5DZ9A

Streptococcus agalactiae agi/ii polypeptide bspa c-terminal domain (mut)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of Cell Wall-anchored Polypeptide Adhesin BspA in Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae serotype iii (strain nem316)
molecule tags Cell adhesion
molecule keywords BspA
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A02
1AMXA 5DZ9A 2X9YA 3UXFA 2WZAA 2WOYA 2XTLA 2X9XA 2Y1VA 3RPKA 3PG2A 3HR6A 4IGBC 4P0DA 2WQSA 2X9ZA 4HSQA 3QE5A 3QDHA 4OFQA 4Z1PA 2F68X 2OKMA 4IGBB 3HTLX 3KPTA 2X9WA 3PF2A 5DZAA 3RKPA 3V10A 4UZGA 2Z1PA 3OPUA 4IGBA 4Z23A 2F6AA 4IGBD
chains in the Genus database with same CATH superfamily
1MFDH 1X7TA 5D4JA 1I7UA 2NW2A 5C7XH 2FQFA 5HY9A 3GS4A 4PJHE 4W9LC 1OV8A 2FZ3B 3QNZA 4CADA 3Q2NA 3EZ8A 3V5DA 4LLWB 3MNMA 2Z4QB 4DKFL 2UXTA 2ZP8A 3I9AA 5I75B 4PRBB 2DMHA 3HI6H 4JZOB 1NC2A 1TOXA 2MHAB 3L3KA 5HGGS 4G8AC 4L8DB 1K5NA 1HHIA 4ZFZB 3ZQWA 3FO9B 1BW8A 3U9UB 4Z8FL 3GDCA 1YJDH 5F89B 2EVJA 1YPZB 1VESA 3SO5A 4F57L 3V4PH 4ELDA 1IM9B 3BD3A 1JN6A 4TOYL 1HX0A 1QVOA 3EGXA 3IKCA 1EMTL 4UTCA 2GITA 1ZTMA 4Q89A 1P5UB 1HKFA 3PWPE 4BBWA 3WAJA 1JNHA 3BQUB 2KL6A 1IFRA 5J13C 5D1ZI 4DK5A 5KSBF 3JTBA 4GJTB 1OAQL 3MRHB 4PCKA 5TK4A 3QUXA 1QSZA 4KVCL 4FJYA 3C9NA 5D7SL 3N5AA 4M8RA 4O51B 4A2GA 3QO1A 5C0JA 4MNHA 3MLVH 4GMTH 3QSKB 4G6FD 2YGNA 3BZ4A 4LP4A 1FNEA 5GGUB 1GS6X 1QRKA 1TDQA 2QHLA 3L7FA 3TBSB 2V4LA 1HWHB 4RMBA 1S7UA 5T3XL 1DJWA 1T83A 3BVWA 2QT6A 3GXTA 1AD9B 2WN2A 3DETC 2WSPA 3V0DA 3GB7B 2EXYD 3KBPA 1JPTH 1MAJA 5EZJB 1UXSA 1ECZA 3TO4C 3OKEA 1RUAH 4IBLT 2VQ1A 2IWGA 3BESR 5D7LE 4ESKA 2CJSA 2VDMB 3DHJA 2JTDA 3IPFA 3HE6C 3QUYA 3RI5F 4OQ1A 4IDJH 1RPUA 4B3VA 3NPSB 2VL5B 1MXDA 1JGIA 3DJTA 4JRXB 4U0QB 3QWRA 2XNAB 2KLSA 4OLYL 4OGAC 1EXUB 2HG5A 4ZNEE 4K2UL 1J48A 5FFLA 1A5FL 2X4QB 4XCYB 1XMWA 1OE1A 2YPVA 1JSYA 4OLVL 1EHLL 3VYPA 4I9WD 4AITA 5T1LB 4F8TA 3T0EC 4PGEA 5JMRA 4JDVA 3HZVA 1EZLA 3CBJB 1KJ3L 1QLFB 4FEMA 2H7WA 4WI8A 4MMYA 2NZ9C 2VDRB 2XC8A 3FO2A 3KPRA 4AQZA 1HVXA 5DC9B 5GIRA 3WS6C 4HX1B 4M7LT 4HVBA 4I85A 4OZGA 4Z23A 3QDGD 3IPBA 3S5LG 2IC2A 1FFOA 3ESOA 1T21B 3RWIB 4H0HB 1XTMA 5KVDH 3TPUB 2O5ZH 2XTLA 1PG7X 2E7DA 3FFDB 5AOJA 5CIPB 3FT1A 1Z3GH 3L7EA 5DHEA 5EN3A 2GJ6B 3NJLA 4K7FB 1NM9A 1P9MC 3QUKA 4X7TB 3TXAA 3GMPA 2XY2A 4UNVA 1KB5H 1SHSA 1KXQE 3W1ZA 2UWEA 2H9GA 2MNUA 2CZNA 4FULA 4Q9QH 3QP3A 5DFVC 1QKZL 4OLWL 3GHEH 5JO5A 4NQSB 5FM5O 3SDDA 4XP6L 1L6PA 3PQYB 4H0GA 5KZCB 3QWRD 1Z5HA 2K7PA 4QXTB 4D9RD 4PB9L 1OF2B 4U6TA 4ZMLA 4Z3TA 4ODUB 3CFQA 3FCGA 3VGFA 3RTQB 2HLFC 3VD4A 3GK8L 4I0KA 1DQVA 3LKQA 4Q9RL 5KJRL 1RZPA 4JO2L 3RLSA 2NY5H 3NEOA 1BYOA 3DC0A 2NY0D 2I9TA 2WJ5A 2A2QT 4ZFOA 4UMGA 5J3HD 3F6LA 2Q3AA 1TJXA 4NAJA 5E2UL 2IADA 4KROC 4EUPB 5B7MA 2VXQA 1MCFA 1UG9A 2I25N 4QTIL 5CEXB 1T03H 3UGUA 3BAIA 3NSYA 1A0QH 1CE1L 1UXLA 3FQXA 4D8PB 4BSWB 1G7LB 4GY4A 5AZ2L 3PG2A 1H3PL 1AXSA 5IHZB 1QA9A 5CLXA 5I18L 2QQLL 4G8IB 4JHAH 1S9XB 3MRFB 1T0OA 3DTUB 4WTXA 5EN2B 1GCYA 4HK0B 4PGDA 2VO5A 3UIYA 2ADJA 1CGTA 1MFAH 4GYBA 4V33A 3WJLC 2X9WA 3IDXH 2NXZC 4H1LB 4LAQH 2QZ5A 3K5RA 1W72B 4G80B 1ILSA 3BX7C 4PJ9D 3FRPB 4XNAA 4D8OA 2BP8B 1K4DA 1DVYA 4GAAA 2NQCA 3VSUA 2Q7NA 2F53A 4FA8A 2CKBH 2FTAA 4ACTA 5IV2A 1XMEB 3AT9A 3LNEA 4N2BA 1LO3H 2R2EB 4N6RA 3TZVA 4QRBA 2VXUL 3DGGA 2H32H 1YEIH 5L2KA 4NP4L 4ODXB 4DWHA 1MY7A 1W6WA 1DQML 3I6LD 4JJHA 4AEEA 1GTNA 2WBJA 3NCYS 2FR4A 1SNRA 5FGSA 4ANWA 3FT3A 1IGML 5BS0E 3BH9A 1CD8A 1E4HA 2DQTH 4MXQD 1NSNL 3WNKA 4IYKA 3GM0A 3LQZA 4NBXB 4ATTA 4JJOA 1IFHL 5FYJD 1MCWW 2EH8L 3U2IA 4XTRC 4TPRH 5KG9A 5F1OB 1E3XA 3TBTA 4G80A 1FNSL 4AEHL 1RZIB 2YO3A 4GQPH 1LWJA 4MDIB 5EO0A 3INUH 3U36B 1NLBH 5IUSA 4L0YA 3L95B 3DROA 3FQYA 1KIPB 2BMKA 2V33A 2O5XL 5IHZA 5J06A 3LKSA 1DVUA 1P7QB 4FFVD 2NR6A 4PWFA 2DY2A 2QLYA 3MUGB 3QIUC 5T3XE 1CDUA 3FFCA 4A7GF 2MNJB 3L54A 3Q1SH 4PQXA 3TO2B 1MRDL 5K69A 1D7DA 4WZ9A 3PFUA 2X44D 1ICTA 1RMFH 3GLEA 2Y22A 2XIDA 1Y7VA 3DVIA 3H55A 3HC0B 4RAUA 4PTUA 4L8BA 4HWEH 1SBSH 4MA3B 3RX8A 3OBAA 3TH3T 2B4CL 3DX6B 1BP3B 5CLYA 4EVNB 3RVVC 1FV1B 1OAUL 3CSPA 1OP4A 2DJMA 4WWKC 2HT4C 2JI1A 3IE9A 3GXFA 1MPAL 4AGLA 2QGBA 3OKNA 4LSSH 1F18A 3OV6A 1A6WH 2VDMH 1KENH 3D85D 2OXHB 4DH2A 1G9MH 3MU3A 5JOEA 5DD5L 3BC9A 3I3DA 5FO8B 2DWXA 1CGYA 2BVQA 1MWAH 5TQ0L 3V8OA 5DHVH 1RPKA 5GGUA 3MNZB 3GHBH 5E23A 4UT9H 3WFHB 1T4KB 2KQMA 3ZVVA 3HBQA 2OK0H 4BHUI 1U8OB 2YD1A 2EYRB 3LH8A 4N2KA 3BAXA 3MLXL 3V79C 1KPRA 3MREA 1E7VA 3GZKA 4MA7L 2H41A 4BFJA 1U8LA 4JPWL 2OTWA 5ICYA 4LGPB 3GUTB 3B2UD 3EO0A 4X6CE 3FB5A 5JUEH 3RWEB 2N7AA 1OM9A 3GJFH 4KOBA 1G1YA 1NGQH 4NJ9L 3BD4A 3KNBA 5BVPH 1JG9A 3QQDB 4HFWA 4OD3H 1UM6H 3RZCB 1UB5A 1TZ8A 1BREA 4PGZA 4Z0BH 4NQQA 4FXGB 5AW9B 5J9PA 3C12A 4OI8A 1IFGA 2NXYD 4HS3B 4F7PB 1V3KA 2DEWX 5FYKL 2GTZA 2IH3B 4I5BB 1IGCH 3O81A 4FQHB 1J9RA 1H3TA 5I1AB 4BZ1L 2CJUH 4ZS7L 1ZANH 4KI5D 4I18C 2YQ2A 3FO2B 4HUVA 2Z35B 1TT6A 3WIIH 4ENZA 3WMPA 3Q2VA 5GGSY 2KUTA 2DRUA 5EIIG 4NDMA 3N40F 5FHAL 2R2BA 2JJUA 4KQ3L 1JF6A 5FO9A 3KD4A 4K94C 3UGEA 3OHXB 4GAGH 1NEPA 3VSVA 1EDYA 3SGKC 5T3ZL 3Q8AA 3T9WA 5E08H 3NJKA 2XCMC 4HZAA 4PY7B 4W9DC 3CX5J 4FQ1L 3II2A 1HI6A 5KVFH 4KKLD 4U3HA 5CGTA 4L37B 5HDBE 2IANE 4L4TD 32C2A 2YLHA 1AYOA 2E46A 5D7EA 5F3HB 1X5AA 4HKZB 4DP7X 2BNRD 1HINH 3TA3D 4FYTA 4P57A 3QFJE 4L4VE 4JFFB 4ZS6C 1WD8A 3KLSA 1LD9B 4M8QB 3TURA 2Y7MA 5BQ7A 5K9QG 1U8IA 3ZUNC 5F2FA 1MFBL 1EJ8A 3QI9C 5KVEH 4FMKA 5DTFA 4P2OD 3FCTB 5JHLL 1DFBH 2E86A 3IFOB 1UA6L 3D39D 2WAQA 5KYXB 4Y9CA 3O3BB 2J8UF 1CICB 2OMYA 3Q3GB 1MREH 2W95A 4XB8A 4Y9BA 4C57C 2Q2LA 1QACA 1ZSHA 4YHOL 4MHHG 4OZGB 3ETBF 3RWCB 1JZEA 2PN5A 1JL8A 4KITB 3WFBL 3VM7A 4XI5C 1IEHA 5EEVA 1TTUA 2VDML 3BP6A 4NC2B 2PYFB 1AO7B 4HKXB 3WFDL 4N9GA 4NZTH 1LE5B 1HXMA 3MGTA 4ZTOL 4X4XA 1PQZA 1MHPH 3BVNB 4L1TA 6FABL 1GGCL 4WO4C 5C09A 3EOYG 2AGJH 2OM5A 2FGZA 5HI3D 5B38B 3P69A 5C09B 4HIPA 1CJYA 1EBPA 4W9GC 2QKIC 5D5MA 4PHZA 3T77A 1RZ7H 1JZIA 5GS2H 2ZKMX 2F53D 3AS3A 5IB3B 3WGVB 4JB9L 1MCKA 2EDNA 1EZVY 1LHZA 4JM0A 3UAAA 3LS4L 2VLME 3OGCA 4OZGF 1KN2H 4QY8B 4G7RB 5D96B 3RQ3A 3SO3B 2JJVA 5IF0A 2J4WL 1TZGH 4O02A 1SJMA 4ZFFA 4FQCL 5LNGA 4EN3A 5GZOC 1B0GB 1AJ7H 3C09B 3OR6B 5E5MA 1E9OB 4YHOH 2ZOWA 5BS0A 2FEEL 4EZKA 4QWWD 2ZP0T 4Z7WB 1IAKB 1K8IA 1T66C 2CR3A 5AYUH 1BZDA 4O00A 1E5AA 1E8YA 1N3NA 2A6KA 1T6BX 3NEEA 4XN7A 1CFQB 1NAMH 1N5YL 4K9JA 4AEHH 5BV7H 5CP3H 1TO4A 2L04A 4HCIA 4GW4B 3TASA 4TPRL 5CBEA 2EH8H 2BSBA 4K8RH 4YBQD 3C6LA 2ZYIA 4XHJC 1JYNA 3CZGA 2D0GA 4NNYB 2YD4A 3ULVD 3VFRB 3DTXB 2DYRB 1HHKB 3WL9B 2AKRB 2RTTA 5DEJA 2Z31A 3MLZH 3BE1L 4KOCA 4F7MB 5J5EA 1JMXA 4EF3A 1X44A 3L08A 1BJ1J 4BRVA 1KIRB 2GSGA 3QXUA 5D70H 2ADGA 3ROOA 2CRMA 1I7ZB 3HZYA 4QRPD 1TSRA 4HKBA 5IHBA 3A6CH 4FHBD 5B1JA 3IDGA 2KS0A 2CKBL 5TTRA 1ZE3C 5AL0A 1L9QA 3DO3A 3CHQA 2IIJA 3MLTA 4G8GB 5EC2A 4LDOB 4ORGB 4PRPA 3ISWA 3X11B 1HEHC 2O93L 1ZXKA 3OZKA 2UV3A 1F4WL 3ATEA 4XWGL 1U8CA 1CGVA 4U6YB 2GK0B 2RAMA 2GABA 1DQDH 3HUJA 4U0RB 3CSBA 4JQIL 1J9CT 3GXDA 2YD6A 1DVFB 1Q4NX 3IN2A 1P7QD 1XGQA 4LVNB 1GZPB 4J3OF 2PO6B 1U8KB 4K23L 5IHUH 4G1EA 3CSTA 4UAOB 3IFPB 1MW2A 5DWPA 4YLBA 3VQ2C 1W0YT 3FTWA 3THMH 4YMPA 3TV8A 1X9QA 1DQJB 1TZIA 1OCCB 4EI6A 5ID0A 4WK0B 2W5PA 2VXSH 4A2FA 4RGOL 1X7SA 5EORH 2HT2D 2GJZA 3QRFM 3ASNB 3HCVB 1L0QA 5FO2A 1Y0LA 3NCBB 1NMCB 2J5WA 4CDHA 4NQEE 3A3YB 1CXEA 5JHDD 1LJMA 4HGKC 2ESVB 3V52H 4AZ8A 5IOPA 4ODSL 1CBVH 3D0AA 1QLRB 3VGDA 1BYPA 4X6DA 1WG3A 5CCHE 2L7JA 3HZ3A 3JWOL 2GJRA 4I0PB 3TL5A 4HPOL 4MDIA 4URKA 3GHBL 4JG1L 2W9EH 1WWAX 4YHMH 1KB5L 1M1XA 1KBVA 1IC7L 1CD1B 4F2MA 1L0YA 1R33A 3B3BA 1U8NB 1RJZA 1YLBB 1WCQA 3QYMA 3B7UX 5D8JL 3TT1H 4XZUB 4HOWA 4QRSB 2QSCL 5DJ8B 3WYRA 1A7OL 4NZRH 4QGTA 4R90H 2VR5A 5DJXA 3CZFB 3P2BA 2FATH 4OCSH 2B0SL 3SIKA 3ARGA 3H9HA 4NJAH 5L8KB 2DD8L 4OCWH 5SV3A 1VAHA 3DVGB 2IGFH 3S4SG 1S9VB 3UC2A 2WWKT 4RMUA 4D7BA 3BRGC 2G2PA 3QCVH 4PBWD 5LGYA 3JV4A 5KYYB 5J6HA 4Z7IA 2J6EL 1JTOA 1XCQB 4JFPA 4MSWA 3ZO0A 2CK2A 4FCHA 4M6NL 1QG3A 2F18A 2RR3A 4LEXH 4X7SL 5J1AA 1K4CB 1WTGT 1FZJA 4FG0A 3R06B 4UUJB 2CNYA 2GEEA 4JVUA 2YAEA 4LCUA 1V27A 5HHVL 2NT1A 5ESVB 4P2QA 4D7PA 2NXYB 4NO5B 1MQ8A 3V6OC 5JW4M 4XP5L 4KPHL 3GIVB 2CHXA 2XETA 3EO1A 1I1AB 4UM8A 5E6SB 4HIXL 3QORB 3L5JA 1ML0A 3HE7D 2VDLL 1X9UA 3BPLC 3O3BA 2YAOA 4OZHA 2OR7A 3IRPX 2YPLE 1FO0A 4FXGA 3NFNA 5DD0L 3SYPA 4F5CE 2D3JA 3S48A 2J8OA 1AXTH 1CFBA 5K39A 1Q72L 4XE5B 5DO2C 3FQ2A 3ALPA 1QPKA 2ZXWB 3F01A 1QWUA 1ORSA 4Z76B 3K6SA 1FC2D 5D2LB 3MXWH 2QVIA 5E94B 1IFHH 3IF1B 4LLYB 1RJLA 2DQDH 5J12B 1T1WA 5AAMA 2DQTL 4LLAA 5EUOB 1PAZA 4Q0XH 1S2EA 2KHAA 3FN3A 4YGVB 3CIAA 3T4YB 3CH1A 3QQNA 4ONGH 1YYCA 3NH7L 4Y4HB 2HJLB 4HUMB 1VADB 2F54B 1E8XA 1CGUA 1DQMH 3D87B 3LZOA 1CLZL 2DQIH 1U36A 4YSDA 2QHRH 3D2TA 4Y4KB 5I1DB 4OJCA 3FB6B 1AGDB 2UWEB 3I84A 4WEMB 4YJZL 1LO3L 3G7TA 3WXWH 2ICWI 4Q74A 3WDHA 5IB4A 3NABH 4HS6A 4JHVA 5ABZA 4UV4L 1XD0A 3K2IA 3T2QA 1QR4A 4E2OA 2IH1A 2Y36L 3S3PA 3W38A 4MASA 3DX7B 5D1QB 1JV5B 2OXHA 2OMUA 4FX5A 4TF4A 1MJ8H 3E8UH 3MV9A 1NFIB 3BN3B 5BV7B 5KN5A 3ABLB 2Q76A 1ZLEA 2PW1A 3OJ2C 3HR5B 3SBWC 4G7YL 4ORZC 2D03H 4BFFA 2YAFA 2ARJQ 2ZX9A 4HJJL 5CGYC 4DKTA 4JK0D 1ED3A 5IJVB 4GS7C 3SYCA 5EBLA 4IOIB 5K5YA 4UQ2B 1WBYA 4KKPA 4NQCE 1IBZA 4AVIA 5BZXA 1IJ9A 3G5XA 3SGDI 1MJUH 2J3SA 4Y89A 3EOBB 2UY6B 3M8OH 4XOAA 1GJUA 2EACA 3O6KL 1N59A 2IFFL 2OQJB 3CXDL 3QJUB 3TEXA 1PL3A 2FLMA 3KPSE 4HGWA 5D2NA 3BT2L 3MLRL 2NY6C 1UCBH 2JXMA 1CR9H 5GZND 5F7YC 1X4YA 3EYSH 4HT1H 2XVBA 3GMRA 5BXFB 3ZHKA 3NQIA 1CN4A 5JHAA 2GEQA 3M1BB 1N67A 4PB9H 3ARXA 2AJVL 4MJIA 4Q58C 3UO1H 6PCYA 1XCTA 4LL9A 2AABL 4NNXA 3NCXA 2YA2A 5HDQL 1WFMA 3OVUB 4FKKA 2F53B 1GJWA 4IOSA 3HR6A 3ABMB 4OJDH 1IE5A 4PR5B 5A40E 1IBGL 1N6QH 2FWUA 1KCVH 3WE6A 4D9LH 1XCWA 4LCWD 3ULUF 3VACA 4N0UB 5IFJB 4M7KL 4KZDL 2ED7A 2YGOA 4HJ1A 3NSFA 2VN3A 4UCFA 4PW9A 4AQ1A 4P5TD 1Z5YD 2H0EA 3BJLA 3FUIA 4EN3C 2ZNWA 5GZOA 1R19A 3UROR 3CUPB 1KJ2L 2KZKA 3CLEH 4TQIA 1N0LA 3EYVB 1JAEA 2W0PA 3JVGC 1ZT7A 3NCWA 1HE8A 4RWYL 1URZA 4MS8C 3AGVA 3AXHA 3KYOB 1JHLH 2J8HA 3E1F1 5FLUA 3DGGB 4JZJB 2UZIL 2NY1B 1MNUH 3VB8A 4ZMVA 5FW6A 3HC0A 4L1SA 3IFLH 3U82B 3HRZB 1MW1A 4RSVA 5BNXD 5D7LD 2IOIA 3DSFL 1A5FH 3D30A 1IBBA 3P4MB 2D7TL 3WY3A 2I32A 3OC8A 2P7TA 4JG0H 3D08A 4LDCA 2GG1A 3MCLH 4AH2B 4NUJA 2Z1KA 2XWCA 4HSAC 4QRUB 5D2NC 1XR8A 2KLTA 2GSIA 1KJ2A 2MPAL 4HOZA 1L3NA 4WW2A 1DSFL 2WBJC 4XNZB 3V9FA 3EH5B 1NGWB 4OGZA 2OLDA 3VFWB 3AMKA 1MRFH 3P11H 4LARL 1U91B 3X1BA 4PG2A 3RVXC 1JUFB 1NCBH 5I1IH 3PNWA 1KNOB 4WI2A 1ZGLP 4X4ME 3BWZA 4FZEL 3RDTC 2WVUA 3VVVA 4Q6IA 1U2YA 3GTNA 4IBWA 2NDFA 5IJKC 2V5TA 4LLUB 4L8CB 3N0AA 4KNUA 1T7WA 3KPSA 3NFNB 5D2NE 1VB9A 2GY7B 3DV4A 3WNNA 3IDUA 2BNUB 3DX9B 2TAAA 4RWHA 5HBBA 3AITA 2A6DB 3D50A 4HJJH 5DA0B 3QHZH 1U8QB 4LCCB 2QTVA 3VI3F 1JZDC 1WUNT 2X4UB 3QDMB 4ODUA 2AEIT 3DKHA 4LCUB 4U1NA 2JKRM 5JHBA 3WTWA 4M6OL 3RAJL 5JQIB 2PCFB 3BPOB 3F64A 3LHPH 5E4IA 3QFDA 1S5IH 1YN7A 4JCWA 4C59B 3BKYH 1EHXA 4BYHA 3BZEB 4APQB 4NO3B 2ROXA 2EDFA 3MZGB 3CJJA 4GT0A 3MRIB 5DU7A 3HC4H 4TOYH 2VXTL 1PKQB 1ET5A 3NK3A 4TSBL 5FV1L 1MUJA 3DVGA 4IIQB 2J8UE 4YL9A 5I1GH 5FC9A 1KTBA 1GIGL 1GW6A 1Q38A 3LQAL 4K3GA 4FZ8L 3UG5A 2Y4SA 3QXWA 2VRAA 5A2FA 5C08A 1BHGA 3LPOA 3V5DB 3FRPG 4ONFH 5EEWA 2Z91A 2EUVA 4QRSA 2ERJC 1HQ4B 5FDWA 2VM3A 1JPFB 2D7QA 2SODB 3T3PB 1WIPA 1YY8A 4S1DD 2VC2L 2Q0ZX 3GB7A 3NSDA 2FSEA 3HG1D 3MLWL 1IARB 5I16B 5HPMA 1WVZA 3FUKA 3OJMB 4IHOA 3GKWH 1R3KB 1KYUA 3PAZA 4XPAL 4UOQA 3EBAA 4IS6B 4XMKL 4BUQA 4AYDC 2WGXA 1XH3A 2Z31C 5IFHH 4HWUA 5JOPD 1CTNA 5CKGA 3ZR6A 2CR6A 3NK4A 1FGNL 3JV4B 5KYYA 2ZPKL 2UUDK 3AXLA 2ADFL 4EUPG 2FCBA 3FQNA 5MEOA 1YMMB 5AW7B 4HWZB 4ZMYA 1KTKE 4HIQA 3GPSA 3VJ6B 1YYMH 2YC1B 2HJLA 1BFSA 3U4EA 2HUHA 4RAVA 1G4MA 4OKVA 3L16A 1ANUA 2JKNA 4E42A 1CDBA 4LNVA 3FXIC 4FA7B 2IQAA 4QNPF 4WY7L 5FFGA 2Y07H 4Q2ZA 4QXUH 5I1EH 3FSAA 4FADA 3E2HB 3H6JA 4NC1E 3PGDB 1RLWA 2I85A 4KMTH 2UZYB 3QUZB 1Q9OB 1NCWL 2YFOA 1KMGA 4AYFB 4ENEC 4MRBA 1D9KB 5ICZB 1XB8A 2XJKA 3QPKA 1S5HB 1OSEA 4AL8H 1SDYA 3QO0B 5DS8B 2DD8H 2Z93B 4JHUA 3REWA 2G75B 3FT4A 3QCTH 4JFHE 4RA0C 5IHLB 4CVZB 4RMTA 4FQJL 1JI1A 4M3HA 3QDAA 1SHXA 2VLRE 3LAFA 5DD6A 1FZKB 5HVFB 1ZDSA 3K74B 4K4KA 1K2DB 4PRID 3MO1B 5LGKA 5ELIA 2K4AA 5C0IB 4B41A 5LDUA 4XN9A 1MHHA 3T0WA 4WQOA 1JZ4A 3H3KA 4ELMA 1UD5A 4WWKA 4GBXC 1BD2E 1P1ZA 3OXRB 2E7MA 4LASH 3FSOA 1UTDA 5LGJA 4DO5A 2APFA 1G5GA 4CA4A 3J07A 1YQVH 3DECA 2VJXA 1E4KC 2VTFA 2DBLL 4HPHA 1EGJH 3BDYL 1CE6A 4KX9A 4WGWB 3WTTA 5TE4H 5KS9A 4Y5XB 1H3UA 3V52L 2YSSB 1AS8A 1J1OH 2JB6B 2X6VA 3TOPA 1IBHA 4AJ0A 1A4JA 3EYSL 1CXFA 4JZNA 4KVNH 4A7UA 5CD3A 4U31A 3LN4A 3MJWA 3E9TA 3EDFA 1KCSH 3KLHD 3VXPA 4A68A 3EJYD 2ESVE 3CSFA 5B3SB 3IGAA 3T1FB 2ZIDA 1QMUA 1GHFL 4K23H 5I6KA 5IHUL 2DQCH 4TTGA 2QQQA 4C4UA 3ARSA 3KPLB 1TZHB 2C1PA 4N26A 2AXFB 2OMTA 3O2VH 1T0MB 3QUXD 3IAGC 1ZEAH 2AZAA 3N43F 5FXCH 5I82A 3QQ3B 1WZLA 5D1XA 1P4LB 3O3EB 3CN1A 3FYIB 4JZNB 1WH0A 1NDTA 3PL6A 4FYSA 4TULH 3JTSA 1P5UA 2GCYB 4PJ6A 4OF5A 4W6XB 1OKEA 2JELH 1C5BH 1AHMA 4UT6A 3LCYA 4L1HA 4KK6C 3MBEA 1RCYA 3AMLA 3U1SL 2DM2A 4JEGB 1MCNA 2WOBA 2CAKA 1MWAA 1P5UC 1BEXA 1CF8H 4FQXB 1AHKA 1FYTE 4P04A 3WFCL 3H2PA 2R1XA 1CYGA 3C60B 2BP0B 4NFBA 1JZ2A 2BXYA 3PE9A 1IKFL 3SDXA 4R2GB 4ZMQA 1J5IA 2FSEB 1KGUA 1Q1JH 4NUQA 3PNWB 4RDQF 3GXUB 3HA0A 3LJ3A 1Z9SB 3Q05A 1CDGA 1URLA 1WGVA 2NYYD 4OFYD 3VFWA 3H7LA 4FNQA 3P02A 5HJDA 2LAAA 2AANA 1AR2A 5EU7E 1MWOA 2CO2A 2XZAL 2PPAA 2YXFA 4YBLC 4Z7NF 5BMFL 3FO0H 5F8RC 3MRLA 5K1NA 2F7RA 1RJYB 3BZDA 4OJEH 3FONA 2NY3C 1VFUA 4U2YA 1S7VB 5IP4A 3SDXE 3OMNB 4XPHH 3WL9A 3MLUL 2IPTL 3QPQD 1DZBA 4MGXA 1OAYH 4PV1C 3RTLA 4Z7UA 1JI2A 3PL6B 1M7IB 1GRWA 4K9EC 1PZ2A 1H5BA 1L3WA 2WTRA 2ZUQB 5EH1A 4LGSB 3S4SB 2OTUB 1E27A 1FH5L 1JNJA 3VNZA 3P4LA 2O72A 1T1ZB 4PY7A 3QCVL 3F7PC 1C5CH 1T4KA 1EDQA 1XGTA 1OW0A 3QR1A 2K8MA 1OCZB 5E2VL 3DV4B 4NQXA 1TJIH 3WE6B 1KCWA 3QIWB 1HNYA 2WXPA 3DPBB 4HEME 1MCPL 1MJ7L 4P2YA 4XVSL 5I8EB 4OKDA 3VE0A 3VTAA 3PCYA 3TNNB 4O02L 4ZFFB 2PCPA 1LD9A 4JDEB 4OM1L 1R46A 4YUEH 4HUVB 1ND0A 3VRJB 1JUFA 4IU2A 3WFBH 4IBUA 1NCNA 1UZ6F 3A6OA 3B9DA 2Z91B 3Q44A 3L5WA 3MNWB 2I07B 2HN7B 5IQOA 1TCRA 3PV6B 5KAQF 1QSEE 1GPOL 1T80A 1H9VA 4AIZB 2N56A 2VQ4A 4RZCB 3B7RL 2W9LA 1DJHA 2K3HA 5HDWA 5K33A 2NY0B 2RACA 2X3CA 1OZTG 2VDLB 1MAKA 1CBVL 3RVUC 2ZCLH 2IAMA 5JIHA 4FC3E 3OJDA 4P23B 4UI2A 3MGTB 4QHKJ 3W81A 4PPTA 3TA4D 4PV8B 1JYWA 4RGOH 3B3IB 3QISA 3H3PH 4QUOA 3DXAA 3MRGB 4YDJB 1DQTA 2FT7A 3TN0A 2EXYC 3BWUC 3R8BB 3DHMA 3EDEA 5KVFL 3VW3H 2AK4D 1IQWH 3PWUA 3NCEB 2GT9A 2E56A 4PJ7A 3ZDXF 2LVCA 1VGEL 2H2SD 4KKBD 2O6CA 4I48A 4PJFE 4R0LC 5K1VA 4CN1A 1CXKA 4IOFD 1DL7L 5C92A 4FFYH 3K6FA 4LSDA 5KYXA 3Q48A 2IANA 5H37A 2WK2A 5IG7B 3VWKD 1D7FA 4JQIH 4D0BA 1JGEA 5TD4A 4QHLA 4POYA 2OL3H 3WTSA 3HG1B 3ARPA 3DIFA 4JRYA 4AVKA 3KLQA 2SEBB 1Q9LB 2PYEB 3QIUB 3BH8B 4NWTH 2D9QB 3TLRA 2KZWA 5DZVA 1BZ7B 1XSKA 4MJIB 2W0KA 4CVXB 2HVKA 4JRFA 5GGRY 1LL1A 2UYLA 3UZEC 3B9VA 1G7JA 2IQ9H 2NZ9D 4XCFH 1CG9B 1M6OB 1U8OA 5T5NF 4XP4L 4MA3A 2VDNL 3BWAB 4A2MA 5HHOD 2X2HA 1MAMH 1ORSB 2HFGL 3WI9A 3K6SB 1NEZA 5F3BA 1O6TA 1R5IB 5KBDA 2NNXA 1T2XA 4KTEH 1JK9A 3UAJA 4Z5RB 5JPNB 4FOMA 3TESA 3DIVA 3OMIB 4KV5F 2OZ4H 5C0CB 5BRZA 2IPKA 3ULUD 4OCXL 3BRDA 1A7PH 1I9RL 2BOCA 3EYUH 1WIOA 2WZ5A 4BZ1A 1JTPA 3VGEA 1MDAA 1YAZA 3D2UA 2BRRL 4ZAKD 4LRIA 1EHKB 4UNTA 1N5AB 2BOCB 3BKJH 2EADA 3MCYA 3V2AR 5EG6C 5DRZB 4H88L 5L88H 5IMOA 2J20A 4JFOB 1PFOA 1Z5LA 3G6AB 1HILA 3N2JA 1AY1L 1BEYL 3V4UL 4GAJH 1AC0A 2P7TB 2JKIS 4AJVA 2RGSA 3LRSB 3I6LE 4XBEL 2WNWA 1JK9B 4XBGA 2OBGA 5LN8A 1DBAL 1U8JA 2XWTB 3BH9B 2ADYA 2N0KA 4PCTA 3WXVL 3WNLA 4AZUA 4WAFA 2EKSA 3T3MB 3T4AA 5HYEA 4JKPL 1CDIA 1E43A 2HN7A 3DMMC 3QDME 2Q9OA 2YPLD 1MCIA 2P5WE 5B4MD 3T4AB 4WCYH 3UYRH 3PAUA 4QTHA 3GS7A 3VWJA 2X7LA 3RZCC 1J0KA 1B4LA 1GAFH 3QUYD 2ICEA 4B53A 1JNLL 4QD2E 2MOGA 1YEKL 2BIIA 4FTVA 4S1QL 1IU1A 2F8IA 1CD1A 4ZD3H 1K3ZA 2VISA 3WEMA 1E2VA 2YK1L 3QAZB 4FI6A 5LGHH 3CWGA 3H42H 4QHLB 5T1KD 3V9CA 1CURA 3TBSA 1DSWA 1HAWA 4M02A 3BAWA 4FQXC 1A65A 3WMQA 3UZQB 4M7LL 5HHOE 4E9LA 2G3XA 1T21A 3B2MA 3QO1B 3QK0A 1WZMA 4GH7B 3V4UH 3B6SB 5IMLB 1QI3A 2ZX5A 5MEQA 1PD1A 2ZYRA 2X0UA 1I8MA 3SPIA 4K8RC 3QIBC 1WAPA 4X50A 1CGSH 2F54E 4TKWA 5ACLA 4KAQH 2XVLA 4TUKL 2WQWA 5C0EB 1SPDA 2WD0A 5DC0A 1T2QL 4Z7AA 1QFOA 2JXMB 3QPXL 4OV5A 4Q56A 4N25A 2YMOA 5AW6B 1TNMA 4S10A 2Y23A 3CLFH 8FABA 2MMXA 4MXQC 2NZIA 1EZUA 4ONHA 2QQKL 3II1A 3I50L 5GGTH 1A3ZA 3LTVA 2CQVA 2CGRH 4OZHE 1OD9A 4I1RA 4JM2A 5C0ND 5EWIL 5IOKA 1HINL 3I02B 5LBSA 1TFHA 2XXGA 1QEXA 1A66A 4A66A 3B7SA 5EZOL 5IJVA 1S7TB 3ES6A 2BHUA 1IAIM 3MNWA 2HMID 4UTAH 1I8MB 2CHNA 2LFGA 3C60D 1TVDA 3MROA 5EF2A 1QTPA 2FNWA 1QUNA 2JQZA 3KWWB 1QEWA 2NUPA 4Z7OE 2EEDA 3TBCA 5IHWA 5T1KA 3DSNB 2LVEA 4JVPA 2X87A 4RISH 4M6ML 3V0HA 5D1QA 4HFUH 3QNFA 4NLAA 5CGMA 3FAXA 4LPCA 4FLQA 2QKSA 2G5UA 2J55A 3K3QA 4Y16C 2DTMH 2BP0A 2XWBA 3ZKND 2YZ8A 4E41E 3AFLA 3ETTA 3L4YA 3TVMA 3O2DH 3DARA 3VSTA 3WIIL 1J8KA 3O2DL 5DJAB 4K07A 2Q7AA 2CJUL 1FVDB 2Y06H 4ZS7H 4BZ1H 3ZQ9A 1S9WB 4AOFA 2HJFB 2X09A 1CG9A 3BUTA 3ZE1B 3EJZD 4HFUL 5C2UB 1O5DT 2GI7A 3A67H 2GSMB 3HI1B 3J27A 2JI3A 2W9DL 4OUOA 3NESA 4PJ5A 5TE6L 3W0WD 3TF7C 2CG9X 3ZZ1A 1VGEH 3P4OB 4QHUA 3TCLA 4PTTB 3KPPA 4ZUTB 5AZEL 4JDVB 3WNJA 1R3JB 4H20L 4LVOB 2GITB 2YGQA 5IVOA 4PREB 3RNQB 4L5FL 4GW4A 2QGDA 2IBBA 3MUJA 2WWMC 4OM0H 5HYIA 2XBZA 1TQSA 3DIFB 2AZUA 2EP6A 2WLZA 3TWCH 3C5ZB 4I1NB 2CGRL 5JUEL 4B96A 4JZOA 2YHGA 3N9GL 3HNSH 4M7JH 5KYUA 2NY3B 3QJRB 1PFCA 2B20A 5KUKA 1PZAA 4NC1C 4FGMA 3HUJB 3JTTA 2APWA 1E90A 4ZTPH 4AK1A 1QLEH 1AG0A 4FRWA 1KUMA 2IDQA 3W82A 5CP3A 2IPUK 3PUCA 2ZAGA 3BLKA 4UM9A 5EBWB 2A9NL 3BPCB 1RHFA 2ZWYA 3A5VA 1HCZA 4TRPL 3UGXA 4PRHD 2IH1B 1AE6H 4B50A 2YPVH 1WS8A 5CSGA 1KCUL 4YC2C 2F19L 1U3JA 5HDBF 1VZHA 2WO2B 4HWBA 4YOKA 2VT0A 1Z3GL 2XXCB 4ZUSB 2BNRE 2LABA 1J1PL 1XBDA 3TJHD 1OGTA 2FIKB 4AW4A 3PWLA 3QC5X 2VERN 2NLJB 2R56H 3ZKMD 4HOMA 2E8YA 2J25A 5CJXA 4MWFB 5ITFA 3ML8A 5E2VH 1KB9K 2ENJA 5I15L 2EE9A 2H3XC 4OLUH 1KGJA 4X6BB 3SE6A 2WTRB 1ULVA 5D1ZD 3VGAB 4EMZA 1SBSL 1TITA 3J7HA 1TSHA 2VCOA 3FQTB 4PJ9A 1R34A 3ZIMA 4FMFA 2XZCL 1RL1A 2KMWA 4GKOA 3ARGC 1Q0YL 2BCMA 3MJ8A 4OLYH 2EXWC 3QHFL 4WLCA 3V7MA 2P46B 4JVWA 3BSHA 2VAAB 1AGBB 4PRBA 5EV7A 4Y2DA 4G59C 4WIQA 3SBRA 2ORBL 2HKFL 1CXLA 3QJSB 1JTTA 2VLJB 4MNHB 1OALA 5FO7B 1AS6A 3VXPB 3CXFA 5IF0B 4AGQA 1DUYA 2GBUA 5F9WC 3VI3A 5AUMB 1QSEB 2JLLA 1P5VB 3MVSA 4G43A 4KNTA 4ANXA 4UT6H 4M93C 1DANU 4FQ2H 1JNHB 3QZWG 4ZK8A 3I2CL 4ZT1A 5HJGA 4JFEE 1LQSR 3DUSB 4BQCA 4DF9A 3LSOB 1DVTA 4RBPH 5D93B 5B7FA 3NZ8A 2GHWB 2WP3O 5TDPA 2VXQH 3PHQB 4ZS6D 3Q9PA 2IV9A 1SYSA 5FV2A 1RULH 3FQUB 3NZUA 4AM0A 3AG3B 5AB1A 3IJYA 2BO0A 3U30B 35C8H 1RZKH 5AVQB 5FGRA 5L7XL 5CJQL 5EMYA 3WG7B 3ZL1A 1Z32X 4NWUH 2EE6A 4JDZB 1OAQH 5EEUA 3B5GA 5KANI 4AIEA 2AJSL 2ADIB 1NPUA 3LZFL 4FFZL 4IU3B 25C8H 5IW1A 1JS4A 3QUGA 1YEWA 4LSRL 4P2RE 3MRNA 3UTOA 4ODVL 1BQUA 1E2WA 4JHZA 4PJ8B 4ZI8A 1NC4B 5H2BA 4DVRL 4NGHH 2C9QA 1A4CA 3DJRA 4I0PC 5B21A 1KELL 5A2AA 3T2NH 4WKZB 3QIBA 4ODBD 4X42A 2OSYA 2XWJB 1M1XB 3B9KB 3ETSA 4LAQL 4K3EH 3BW9B 3GS0A 4LHUA 4HBCL 1UB6B 1JGVH 1PX8A 2LT9A 1FNEB 3AWEA 2YA1A 4HHAA 3L3DB 1E9OA 4PP1D 5BS0B 1P0SE 3QAZC 2FBOJ 2XV0A 3HG0A 3S5YA 1HNFA 2R1WA 3JSSA 4LSTH 5F0LB 3AADB 2L7UA 3D12B 1T5WA 1PTZA 2ED8A 4K71C 3U9PL 4ZTEA 3P0GB 2Q8AH 2GCYA 2BSTB 3O2WL 1RP9A 2JJWA 2J1ZA 1JVLA 3FT9A 4WNQA 1NDMA 2F5BL 2HA1A 1KPRB 3KGTA 1RHHA 1OTTD 3EYQD 2YSSA 2WY3B 5AVTB 2EEXA 4CN4A 1WPCA 4GLRI 4P4RB 5I76B 1X5KA 1EJ6A 3WN6A 2BY0A 4KKAC 5C0FA 2Z34A 1NWOA 5FYJH 5GRVK 5HXMA 4NPYA 1CT8A 4Z7VA 3PRZA 3QEHB 4ETQA 3L3KB 4LP8A 1QRNA 3WOVA 2ZCLL 4MQSB 2COVD 3AB0B 1YPZE 3I9GL 2FD6L 1UZ8B 2NYZA 2VR8A 3RWGB 3WFZA 4EN3B 2OJZH 1KLFB 5K1JA 2ITFA 2R39A 3CVHA 1SQMA 5E1HB 1XD1A 1PY4A 3NCFB 1I3GL 1NFDA 2WLYA 4X7FC 2G0LA 3WENA 3W5NA 1MH5B 3GIZL 4FQHA 3CDZA 3SE8L 4PJDB 5HGAA 2NPLX 1DEDA 1T20B 2OMYB 3QCUH 2UZPA 4U1JB 3ALWA 1MI5A 1RIHL 2FBRA 3C60A 2A1WH 2BX5A 4F7PA 3ULVC 4NUJB 2DLHA 1R3LA 3RB7A 4N4YB 1E28A 5LCVL 2H3NA 4F2EA 4MVBD 3RPIA 4U1MB 3KH4A 4XXWC 1J8HD 2DLGA 2VSMB 3MV9E 5DMIL 2WP3T 3EADA 1X5MA 1TJIL 3KXFA 1EZSA 1KV7A 5JDSB 2DL9A 5I6MA 5C0BB 4X4XB 4WSKA 3IS0X 3H53A 1U8MA 4PJHA 1RFDH 4ZQKA 3X1NA 4WNQB 2EDYA 3UL4A 2FO4B 3ELAT 1S78C 5ERWB 3PWJA 5LDSA 3H8NA 2B1AH 3LEVL 4OLXL 1XGZA 2JWYA 4GXUN 3V0FA 1F42A 1JP5A 1TQCC 1N7ML 3N0PB 3WEXB 3TV3H 2MOVA 3RGVA 1T0MA 3QEQD 2MKWA 2WNGA 4I3RL 5AKSA 2NXZB 3EDKA 1F4XL 3BDBA 3X3GH 4DAGH 3AT0A 2BIHA 1GY1A 2CLRB 1F6AB 4XPTH 1OAJA 1IUZA 3TVMB 2VDNB 1DR9A 3CZEA 5D7IA 5CWSB 4Q8BA 5KUMA 1RIVL 3KPNA 3D85B 3ZMEA 3EGSA 1SEQL 3BZFA 2DYPB 2ZWLT 1F6FB 4O02B 4FQQA 3ZK0A 1T7YA 1P6WA 3JZ7A 1A7QL 2AI0L 1ZLSH 3BUBA 1YY8B 3WNIA 4NENB 1TJMA 1R6VA 2AK4E 3FTZA 3NP4A 5GJSH 3V5HA 4M5TA 4DESA 3T0EA 1CIUA 1EUUA 3WIHH 1CZ8L 3AY2A 4EVNA 5L4JA 1AR1C 4N8VG 5AW4B 1D7BA 4GEIA 5IHHA 4Y2OB 4GMSH 3B2PA 5I6PA 4X6DF 3GBEA 3MLVL 4GMTL 2WLIA 3GMQA 3U6XS 1MEXL 4JGUA 3FQUA 3UOAB 2BC4A 3QAQA 4ZUSA 1QFWM 1RSFA 2ZD0A 2FWSA 1AZCA 4FZ8H 4KVCH 3TYFB 4KNQA 1CF8L 1ETB1 1NKGA 3TU6A 5DUBA 1HXMB 4FNSA 5A2IH 1UQSA 4IHOB 4XBPA 1S9YA 3E8VA 3I6GA 5C9KA 3H1ZA 1Z3RA 2X9YA 3UJJH 3TF4A 2BNQB 4JY6B 3HNTL 1YEFL 5IVZB 2KDYA 3GEWB 4BCYA 3BHBA 3BKYL 4XRCA 4N1HB 5BUPA 3OKKB 1NMAH 1I4FB 1D2PA 1BAGA 3BGAA 3NCYP 3LHPL 5I5RA 3BO8A 4Y2DB 3RU8L 2D7OA 5D7LA 1SYVA 1GJIA 4BQ8A 5GJTL 3MBEC 1KTLB 3LOWA 4Z77A 3BDXA 1WITA 2D0FA 1YYLH 5AVRB 4BIKA 4EZLA 3W9DA 1TEYA 3BYTA 3MR9A 3K4ZA 2ILLA 3KDMB 1MF2H 4PJGE 5CILH 4C47A 5IQLA 3UDWA 3S8WA 1CZ8H 2ZG3A 3F7LA 1KACB 4I9WE 4PJIE 5HHME 1OARL 2EUZA 1GC1C 4J28A 4XX1G 1DN0A 4HISA 3RNKB 3TH2T 4JG5A 5BPPA 4DZBA 1OF2A 1QBLH 5F0MB 3EHBD 4HF5H 2QJDA 4R7XA 3D4CA 1I9EA 1LGVA 2J12B 5I0DA 3EDDA 3IDIB 3EG9A 3T04D 4KHTH 3V6FA 4F15C 2V0AA 1B4JH 2G5RA 3DX8B 5DJAA 4HIJB 1U3YA 4XPTL 1SLUA 5KBLA 4PYHA 2V7HA 4W9CC 4Z95H 5BO0D 3QZNA 1UD3A 1KGCD 4IRJC 1KTLA 3T3PE 4AG4L 5BOPA 3MV7A 2I24N 2DBLH 3HS0A 2XN1A 4I18B 4JFZL 2Y1VA 4RQQA 5FO8A 3L48A 4JG0L 3VU2A 1OP3K 4Z7QE 4C83B 4L48A 5HVWA 1LWRA 1VRSA 3FOMA 1JRHH 2QTEA 3QEUB 2J88H 4P2OB 5DI8B 5ESAB 4OLXH 3WKNA 3RFZB 1QA9B 1CICD 3LKOA 3T6XA 3TNMB 1KIPA 3RFZA 1EEYA 3LN5A 2RQ8A 1FZJB 4WNJA 1N0XL 3CXHJ 3GXMA 4W6WB 1WAAF 5HI5D 1F2QA 5DJZA 1NIBA 4KO5A 3K0WA 3PDOA 1A1MA 4JM2B 5CHNB 2E7LC 1WFJA 1I7TB 1CC3A 4PJBB 4AVHA 5IW6B 2Y2WA 1KDIA 2ATAA 2YBRA 1A6AA 1VF5C 3F8UB 3ZKXC 1ZSDB 1G6RL 1P53A 5DJDA 5F1NA 4NNXB 5JR1H 5L4MA 3L6FA 4D9LL 3ESVF 2EAEA 4J3OG 4RZCA 2OSXA 3PJNA 3H4HA 1AH1A 1UWXH 2GJJA 2J88L 3KPQB 2HVBA 2WXFA 1GOFA 3T6WA 3V10A 3FU5A 2ZONA 2Z1PA 2YD9A 3TIEA 5DZAA 1P7QA 1TQWA 4HULB 1BXVA 4NYLA 2CBQA 3X12B 3ZXAC 2EUXA 1OZUA 5JXED 5CGYD 1DEEA 3HZMA 3FTGB 2C34A 5EO0B 4W1TA 3O9WC 1EZVX 2IBZY 2JB5H 3FTGA 3V4PA 3G04B 3G5ZA 5EBLB 3HFMH 5DQJB 5IFHL 3I9IA 1JDAA 1VSCA 2Y5EA 3HB3C 5AOKA 3VFTB 2X7LB 3N91A 2Y6TE 3KXFE 4LRNL 4BKLA 4GBXB 2APXA 3TP4A 3R19A 1FV1A 3RGVD 3LH2L 3U9PH 5GZNC 1A7RL 3MRHA 3PAVA 3TZVD 1NBZA 1JV5A 5I9QC 2R8SL 4MNGE 2G4GA 3PXLA 1ADQH 2HXAA 2XG5B 3L3HB 4TNVF 3ARZA 1QX1A 3BVXA 1JK8B 1JWSA 4HIEB 5IVXB 1TZAA 3UTQA 3AS0A 5JOFA 1MIML 5JIQA 5LVEA 5ILTL 1QHOA 1CS6A 3O3DB 4K3EL 4O4YL 1GZQB 4RDBA 1OB1A 4UV4H 3G5XB 4WGVB 4LLVA 3HLAA 4HJ0D 4YHYB 2F0CA 4QRPB 5F7LB 1IRAY 4HG4K 4A38A 4KV5E 4LNRB 2VZVA 1Y6MR 3CDZB 4ZOBA 1S5IL 1PZDA 3BUYA 5E94A 4EN3D 1DVXA 3NA9H 1RZKL 3WHXB 4LE8A 1CD0A 4JY5H 4YHLH 4IRSC 1XH1A 5E4EC 5ICUA 1ZPUA 2WGNB 5IWLC 3GFUA 1NBCA 2VLKA 5DUML 1EAOA 1HU8A 4QOKB 1JYXA 2I9TB 2IDFA 2ZG2A 3PGFL 3PV7A 1UD2A 1F6AA 3IMBA 5EU6D 1DVZA 4PJXA 1GR7A 2I7SA 1Q72H 4WTQA 2ZUWA 2C9VA 3GIVA 5IQMA 3HPJA 3QGVA 4I3SH 3EGDB 3G3LA 2YMTA 2P26A 1YEHH 4TNWK 3QA3A 5FF6A 3QULB 4WJKB 5I8KL 3GSNB 5HYJD 5KS9E 2WKOA 4IBSA 3JWNH 2A9AA 2DWSA 3GHPA 4HIXH 1IEBA 4KZCA 2ZX7A 4DZBB 2MSPA 2EVHA 3GRGA 1EEZB 4AQEB 1UWGL 2LQRA 4XXWA 2WBWB 1OLLA 5C1MB 3UTPD 2BVEA 5BJTA 5HHVH 2E47A 3RVXD 1ITCA 2CRYA 1CFVH 2W1NA 3K6NA 1THCA 4PJBA 4P3DA 4LT7A 3QHFH 4GIAA 2MCMA 3RI5K 4JMNA 3SDAD 3F12A 3RDTD 4HHGA 4JRXA 4JKNA 3MLYL 5EOQH 1WBYB 2QELA 3NZSA 1A1OB 5D7IE 4XBMA 3QEQB 4E9WA 3MRMA 4ZRGA 3T6QC 1HQRA 3LEVH 3IFLL 5CP7B 3S98A 1YNTA 1LP9F 1MSPA 1EEYB 2CDGA 2XWJA 4LCWE 1RIUH 4U1GC 5E6IB 3GF8A 3MZTA 1KCBA 4G6ML 4TLUA 1ZPLA 4R4BB 3UMNA 1EX0A 1SVCP 3JQOB 1KWGA 2OR8A 3SZ6A 5I66B 4M1DH 1IMHC 2WW8A 3SDXB 4MFHA 4PRPB 5DT1H 5BRZB 2PXYD 3GZPA 3P9MB 4YO0A 3P30H 2P5WA 3GMNA 3RVWC 4YXHH 1FZMB 3MUHL 1BGXH 1BVOA 4XX1E 3VU1A 3FT2B 4JGNA 4NZDA 5DQDH 1OCWH 2NNAB 5EZLA 3BUDA 5DJ0B 5HGDB 2JI2A 2YUWA 3O6FB 2Y5TA 3WE1A 2AQPA 3IK2A 5T5FA 4GRMA 4UT7H 3CZSA 4NKMA 1QSFE 4R7VA 4QXWA 1WCBA 1T89A 4KH2A 1NJ9B 5I28A 4U1SA 3JWOH 1C7SA 1OT2A 5B8CC 4ZG1A 2R0ZL 2VDKH 4A2HA 3N06B 4PS7A 4P9ML 3DRQB 2A7BA 2YXWA 3D0LB 3ET9F 4ODSH 2WOYA 2KZBA 4LHUG 5CLTA 5D2LE 4XXDB 4S1SL 2BIOA 1FSKC 4ABQA 2FIRT 1H15B 5B3JF 4WHDA 5CJBA 3SDYH 2BS71 4R97C 1AIFB 3FO9A 3U9UA 5H4YA 3FH8A 2ZYHA 2ATPA 3EUUA 2MFNA 3HE7A 5HHQB 1CB4A 3KWVA 1CQYA 3CXDH 1Z9PA 1PEWA 3CU7A 4I0PA 4F15B 1G1KA 5T33L 4GG6E 2VJ0A 4PRAA 5IIEA 2IALA 2Z31D 3LMJH 4WV1A 3SZKC 3HE7B 3C08L 4MAZA 4P46D 5E8NB 4WFHE 4JO3L 3SEPA 4QJ3B 3U83A 4BZ2L 1BD2D 1WISA 4X8XA 3U7WL 3V0VA 3ARDB 1S3KH 3GSQB 2W0FB 4NCC1 4NZUH 4G8FB 4O2EA 5GIRB 3NFSH 3D33A 3A67L 3JV0A 5AVWB 4V1DE 3BAYA 3DRQA 3HC3L 5F3HA 4FG2A 2Y06L 3UC0L 4WRLA 3X1EA 4ANKA 1B2WH 3GEFA 2QGEA 2XUWA 4XO8A 2YC1A 1IBFA 4HBCH 4XWGH 4HCRH 3BSZL 4Y2DC 2CLVB 4LIQH 4NERA 3SBPA 4Y19A 1II4E 2F54D 4JRLA 4PRDA 3T2NL 5HDOA 1K5NB 4ENED 2OCJA 4J4PC 4F27A 4YSOA 3EAKA 1H3GA 4RISL 2I7OA 4DVBB 1KGWA 1VIWA 3H9HB 3L13A 5L8JB 2I9LA 4DEPB 4Y8AA 1GMEA 1D5ZB 2WVVB 4UTAL 5D4HA 5D70L 4PJDA 1CLZH 2DQIL 3MRPB 2J21A 4Q6KA 2ED6A 3ZE2E 1FFTB 3AXIA 2CGZA 3OJVC 2BP5M 4BFKA 2K6ZA 3I3EA 5ITBL 3VFOB 1ITBB 3RJQB 3QIWC 2A6JA 4KK5D 5E00A 1DTUA 3FFCE 3HIZA 1MQKH 3BSGA 3N43B 5GGTL 1IIIA 3R18A 3MXWL 2GKIA 4Y8DC 3CLFL 3MOQA 3IFOA 2ZT9C 3KL3A 3NA4A 3BZ4B 1BJ8A 5ENWB 1I7ZA 1RQ5A 3STBA 2EO9A 4FQ2L 4I87A 4Z7WF 4IRJA 4LHUD 2H0PA 3KBHE 4X7DC 2FWOA 1CGSL 3SKMB 2VDLH 3MOAL 1ZV9A 5MERB 4NN7C 1NDMB 1Z9LA 3P9WB 4NKDA 3MXVL 4D3CH 4QXGH 2EDLA 2H6UA 1L7TL 3Q5OA 4OCYH 4M48H 4F7CB 5MERA 5IQ7L 5I71C 5E9DB 1ZT1B 3DLQR 3JUYA 2D31B 1KLUB 3MBXL 4JRXE 1KFAH 2NDGA 3KXFB 2P8PA 5JPNC 1S9WA 1QBAA 1T0PB 1HE7A 3KLHC 5J6GB 2VLJA 4FD0A 3FYEB 4JPVL 2C3VB 2EIMB 2JKJA 5DJ0A 2AQ2A 4QHKI 4F9PA 1U8KA 1NC2B 2MHAA 2YRLA 5KTEL 3APDA 3BGFB 4CW1B 3JV6A 4V2CB 5TE7L 2BINA 1EXGA 3GMLA 5DHDA 2WWKO 4XGZB 2YQGA 1BVKB 3IWUA 4OCWL 3TA3A 3OKMB 2RMNA 3GSRA 1S7SA 3LPPA 2BXZA 1IGTB 3HG2A 3AJ7A 1GGCH 4GSDH 4XNQB 3HKFA 4XXDA 4YHZH 5E6IA 5HDLA 1ZLUK 1GGIH 4HC1A 1IGTA 3I9PA 3QR0A 3VFSB 4Y4HC 2EIJB 3X11A 3QEQE 3WFDH 1NIEA 3LKPA 3A4AA 1NBQA 1C12A 3RUGA 3BQVA 3PAYA 1HKLH 4ODTL 4GAYA 2C7UB 3RGHA 4AENA 2XQBH 4AYSA 3LB6D 4LSVL 3ZTNL 2YPVL 4MB5A 2X88A 3UCRA 3LRGA 1AGCB 5I0VA 4QYOB 1GZQA 2FB4H 1UXWB 3BMVA 4NT6B 1UA3A 1CMOA 2BSED 4P2RD 1FIEA 4N0RA 4YSPA 1ZIAA 5I76A 5TH2A 1TVHA 4DN4L 4L4VD 2VN4A 2J2ZB 3WHE1 4ZUTA 1OOWA 2AEOA 1JDCA 2MNWA 3WD5L 5IB2A 3D07A 4Q4IA 4G6AD 2D3LA 4QDGA 1TVBA 1OO2A 2VERA 4XC1H 4U1NB 1T5XB 4XR8C 5D1XB 3N55A 2VWEE 4P5MA 4P59H 4Y5YA 4EDXB 2OZ4L 2AK1L 1A2YB 1YDPA 1YC7A 3MX0B 1ZS8A 1JIBA 2K4WA 4GKNA 2K9FB 4ZSOE 5ICXB 4Z7WA 3CFMA 1S5HA 3APFA 2BY2A 4KX8A 4WO4A 3O0LA 1BZQK 3G6JE 4LVEA 2VR9A 3QIBB 2E4FA 3OKOA 3ZE0F 3PGDA 5LWYL 2HT3C 1H3XA 1KY6A 4QOKD 3F7QA 1ET8A 4R0LB 4TUJA 1QEWB 4HUWB 3U7AA 1DQDL 3VG9C 2WBJB 2FR4B 1KG0A 5ACZA 2VDKB 1KYAA 4WW2B 3SGEH 5E1IA 3VWJD 1NCIA 1J10A 3GBMH 1EAPA 5DFAA 3K1KC 3TO4B 3VI4A 5AW5B 1YMHB 5CCKL 5C0AD 3TBVA 2EDJA 4NN5C 3IJHB 3EO9L 4KO6A 5CNHA 2AXWA 4DP9X 5DK0B 3OSVA 2DKMA 3DRTB 3DWTA 2H1PH 3DOSB 4CSZA 2ZWSA 2AAAA 2P80D 3EH3B 4JZJA 1IQWL 3JWNG 2CIIB 3WFEH 1ONQA 1X5HA 1DJZA 1U8HA 1GW0A 3HHMA 2DBJA 5I0WA 1U9KA 3LN5B 5FYKU 4J6IA 1R5VA 1WTLA 2OMXA 3BUYB 3S36L 1YEDA 1EO8L 1YECH 3KCPA 4E9YA 1QTSA 4BJLA 4P59L 3VG0H 3P40A 4NEHB 4MA7H 2OMVB 4PJCB 1F58L 1T0NA 2Q8BH 4PSPA 1ZV5A 2AAVA 4GXVH 5JORB 3O4LA 1MNNA 2CHZA 1INDH 3M45A 3HJEA 3CZNA 1ID2A 2DZEA 4NO0B 3GBDA 3TBTB 2XX1A 2UX6A 1T7ZA 3GMOA 2X4RA 1IIKA 3BP4A 3L8QA 3MYJA 4PWGA 5EU3B 3NJNA 4LBEA 3HAEG 1W6LA 3FS9A 4PREA 1E5BA 1RERA 4FMVA 4QRQA 4GRWB 3RNQA 4FS0A 1YN6A 4NYLB 3FQWB 3QZWA 2OMBA 1G0XA 5LBSH 1XL6A 5FHBL 3S96A 1TZGL 4KRLB 4LFHG 1DVSA 4QXTA 1JZ8A 1S46A 2PWGA 3MREB 2VR4A 4QF1A 5B1AB 1IM3B 2P45B 4AVJA 5CEYB 2JKWA 1TZOA 2YMXH 2Q86B 2NOYA 1XAUA 4LMQI 3IKKA 2X1WL 3O6FA 4NQCB 4X98A 4ALAH 2P5PA 3BEVB 3FOLA 4S1QH 2CDEB 2K7QA 3RFRA 2H2SC 4KKBC 3MNZA 3VXSA 3BXNA 4IOFC 3CDFA 3MV8A 3T0BA 3ZDZB 3OWEA 2VLRA 2C4XA 3NJVA 3UYRL 3VWKC 3MRRB 2QFRA 2DWEB 1FVEB 4X0KB 3BO8B 3VI4E 4ZMTA 5L6YL 3DSNA 1BG9A 3DETD 1MHPL 2ZKHL 3X13A 1WQVT 4YSAA 4N20A 1HOCB 4G5AA 2WN3A 4PJIA 1WD9A 4NO5A 4HX1A 1EPFA 1HZHL 2ZJSL 1M05B 4FQPA 4BWTA 4BUGA 1KIUA 2HRPH 3E6HB 3HE6D 4KROB 5DK2B 5C08B 2W92A 1CGWA 5J1AB 1L5GB 2XG4B 1NIFA 5BOJA 2CHWA 2JTYA 3FL7A 1M7UA 2DQHH 4GAJL 3CFCH 5DUBB 1KLGB 1S4IA 4MCZB 4RAUB 3WKPA 4YBLB 3BXNB 4AC4A 4NAMA 4YHIA 4H88H 4IEFB 2BSDA 4OGAD 3AQXA 1T5KA 4NQEA 1AGFB 3US1A 3ULUL 2BHYA 2O5NA 3GUTA 5C0EA 4YH6A 3KYMB 3PHOA 1G1OA 5DO8A 3W39A 2NX5D 3PP3H 5L2KE 4AK2A 1IKFH 1ZLVK 3AT8A 4LOVA 2QPEB 3C5ZC 3Q8CA 5FKAA 4PJEE 5TFSH 2P5EE 1PG7H 1JXDA 3QEUA 2O5YH 5D71L 5FOBB 2JKLA 3MKGA 4MAYC 2C9RA 2H5UA 3UTSB 4RQQB 2BFVH 3H2QA 4AYBA 3FJTA 1ZXQA 3OTTA 2VDQB 2CIKB 4DKAA 4OAWA 1GS7A 1E40A 4WW1B 1LO4H 5HHMB 2V3FA 1FFOB 4NUMA 5TF1H 4EI5B 3BPOC 4LKXA 4LIQL 1OGPA 1FYTB 2IDSA 5DFVD 4XO4A 1HYRC 2YKLL 5KVEE 2G30A 2Z64C 4GRWF 4U1KA 4HIIB 1I9IH 5ISZE 2P49B 2UXFA 3ROLA 4GKZB 4UQIM 2XKUA 4XZ4A 3VGHA 3APMA 4YDLB 3PLYA 1NGPH 1WA2X 5JHDA 4HXBL 4MD0A 3DOSA 3KGSA 2HLFD 1XGYH 2OMZA 3QXDA 3RZCD 3QUYC 2YBRB 1NKOA 2EYTA 3GMOB 3MYJB 4A63A 1IL1B 1IBDA 3I6KB 4MKTA 3S88L 5IB5B 2DIBA 3K72B 5IROD 5HYSA 2NNCA 4OCNC 3L4VA 1E4JA 4XMXA 4O58L 4DZ8B 5A2KH 1QW9A 3MJ9A 1NANH 1B0IA 4FQXD 1CYWA 3Q0HA 3ORJA 3DVFA 3KW7A 1L7IH 3UZVB 3WIHA 3I6SA 2ZCHH 3N42F 4OR1A 1J1OL 2OMXB 5E8EB 5FUOH 3PYCA 4U49A 4K8RD 4S1SH 1G0YR 2R0LL 5JIMA 1S9KC 5TE4L 3UZQA 2A6IA 1A4AA 1M9WA 2MEJB 4G8EB 3QUHA 3RRQA 4AQAA 4XP6H 1THAA 3HAEA 4X83A 2BWDA 2PWEA 4HS8L 4DN4H 2VLRB 4P4KD 1V5JA 3JVFC 4WHCA 3DRTA 2D2CC 3NGBC 4JRYD 3DGCR 1I31A 4UILL 4RGNB 4GI8A 3E9UA 1H6UA 3UTTD 4PP2B 3Q6GL 4ZUUA 4ZW8A 2DTSA 3UFIA 5DEGB 4N22A 4L3AA 3WLBA 4R2GC 1XB6A 3DOIA 1MN4A 4J1UA 2WBKA 4PJAE 1R5WA 3W39B 4JNXA 3P30L 2HPOA 4PLNC 1H19A 3IDJB 3NP3A 5TJWK 1ZLUH 1UKSA 1X6NA 4ELMF 3LIZA 4M1DL 2HMIC 4FQJH 5D4QA 3SJVB 4YHZL 3C60C 4UNIA 1BECA 1M6UA 1VHPA 1P4LA 5IV2B 3D25A 4R83A 2EDHA 4Y4FB 1XF2A 3A21A 4K3HA 3W0WE 4JPKH 3GRWA 2PP8A 3G5VB 4XNXL 2BSEA 2F7IA 3G6AA 4NN5B 4KTYA 3VFGH 2F7PA 5DVOA 3LKRB 2VDOB 3OX8A 2C9PA 4HAFA 4WY7H 3TVMC 3UBGA 1A9VA 2FZ3A 5EIIA 5EEYA 3WY4A 5J11B 2CUAA 3PL6C 4GRWH 2UY7A 4IBYA 3B9KC 1D2OA 3MV9B 4D2NA 3EJZC 3N1FC 3ZOAA 5CEZE 4OZ4A 1H5BB 1KLFA 1IGFH 2CBMA 1HH6A 2WO4A 3WSQL 1I1FA 2QVMA 5KBMA 3T65B 2EVIA 4TTDD 2B5IC 1F3RB 2G9KA 1ZGLA 4MD5A 1DVFC 5DD1L 4F9LC 4KRPC 4E36A 2PLTA 9CGTA 1FNSH 1XHHA 3FAWA 4BFBD 1F11A 3NPZB 5E0QA 4KXBA 4OLZL 5IT2L 5F9OL 2YAHA 1EEUA 1T2JA 2VDRH 1G1CA 1J5HA 3ARED 1K3IA 4D0CA 2XU9A 1EJOH 1RURL 1RY7B 1FPTH 3FQWA 4BE5A 4WWKD 2HT4D 4XXCA 1TQBC 3NA9L 4LKCA 4X5WA 3IMVA 1KB5A 2IEPA 3BLPX 3ZUCA 1IGIL 1RUML 1IGYB 3LRKA 2QADB 1IKNC 2VXTH 4KBPA 3EXLA 3UXFA 5ICXA 4CVZA 3MGOB 4AE0A 1FL5A 2EH7L 4X0NA 4AI7A 2OR9L 4WHYG 5KJ7E 2EABA 1D9KA 5ICZA 4MQTB 1KXQA 3D3VB 3ZKMC 3MRCA 4P2QB 4XOEA 3I74A 5T8IA 4GUPB 4DK3A 4RFOH 5F88B 4MNQB 1WJ3A 3VD5A 3ZGIA 4DKFH 3B3IA 3EYOB 2QQLH 2D4DA 4BK4A 1E9PA 4XCCH 3C6EA 5D1ZC 1A0QL 1CE1H 5JIDA 5ITFB 1TVHB 2JIXD 2X4QA 4IQHA 5JDSA 4YN3A 4B9KC 2O61A 4IRJB 4JY4B 5E2WH 1RH8A 1S9VA 3ARGD 3DJ9A 4J3OH 2EXWD 2RBLA 5D7KE 3PHQA 5KSVA 2HX9A 4NQCD 4BD4A 3CFEB 1R1CA 4K9EL 4UZUA 3ZO9A 3B9KA 2NXYC 4KVNL 4N2IA 4YXKH 1YZZA 3SDYL 5F9JA 4KNSA 4KTDH 3CQPA 3NIGF 2ODHA 1EO7A 5F88A 1G7MB 1ND0B 2WJ7A 3BUQA 3MUY1 3DUUB 3T8VA 5IESH 5E1GA 1NCDL 2AC0A 2QKIB 5HHXL 5IJBC 1F8TH 1MCSA 2R0ZH 2IAND 4O9HL 5LUMA 4KGJA 2CDGB 3GHEL 1AO7E 4G2AA 1M7XA 2G3ZA 1UZ8A 4W9JC 3CC1A 1QSFD 1I8KB 3C5SA 1IAIH 3KPOA 2H2PD 3MACL 3SDCD 3ZSTA 3REWB 5AG8A 2EUWA 2BH0A 1MW0A 3IE4A 4OZFA 3VO0A 1MNUL 4BKTC 3GSWA 5FLVA 4UU9A 3KLKA 4GRWE 3ZN6A 3VFNB 4PJEB 2B3RA 3FN0H 1OCWL 4UINH 3WEXA 3RL2B 4KHXL 2XTJB 5J13B 5DLML 3NRPA 2FEDD 5C09E 1U8PB 4POUB 1FG2B 4AQEA 3OQRA 2DQJH 2NY4D 1E9PB 4FNLH 4K7PY 5I0XA 4XPFL 4RAVB 3DX3A 4PJHB 4BXSV 5L2JB 1QPXA 2GUOA 3MI6A 4M7KH 1F3JA 1TKWB 5AKTA 4WENB 2VZUA 3NSCA 3A0OA 4DPAX 1JD9A 1ID5I 1UD8A 1UM5L 2AEQL 4HPYH 2AVFA 3AQYA 4I0PD 1ACCA 3RJDA 3QRGH 4M03A 5FWRA 3AXLB 1EHLH 1UVQB 3QI9D 1GZPA 3VXRB 5KYWA 5B3NA 5EEZA 1FL5B 1NGYA 1RI8A 1ZHBB 4BFNA 3L3JA 1DQLL 5C9JB 4MCYA 4JFZH 5EDXA 3X2QB 4TSAH 2B3IA 1XWVA 2D9CA 1RPQA 1WFTA 3QDJE 4TQ8A 4OZ4B 5I66A 2GTWB 1TTFA 2Z35A 4OT1L 5G2NA 1B4JL 5DC4B 3BVUA 3BFWA 4HW6A 2Y1AA 4G7VL 2R69H 4YQXH 3EZJB 4CKVX 5L9DL 4ODHL 4PS3A 3T09A 4FAAB 3GBLA 3A47A 5M95B 3GI8L 2G5BA 3IMTA 5FUCE 3LZQA 2BIMA 4HEPG 4RA3A 4V11A 1JPTL 4DVBA 1OTTC 1OY3B 3EYQC 3M8OL 3VFPA 5KYNA 5E5UB 1RZFL 4NKMB 5E2WL 4XMKH 3G5VA 2YN3A 4NLHA 3KVQA 5I6NA 1MUJB 3GO1L 3I6KA 4KKAD 3NBNA 5CILL 4G72B 4KRNA 4MD5B 1FE8L 2FUTA 3T3ME 1PLBA 3V4VH 2R1YA 4IRZL 5DUMH 2P5WB 3U2SB 1BF2A 3D18A 2C4FU 2XKSA 4DOHE 3EYOA 3DYPA 3C6LB 4I77H 4PLJC 3D69A 1USQA 4DO6A 1MG3C 5D7SH 5E03A 1VACB 3AQZA 4GRLA 5BOZG 5DHVA 3D4GA 5GRZA 2V3EA 3MJ7A 1DUYB 4OFPA 3ZKSD 1IBYA 1L0PA 1A6TA 4WUUD 1VFAB 3SOTA 5GZOD 2J1KA 5F6HI 4HZLB 4ZAKA 3MRMB 1ODUA 1T66D 1XGUB 4K7PH 4DEWA 4IRSB 1YJDL 4IW4C 4Z8FH 5AAWA 2WXJA 4YDKH 1PKQA 4NM8L 1GVIA 3RAJH 3HZMB 3G6DH 4NUGL 5DURD 3GSVB 2ZE0A 2J1XA 3OB8A 3ZYJA 5LAPA 3PXJA 1FPTL 5GS2D 2XX0A 4M5YL 5BZDA 3GMMB 2KT6A 2W65A 3KLDA 5E8OB 5I1CL 5JA8B 4K5PA 1Q0XL 15C8L 1EV2E 2IQAB 3DIDA 1TTRA 5E9DE 4PMFA 1BZOA 4LCCC 4YBQC 3RL1A 1NBYA 2H4EA 4ZUVA 2WTOA 5I30L 1C5DB 2L7QA 1JE6A 3R4DA 1GY2A 3GO1H 1LMIA 4Y1AA 4LLVB 4M1CD 5MI0B 4XNDA 3FBKA 1ZS2A 1F86A 1G9MC 2G0KA 1TCMA 1U30A 1UZ6E 1ZCRA 1IGJA 3FUNA 4XBGB 4ADJA 2UY6A 5GGSA 2ZOKA 3B1UA 5KYWB 1IGFL 3P11L 4LARH 4KPHH 4M62H 2PYEE 4Y4FD 2Z92B 3P9MA 4GKLA 4YO0B 4DQOH 2Z8RA 3IGLA 2FQEA 2MPAH 3KPMA 1EA9C 1UWFA 3NJHA 4PV9A 4DGIH 4JN2A 4L8SB 3MCLL 2AQTA 4PB0L 4CNIA 2EIEA 3M46A 4EXPX 1WS7A 4APXB 5BW7C 1V7ML 12E8H 1LO2L 4DGVH 4QHNB 3JTTB 5EUOE 3B1TA 4DN3H 2BZDA 2ZSWA 3PWVB 2B1AL 3L3IB 5IIEB 4XB3A 3LEYH 1BIHA 3SGJC 4IIZA 2WXNA 2Z8SA 2WZPA 3F84A 1YEGH 1NCHA 1WFUA 2VISB 2QADC 3QQ9D 5IBUB 5I5IA 4OCSL 3D7PA 3C6SA 5IEKB 4BELD 3LKNA 1A7OH 4NZRL 4X6EB 3W0WA 1OQOA 4EEEA 1D6EA 1XR9A 4Z7QB 4FF9A 5DYFA 2L8AA 4OKVB 5CJ8A 4MX7A 3ARBA 3L9RA 4MZ3A 2V9QA 3QCUL 1XXFC 2IOMA 3SPGA 3EGDA 1XSJA 1E4XI 1G0DA 1XBRA 4UIKL 1X5ZA 2WIIA 1WAAA 3EFOA 5DJDB 2Y7QB 3LS5L 4LBEB 4R7LA 5J12C 1JRHL 2V2TB 5DF0A 1DQQA 2IDUA 3V0WH 4LXFA 4IGBA 4UBDC 3U1QA 1KCRH 1HWGB 2G60H 2IXQA 3CPLA 3QUMH 4V1DB 1MHEB 1SOKA 2YEZA 3ARRA 3IGFA 1BQLL 1EAJA 4P2CG 1BOGB 3V7AG 1X5IA 1HCYA 2MPVA 5DGRA 2RIKA 1NQBA 4J6RH 1J87A 3SBQA 4U1HA 2UY7B 5FDWB 1UFUA 4GSXA 4FCAA 3RZWA 5C6TH 2AXHA 2P4AB 1NFKA 5EZIL 1M2VB 4KKZA 4ATWA 3EHBC 1ZHNA 2QV4A 1QFUH 1R3HA 2ARJB 2P52A 5F93C 5TF0A 3GGWB 5IBTH 3HB3B 2EIKB 3P4MA 4XPGL 2Y69B 1RUKL 1WT5C 4GQ9L 2F53E 1IGJB 5C3IA 3V0IA 5LNDA 2X2IA 4ZDHB 2G2RA 4FXGC 3ZE2B 2I5YL 2LLLA 4BQ6A 2HFFA 1C1EH 3ARTA 3F7VA 4F7TA 1K6QH 4IRJD 3SJVA 1DBML 2J43A 2R4RL 4ANVA 3QYCA 1I3VA 2ICWJ 2OTWB 4GKZA 2BY1A 2OCFD 1L5GA 1MJ8L 1RZGA 3FFCB 1CXHA 3BH4A 1UOWA 4QF1B 5BCAA 5C2BL 2TSAA 1NBYB 4YGVA 3G08A 3HI1A 2Y36H 4OD1H 3T4YA 3ZHFA 3CHPA 4ZPVB 3D2UB 4CILA 5LBVA 1I1YA 1CICC 4G70B 3BIKA 1JGUH 5JIPA 1ZVSB 3OLGA 1HT6A 3CQQA 4OBSA 4FKHA 3H9SE 3NDYE 2CIKA 3FNKA 3L3GB 5F7FA 3ARQA 4V1DA 5HI5C 2XN9D 1X5JA 3TWYA 4HS6B 3IDMB 3MLZL 5DHXB 5JPMC 2ZP9A 1NDGA 1P7KB 4N8UA 5L7XH 5E9AA 3K71B 4FTVB 4AUJA 1MEXH 4HIJA 2BVTA 1J0HA 1A4BA 4RFEB 1EJOL 1RURH 3A4EA 3ECUA 2QVKA 4O51A 3NVQA 1DUZB 5F9OH 1MCOL 4L3CA 1VADA 2F54A 4JFEB 3WIFA 3WDIA 5EUOF 1BF5A 2ICEC 3S4SA 4H1LG 1MCWM 4FE9A 2E7BA 2H6OA 3GKZA 3L45A 3HZVB 3KW8A 2WINB 1DBJL 1W91A 5DCCA 2XBTA 3WO4C 2YWYA 1TQUA 4YAQA 5A6LA 1IL1A 3WSQH 3UBXG 1T83C 4B9YA 3STLA 1TQVA 2KERA 5DSCB 4JFDB 5K39B 1DZ0A 3L4TA 4GO9A 2N4IA 4F20A 2Q6WB 4PBDA 3LV3A 4ERSL 1WFNA 2HRPL 4FNUA 3V6ZB 2ADJB 3R1GH 1KN2L 3CZJA 4EZMA 4L05A 1Z0MA 3SQBA 4Y5YC 1KIUB 2Q1EA 3E6HA 3QJZA 5DK2A 1UATA 1SF3A 1QWHA 4NHUA 4JKLA 5F0PB 3GPEA 5PAZA 1TTGA 5GGVH 2ZKHH 4QMEA 1PAMA 2XZCH 2EIZB 2BCKA 4LESA 3RHWK 4ETYA 4AUYA 7CGTA 4MXWH 4YSCA 3RGVC 2CM5A 3M1OA 3OKLA 5FA3A 1B88A 2XWEA 3VQLA 2IADB 1UQSB 4EUPA 2ZUYA 4WO4B 4L9LC 3CPLB 1UC6A 3MBWB 1KYDA 4WSGA 5GGSB 4OH2A 4XP9L 3OR7A 1JXKA 1PX3A 3QRLA 1DEEB 3ARFD 3VXMB 1BM3L 2MCPL 2YMXL 2R56L 4U6HB 1SVZA 1MCJA 2ICWB 5CMAB 4AWJC 4ZX6A 5CSZB 4WI5A 3AAZB 3CVDA 2NY6D 5CEYA 3W56A 2FUQA 1UYWH 3CX2A 5I1LA 4BEIA 4JR9H 3PS6A 1RU9L 1DN0B 3RNKA 3HEIB 4JMXA 1MREL 2B7DT 1JDDA 3EGXB 1T5WB 3UBXI 1VEOA 5FWQA 3EH4B 2GQHA 1A1NA 1E7UA 2PPCA 3FONB 2OL3A 3EOBA 4F2ME 4W4OC 4E9VA 4IRSA 4J3OD 5L4FA 3QIWA 5B39B 3ZHDA 4RX4D 5FUOL 5GS1B 4D94A 4RBPK 4WUUB 3GZOA 2OI9C 4L0ZA 3MX0A 1L7IL 3TPUA 3LKPB 3JWOC 2A6JB 5E00B 5JDJA 2XZQL 1X6LA 5IEHB 3QS3A 3EBGA 1NFDB 2DYPD 4JFSA 3X3FL 5ISZB 3OAYH 3ZTEA 3JUZA 1EQWA 4L5FH 3V9EA 3DXAB 4MRCA 4YDJA 3S88H 3PWPD 1QLFA 3P2DA 3PWJB 5AZEH 3VCLA 1BVKA 4JFFE 5D9SB 4MS8D 4G8GA 2XY1A 5GISH 3FB8B 5L8LB 1JPEA 2YEQA 4JHBA 3D1MC 4LSTL 2UZXA 5I75C 1I9IL 3F00A 4LQFL 5G5DA 1CL7L 3V0JA 1SYSB 5ALCH 1JGVL 4FERA 4AIXA 1G7QB 2VL5A 1R3LB 3NIDE 4OGXL 1ZT1A 5GZNA 3VFRA 1TYRA 5CFHA 3ESPA 4ELMB 2YAPA 3IPEA 1I82A 1IGCL 5FM8A 1EVTC 1OGAE 4NQTA 2WM0A 1ZHLA 5KSBB 3CU1A 2HPTA 1QFWH 1N2RB 1A4KB 2ITCA 3QNXB 1UWEL 3ESMA 1KBPA 2CALA 2J44A 1V55B 3CMOL 4AYEC 1I75A 3V0VB 3B56A 3T0EE 3MMEB 3VD2A 4UU9B 5EO9B 3DBSA 3O8XC 2PXYC 5GSVA 2O5YL 5D71H 1A14L 4JN1H 4J3BA 4NQXB 2CDFB 2ZXBA 2J1YA 35C8L 1IAII 4FQXA 4JDTH 3BW9A 4LHUB 2OMVA 1EANA 1OK8A 4PJCA 5GSVB 5IBLC 4AJWA 5HYQB 3GBNH 1RLBA 1CTOA 3IS1X 1DYZA 3GC3A 4GOSA 2M2DA 4HCGA 3IJSA 2QQKH 4AJYV 2FX8H 3DURA 5ES4B 4PVNA 5DHVB 3GJFB 2HLAB 2V8MA 4RMQA 5I8OL 2GUOB 2ITDA 2X05A 1ETZA 1I3UA 1NOLA 3ZDZE 1S7QA 1OW0C 5K59F 4RMSA 2IPUG 1SGKA 4YNYA 4YE4L 1EERB 5A6IA 4S1RL 3LYRA 4AL8C 1K5WA 1HI6B 2MWCA 1R4XA 2E7LA 4BFEA 1HSAA 1N6VA 1QBMH 1F02I 1NBVH 5DUPH 1OGTB 1Q1PA 1HN1A 2W81C 3K91A 1RJYA 4GUCA 5I6LA 1G9ML 1AP2B 4UTBA 3KPLA 5ETUB 3VXTB 1EAPB 2JKSA 2X12A 3MNVB 1AQKL 4JQVA 4OI9A 4Y2OA 4HWBL 3S35L 4GAYB 5HGHB 1SXBA 3MA9L 4N8VA 4YHNA 3H42L 4ABUA 4L3EE 1GZHC 3U4BH 4GO8A 3MUZ1 3WUWB 4N0CC 4N2GA 2BW5A 4XXCC 3QC6X 2ZOTA 2AV7B 3RWHA 4AM0Q 5MENB 1RVFL 1F00I 4I9XA 4QCIB 2B4CH 3ALXA 5C0GB 5B8CA 3HLKA 3CVHB 3N1MC 2VB5A 4M1GH 4U6XA 4UAOC 3A24A 2C5DC 3Q3GA 1CFTB 1YA5A 3M88A 3BFQG 3CFEA 4E9XA 4JKPH 3PJLA 4GQRA 1J5CA 2VAAA 4BHUA 5D5ME 1U3NA 4ZTOH 4ETQB 2EO1A 1FAKT 2PUQT 1OWRM 4KKQA 4AM0B 3LDBC 4DKDC 1PX4A 1LEGA 1P69B 4JRXD 5KOVC 2EYSB 4J4PD 4JM2D 1ZA3A 3II3A 3QFJD 1PQZB 5SX5H 5L2JA 2J5LB 2F74A 1QPPA 4N90D 4MXVE 5D1XD 4H13C 1YQ2A 1ORQB 2ZAHA 4YE4H 3SPVA 1H8NA 4X6BA 4FYQA 4IKLA 5I5MA 2B77A 5SV4A 4U1LB 3IKCB 1WZAA 4UQBA 5GXBB 3ETBJ 1WEJL 1FDLH 5DEGA 1HC1A 4ZMXA 1MFBH 2FJFA 3BKML 5H35A 3QIWD 4KK5C 4CU8A 1U3HD 1Z66A 3OR7B 1FIGL 4U4IA 2H3NB 4B6ZA 3MRLB 1MCEA 1MQKL 4QEGA 3F2LA 4PG9B 4XH2A 1F1GA 2CNZA 2DM3A 2ICCA 3S36H 1C12B 3RUGB 4UDUB 5I2IB 5ITBH 2OMWB 3FB7B 2JF1A 2BJML 2X4NA 3POCA 3DX1A 1H15A 4FNRA 2XN9B 3TFKC 3VFVB 1Z2KA 4B95C 2HFGH 1G7MA 3IVKB 4B9ZA 1JHKL 4DOHB 4PJ8A 5PCYA 4H20H 4RLDA 4UIMB 2P44B 3JBG7 2P24B 2YUVA 3OKMA 2XQ0A 2XTSA 1OHQA 1TJHH 1RK1B 1T7VA 5TE6H 3KM1A 1VGKB 2AEWA 5FM5M 5DD3H 1ASOA 2F58H 4PJBE 5A2JH 1TENA 4PJ7F 4GBXD 5FPIA 4YE0A 3NQKA 4YGAB 3DK2A 1CT8B 1AQDB 1OT1A 3D34A 3O9WB 5ALCL 5M7QA 3WUZA 2VO8A 2E3VA 5FCUH 5D6DC 2D31A 1ZT4B 4TNGA 3UTQB 4JJ5B 4PD4K 1C7TA 2EILB 2DTML 1G43A 3MJ6A 5K9JL 4NIYE 2A9MH 5DD3L 3G6JB 2AK4B 1DL7H 3SGEI 5C0IA 1TJHL 5EC1A 3B8SA 5ECGA 1ZA6B 5FF6B 4QTIH 1LM8V 4OF8A 5GISL 1NLDL 4OFKA 4OJFL 4DFHA 3D52A 4GS7B 1KWKA 3ARDA 1NCCH 4Y4HD 4NO0D 5HSFA 1J12A 4WI0B 4NJ9H 4JO2H 5I6OA 3VD3A 1VKXB 2EIBA 4TNWF 3BSZA 3KLLA 4A2DA 4YSEA 1SJHA 2HCZX 3KVPA 4AQAB 4OFIA 2A73B 2E9JA 3E3QE 4YIQA 5CSBA 3VFOA 3QUXC 1KB5B 3CSGA 3SPCA 1ES0B 4BQ9A 3D25B 4GEJA 4P9MH 2XV3A 5CUSH 1JFQH 3BZEA 3UJIL 5I8CB 1ZHLB 1W0VB 4JM4H 3EBHA 4NFCA 5KSBA 3F85A 3RWDB 3WAKA 2AJZB 4C4BA 1NAMB 1FUNA 2PKDA 4NO2A 2VW4A 3ZE1F 4LPYA 1NJ9A 4J7RA 1RU9H 2J6EA 4TNFA 5EIQA 2R7EB 1MY5A 4KK6D 4LSVH 1PYWB 5JLZA 4PP2A 2QQNL 2VLKD 2VMEA 4C56E 5JXAL 4Z1PA 4PJCE 4YXHL 5D6DA 3WIAA 4YLCA 5CAYB 3S97C 3Q13A 4QOKA 1W16A 3U0WH 5IVXA 2AW2A 4F33B 4XP9H 5H8DA 5FB8B 3CD4A 4HKXA 4ZBJA 4G8EA 5FK9B 4WW2F 1OAKL 3RDTB 1KNOA 1JZ3A 1FFNA 1IC5L 2DICA 2BOLA 3QORC 4LOUD 4RNRA 1C5CL 2BCKB 2CSPA 3BPLB 3HS8A 3HE6B 5C08D 4TXVB 4WCYL 2ZICA 5DVLA 4LK4A 4J8QA 5IREA 4DP8X 1RVFH 2BMKB 2MIZA 3SKOB 3PQYE 1AQMA 2R4SL 3T0VA 4KY1H 2YXVA 2IWKA 2IVFC 2ODIA 3UAJC 4F9PC 3HUJF 2BIPA 4QRUA 3IU4H 5INDB