;  4CCK A;  5H6Q A;  2FBK A;  1S72 I;  1F5T A;  3K4C A;  2K5C A;  5EG0 B;  5F0H A;  2D1V A;  1T33 A;  1WJF A;  3IC7 A;  2XF5 A;  1JKR C;  2E60 A;  3CUQ C;  2YU3 A;  1ZR2 A;  3VWB A;  4IEJ A;  2VE9 A;  2PG4 A;  3AFH A;  1GUU A;  2JTV A;  3JTH A;  1ZLK A;  4ZYE A;  5D4R A;  4HX4 A;  2DQR A;  2L9R A;  3BJA A;  4HBL A;  4AD9 A;  3PL8 A;  4MO7 A;  2VLA A;  4LG3 A;  3RI4 A;  4HF1 A;  1HXD A;  1RNL A;  5FJ8 J;  4OMZ A;  2R92 J;  4AC0 A;  3CMM A;  1FWZ A;  2DMT A;  3A1Y A;  4AVP A;  1SMT A;  1G3Y A;  3GZ5 A;  5CLS A;  1MBF A;  1H9G A;  3JRE A;  5EZG A;  3AG1 H;  1JI8 A;  4RGR A;  5L3G A;  1H89 C;  3BZC A;  1ZAO A;  1P7J A;  3FXR A;  3OS2 A;  2QM3 A;  5IP7 J;  1KQ0 A;  1LVA A;  2X48 A;  5HOO A;  3LSH A;  4CCL A;  2CO5 A;  4LK0 F;  3QRF F;  1VQ9 I;  3TP3 A;  3HKZ A;  4L5E A;  2DN0 A;  2XAF A;  3O3K A;  3HKZ N;  2WAE A;  1G59 A;  3K70 C;  3GTQ J;  2L3D A;  2MYS A;  2YS9 A;  3LWF A;  3DEU A;  3LSP A;  1ETY A;  5KK1 A;  3TP0 A;  4M3E A;  4NDL A;  4RLF A;  1XX5 A;  1K6Y A;  1WJB A;  4QWQ A;  2X85 A;  5LGT A;  3BQZ A;  1GXQ A;  3OYN A;  2EA4 A;  3WGI A;  4YFX F;  2IJL A;  3DKX A;  4I7H A;  5LGU A;  5HS9 A;  2P8T A;  4CCN A;  3RKW A;  1S6L A;  3OV8 A;  1P9Q C;  2PJR B;  1QVU A;  5H20 A;  1YIT I;  2DFE A;  2P0W A;  5LEK A;  1TZL A;  4ZTJ A;  1FTZ A;  3HHG A;  5EZH A;  3L2R A;  3JAM Z;  3BR1 A;  2VL8 A;  2FSW A;  2EFQ A;  1UJ8 A;  3V7S A;  3H9J A;  3Q0V A;  4IRI A;  2OQG A;  3HJE A;  3MQ0 A;  3RYR A;  1XDU A;  5GAG J;  5E8I A;  3CF5 F;  1NH3 A;  1UMQ A;  2Q2E A;  2D45 A;  4CA0 A;  2V79 A;  4HF0 A;  3WTX C;  1T56 A;  4RM2 A;  2R5Y B;  1X1A A;  3ZQI A;  1HA8 A;  4U7B A;  1I3A A;  3DKW A;  2ZXJ A;  1WCM J;  4A3B J;  5DCM A;  3AG2 H;  4NQW A;  3BP8 A;  2G0E A;  3GWZ A;  1U8R A;  4OOI A;  2OJE D;  4J00 A;  1IV8 A;  1XG1 A;  2ZSI B;  3L09 A;  1RKW A;  4UB6 C;  5IT9 Z;  4HX7 A;  2W7N A;  3E0J B;  3ZQL A;  2ISZ A;  3BR2 A;  2H1L A;  3V8L A;  3JSP A;  2Z5U A;  3I59 A;  5M5X J;  2DBB A;  1V54 H;  2IBD A;  2OUM A;  3DTK A;  1X1P A;  2A07 F;  4BHB A;  3P5J A;  5LHG A;  4FAS D;  2JJ7 A;  3CJN A;  1K78 B;  2BVL A;  4JBA A;  3BR3 A;  3J7A Y;  2E2J J;  2GLO A;  3K4J A;  3Q0U A;  4BJ6 C;  3P9C A;  4U0W A;  3ZXS A;  2CV2 A;  4LIU A;  2HYG D;  2V9V A;  2M9H A;  5DUI A;  3Q9V A;  2HVR A;  4EM0 B;  3MZY A;  5IY5 H;  1DQU A;  2VPR A;  1HKS A;  4GFB A;  3HOY J;  2G7U A;  1OYI A;  3BTJ A;  4QPO A;  4E7Z A;  4KA4 A;  1XGS A;  4BDY A;  3GTK J;  3H5N A;  3KP6 A;  1VND A;  2XGX A;  3JAM K;  2YX4 A;  3I4N J;  1PUE E;  4HNV A;  5KHD A;  3G2B A;  1I39 A;  2XAJ A;  2F4O B;  3VPR A;  4JK1 X;  2HQN A;  3GF2 A;  5FFX A;  3K4L A;  4M3F A;  4H0E A;  5DM6 F;  2DI3 A;  2XPU A;  3BG9 A;  1RIO H;  4G7Z F;  3LMM A;  2CRG A;  1B8I B;  2X1D A;  2JA5 J;  4XKB A;  1DUX C;  2X6O A;  1D3Y A;  4EJT A;  3F8N A;  2FJ1 A;  3DPT A;  4ZDL A;  5L3F A;  1S8N A;  2L7F P;  2XRO A;  4MTE A;  2JN6 A;  3CUO A;  3K4K A;  1QVT A;  2L4A A;  3BTI A;  2B9S A;  2OD5 A;  1OCT C;  3H3U A;  2IEK A;  4XSX F;  2H09 A;  5IT9 K;  3F9K A;  5K5Q A;  3KP3 A;  3BR0 A;  2K40 A;  3CLO A;  3OR2 C;  1L3L A;  3AL0 C;  2H27 A;  5J8C A;  2LKP A;  3H0G J;  3WU0 A;  1V55 H;  3GVA A;  3LOC A;  3HOV J;  1WJE A;  3DU5 A;  2RKH A;  5E18 F;  3HOW J;  3H5A A;  2EIJ H;  4AWX B;  2LKX A;  3C2H A;  1RPW A;  2AXT C;  3JRD A;  1KQ8 A;  9ANT A;  3FMS A;  3VYS B;  4BE2 A;  3MKZ A;  2BEO A;  1EA3 A;  3BPV A;  1WJA A;  2NVX J;  1T95 A;  3KEY A;  3L2V A;  1AOY A;  3A01 B;  1CGP A;  1WJ5 A;  2IAI A;  1G6N A;  1Z7U A;  4MFD A;  3PUB A;  2HQR A;  4CSW A;  2GA1 A;  1U8B A;  5E17 F;  1D1A A;  1NG6 A;  3NRV A;  4A6D A;  4CO8 A;  3I53 A;  2J5P A;  3DBL B;  4S05 A;  4BUP A;  2FXA A;  3J7A O;  1R36 A;  1AWC A;  4A12 A;  3FKI J;  4RM3 A;  5JLW A;  2DA5 A;  1I5Z A;  1MDM A;  4A3E J;  3PIP F;  1O3R A;  1HKT A;  2Y2Z A;  5E8G A;  2BY0 A;  2LLK A;  3K2Z A;  4Y33 A;  4CYD A;  3OY9 A;  2JSC A;  3PIO F;  4G8X A;  1HKQ A;  3H5R A;  2R7F A;  3C2B A;  1YJ9 I;  5HLI A;  1G8X A;  1EF4 A;  1IN6 A;  5DS9 A;  1F36 A;  5BQT A;  1R6R A;  4LIT A;  3TW6 A;  1YI2 I;  3E6C C;  1JJ8 C;  1TWG J;  4XMY A;  3S17 J;  1W1W E;  3ZR8 X;  4RGU A;  1LNW A;  1BL0 A;  4ZDP A;  2GA2 A;  4XOR A;  5C4J J;  4IOA F;  2JUC A;  1ONV A;  5IYD J;  4E7S A;  3OYE A;  4KIG A;  3DKY A;  2GOM A;  1GLN A;  2MD0 A;  1IAW A;  2KIQ A;  4XRS G;  1B59 A;  1AA7 A;  2KJC A;  4ZH4 F;  1B1B A;  4E7I A;  3D5S C;  3HYI A;  2VQC A;  3UR3 C;  2E1N A;  1MNE A;  2RNG A;  4BAC A;  2L4M A;  5E1Z B;  1S5L C;  4FX4 A;  2LVS A;  3E5U A;  2AQF A;  4ZZL A;  2B63 J;  4UY8 I;  3TOB A;  3FIW A;  3MFK A;  5J8F A;  1W0U A;  1D8J A;  3SHF A;  4XID A;  2L7Z A;  3L2W A;  3RDI A;  2BVM A;  5LBQ A;  5A2Q Z;  1YRN A;  5K7Z A;  2LF7 A;  1Z3Y A;  1H8A C;  1A5J A;  4UUT A;  2EBI A;  3ZPL A;  4DBQ A;  3ELK A;  1J7K A;  3CJT B;  1GHC A;  3DFG A;  3O8H A;  3HM5 A;  1SFU A;  1G3W A;  2EFO A;  4F3Q A;  5TJJ A;  2NS8 A;  4KDP A;  3M7G A;  5D5W B;  3S8P A;  5FRM A;  1FMW A;  2XAH A;  1X3U A;  1WKM A;  3P9K A;  3LL7 A;  4RB0 A;  1E3O C;  4WXD A;  4D9J A;  2QWW A;  4XN3 A;  1JXS A;  1VQ7 I;  5GAE J;  4XN0 A;  1F1Z A;  3GCM A;  1MSE C;  4DOZ A;  4I6Z A;  1JHF A;  1QO0 D;  1FP1 D;  2KJB A;  1SFE A;  2ZXW H;  4DQ2 A;  2X9D A;  4LG0 B;  2O61 A;  1X1B A;  3TED A;  1LJ9 A;  1T39 A;  2IT0 A;  4LJZ F;  3NAR A;  2A05 A;  1SFK A;  1UG0 A;  4F7Z A;  4DYR A;  1LUJ B;  5EDN A;  4R79 A;  2NVT J;  3K69 A;  3QOP A;  3HTS B;  2VJI A;  2R5Z B;  3GTL J;  2IS6 A;  2E2H J;  3OIP A;  1MJB A;  4Y15 A;  4HLY A;  2L7K A;  3QOD A;  1U3E M;  2HFH A;  1E2X A;  3DU6 A;  2WA0 A;  4ETS A;  2NYX A;  1YO5 C;  2A6E F;  5CVU A;  4S0H B;  4OIR F;  2P7V B;  2VQL A;  2CQN A;  1SC7 A;  1R5I D;  1T38 A;  1J9I A;  5D8K B;  3KZZ A;  2FRH A;  1D0Y A;  1LDK B;  2K9M A;  2STT A;  1X2N A;  3S16 J;  4BQA A;  4M3G A;  1IXC A;  2GAU A;  1LDD A;  3WHB A;  2XGE A;  4FX0 A;  1R49 A;  3GFL A;  5E20 A;  4EGY A;  2B0L A;  2P5K A;  3PSI A;  4DGW B;  2ZXH A;  4L9J A;  3CF2 A;  4XR6 A;  3ZOB A;  3ERM A;  3F3X A;  4YFK F;  1RRJ A;  5ICF A;  2QBY B;  4A3L J;  1YG2 A;  3U1K A;  1VQ6 I;  4ENN A;  2MLG A;  2CUF A;  3FK7 A;  2WB1 A;  5J3L A;  2OTL I;  3HRS A;  1QHG A;  4B47 A;  1HQC A;  1EH6 A;  3MWM A;  4ENJ A;  2WB1 N;  3M8J A;  2LD5 A;  4XOP A;  3TQN A;  1H88 C;  3EYI A;  3OMY A;  4RMN A;  3HUG A;  2L7M P;  3KEQ A;  1Z1D A;  3PQK A;  4BE1 A;  2O8K A;  3BDD A;  3NEU A;  2RQP A;  2ESH A;  3QOE A;  3E97 A;  3EUK L;  1C0W A;  3LSG A;  3C1D A;  3I56 I;  5D8L B;  5GTH C;  2EZK A;  3HDD A;  2HDW A;  3V4G A;  3HC7 A;  3MMY B;  5KAF C;  2BY3 A;  1BBY A;  1S7E A;  3ZQF A;  4L0Z B;  2XAS A;  5FLV A;  2VBY A;  4O6J A;  2KFD A;  1D0X A;  4A5N A;  2XSD C;  1BA5 A;  1J2X A;  1A04 A;  4HEA 2;  3W2V A;  2DOF A;  2JRT A;  3OYH A;  2R0Q C;  1LE8 A;  2IPQ X;  4BJT A;  4EJV A;  5LRR A;  2LTP A;  2VXD A;  2R7S A;  1S29 A;  4UHT A;  2B7E A;  2FUG 2;  1ETK A;  2BZT A;  4Y4R A;  1ON2 A;  2FX0 A;  3ZQQ A;  1K6O A;  3AG3 H;  4UNO A;  2LKS A;  3WTV C;  3QQA A;  3HBL A;  3OS0 A;  4MQV A;  2VN2 A;  3A4C A;  3S3O A;  4PJL A;  4CGZ A;  4MFE A;  3WU2 C;  3HOX J;  5TIS C;  4RB1 A;  1ZRC A;  1AHD P;  2VXZ A;  1P4X A;  2EWN A;  3A2K A;  2VT3 A;  3ZP5 A;  4K2E A;  5DTD A;  2WY8 Q;  5E1X A;  1PYV A;  4HDU A;  2M4K A;  1MNM C;  1A31 A;  4PGG A;  3HSE A;  3PNV A;  2MA3 A;  2KP6 A;  4CCJ A;  4XSZ F;  1UCR A;  2IGN A;  3ECO A;  4M3D A;  4PGH A;  1BC8 C;  3CMA I;  2O9L A;  3OYF A;  4B3X A;  1Z6R A;  1UHS A;  1TBX A;  2W48 A;  4BGD A;  1RES A;  5FKO A;  2K85 A;  1ZN2 A;  3WTW C;  3KFW X;  1HBX G;  1BW6 A;  1S3J A;  1WSU A;  1TTY A;  4AYB N;  5BPI A;  2A69 F;  4XKV A;  5BMZ A;  1FYK A;  3KLO A;  3I54 A;  2PFB A;  4B4C A;  3IKT A;  4C2T A;  2IRF G;  2E5Z A;  4HQE A;  1ZEL A;  1EJ9 A;  5AIQ A;  4I02 A;  1CF7 B;  4IL6 C;  5FLM J;  1YW9 A;  1LEA A;  4OMY A;  4LD5 A;  3GLX A;  1R1V A;  2DMQ A;  4GGG A;  4R1H A;  1M1E B;  3GUD A;  3G1L A;  1O7F A;  4JP0 A;  1U78 A;  4CCM A;  3BG5 A;  1Z77 A;  4XLF A;  2XUB A;  2W24 A;  2KIS A;  1BR1 A;  2XPW A;  1U6G A;  3BG7 A;  3R6S A;  1QQI A;  1S7O A;  2WBM A;  1OCC H;  2RQQ A;  2BYV E;  2F5V A;  4KN4 X;  5E3L A;  1YX5 A;  3OR1 C;  5LGN A;  1V5G A;  3T5X A;  2PN6 A;  3ZMZ A;  1ZGJ A;  2DA2 A;  3H1C A;  1MGT A;  3IWZ A;  3K1P A;  3N97 A;  1DP3 A;  4L5J A;  4ESJ A;  3VYR B;  3VYU B;  3ESW B;  4HV5 A;  5KCM A;  2HQ5 A;  3SZP A;  5GAD J;  3HZJ A;  3WTZ A;  3H0D A;  3GTP J;  2BE5 F;  5LRS A;  4D1Q A;  3VSL A;  1O57 A;  2ZFU A;  4I76 A;  4OIP F;  2HPI A;  3KP2 A;  4CIC A;  2W82 A;  4FIS A;  4XRM A;  2M3A A;  3M8E A;  5CJ9 A;  3HRM A;  4XON A;  2W57 A;  4OU0 A;  3BC8 A;  4UVC A;  3W2A A;  3NWS A;  2MW8 A;  1JGG A;  3W3C A;  1I3Q J;  3Q3S A;  1ETX A;  4DBR A;  3ABL H;  2RC4 A;  2DA3 A;  4L18 B;  2R7R A;  4BBR J;  3BR6 A;  3JRF A;  1SD6 A;  1VTN C;  5KNL A;  4A93 J;  2VBZ A;  2F5F A;  3FK6 A;  4QLC U;  2EZI A;  2M7A A;  1GVD A;  2WAF A;  4M73 A;  3FKJ A;  4FTH A;  4IHY A;  1VQ8 I;  4JOM A;  4QPQ A;  1R71 A;  1IUF A;  2CFX A;  2Q2E B;  1IRF A;  5HS7 A;  3V8J A;  1YLF A;  1ZHF A;  4ZYH A;  3GX4 X;  2BBY A;  2CG4 A;  2K7L A;  3WG9 A;  2K4B A;  1YIJ I;  4CUG A;  3SXY A;  3LNQ A;  3SEQ A;  1X3Z B;  1LQ1 A;  2PLY A;  5DCM B;  5M5Y J;  4OWR B;  4NQW B;  1FSH A;  3I58 A;  1K7A A;  1Y0N A;  2EFN A;  4AIJ A;  3CUQ B;  3K4B A;  1TW3 A;  4L9V A;  3N05 A;  2K86 A;  2L02 A;  1VQ5 I;  1BOB A;  2OQR A;  2XB5 A;  3ZQ7 A;  3FZV A;  2QQA A;  3DBR B;  2HNH A;  1OR7 C;  1JUM A;  2R7O A;  3I59 B;  4DYC A;  4UUV A;  4AVZ A;  5CQE A;  2QKL B;  3HG9 A;  3KE2 A;  2OCC H;  3QPL A;  4I0A A;  4ZYA A;  5H2F C;  4F91 B;  5K5O A;  4S04 A;  3B6C A;  3IAM 2;  1ETQ A;  3GFI A;  4BBS J;  4YRV A;  3OSF A;  5GPC A;  2NAZ A;  1ZLJ A;  3OIQ A;  1PVE A;  4HSR A;  4DIQ A;  3Q9S A;  1AU7 A;  4O3M A;  4U88 A;  3AAF A;  2R7T A;  4ANJ A;  1XN7 A;  3PJR A;  2FBH A;  3DWL E;  3U9G A;  1TL8 A;  3R4K A;  2X0L A;  2JSP A;  3DPU A;  4PSW A;  2CFO A;  4E7J A;  2RDP A;  3CO6 C;  3JSO A;  4FQG A;  1R00 A;  2WAD A;  1WH5 A;  2ZBK A;  2QLZ A;  2ZKZ A;  2DT6 A;  4C3I J;  2VOD A;  3M9A A;  2GXB A;  3E5X A;  2BXY A;  3JRC A;  3D1N I;  1KU9 A;  3S2D J;  3FXJ A;  3W6K B;  4BY7 J;  2L9S A;  1Y6I A;  4R8H A;  3IUO A;  3DPL C;  3TO9 A;  4GO1 A;  2M0C A;  3EYY A;  3L00 A;  3U2R A;  4RDU A;  1UFM A;  3WTU C;  3HOT A;  2ZJP F;  3GTO J;  4E4H A;  3RSN A;  2E1O A;  3F8M A;  5FRN A;  3VYT B;  5HDN A;  2PMU A;  1ZGA A;  4II3 A;  2FBI A;  3X2Q H;  1O3S A;  1SFO J;  1WI3 A;  3ZMS A;  4P55 A;  2E34 A;  2CUZ A;  4FHT A;  5DD8 A;  1WJC A;  4H4K C;  4N4N B;  4KYW A;  4LK1 F;  3ASO H;  2HTS A;  3CJQ B;  3VB2 A;  1PDN C;  4G6D A;  2DW4 A;  3FMR A;  1FSE A;  2BHY A;  1JT6 A;  5JLX A;  1A36 A;  4UVB A;  1N77 A;  1D5Y A;  2G9W A;  1HDP A;  2ESN A;  2HYJ A;  2KMU A;  5JHU A;  4FT8 A;  1FBS A;  5C44 J;  1A35 A;  4XRS A;  1OR7 A;  2L01 A;  1XMA A;  1MBJ A;  5AIP A;  2UXN A;  1W36 C;  2CMP A;  3ECH A;  3KPH A;  4ZYD A;  1UHW A;  3E5Q A;  3IRR A;  1U0J A;  4YEJ A;  3FXQ A;  3MZH A;  3F8C A;  1MMD A;  5ILU A;  1FOW A;  1HW1 A;  2FU4 A;  4D7N A;  4BAY A;  3FF5 A;  3A02 A;  1XDS A;  2Y31 A;  2H6C A;  4EJW A;  2LY2 A;  4AM3 A;  4RBO A;  4WXH A;  5FKL A;  3WHC A;  4J19 A;  4RGS A;  1TQI A;  2VB6 A;  3SFI A;  3VOD A;  5HVQ C;  5HOD A;  2QSG X;  2BW3 A;  2JA7 J;  3J80 Z;  1TC3 C;  4EM1 A;  4UUS A;  4L0Y B;  2TRT A;  1ZRD A;  2ZJQ F;  4G6Q A;  3ONQ A;  4ON0 A;  1XMK A;  2CQX A;  4UVA A;  4HA8 A;  1OYW A;  2I5U A;  2M0M A;  4IO9 F;  2KIM A;  1HST A;  3MCZ A;  1O3Q A;  1MDM B;  2R7X A;  3M1C A;  2LP0 A;  3WTY C;  4HDV A;  3QP5 A;  3T1B A;  4FCY A;  2KZG A;  1W0T A;  4BXU A;  3PFI A;  2K9S A;  1NK2 P;  2OBP A;  3GEZ A;  2L0K A;  1Q1V A;  3BG3 A;  5C3E J;  2Z16 A;  2DK5 A;  4A0X A;  3G73 A;  2BY1 A;  2P5L C;  2DYS H;  2FF4 A;  3HPH A;  2QEX I;  4GXO A;  3K70 D;  1WRJ A;  3ZN1 A;  3LST A;  3SFZ A;  3L2U A;  1RI7 A;  2DT5 A;  1WPK A;  1R4N B;  4M9X A;  4MLO A;  2CQK A;  4D5C A;  4HST A;  3SJM A;  1SFX A;  3RIR A;  2EZH A;  2ECB A;  1LDJ A;  2W00 A;  1BM9 A;  3C18 A;  2IXS A;  1B9M A;  3OYB A;  3S2W A;  4G12 A;  2GZW A;  3H9G A;  2L2O A;  2OU2 A;  2M2E A;  1Z9C A;  3AL0 B;  1OIS A;  2W1O A;  1QBJ A;  3CCJ I;  1TWC J;  1W5T A;  2A3S A;  4M74 A;  3CTA A;  5F1R A;  2LDU A;  2V1X A;  3OOU A;  4A0Y A;  1YYV A;  2E71 A;  2O5R A;  4LLN A;  3D5R C;  2YSR A;  5K7F A;  2JMW A;  4BY1 J;  1T8I A;  3HSR A;  4IQ4 A;  4A69 C;  3WTS C;  2BY2 A;  2JT1 A;  1FY7 A;  1YRN B;  1IW7 F;  3CD6 I;  4X6A J;  2JUG A;  2VC1 A;  1RET A;  2VKV A;  4NC6 A;  5LHH A;  1HLV A;  3KYC B;  1W36 D;  3J80 K;  4RA2 A;  2ISY A;  4AID A;  4MEX F;  1KYW A;  3CC7 I;  4L5I A;  1I50 J;  4J01 A;  1NK3 P;  1VQN I;  1B72 A;  2K9N A;  1RUN A;  5CPR B;  2QQ9 A;  4XQF A;  1MMG A;  1X1C A;  3K4N A;  4E6K G;  2LG4 A;  1SVL A;  3BOQ A;  5DDG A;  3BQY A;  1LPQ A;  3I3L A;  1FBU A;  1SMY F;  2UZK A;  4XLH A;  3MN2 A;  1T08 B;  4GDF A;  2VQG A;  3MKL A;  3V42 A;  1FOK A;  4MHG A;  1SEU A;  3OYL A;  2EV5 A;  3FIS A;  5E1W A;  2F4M B;  2IGO A;  1Z0X A;  2V1N A;  2VJ4 A;  2EFP A;  4PJJ A;  4BQN A;  1FP2 A;  4UB8 C;  4WX9 A;  2VI6 A;  4CHU A;  5KAI C;  3TKY A;  2X1C A;  1K83 J;  5D6E A;  4IOC F;  2E2I J;  1Z67 A;  4PDK A;  2YX7 A;  4CDG A;  2HKO A;  6PAX A;  5FKN A;  5JI6 A;  4PK4 A;  2YUS A;  3BG6 A;  3Q0W A;  4E7L A;  4KN7 X;  2OAZ A;  2Y48 A;  3ML6 A;  5HS8 A;  1BR4 A;  2M1B A;  3LSK A;  1RR7 A;  2BHZ A;  1ZRF A;  2GQQ A;  1R22 A;  3HEF A;  1WWX A;  4N9H A;  2PI0 A;  4PJM A;  2D5V A;  4KT5 C;  4AIK A;  3LQR A;  3KET A;  1KQ9 A;  2ZCW A;  1IRX A;  2GXG A;  5ILS A;  2A61 A;  2DOD A;  1W5C C;  1UAA A;  1IN5 A;  3FHZ A;  2M34 A;  4C2U A;  5B66 C;  4RB2 C;  1WGX A;  3FXK A;  2EJR A;  1JKP C;  5IPA A;  4G7H F;  1X2M A;  1IN8 A;  4IZZ A;  5FLX Z;  1XMX A;  3ZGK A;  3G1O A;  1UST A;  3CQZ J;  2A6H F;  3A0H C;  3OL3 A;  1JJ6 C;  1N78 A;  3CDL A;  3I55 I;  1U2W A;  3IP4 B;  5LEJ A;  1Y39 A;  2RVC A;  1F43 A;  2LBF A;  3HUG B;  2IA2 A;  2K9L A;  3CCS I;  2M8E A;  4L9N A;  1SD4 A;  2CH0 A;  3EET A;  5IOY A;  4EV0 A;  4XLE A;  3S2H J;  1RZ4 A;  4GYI A;  2FOW A;  5E3N A;  4I09 A;  3RQ4 A;  4M71 A;  5D6F A;  3RCO A;  2FA5 A;  4A3J J;  5ERI A;  2K02 A;  1FIA A;  1FYM A;  4ABZ A;  3VSK A;  3OOP A;  3QU6 A;  2H1K A;  3A03 A;  4JX4 A;  3SZT A;  3GTG J;  3FHN A;  4XNF A;  1ZRE A;  4LMY A;  1F9N A;  2VUM J;  3CES A;  3E1S A;  2A5Y B;  2E5N A;  3RJP A;  3EUA A;  4IF4 A;  5DYM A;  2XGD A;  3BT9 A;  4NUB A;  4F93 B;  3K6G A;  5IYC J;  4C9Y A;  3TO6 A;  3RKX A;  2KKO A;  2IA0 A;  2KRC A;  3LAP A;  3BZK A;  1DU0 A;  4WXC A;  1LFB A;  3I5U A;  4KUM A;  1JUS A;  2DOA A;  2VOP A;  2NXN B;  2ELK A;  2I10 A;  2HU9 A;  5J47 A;  5M3M J;  5HDK A;  1FEX A;  2ID3 A;  2JVG A;  2V6C A;  3I71 A;  2L5Q A;  4LB6 B;  4M9Z A;  1FX7 A;  5CQG A;  2V7F A;  3BTL A;  1HW2 A;  3PUF A;  4XLA A;  1RC9 A;  2ADU A;  2CU7 A;  5TRD A;  4DZJ A;  2COB A;  2KRF A;  5EYR A;  2A6T A;  1MH3 A;  4O5V A;  1BI1 A;  4E70 A;  3IL2 A;  3CLQ A;  5J1R A;  4RAG A;  3GFJ A;  2JZY A;  3S93 A;  2R7D A;  4PFP A;  1U5T C;  2Z99 A;  4QIW N;  3FBN B;  5HLH A;  1KON A;  3GTM J;  1YJW I;  2QCO A;  4F55 A;  2O7O A;  3DV8 A;  1P2F A;  1VF9 A;  5FLX K;  2P81 A;  2LRE A;  2CW8 A;  4EVI A;  1K4S A;  2CGP A;  2NOJ B;  2L54 A;  4V2F A;  2VON A;  2JWT A;  2ZFW A;  4OAZ A;  3DTI A;  1MW7 A;  2PBI A;  5JHF A;  3J81 Z;  2MD5 A;  1J5Y A;  2IA1 A;  2XRL A;  3RKY A;  4A3K J;  3ZN0 A;  3C3W A;  3F6V A;  4Y7N J;  1J75 A;  2XAG A;  2NVU B;  4A3G J;  2ECC A;  4Y13 A;  3WGH A;  3HOU J;  1QPI A;  4JX5 A;  4BEH A;  4IXA A;  1I27 A;  3JRA A;  3HPG A;  5E3M A;  3PFY A;  5FKM A;  2PEX A;  2KHM A;  4XKW A;  4B43 A;  5ICE A;  1LVK A;  1OCP A;  3B73 A;  1R23 A;  3E6D A;  2R7U A;  2XAQ A;  3R0J A;  4ZZD A;  5K1Y A;  3QAH A;  5K5R A;  1IG7 A;  1OJL A;  4BDZ A;  1D5V A;  3T8T A;  3DBH B;  4CZZ A;  3TOA A;  5GAH J;  2MFZ A;  4BL0 B;  1IXS B;  1ERD A;  1QRY A;  2R4G A;  3DCF A;  3EUH A;  1H9T A;  2HR3 A;  5CVV A;  1PP7 U;  4KIB A;  1D1C A;  2DXI A;  3HGG A;  3CJR B;  2ZSH B;  4BH9 A;  3K7A J;  5E79 C;  2VKH A;  2DPD A;  2QSF X;  1GVJ A;  1MBE A;  2CSO A;  5AON A;  1Q1H A;  4AIH A;  4LGW A;  4NB5 A;  1N75 A;  3TL4 X;  2J5O A;  1WHU A;  3SQN A;  1W5S A;  3HOS A;  1IF1 A;  4BQO A;  2R93 J;  2LSO A;  3LSI A;  1RUO A;  3WE2 A;  1BJA A;  1FJL A;  2HOE A;  3W6V A;  1DGR M;  4HNU A;  4MNU A;  3H36 A;  3R0A A;  1V4R A;  4LFU A;  1ETV A;  1W7P A;  4B8X A;  1GV5 A;  3E3V A;  1U5T A;  2CJJ A;  4RAY A;  3F8F A;  3OYD A;  1VZ0 A;  1KA8 A;  1R58 A;  2EA2 A;  3J81 K;  2ID6 A;  4EEF G;  2EIN H;  2W85 A;  4XLN F;  1LB2 A;  2LYC A;  3KX2 A;  2DU9 A;  4BHP A;  2CW7 A;  5IT3 A;  2Y0M A;  3B02 A;  5BPD A;  4EAT A;  2ELJ A;  1Y1V J;  5HDG A;  1K79 A;  2DMN A;  1LKX A;  2DA1 A;  2F6C A;  1OMI A;  3GXO A;  1ZTR A;  2UWM A;  2KLO A;  3ULQ B;  2WV1 A;  1NHA A;  3UKG A;  3ISP A;  1MMN A;  2NNY A;  2EH3 A;  3G3Z A;  2X51 A;  2DPU A;  3SDB A;  2F4I A;  2WC2 A;  3FM5 A;  1SVO A;  1KZH A;  3R60 A;  3CCM I;  1CQT A;  1OQY A;  4AYB A;  3D5L A;  1Z3X A;  2DLL A;  1O3T A;  2K27 A;  3LFK A;  4BE0 A;  2CV1 A;  1R1U A;  1ULY A;  3K4M A;  3LSM A;  5CVJ A;  1S7A A;  3EQL F;  2BV6 A;  1XSD A;  2IS2 A;  4U0Y A;  3QWL A;  2X6W A;  3I9V 2;  3MAJ A;  1MH4 A;  3DF8 A;  4GRI A;  5DCF A;  4ZC3 A;  1ORK A;  2R7Z J;  2V1D A;  1YQA A;  3RPQ A;  4Z6Y A;  5BS6 A;  1H0M A;  2Y75 A;  4ZDO A;  2EQR A;  3FDY A;  2H8W A;  4A3C J;  2HXI A;  2XAU A;  5L3B A;  1TQM A;  2DMU A;  3W2W A;  5EGO A;  5ED4 A;  1GV2 A;  4I2O A;  1XGO A;  2ZC2 A;  1IC8 A;  1I1G A;  1XTA A;  2L9V A;  2FOK A;  3S1N J;  2V9P A;  3DEE A;  4FE4 A;  2EIL H;  4CH7 A;  5F1J A;  5ILV A;  4WWC A;  1XS9 A;  4JYK A;  4U0V A;  1ZYR F;  2CW0 F;  4C2M J;  3CDI A;  4XRF A;  3T0Y A;  2GIZ A;  2H94 A;  3EPZ A;  2OF7 A;  4PJ0 C;  1IDY A;  2ZME C;  1R5G A;  1AKH A;  2VKE A;  4FE7 A;  2V9K A;  2XPV A;  2JVH A;  5DD4 A;  4HZF A;  2IGK A;  4AUX A;  2M45 A;  3F0C A;  4BJ5 C;  2IVM A;  1ZGW A;  3IRQ A;  3HRU A;  1QNT A;  4BXX J;  4HRI A;  2LY1 A;  5FRO A;  1X4P A;  3KCC A;  2DOE A;  2OZ6 A;  4ITV A;  4YEL A;  3O2P E;  2Q0O A;  3MKW B;  2HDD A; 
#chains in the Genus database with same CATH homology
 4P5O A;  4G7O F;  2H6B A;  5D5V B;  1HSJ A;  4PCQ A;  2XKO A;  4YG2 F;  3RPU A;  3F6O A;  5EEH A;  3TDZ C;  4M6Y A;  5CVR A;  3MEX A;  2WTE A;  2ZNZ A;  4BNC A;  3KP7 A;  2DQL A;  3E6M A;  1MZB A;  5HLG A;  2IP2 A;  4N0B A;  2G7H A;  1T98 A;  4KNY A;  2MC3 A;  1XD7 A;  2O3F A;  1G3S A;  1Y0U A;  3PQJ A;  4RAZ A;  2QEN A;  3DQV C;  3VEP A;  1XGN A;  1EH8 A;  1QZZ A;  1I1S A;  1JE8 A;  4A0Z A;  3VOE A;  2FE3 A;  3QPH A;  4XBF A;  3BJO A;  3TDU C;  1FC3 A;  2OA4 A;  2QUF A;  4GCV A;  4TV7 A;  2XIG A;  1CF7 A;  4LLG F;  2NNN A;  1EV7 A;  1XSV A;  3V7C A;  1T6S A;  4Q4Z F;  1JGS A;  2ZME A;  3HTU A;  2MH9 A;  3FWE A;  2PMH A;  3HRT A;  2MBF A;  3TO7 A;  2FNP A;  2P7C B;  1ZG3 A;  2Z9O A;  4YFN F;  3BWG A;  3F23 A;  2M30 A;  3GZ6 A;  3C7J A;  3ERE D;  1MD0 A;  4BYY A;  1OKR A;  2FEZ A;  4HAM A;  4OIN F;  1BC7 C;  1T0F A;  1TNS A;  4KMU X;  3ZMD A;  3K0L A;  3WOD F;  1E17 A;  1YW7 A;  3I0T A;  3LA2 A;  1QPM A;  4ENK A;  1PP8 F;  3ZMV A;  3GW2 A;  1USS A;  4YIF A;  4IPA A;  4I98 B;  4GYG A;  3RYP A;  2AS5 F;  4MGR A;  2R3S A;  1P92 A;  2RGV A;  3BJ6 A;  4UV8 A;  4A2U A;  2Z33 A;  4P96 A;  1KU7 A;  1G4D A;  5CVI A;  3CUQ A;  5DUK A;  2VBW A;  2AXL A;  2P5V A;  1ON1 A;  2VOO A;  3IHU A;  2NS0 A;  1REP C;  2WV0 A;  3D0S A;  3LQQ A;  5EEG A;  1UB9 A;  1QGP A;  3I4P A;  1FZP B;  1ODD A;  5ICC A;  1L0O C;  1B4A A;  3LA7 A;  2ZO4 A;  2F2E A;  3Q5F A;  3QP6 A;  4WCG A;  3LAJ A;  2CYY A;  2VE8 A;  5FGM A;  2HEO A;  4MTD A;  5D5X B;  4IVN A;  3R61 A;  3ABT A;  5D4S A;  4WK8 F;  1XB4 A;  1IRG A;  1KU2 A;  1IZ1 A;  4KIC A;  4MEY F;  2HGC A;  3REO A;  3M8F A;  3JW4 A;  5L3E A;  2X4H A;  4IRG A;  4NHJ A;  3GFM A;  4IHT A;  2CWE A;  2ELH A;  2YPR A;  1P4W A;  2RNJ A;  3FX3 A;  4ASN A;  3WE3 A;  5L3C A;  4OIO F;  3KP5 A;  1F4K A;  2RN7 A;  5H6R A;  1FNN A;  2GIV A;  4L9T A;  2O03 A;  4ENM A;  3VFZ A;  3M1E A;  5FB2 A;  1MJ9 A;  2JPC A;  3FM3 A;  2BGC A;  3KZY A;  4BHC A;  5FO5 A;  4EJO A;  1YS7 A;  1WQ2 A;  5JVT A;  4OIQ F;  1XCV A;  3H92 A;  1DPR A;  1STZ A;  3L9F A;  2ETH A;  2D2W A;  5L3D A;  3EDP A;  3V7R A;  1Z05 A;  2ACJ A;  2O8X A;  3F72 A;  4I01 A;  2UXX A;  4P9U A;  1BIB A;  1SD7 A;  1TNT A;  3HSF A;  2KIF A;  4EJU A;  1EH7 A;  1IN7 A;  4Y17 A;  1UHM A;  3ROU A;  2O6G E;  2TDX A;  4LLL A;  3O6B B;  2EV6 A;  4ESF A;  1K78 A;  2LF8 A;  3ZMU A;  4LB5 A;  1P6R A;  4HX8 A;  3RTR A;  2QZ8 A;  2M5W A;  2HS5 A;  1KYZ A;  4I0B A;  4KMF A;  1YFH A;  3GYH X;  2IW5 A;  2VT2 A;  3TGN A;  3CDH A;  3FXU A;  1ZG5 A;  3HHH A;  1YS6 A;  4HQM A;  2O0Y A;  3DXJ F;  5BOX A;  2FNA A;  4D0P A;  2QYO A;  2P4W A;  1R7J A;  1HW5 A;  1WI9 A;  1BOA A;  2HKX A;  4P9F A;  2PQ8 A;  3HIF A;  2XVC A;  1I6X A;  4UXN A;  2F5E A;  3V8K A;  3L7W A;  2D1H A;  1FBQ A;  2FML A;  4RGX A;  1BI3 A;  3N4M A;  2PJP A;  2DO7 A;  2EB7 A;  2COM A;  3DP7 A;  1YIO A;  4HF2 A;  1FLI A;  1R1T A;  1W7P B;  1U5T B;  5KVR A;  3CO7 C;  3QU3 A;  2EFW A;  2EV0 A;  2K4J A;  2A68 F;  3IKV A;  1O7L A;  3WU1 B;  4M6X A;  5ICG A;  5JR3 A;  1JHH A;  5JFR A;  4KFC A;  2RV8 A;  2MH2 A;  1Z91 A;  3ABU A;  2F5C A;  5LLQ A;  1DPU A;  3KEO A;  2ZNY A;  4A5M A;  1KU3 A;  3LA3 A;  5LHI A;  1TW2 A;  1IN4 A;  2HTJ A;  5FFZ A;  4Q5S F;  3P9I A;  2HWV A;  3BPX A;  2YR2 A;  1BI2 A;  5J6X A;  3F22 A;  3K1M A;  1D8K A;  2FQ3 A;  4G94 A;  4DNC A;  1ZH5 A;  4CXF A;  2LNB A;  1MJA A;  5A2Q K;  1BN5 A;  5CYV A;  4EGZ A;  3JTG A;  3P7N A;  2Z3Y A;  4IJA A;  1J0R A;  2F5D A;  3E6B A;  2HDC A;  1B9N A;  3U1D A;  1T2K A;  4YII A;  1B6A A;  1BI0 A;  2DTR A;  4ESB A;  2P6S A;  4EM2 A;  1W4M A;  1ZAR A;  1Z6T A;  2XKP A;  1IXR C;  1W7P D;  3BY6 A;  2DFI A;  3F8B A;  4LG0 A;  1FPQ A;  4HV6 A;  1YW8 A;  5FD5 A;  3KP4 A;  3T8R A;  3BRO A;  1YTY A;  2C6Y A;  3L2C A;  1V3F A;  4JQF A;  2NRA C;  2ZJ2 A;  1ZG1 A;  2W84 A;  2HYF A;  1FT9 A;  4IHS A;  1MKM A;  4N9I A;  4Q47 A;  2XHK A;  2E7X A;  4HW0 A;  2GWR A;  2WWY A;  3I64 A;  2JPB A;  2VBX A;  2E1C A;  2V1U A;  2HZT A;  4M72 A;  4EMS A;  3W6J B;  2VC0 A;  2Q8K A;  4B09 A;  2QBY A;  4M9S A;  1OYY A;  4KIF A;  2DAO A;  4A6E A;  5DEQ A;  3ZMT A;  1LEB A;  1SAX A;  1SD5 A;  4PZJ A;  2EK5 A;  2P6T A;  3FMQ A;  3WTT C;  4ZYG A;  2DK8 A;  2ZME B;  4UV9 A;  5D5U B;  4U7D A;  1P4A A;  1GXP A;  3H3Z A;  1J59 A;  3F21 A;  1DP7 P;  2KIU A;  1FYL A;  4WF2 A;  3QPT A;  5DV5 A;  2QQB A;  4IRH A;  3WGG A;  1G3T A;  2MLK A;  1TLH B;  4XLP F;  2E7W A;  1XSX A;  1XGM A;  1QZY A;  2W25 A;  3K9T A;  1XCB A;  3IWF A;  4EQQ A;  1KGS A;  1R5H A;  2M87 A;  3BZ6 A;  1DDN A;  1TQP A;  3NQO A;  4Q48 A;  5FD6 A;  2FMY A;  1BIA A;  1OPC A;  4HOB A;  4HLX A;  5F64 A;  1IUY A;  2XRN A;  3KLN A;  2OZU A;  3COA C;  4RB3 C;  4Z2Y A;  3GO5 A;  2QVO A;  2XV4 S;  4RS8 A;  4HYE A;  4G9Y A;  5F6F A;  3K1N A;  4MQ9 F;  2STW A;  5H6Q A;  2FBK A;  1F5T A;  2D1V A;  3IC7 A;  3CUQ C;  2YU3 A;  2VE9 A;  2PG4 A;  2JTV A;  3JTH A;  1ZLK A;  4ZYE A;  5D4R A;  4HX4 A;  2DQR A;  3BJA A;  4HBL A;  4AD9 A;  3RI4 A;  4HF1 A;  1HXD A;  1RNL A;  4OMZ A;  1FWZ A;  4AVP A;  1SMT A;  1G3Y A;  3GZ5 A;  5CLS A;  1H9G A;  4RGR A;  5L3G A;  1ZAO A;  3FXR A;  2QM3 A;  1KQ0 A;  1LVA A;  5HOO A;  2CO5 A;  4LK0 F;  3QRF F;  2XAF A;  3O3K A;  2L3D A;  3LWF A;  3DEU A;  5KK1 A;  4QWQ A;  5LGT A;  1GXQ A;  2EA4 A;  3WGI A;  4YFX F;  2IJL A;  4I7H A;  5LGU A;  5HS9 A;  2P8T A;  3RKW A;  1S6L A;  3OV8 A;  5H20 A;  5LEK A;  3HHG A;  3JAM Z;  2FSW A;  2EFQ A;  3V7S A;  4IRI A;  2OQG A;  3MQ0 A;  3RYR A;  1XDU A;  5E8I A;  2Q2E A;  2D45 A;  2V79 A;  4HF0 A;  3WTX C;  4U7B A;  3DKW A;  2ZXJ A;  5DCM A;  4NQW A;  3BP8 A;  3GWZ A;  1U8R A;  4OOI A;  3L09 A;  5IT9 Z;  4HX7 A;  2ISZ A;  3V8L A;  3JSP A;  2Z5U A;  3I59 A;  2DBB A;  2A07 F;  4BHB A;  5LHG A;  3CJN A;  1K78 B;  4JBA A;  3P9C A;  4U0W A;  2HYG D;  2V9V A;  5DUI A;  3Q9V A;  4EM0 B;  3MZY A;  1HKS A;  2G7U A;  1OYI A;  4KA4 A;  1XGS A;  3KP6 A;  2XGX A;  3JAM K;  2YX4 A;  1PUE E;  2XAJ A;  4JK1 X;  2HQN A;  3GF2 A;  5FFX A;  4H0E A;  2DI3 A;  1RIO H;  4G7Z F;  1DUX C;  4EJT A;  1D3Y A;  3F8N A;  3DPT A;  5L3F A;  1S8N A;  2XRO A;  4MTE A;  3CUO A;  2L4A A;  2OD5 A;  3H3U A;  4XSX F;  2H09 A;  5IT9 K;  5K5Q A;  3KP3 A;  3CLO A;  1L3L A;  2H27 A;  5J8C A;  2LKP A;  3WU0 A;  3GVA A;  2RKH A;  5E18 F;  4AWX B;  1KQ8 A;  3FMS A;  2BEO A;  3BPV A;  1AOY A;  1CGP A;  1G6N A;  1Z7U A;  5E17 F;  2HQR A;  2GA1 A;  3NRV A;  4A6D A;  4CO8 A;  3I53 A;  2J5P A;  4S05 A;  2FXA A;  3J7A O;  1R36 A;  1AWC A;  4A12 A;  1I5Z A;  1MDM A;  1O3R A;  1HKT A;  5E8G A;  3K2Z A;  4CYD A;  2JSC A;  4G8X A;  1HKQ A;  2R7F A;  5HLI A;  1IN6 A;  5BQT A;  3E6C C;  4RGU A;  1LNW A;  2GA2 A;  1ONV A;  4KIG A;  1IAW A;  1B59 A;  2KJC A;  4ZH4 F;  1B1B A;  3HYI A;  2E1N A;  2L4M A;  5E1Z B;  4FX4 A;  3E5U A;  4ZZL A;  3TOB A;  3MFK A;  5J8F A;  1D8J A;  3SHF A;  3RDI A;  5LBQ A;  5A2Q Z;  2LF7 A;  3ZPL A;  3ELK A;  1J7K A;  1GHC A;  3DFG A;  1SFU A;  1G3W A;  2EFO A;  4KDP A;  5TJJ A;  3M7G A;  5D5W B;  2XAH A;  1X3U A;  1WKM A;  3P9K A;  4RB0 A;  4WXD A;  2QWW A;  1JXS A;  1F1Z A;  1JHF A;  1QO0 D;  1FP1 D;  2KJB A;  1SFE A;  4DQ2 A;  4LG0 B;  2O61 A;  1LJ9 A;  1T39 A;  2IT0 A;  4LJZ F;  4F7Z A;  4R79 A;  3K69 A;  3QOP A;  3HTS B;  4Y15 A;  1MJB A;  4HLY A;  1U3E M;  2HFH A;  1E2X A;  4ETS A;  2NYX A;  1YO5 C;  2A6E F;  5CVU A;  4OIR F;  2P7V B;  1T38 A;  1J9I A;  5D8K B;  3KZZ A;  2FRH A;  1LDK B;  2STT A;  4BQA A;  1IXC A;  2GAU A;  1LDD A;  4FX0 A;  3GFL A;  5E20 A;  4EGY A;  2B0L A;  2P5K A;  4L9J A;  4YFK F;  3F3X A;  5ICF A;  2QBY B;  1YG2 A;  4ENN A;  2MLG A;  3HRS A;  1HQC A;  1EH6 A;  3MWM A;  4ENJ A;  3TQN A;  3EYI A;  3HUG A;  3KEQ A;  1Z1D A;  3PQK A;  3BDD A;  3NEU A;  2RQP A;  2ESH A;  3E97 A;  1C0W A;  3C1D A;  5D8L B;  3V4G A;  1BBY A;  4L0Z B;  2XAS A;  2VBY A;  4O6J A;  4A5N A;  1J2X A;  1A04 A;  2JRT A;  2IPQ X;  4EJV A;  5LRR A;  1S29 A;  4UHT A;  1ON2 A;  1K6O A;  4UNO A;  3WTV C;  4MQV A;  2VN2 A;  4CGZ A;  4RB1 A;  1ZRC A;  2VXZ A;  1P4X A;  2EWN A;  2VT3 A;  3ZP5 A;  4K2E A;  5E1X A;  4HDU A;  4PGG A;  3HSE A;  2MA3 A;  4XSZ F;  1UCR A;  3ECO A;  4PGH A;  1BC8 C;  1Z6R A;  1TBX A;  1ZN2 A;  3WTW C;  3KFW X;  1HBX G;  1S3J A;  1WSU A;  1TTY A;  5BPI A;  2A69 F;  5BMZ A;  1FYK A;  3KLO A;  3I54 A;  2PFB A;  3IKT A;  2IRF G;  4HQE A;  5AIQ A;  4I02 A;  1CF7 B;  1YW9 A;  1LEA A;  4OMY A;  4LD5 A;  3GLX A;  1R1V A;  4GGG A;  4R1H A;  3GUD A;  1O7F A;  1U78 A;  2XUB A;  2W24 A;  1U6G A;  3R6S A;  1QQI A;  1S7O A;  2BYV E;  4KN4 X;  5LGN A;  3T5X A;  2PN6 A;  3ZMZ A;  1ZGJ A;  1MGT A;  3IWZ A;  3K1P A;  3N97 A;  4L5J A;  4ESJ A;  4HV5 A;  3SZP A;  3WTZ A;  2BE5 F;  5LRS A;  1O57 A;  4OIP F;  3KP2 A;  4CIC A;  3M8E A;  5CJ9 A;  3HRM A;  2W57 A;  4OU0 A;  4UVC A;  2RC4 A;  4L18 B;  1SD6 A;  1VTN C;  2VBZ A;  2F5F A;  4QLC U;  4M73 A;  2CFX A;  1IRF A;  5HS7 A;  3V8J A;  1YLF A;  1ZHF A;  4ZYH A;  3GX4 X;  2BBY A;  2CG4 A;  2K7L A;  3WG9 A;  2K4B A;  3SXY A;  1LQ1 A;  2PLY A;  5DCM B;  1FSH A;  3I58 A;  1K7A A;  2EFN A;  4AIJ A;  3CUQ B;  4L9V A;  1TW3 A;  2K86 A;  2L02 A;  2OQR A;  3ZQ7 A;  3FZV A;  2QQA A;  3I59 B;  4UUV A;  3KE2 A;  4I0A A;  5K5O A;  4S04 A;  3GFI A;  2NAZ A;  1ZLJ A;  3Q9S A;  4O3M A;  4U88 A;  3AAF A;  1XN7 A;  2FBH A;  3U9G A;  3R4K A;  2X0L A;  2RDP A;  3CO6 C;  3JSO A;  1R00 A;  2ZBK A;  2QLZ A;  2ZKZ A;  2VOD A;  3M9A A;  2GXB A;  3E5X A;  1KU9 A;  3W6K B;  4R8H A;  3DPL C;  3TO9 A;  4GO1 A;  3EYY A;  3L00 A;  3U2R A;  3HOT A;  1UFM A;  3WTU C;  3F8M A;  5HDN A;  2PMU A;  1ZGA A;  2FBI A;  1O3S A;  3ZMS A;  4P55 A;  4FHT A;  5DD8 A;  4KYW A;  4LK1 F;  2HTS A;  3VB2 A;  1PDN C;  4G6D A;  2DW4 A;  3FMR A;  1FSE A;  4UVB A;  2G9W A;  5JHU A;  2ESN A;  4FT8 A;  1FBS A;  1OR7 A;  2L01 A;  1XMA A;  5AIP A;  2UXN A;  4ZYD A;  3ECH A;  1UHW A;  3E5Q A;  3IRR A;  3FXQ A;  3MZH A;  3F8C A;  5ILU A;  1HW1 A;  2FU4 A;  4BAY A;  3FF5 A;  1XDS A;  2H6C A;  4EJW A;  4WXH A;  4RGS A;  1TQI A;  3VOD A;  5HVQ C;  3J80 Z;  4EM1 A;  4L0Y B;  1ZRD A;  4G6Q A;  4ON0 A;  1XMK A;  4UVA A;  4HA8 A;  1OYW A;  2KIM A;  1HST A;  3MCZ A;  1O3Q A;  1MDM B;  3WTY C;  4HDV A;  3QP5 A;  3T1B A;  4BXU A;  3PFI A;  2OBP A;  3GEZ A;  4A0X A;  2DK5 A;  3G73 A;  2P5L C;  2FF4 A;  4GXO A;  1WRJ A;  3ZN1 A;  3LST A;  3SFZ A;  1RI7 A;  2DT5 A;  4M9X A;  2CQK A;  1SFX A;  3RIR A;  1LDJ A;  1BM9 A;  3C18 A;  1B9M A;  3S2W A;  2GZW A;  2OU2 A;  1Z9C A;  1QBJ A;  1W5T A;  2A3S A;  4M74 A;  3CTA A;  5F1R A;  2LDU A;  2V1X A;  4A0Y A;  1YYV A;  4LLN A;  2YSR A;  3HSR A;  3WTS C;  2JT1 A;  1FY7 A;  1IW7 F;  2VC1 A;  5LHH A;  3J80 K;  2ISY A;  4MEX F;  1KYW A;  4L5I A;  1RUN A;  2QQ9 A;  3BOQ A;  5DDG A;  1FBU A;  1SMY F;  2UZK A;  1FOK A;  4MHG A;  2EV5 A;  5E1W A;  2EFP A;  1FP2 A;  4WX9 A;  4CHU A;  3TKY A;  5D6E A;  4PDK A;  2YX7 A;  4CDG A;  2HKO A;  6PAX A;  5JI6 A;  4KN7 X;  2OAZ A;  2Y48 A;  3ML6 A;  5HS8 A;  2M1B A;  1ZRF A;  2GQQ A;  1R22 A;  4N9H A;  1WWX A;  2PI0 A;  4KT5 C;  4AIK A;  3LQR A;  3KET A;  1KQ9 A;  2ZCW A;  2GXG A;  5ILS A;  2A61 A;  1IN5 A;  3FHZ A;  4RB2 C;  2EJR A;  4G7H F;  1IN8 A;  5FLX Z;  1UST A;  2A6H F;  1U2W A;  5LEJ A;  2RVC A;  2IA2 A;  2M8E A;  4L9N A;  1SD4 A;  3EET A;  4EV0 A;  1RZ4 A;  4GYI A;  4I09 A;  4M71 A;  5D6F A;  2FA5 A;  5ERI A;  2K02 A;  1FYM A;  3OOP A;  3QU6 A;  3SZT A;  1ZRE A;  4LMY A;  1F9N A;  2A5Y B;  3RJP A;  4IF4 A;  5DYM A;  3TO6 A;  3RKX A;  2KKO A;  2IA0 A;  3LAP A;  4WXC A;  3I5U A;  4KUM A;  2VOP A;  5HDK A;  2V6C A;  3I71 A;  4LB6 B;  4M9Z A;  1FX7 A;  1HW2 A;  2ADU A;  5TRD A;  2KRF A;  4O5V A;  3IL2 A;  1BI1 A;  4E70 A;  3GFJ A;  2JZY A;  2R7D A;  1U5T C;  2Z99 A;  5HLH A;  3DV8 A;  1P2F A;  5FLX K;  4EVI A;  2CGP A;  2L54 A;  2VON A;  2ZFW A;  2PBI A;  3J81 Z;  2MD5 A;  1J5Y A;  2IA1 A;  3RKY A;  3ZN0 A;  3C3W A;  3F6V A;  1J75 A;  2XAG A;  4Y13 A;  3WGH A;  4IXA A;  1I27 A;  2PEX A;  5ICE A;  3B73 A;  1R23 A;  3E6D A;  2XAQ A;  3R0J A;  4ZZD A;  5K1Y A;  3QAH A;  5K5R A;  1D5V A;  3T8T A;  4CZZ A;  3TOA A;  1IXS B;  3EUH A;  1H9T A;  2HR3 A;  5CVV A;  1PP7 U;  4KIB A;  4BH9 A;  2DPD A;  1GVJ A;  2CSO A;  5AON A;  1Q1H A;  4AIH A;  4LGW A;  4NB5 A;  2J5O A;  3SQN A;  1IF1 A;  1W5S A;  3HOS A;  2LSO A;  1RUO A;  3WE2 A;  1BJA A;  2HOE A;  4MNU A;  3R0A A;  1V4R A;  4LFU A;  1W7P A;  4B8X A;  3E3V A;  1U5T A;  4RAY A;  3F8F A;  1KA8 A;  1R58 A;  2EA2 A;  3J81 K;  4XLN F;  2W85 A;  1LB2 A;  2DU9 A;  4BHP A;  5IT3 A;  2Y0M A;  3B02 A;  5BPD A;  5HDG A;  1K79 A;  1OMI A;  3GXO A;  2UWM A;  3ULQ B;  1NHA A;  3ISP A;  2NNY A;  3G3Z A;  2DPU A;  3FM5 A;  2WC2 A;  3R60 A;  3D5L A;  2DLL A;  1O3T A;  2K27 A;  3LFK A;  1R1U A;  1ULY A;  5CVJ A;  1S7A A;  3EQL F;  2BV6 A;  1XSD A;  4U0Y A;  3MAJ A;  3DF8 A;  5DCF A;  2V1D A;  1YQA A;  3RPQ A;  5BS6 A;  1H0M A;  2Y75 A;  5L3B A;  1TQM A;  5ED4 A;  4I2O A;  1XGO A;  1I1G A;  2FOK A;  4WWC A;  5ILV A;  4U0V A;  1ZYR F;  2CW0 F;  4XRF A;  3T0Y A;  2H94 A;  1R5G A;  5DD4 A;  4HZF A;  2M45 A;  2IVM A;  3IRQ A;  3HRU A;  1QNT A;  3KCC A;  2OZ6 A;  3O2P E;  2Q0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...