5DZ9A

Streptococcus agalactiae agi/ii polypeptide bspa c-terminal domain (mut)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BspA
publication title Structural and Functional Analysis of Cell Wall-anchored Polypeptide Adhesin BspA in Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae serotype iii (strain nem316)
molecule tags Cell adhesion
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A02
3HR6A 3HTLX 5DZ9A 4P0DA 2X9XA 2Y1VA 3KPTA 3V10A 3RKPA 3QE5A 4IGBC 3PG2A 2OKMA 4IGBD 2F6AA 4UZGA 1AMXA 4IGBA 4HSQA 2Z1PA 4OFQA 2WZAA 5DZAA 3RPKA 4Z23A 2F68X 2WOYA 3UXFA 4Z1PA 2XTLA 4IGBB 3OPUA 3PF2A 2X9WA 2X9ZA 2X9YA 2WQSA 3QDHA
chains in the Genus database with same CATH superfamily
2K45A 1LD9A 1F4WH 4KJPC 4PD4K 1T5WB 2G5UA 5E8DH 1I8UA 2C8NA 3BGAA 3FQYA 4PHZA 3NA4A 1IEBB 3LH8A 1M9WA 4YH6A 1QTSA 1UQSA 4EXPX 1LD9B 1XGUA 1N70A 3QUXB 5FS5A 3UMNA 4A6YB 2VXQL 4MXWH 4Y19A 2XPZA 1WC7A 2B8OT 2BSRA 1I9JH 3D0VA 3DX0A 3K5SA 2OW7A 2IDCA 2VRQA 1XGUB 5CINH 3GRWA 4TVPD 4X0KA 4HMEA 4Y19B 4ADIA 1N26A 4P59L 3SDAA 2BSRB 4Y88A 5IB4A 2D73A 1XCWA 3B34A 3L7FB 5I82A 4QXVA 4OCRH 5T3ZE 1S7XA 3VFGH 3VXPA 3OAZH 2X41A 1E43A 1T03L 3CH1A 4S0SD 1WHPA 3PDDA 3T08A 5IB4B 3T3PE 1NMAL 2UUDK 3MNMA 3SPHA 3NYKA 2J8UA 5D70L 4YK4C 4JFTA 2QZQA 5IROD 3N3EA 3CH1B 4FQJL 2CJUH 4LSQH 2V6HA 5T3XD 2YA2A 5CD3A 5IJKC 1NCDH 1IEAB 1EK3A 2OX5A 3W0WE 1X9UA 3HIZA 4QYOA 1X4XA 4FQPA 3EG9B 3LZFL 4ORZC 3W39B 1ZT4B 2YLHA 3HBZA 1DBAH 4IRSA 4ZQKA 4JM4L 5JO5A 4D2NA 4M5ZL 5C0JA 3FRPA 2OX5B 3O0RL 4G6JH 4KNSA 3GKWH 4NBZB 4QYOB 4GXUM 5DUJA 5E8NA 1XBRA 3DI2B 3K74B 5IZ7A 1UJ3A 1E27A 4ZMWA 2QGEA 2IFFL 3EFDL 5C0JB 4TQ8A 5IHHA 1U30A 4LSPL 3QHFH 5F7AA 4LARL 1FG2A 2PYEA 1I7ZA 3B3IB 1UJ3B 3DI3B 4U6TA 3IJEA 3JV0A 1E67A 3D1MC 4GAGH 1LEKA 4NSKB 4N8CL 2O5XH 4AEEA 3S2CA 4GRLD 2MTAA 3AG2B 1ASQA 5TQ0H 1FG2B 3L08A 5DO8A 1I7ZB 4XXWC 3L1FA 5A16A 2F7OA 4FABH 3IJEB 5AG8A 4QD2E 4EDXB 4JFFA 3SDCA 3GJFB 4NGHH 4M00A 1MI5B 2YXWA 5TPWL 4B7LA 2EDRA 1JZ2A 1N68A 3NFPA 3BESR 3O3EB 3HW7A 4JFFB 5C6TH 1PNCA 2DQFA 1MJUL 3D9AL 5IW3A 3O6MH 3EFOA 4KKPA 1OSYA 1YEDB 2P28B 4IIZA 2F5BH 1HH6B 3DJRA 1DBML 3FFCA 3HNTL 3NSCA 4DP5X 5F7UA 5JDJA 5L2KA 2QPDB 1HZKA 3ZT7A 3A4FA 5F9OL 4HLEA 3ISRA 3EFOB 4UNVA 2PN5A 2ZWZA 1FC2D 3G7TA 4AEHH 1BA9A 3GSXB 1CQKA 4GYBA 5AVVB 2EDDA 3Q06A 1HZLA 5L2KB 4YHNB 1QO3A 4OUOA 3EYOA 4WY7L 2YEVB 2F58L 3VXQA 1I1YB 3L3IA 3O4LA 3E2HB 4JGNA 1CYGA 1TTFA 1QO3B 2R69A 1XB6A 4NKIH 3VXME 2F2HA 1ZVHA 4KXCA 5D2NA 2XX1A 3VXQB 1UJTA 3L3IB 3IN0A 3JVGA 3O4LB 4ZOCA 4X6DB 2XPGA 5E9DB 4NWUL 3U46A 4JREB 4F9LA 1U2CA 4R7DA 3PJLA 2MCPL 1MHCA 3T77A 5D2NB 4W9LC 1XX9C 3CFQA 4JW3A 3E8UL 5DF0A 4JPWH 2ENPA 1YYMH 2NQ3A 2XPGB 2GK0B 1IGCH 3UROR 3U46B 1LWHA 4A2EA 1F4YL 4HXAL 2WGNB 3I02B 4AYEC 2BNQD 5HI4C 4HS8L 2I24N 4H0LC 2NTFA 1H3GA 4X99B 4WUUD 3QZLA 1J7VR 4GO9A 3VRLE 5FO7A 4ZO9A 4JRXD 1R19A 5GRUH 1D7FA 2VSCA 2E8YA 2NTFB 4JK0D 4MAYC 1HNGA 4B50A 2VO8A 3ARGC 1F3RB 1FJ1B 1S6NA 1S78D 3ML9A 1FGNH 4N86A 1CIDA 3DUSA 5C8JA 1NMBL 4YPJA 4GXVH 3BUDA 5EBWA 3H0TA 3IJHA 5DZ9A 3BP7A 4OFPA 4UNTA 3VRIA 1DQMH 5ISZE 3DUSB 2GAZA 4NQCE 4OM0H 3FO2A 2R1YB 2FX9L 2EZ0D 4PEEA 1DL7H 1SXAA 2A74C 3ZKNC 4OZFH 3TN0D 4HBCH 4P2QD 4I4WB 2EDOA 4N0FB 5EBWB 4O9HL 3ZLQC 4DO5A 1SZNA 3VRIB 1IM9A 4BGDA 5IHWA 3FO2B 4TULL 1S9YA 1PIFA 4OCSL 4B9CA 4YS4A 4ZMZA 1PFCA 4KUCF 3L5JA 5AUMB 1IM9B 5F71A 1LO4L 5KSBA 2ICEC 3Q48A 2XT1B 2K9FB 3QFJD 3BKML 2R27A 3KPTA 2H4EA 4AQOA 2C26A 4FG4A 2XJLA 5CLZA 2W81C 3LCYA 1KDJA 1R1CA 1Q9WA 1EVTC 4ODXA 1EZVX 4JNXA 3ULVE 1MFDH 4N2HA 1HYRC 1FBIH 4PU2A 5AOMA 1SXNA 3R4DA 5T5NG 3WNLA 5C0IA 2FH6A 1F86A 3ARZA 2GCYA 4P2OC 3C6EA 1X5HA 2DJMA 3LB6D 3MSPA 5D7HA 4JO4H 2B9BA 2ISDA 1Z9SA 2E6QA 5DT1H 3C6LB 1TJXA 2OYKA 4D9RE 2FO1A 1ACZA 3H56A 5C0IB 5CCKH 3OKEA 4G6KH 3IBEA 3BUBA 3GS7A 1KV3A 2GCYB 4NN7B 3MLWL 5AW9B 4DIXA 1MFCH 5EORH 4TPRL 3WY4A 4PM1A 5CWSA 3ZHNA 2GIXA 4UWQB 3EDJA 1TLKA 3MUZ1 3BE1H 1QI4A 3H7BA 4IEFA 1NGWA 5B1AB 3MRHA 4KX7A 4ZFOB 3OKEB 2NY6C 4MMYB 1MFVA 3SGJA 2A9NL 1M42A 1K3IA 1X7SA 1N2RA 1RAMA 2H3XC 3U9UB 4IEFB 3CN0A 3MRHB 4J8QA 3LKNA 5JW3L 1HIML 1IARB 4UM9D 3VVWA 2YLKA 7FABL 1R3IH 1T22B 3BQUA 1TKWB 1N2RB 3MJ9H 5G4NA 3T2NL 1J5IA 2PR4L 2VN7A 1DLFL 4MCNA 4YDVA 4OCNC 5BV7H 4FFZH 3GXPA 3R8QA 3KLSA 1B6DA 2WKOF 2CHWA 1KXVA 3QEGL 4U1IA 4ZS6C 4N90E 1MCRA 4ODUB 5AFAA 1JRHI 4GKSA 4F8LA 5H8DA 1WBZA 4MJ6B 5CS7A 3LZLA 1J05A 1C8QA 3QQ9C 2PPAA 2QPEB 4WJ5A 2G0LA 4U1IB 1F4XL 3B1UA 1CF1A 3KGTA 4HF5L 1RUPH 1VJSA 3IPFA 5D72H 1W6WA 1IGYA 1WBZB 4RGND 4P2RB 3VWKD 1GY2A 5C0AA 4JDVB 5A2CA 1J05B 4WSJA 4U1HA 1UB6B 2YQGA 5GISH 4IKKA 4A6YL 5ID0A 4WJ5B 3KL3A 4JFZL 1FFTB 4GG6F 1W9XA 2A6IA 4XN9A 4LU5H 2GI0A 2LR4A 3RX5A 3W56A 4U1HB 4MNHA 2VN5A 1RIHL 2GT9A 3FTGA 5IK3B 4YBQC 1TQSA 1M4KA 3DDGA 3QCTL 4ZFQA 3V0FA 2GQHA 4MNHB 4XVUC 2MIZA 4HJJH 4XMLL 2GT9B 5CGYC 5F7MC 3FTGB 5I6LA 5JR1H 3K2MC 2ZYHA 2WLHA 1BLIA 4KRPB 3ARBC 2NY5L 2X4UB 3MV8D 1KNOB 3V6FA 3QJOA 1E7UA 5FC9A 3CZJA 2R1XA 4I1NB 1YEHL 2NRDA 4EBQL 2ZICA 1IAMA 5JDSB 5LAXB 1FRGL 3O8XA 4X4KA 1E5UI 3O6LL 1OHQA 4OLZL 1TVHB 4UDUA 5F7DA 1KFAH 3GIVA 3F5WA 3GO1H 4BKLA 2KT6A 1A5FL 1NAMB 1T66C 1TNNA 2X28A 3DMMC 3HLAA 3ESPA 4NQQA 2DLIA 4PRNB 4G1EB 2WUCH 3O8XB 4OLVL 2LT9A 1OPGL 3FTSA 3UO1H 1PY4A 5SX4I 3K1DA 3S96A 4PIBA 1NWOA 3EGDA 3H54A 3HLAB 5JHDB 4LMQI 4ONFH 4NM8H 1UWFA 2IWEA 1MCSA 4OFDA 2XWCA 2V3DA 3C2AL 3SZ6A 1SJHA 5DEZA 3MJGX 1IKOP 1JCKA 3MJ7B 4HGMA 4M3JA 4PJ6A 4YHOH 4BGLA 3ATEA 5GZOC 3OMNB 1EHNA 1M71A 1ZK5A 4FNTA 3R18A 4MLIA 2GUOB 1UZ6F 1E7VA 5F7FA 5DGQA 4RMRA 1DBBL 2EC9T 3GXIA 1A6ZA 1BX2A 1L7TH 1MW3A 4UAOB 4PS4L 5E9NA 2LV4A 2X1WL 4IKLA 2RB8A 2OI9B 4ZMPA 1OF0A 2VLRE 1E50A 3U1PA 1A6ZB 5F0JB 2O5ZH 4YHKH 1D2PA 1KY6A 2NQCA 1K4CB 3UYRH 5E6SB 5CLXA 2QHRL 1JFHA 3BGFB 4QXWA 2WD0A 1K8IB 3BDBA 5EDXA 2Y7QA 2P5WA 4JLRA 4MQSB 3KR3H 4I88A 4GQZA 3UEQA 2Y6TE 3BT2H 2IMMA 1JVLA 3B9VA 2XA3A 3TIEB 5T5FA 3MLXH 5F0LB 4TNEA 5EU7E 1KCUH 2P5WB 3HUJE 4K9EH 2F53D 2DMCA 3I6GA 1BIHA 3BHBB 3L3HA 1NCWH 1GGYA 3GMQA 3BX7C 3VFSB 3QI9A 2AQPA 1XF5A 5CD5C 3I6GB 1W8OA 3A5VA 5JUEL 3GSOA 5IUSA 2CMRH 3A67H 3NCBB 1QZ1A 2O30A 4ZOEA 3CXHJ 3B9KB 1A1MA 1IT9L 5GHWH 5KTEH 4XBPA 3U4BH 1OCOB 1OGAA 4F15C 4ZAKA 1A0QH 1NKRA 3GSOB 3SDAD 1PPIA 3GZQA 2G3MA 4I0PD 4Z95L 4X80L 1QLFB 4ZO7A 3QGVA 5HVHB 1AR1D 3U6XA 2V4LA 3RU8H 4XMZA 1E30A 1EFXB 1KG0A 1OE1A 3GHBL 5C0BE 3Q05A 3TYGH 3U48A 3MOBH 4XP9H 1WIUA 4N20A 4IJ3C 4E9WA 3T8XA 1JERA 4PHXA 1QR1B 2ZAGA 3CXDH 3ZIMA 3Q6GL 1DZBA 1KG0B 3OR7A 4GINA 3AFLA 3NCJH 1FO0B 1U92A 1G6RH 4ZFZA 3EBGA 2Y7LA 4ES8A 2J7LA 2XQ0A 2WWKT 4L3EA 1GR7A 1IAOA 5D55A 1JDDA 2NYKA 3DGGA 2VAAA 1G7PB 1G84A 4NFBA 2XWEA 4CC1A 1U92B 3VD2A 4QJ5B 5HHPA 4I89A 4ZFZB 1FVDB 4U31A 2G0KA 1UA7A 3BYYA 4L3EB 1HEZA 3LXUX 4QGYA 1ES0A 1I85A 3VWJB 4IKNA 2RAMA 2VAAB 3L81A 2X3AA 1RVFH 1W0WB 3FSAA 1CXLA 3UC0H 3P54A 5IBUB 4DEPB 3IWUA 5HHPB 5C6PB 1SBBA 4I87A 3ZVVA 2F8IA 1FIEA 1H6UA 3NH7H 1QR4A 4DWHA 1OOWA 2MJWA 1ND0B 1B0WA 1HEZB 2CDFB 1ZIBA 2OQJB 4I3SL 1N59A 5D1QB 5DLMH 2AMUA 1AHWC 1QQDB 3BO8A 2P8LA 3TCXA 2XIDA 1QSEA 3EYVA 3ESOA 4MJIA 1MHEA 1RU9H 4OJEH 1FFNB 1ZWIA 1GJIA 2WB7A 1IFGA 1TR7A 4X2UA 5TK4A 2YZ8A 3HOGA 2J6EA 1CR9L 1N59B 2C9AA 1RJZB 4R8WL 4RESB 1Q90A 3P77B 1DQLH 1EDYA 3SDCD 1A66A 4M6ML 2OM5A 1PBYA 1MHEB 4OTXL 5FOBA 1T5XA 1JOIA 1Z7JA 2A73B 1ZWIB 3IPEA 3WMSA 4LCWD 3OAUL 3GRBA 3ELAT 1PZDA 2YXVA 4POUB 1SDYA 1KBVA 4HJTA 4B9ZA 2R51A 4XNUH 5J3HD 4K7PY 2RCSH 4UIKH 5FOBB 1T5XB 1G7LA 1NPUA 3MKKA 4KRLB 3NIFB 4JN2B 2KZ1B 3HG3A 2VQUA 5IFHH 4OD3H 2VH5H 4U1JB 3FFCD 3HS0A 3SBQA 4DKFH 3S4SA 3EADA 3SDYL 3TPUB 2QPUA 1RP9A 4ZOBA 2QQLH 2IO5A 5F6HJ 4Z7WF 5B8CC 3T0EA 1G4RA 5EU3B 2P4AB 4AUYA 1NUGA 2YIHA 3QQNA 4QXGH 5L2JA 1EVUA 1SHSA 4LLVA 1XGYH 3S4SB 4DAGL 1PCSA 1N0XL 3GI9H 2DKUA 2Y5QA 2PW1A 2XN2A 3S88H 2FBJH 1GVIA 2D03H 3B56A 5L2JB 4NKQB 4D0CB 4Q9QL 2WZPD 4LLVB 4DGIL 4ZFOL 1SY6L 2QVFB 3RVTD 4APQC 4PI0A 3BKCL 2VWEC 2A4EA 1M7DA 4Q56A 2H5UA 2ZOWA 3JWDH 1PDKB 5EU5A 3MXWH 4K8RD 3KNBA 4OAWB 3D51A 3M1BB 1OV8A 1DQDH 3GSVB 1M7DB 3ZBMA 3QNXB 3KYKH 3WFBH 2O5YH 2MSPA 4WNSA 4NOFA 1M6UA 1WJ3A 3QZBA 5F7EH 2N1TE 4S1DC 4HCIA 4HLZG 4X0NA 4Z7UA 4L29B 5EN2A 4EVNA 5JOEA 4QRTA 4HU8A 3JXAA 5AVZB 2YQBA 1MPAL 1YMHA 1EZLA 3CQQA 3ECWA 4JRYE 2LE9A 5EN2B 4JVPA 3COOA 3L7EA 2D7TL 3UYPA 4AJ0A 3DX6A 3I6LE 1YMHB 2GY7B 2WYIA 3A6BH 3WMPA 2HFFA 4P46A 5I8KL 3MPCA 1Z9LA 2Q6WA 3L7EB 3UYPB 2K1MA 1U8IA 4JY5H 1KCBA 5GS2D 1DJSA 1CTNA 1UYWH 1B2WL 1WCQA 4W4NA 2PW2A 4JFYA 2EINB 4NZ8A 5SWZE 1K6QL 4JFUA 4HZAA 1U8IB 2Y24A 3UERA 2ZWNA 4PG2C 1MDTA 4G8GE 1WAAA 4Y4KC 4GSUA 2MQCA 4PRBA 3BH4A 2PW2B 1P84K 4JFYB 4PJGE 1G7IA 1YEFH 3KXFE 1EO8H 2H2PD 4UZSA 3DV6B 5JOPE 1XZ0B 1F00I 1Z9OA 4M7JL 1A7PL 4LEXL 1CFMA 3E1F1 1NAML 4WGWB 2BIQA 2P8PA 1EAPA 3HG2A 4EN3A 4BQ9A 1UTDA 5E4AA 4JQIA 4NQDD 2YRPA 5EIIA 3KPLA 4HWEH 2ICWJ 4JGJA 5IMMA 3W5NA 3G6JA 4XI5D 4X9YA 4WHCA 1EAPB 2MPAH 3WFCL 4UT6L 2IAMD 5J13B 2R0WH 3FS9A 3IU4H 5GGSB 2OAAA 4F33B 1JPST 1PS3A 3QUML 5EIIB 1ITCA 5IMMB 3D0AA 3TCLA 4U6YA 2ZJSL 3G6JB 4HD9A 5KYXA 1CK0H 4J39A 1R3HA 3TYFA 2AXHA 3AY4A 2D3JA 1CGSL 2B3IA 2GFBA 1A9EB 3KCPB 5IR1A 2HJKB 3N0PB 3HBGA 2AGJL 1T2XA 3TCLB 4X6FB 2HWZH 1N7MH 4NO0B 5KYXB 4I85A 2ENYA 4OGXL 1R3HB 1P5UC 1RUKH 2GFBB 1ULVA 4ZD3L 1D7DA 2VLKE 5IR1B 3JTSA 2YOAA 3KAAA 1X5FA 1FN4A 1Q0XH 2Y2TA 3K6DA 1NDMA 1BDYA 2VKWA 3VXSE 3QR0A 2L8AA 1YQ2A 4MB5A 3VGGA 1IQDA 3MLSH 4LNVA 4B5ZA 2A6JB 3JTSB 2B14A 4FQ1H 5EZJB 4DTGL 2VABA 1FN4B 3DROB 3QVAA 1GYCA 3PHOA 2QQKH 4ZW5A 4PJ7A 1KELL 5C7ZA 2QVIA 2MQ0A 1AC0A 2DQCL 1BFOB 1YMMB 4ERSL 4PRIA 4C55A 2JKNA 2EDQA 4OFVA 4FGMA 4XPAL 2BCKB 2VABB 5DRWA 2Q7YB 3PHOB 4PJBE 3QCUH 5LBSH 3V4VH 4PJEF 3FQXA 3UG5A 1VIWA 4LNRB 4PRIB 3MROA 1F1DA 2CKBH 5IIEB 2FSEB 5T5FL 3N41F 1JPTH 1ZK9A 3VQLA 2B5IB 5ICZA 1HYSD 1BMGA 1BD2E 4H8PA 5C0AD 3VD3A 5F96L 4NLAA 2F08A 3ARDD 3MROB 3S3DB 2AABL 1BCIA 4GG6B 3DARA 2EDJA 1W8NA 2GB2A 1USQA 2BNRD 3M46A 3I6SA 4KK6C 2PWGA 4KMLB 2IANA 4KMQA 3QULA 2NZ9D 3OZLA 5JHBA 2VR9A 4N0CD 1FNLA 4L37A 1MJ7L 4UTAA 1PSKH 5KYNA 2IANB 3VQ2C 1DDHB 3BWSA 2A74B 4P9HL 1Y0LA 5BRQA 2WIIA 5H37G 4L37B 5EO0B 2WGXA 5FLVA 2ZSWA 4YFLI 5D7KE 3PP3H 5FYJH 2B1HH 5DWUL 4UINL 5CEZL 3D50A 1CVSC 1FO0L 2E7DA 2XY2A 1JK8B 4W1TA 1HXMB 1BLNA 1P6WA 1Y0LB 1FE8H 2WIIB 4LCUA 4S1QH 5DJAA 3IU3A 5CJ8A 3NPSB 2ZSWB 2ICEB 4U1MB 3ARTA 5FA4A 1M7IA 1O5PA 2DAVA 2LLNA 4JFOB 4XT1C 3RVVD 4XPBL 3ZSSA 1BLNB 1MJ8H 4ZSOA 3WNKA 2F54D 5DJAB 2PCPA 1VGKB 1BQLL 4Z7QF 3WYRA 1E4KA 4JM2C 4XP6L 4FS0A 5FA4B 1MCWW 1TJIH 4IMKC 5JXEA 3U36A 3NMEA 4MMZA 4NWTL 4X6BA 4ZSOB 1OD9A 4BQCA 3SE4C 1V7NL 4JQXC 3RG1C 1B4TA 4ZW6A 1WWCA 2LQRA 5KSVB 2DBJA 1U3HC 4D0BA 3OZ9L 2LVEA 3VSUA 1Q1JH 3U36B 2NUTB 4NB7A 1TJGL 4F8PA 1F6AA 5C0CE 3VNYA 1SM3H 5DK0B 1X4ZA 5DJXA 4X9IA 5F88A 4RAUB 5CMAA 3DHPA 1W72A 3BJLA 1LEIB 4PS8A 4YNYA 5CN3A 1RERA 4FHJA 1F6AB 2J6EL 1OD7A 1OAXL 3LRSA 5DJXB 3II3A 4ZXBA 4DHLA 5TQ2L 4PJ8C 5CMAB 1W72B 5IMOB 4OIIL 1AP2A 3S5LB 2CGRL 4GS7B 4QHNB 4WTQA 2R1WB 2NCMA 1MI5E 4OCXH 1LL1A 1JXKA 4ZXBB 4I5BA 4DP2X 5KBMA 2X1OA 5DA4A 3MA9L 5G4MA 2VDRB 1GZHA 3IMBA 1SLUA 1RZIA 1I8LC 5ID1B 4H1LH 3B43A 3BSHA 2QHLA 1JZJA 2H8PB 4N8VG 1C5CL 1F58L 2P49B 2QQNL 2GJZA 3JWOC 2JKRM 5FM8A 4F7PA 4M62H 4NOBA 2WIMA 3QI9D 4XPHL 3LS5L 1RZIB 1HN1A 3KLQA 1T80A 2FD6H 1KCVL 3EDDA 4L8DA 3IS0X 3VXTB 3NEEA 4DJMA 5F89A 2IQAA 2Z9TA 5IV2B 4U0RB 1NCAL 3U4EA 1DCEA 4TMPA 3V4LA 5FW8A 2OXHA 2FHCA 4OV5A 1CL7I 2FATH 3ZZLA 3DYOA 2DQTH 1MEXH 4JPQA 3OHMB 5L7XH 3N1FC 4L3CA 4NIKB 4RVBA 4A7QA 2JKXA 3BZFA 2NQDA 1A14H 4JPSA 3QARA 2OXHB 3JWNE 4K71C 4OZHF 1TO4A 3VMNA 4L3CB 1IGJA 3SBWC 1JCVA 3BZFB 2DLFL 4HCRH 4X6DE 1JVOA 5E9DE 2ITFA 1BOYA 3NSDA 3KPNA 3IDNB 1G7QA 4XE0A 4PJXA 2YQ3A 5IFAH 2X10A 1ADWA 4TNVF 4F8NA 2BXYA 1SFDA 4G7VL 1BQHG 3FT2B 5D2LF 2YOCA 2MNUA 5T3ZD 4EIGB 1A1NA 2DIEA 3DMMB 5CJBA 1MCHA 4PWGA 3QUGA 1HZHH 1KPVA 4LSVH 1RJLB 3MTRA 3N5AA 2OXGA 1YY9D 2QGBA 3REVA 3WIAA 2VDPH 4NO5A 1I31A 3IETA 1A1NB 1AS8A 3U9WA 1QYGH 4GEJA 4HPHA 1NLBL 3LHPL 3SODB 5TE4H 1L7IH 3N85H 1SVCP 4QXUH 2PPDA 3P0VL 4XGZA 4EXKA 1V3LA 2H1XA 4LSRL 4FFYH 4JM2F 3BUYA 3BMVA 1X5AA 4R3SA 4IYKA 1KTJA 5B1JC 1NOLA 1QSED 1EEYB 2VZ1A 3TJPA 4P8QA 1M9SA 3U0PA 2O5NA 4XGZB 1VZGA 2I27N 4WEEA 1TTGA 5GGVY 4J3WA 4LP8A 2CDGA 4NHCL 3V4PA 1OAJA 4O2CA 4YX2H 5K69A 3FPYA 1J5OH 2C7FA 3U0PB 5EU6A 5B38A 3GDCA 4WI3A 2V2XA 4OQTA 1DN0A 4NN5C 2MQ3A 1C7SA 5GGTA 3V4PB 2A9BA 4MX7A 3KHQA 5EMYA 1N12A 2CAKA 2OMTA 1OM3H 3ZDZE 1A7QH 5B38B 3NCMA 2V2XB 4NKDB 4CSTA 1NCJA 1P6AB 3UL4A 1F1GA 3LPPA 4KGLA 3HI1A 5E1HB 5INCB 3FU5A 3MODL 2P8MA 1IKFL 1AI1H 4JN1L 1BPVA 4OZGF 2C4FT 1RIUH 4Z7NF 3T3MF 5K1NA 4W81A 2P8MB 1GMEA 5C7XL 1BFSA 1ILUA 2HYMA 2AEIT 5DQDH 3IF1A 3WTUA 2RD0A 3ZKMD 3CLEH 2B9AA 2V5MA 4HWNA 5FUZH 2JV6A 3EUUA 3PHQA 1AYOA 1HL5A 4WHTB 4PV9B 5DYFA 5MP6H 3RZWA 2WBWB 2HTKD 5CZXC 4ABUA 2MEJB 1U36A 4MQ7B 3ATBA 3G6DH 4FQHA 5I1KL 3PHQB 5T33L 2ZG3A 3MUY1 4JRLA 3CLFL 4F15B 2GKIA 2NY3D 1GKOA 3WEBA 1EEQA 1PF3A 5A2IH 3FJTA 2CIKA 5GSRA 3WTVA 4RQQB 5K93A 5JPMA 2N56A 3HCVA 4L1LA 3FYEB 2MHAA 4M6NL 1BZ8A 3SJVA 2HFEB 4ZUTA 4RDBA 1KXTA 5AL8A 1BOGA 3QUKA 3QH3B 4KKRA 4LHQB 2W0FB 4IJ3B 2XKSA 3EUDA 3F7VA 2WQSA 1ZANH 1A25A 2CIKB 4ODHH 5JPMB 1ZY9A 3HCVB 1EDHA 1OTUD 1FZJA 1F8TH 4ZUTB 4TF4A 1AGEA 1BOGB 4WUKL 1EHLH 1JZ4A 1N8ZA 3SY0B 1CDIA 4F93B 5IOPA 2DWYA 4NRYB 3GHEH 1TYJA 5F6IC 2Y36L 1WV7T 3RL2A 2KI6A 4JG1L 2ZCLH 2ZOLB 3T09A 3GWJA 1ZT7B 4P2RE 2BH0A 4ZTOH 5IOPB 1DE4A 3D6GA 3WKPA 5BVPH 2X9YA 3BDXA 2BOBA 3N1QC 3KBFA 5F0PB 2IJ0C 4CVWA 4DUWA 2L7UA 1DE4B 1T7WA 5GS3A 3ML8A 4U1NA 2J25A 1SEQH 1P4BL 4WSGA 2BOBB 5I1EL 2VXVH 1WFMA 3C75A 1CF8L 1I3GH 3RHWF 1NC4D 2Z7UA 2RR3A 4WTXA 4JJ5A 4XVSH 4UTAL 5E4EC 2UY6A 4DQAA 2AJYL 4U1NB 2BO0A 4A2LA 2HT4C 4J1UB 5ISZD 3O45B 4N8PA 4NQCD 3LEVL 3VXNA 2WN2A 4EN3D 4WNQB 3GMNA 3BRDA 5EBGA 4M5YL 5FUCE 2UY6B 4TTDC 4HP5A 5DRZA 1N9PA 4C56B 2CE6A 4YVNA 2A99A 5EC2A 4IGBC 1OB1B 3VXNB 4OF5A 5FGBA 3ESNA 3T6QC 3GMNB 5FYLH 5JXAL 2X89D 4G8FB 5DRZB 5F8QC 2K9UA 4BCZA 1T2QH 4R4ND 3IFPA 5EC2B 4U7MA 4XNQB 1GGCH 2RH0A 4ACTA 5JHDE 3D39B 3PIQB 5KVEL 3V8CA 2NW3A 5IFJB 1WT5A 3IFPB 3HPJA 3PDGA 3ULVD 2E56A 2W80C 3NDZE 1CDYA 4AVJA 4HZLA 1OXYA 5DVMA 4JFEB 2WLYA 4JR9L 3AB0B 1QLEH 43C9A 4FQIL 4GRWB 2NW3B 4JZJA 2VR4A 4E42B 4AG4H 2BMKB 1SLXA 4ZS7H 4D9RD 3RIAK 3WN5B 1JZ8A 1BAFH 1O6VA 3GUTB 1Y1DA 3QDJE 2NXZC 4KKAD 2YMOA 3H3BC 5CU9A 2HJLB 2ZUWA 1B0GB 4JANA 1DQIA 2YFNA 1NCIA 3K6SA 3P30H 5D7LA 1ZXQA 2Z31C 2YRBA 2NSQA 4CU8A 3F6JA 3SB3A 3HMXH 4KVNL 1URIA 4TVPH 1LO2L 2A7BA 2CO4A 4PJEB 4Q6IC 5E00A 2VDRL 4KDTC 5I1AA 4JANB 3AU1A 4XP4H 4WHYG 1D5BA 3K6SB 5EEVA 5D7LB 3N41B 4P23D 3MRJA 3DPDA 2FYYB 3RWEB 3VFNB 1ZLWK 5E00B 3OMAB 4WV1C 2EKSB 5I1AB 4RIRA 3AU1B 4HIEA 2EIKB 4LVHC 4MS6A 5EOQL 1JN6B 3MRJB 2CNZA 1FLRL 1QEXA 5L9DH 3NABL 3WFDL 3VTTA 1JS4A 5HY9A 4WJKB 4R2GD 1OQXA 5J6HA 4N90D 4PRHB 4OGYL 3IAPA 4OGZA 2MCMA 2PO6D 1Y6MR 5FKPA 4YJZL 3TH4T 1HT6A 2ZG2A 2WBJC 1U42A 5J6HB 1UA3A 4XAKE 3ZL4H 1PZ3A 4Y16C 4MMXC 3UGEA 1OEZW 2APFA 2WXQA 1QKZL 32C2A 3RNQA 5JIPA 4FJZA 2XTLA 1G5GA 1OE2A 2B2XH 2HT3D 1GS8A 5H4YA 5C0DB 4NT6A 3S48A 2WMPA 4LFHD 3RX8A 2HMIC 5KYWA 2GJ6B 4CNIB 4ELMA 4JHWH 5I2IB 4Y2LA 32C2B 4Y4KB 3MOAH 3RILA 1QSVA 3RNQB 4NJ9H 3DO7A 4B97A 2SEBB 2YK1H 1W0VA 4NT6B 3ZXAC 2WMPB 5E23A 1A3LH 5KYWB 5GJSH 4ELMB 3TBSA 3G5VB 1Z66A 5D5MF 5I6NA 4N3TA 4QPEA 4YE4L 4AYMC 3L5IA 1T20A 1G7MA 5LXGL 1S3KL 2QFPA 3GSWA 1NGQH 3EFFA 5CEZE 3VD0A 1IVTA 2HH0L 3TBSB 3BUTA 4LSSH 2XZCL 4BIKA 3H9SB 5DUBA 4PB9L 2K6ZA 2WXPA 3QJHA 4DZBA 4OFKA 4JHAH 2W9LA 5HGBA 4H88H 3BVNA 4TLSA 3U1SL 4AW4A 3MNVA 3HN5A 5CIPA 5DJ8A 5BMFL 4ZRGA 1ZVSB 3LVEA 2AEQL 5DUBB 2Y69B 4MDJA 5FDYA 3DXAA 5E95B 2ETWA 4UQ2A 2H1PL 3AU0A 1RZ7H 5HGBB 3BVNB 2ZPKL 3EYQD 3VDCA 1U8PA 3AXIA 3DXAB 5EBLB 1JV2B 5C0FB 1J12A 5D1QE 3LD8C 1P5UB 4KH9A 4AXWA 2F5AL 3FN3A 3V6OC 3VGBA 1U8PB 4ZX3A 1NEPA 2DN7A 5BV7C 1XL6A 2C9XA 3V4PL 4KITB 3RVXC 3KYMA 3GEFA 3LN5B 4LASH 3DO3A 2N0KA 3BSZL 3FONA 3T0BA 4I18C 1Q9KA 1UOKA 3TVMC 3MZGB 3BEVB 4L8SA 4BRJA 5ESQB 5BS0E 4FNUA 3SDDA 4NNXA 3FONB 1BG1A 1BEXA 1JF6A 4CJ1A 2QR0A 3NIFE 3DX8A 4Q4EA 4KMTH 2HRPL 3TH3T 4QRBA 2HLAA 1OAKH 2XWDA 1GZQA 4K7PX 5FW7A 4FC3E 3TJHC 1YG9A 4LDEB 4TNWF 3UCRA 4TRPL 2FWSA 1MFNA 4HSAC 1B4JL 4XMPL 3DX8B 2BRRH 4GUQA 2ZUVA 2FQGA 2HLAB 4QKTA 1DN2A 5CBEB 5JLZA 2BVQB 1UH4A 4RGMC 2WUBH 2OZ4A 1ZHLA 4UDTA 2AMGA 1CLZH 4YXKL 4Q9RH 1YA5A 2A4CA 4OZHB 2FO4A 4PRPB 2XA8H 2ZP8A 5BZDB 1UZ8B 4KQ4L 1ZV9A 3RUGF 1MH5B 3TESA 4FTVA 1ZHLB 3BKJL 4UDTB 1NKOA 3CCHB 4RRPG 4N8CH 4JDEA 4XX5A 2YQ2A 4YAQA 3RGBA 3OHXA 3X17A 4B9YA 4ONOA 5D6DC 5DUMH 4FQQB 1P4UA 2HRLA 3DJSA 4FTVB 1OKEA 5K5YA 4IW4C 4XXCC 4PJDF 8FABA 5FV1L 4HYTB 4YAQB 5HGDA 2V3FA 2YRLA 4J4PA 4UOQA 5FKAA 5DVNA 5KW9H 2K8QA 2DS4A 4XBEL 5HBBA 5HI5D 5C0BD 4WFHE 2YPVL 2Y06L 3WXVH 1AD0B 3D06A 3DURA 3D9AH 4NO3A 4NRXA 5FKAB 4LFHG 1BQSA 3VI3F 3RAJL 4M3KB 4BZ2A 3CDZB 2ZTBA 3DURB 3CX5J 1AR2A 1GJUA 4AQ8C 1DANU 3RP1A 5ITBH 5KVGH 1MFBL 3DRTA 1XH3B 4RRPM 4LSUL 5I1GL 3VH8A 1XB3A 1UM6H 5E03A 2FX8L 3QUZA 2BFVH 2F58H 5AD0B 3F7YA 3LNDA 3ECQA 4ZNEA 1SHWA 3J7HA 1BVLA 1V7MH 4WI0A 3SKOB 3ZZ1A 4E5XG 3MCYA 1TEFA 3BI9X 2CKNA 3K72A 3ESMA 3GXDA 1QPKA 3O6FA 3UAAA 3V0AC 4D8PB 1MCOL 4YSOA 1GA2A 2G2PA 2X5PA 4AGPA 3ZYOA 1N6VA 4WI0B 5J1AB 2Q10A 4UT9H 1FL6B 5A2FA 3O6FB 3CVHA 5AYUH 1FF5A 2NY1C 4PJ8B 4I9WE 1X5JA 3V0IA 4NHUA 1Q94A 2ROXA 3HE6A 3LQZA 4FF9A 1F4YH 3R06B 4U4BA 4PJ9C 1UOWA 3GUFA 1UXWB 3HC4L 3VGEA 4IU2A 2W1NA 2RALA 1YQVL 1S7QA 4NHUB 3H8NA 1M6OA 3HE6B 3L16A 1R24A 2WN3A 3F05A 3TCTA 4H8HA 5FHAH 4XWGL 5L8KB 1FNGB 1EJFA 1HHHA 2VDQB 1FAKT 4IU2B 1UWXK 4JPIA 4P5TA 4R7NA 5EWIH 4OLXH 4HEME 1TEYA 3MRNB 1R24B 2ZOKA 1BSIA 4NZDA 5DMYA 1KCRH 4K7PH 5BQDA 1SBSL 2Z93A 4R7NB 4ENEC 5F9JB 3QA3A 3S3SA 5FYJU 1BXVA 2QADB 4JFDB 4BE6A 3B7RL 2ZCHL 2ZOKB 3IGLA 1D5XA 1Z2KA 3AWGA 4PCYA 3K91A 1T7ZA 4PJ5A 4YHLH 1A6TA 3W57A 4BELD 5DD5H 4F2EA 1FYTE 4GBXC 3IDGB 1LO0L 2WLIA 2GBAA 3QXAB 5IBTL 4K71B 1THCA 4QHUA 1QOKA 4M1GH 5DZVA 4HHWA 2GITA 1RK1A 1XF3B 4HT1H 4NNPH 4PJ5B 1NCNA 1EANA 3GF8A 1UKQA 3GSUB 4H8VA 4GG8A 2WLIB 3DGCR 2FJSA 1JZDC 4OCSH 4QHUB 4JO5A 1VESA 4KFZC 1HHGA 2GITB 2WYHA 1RK1B 1YMME 1YPZB 1INDL 2PNDA 3K8LA 5LUMA 3U7YL 1F3DJ 1KJ2H 2ARJA 3CSFA 3QCVH 4GG8B 4DN3H 1MLBB 4K5MA 2HFTA 3O4OC 2GSGA 4V1DE 4PRIE 5LNEA 2ARJB 3AQDA 5B3JF 3RI5F 3FUMA 1BZOA 4CDGC 4AGOA 4HPYL 5M94B 3IEAA 1JWSA 1YRKA 5F7WC 1BJ8A 3HFML 5E5UB 5EUOF 4GG6E 5AB9A 2DW5A 3ZTDC 4CW1A 2CGZA 2IH3A 3QJFB 5F1NA 1I4FA 3C08H 4JRYD 4AIXA 2V17H 1EGJA 1Q38A 3SE3C 5IEKA 3M7FB 2NCEA 5FK9A 4FXKC 1ACYL 4CW1B 1HQRA 5AAWA 5F1NB 3P0YH 5LNGA 3GMRA 3CSYA 1ECYA 3H9HA 4HJUA 4YL4A 4B7IA 4MS8D 2E7LA 3EHBD 3HE7D 2JK5B 3LVTA 3LYRA 4B60A 4WO4D 2FUQA 1H15A 3FN9A 5IEKB 3H2WA 5LJYH 5FK9B 3P9MB 3IVKB 3TWCH 4U2YA 2YGNA 3GMRB 4AGQA 1DBJH 3H9HB 1FPTH 5DXWA 4ZODA 3AREB 1TYRA 4IBZA 3HS8A 4G8GD 4PBDA 1KXQE 2DM2A 3REWA 3EJZC 3SYPA 4DGYH 5LCVL 1D9KA 5F7HA 2RACA 3KXFD 3TPKA 2K4AA 5LWYH 4H0GA 1BM3L 4XCCH 3WIHH 1A6AB 1H3VA 4ZNCD 4H2AA 3REWB 3ECBB 1YEKL 5FCSH 1VGEH 3SOTA 5I17A 3HNSL 3T4AC 4L4VE 1P4IL 2DBLL 3OLDA 1F4XH 3SGDH 1IX2A 1DTUA 2CK0L 3VXUE 3NCEB 2NNRA 1WZ1L 2JCCF 2Y5TB 3JWDC 1V10A 4HD5A 3X14A 4U1KA 2R2BB 2QMJA 4ICWA 5J7CC 1UZ6E 2VDMH 3PGCA 5KVEE 4N2KA 2EIJB 2HG5A 3KWXA 5TE7L 1DCLA 3OKMB 4EZMA 1CXEA 3TBBA 5AG9A 1DZ0A 3LDBC 4Z8FL 5IB5A 4CA4A 4F7EB 1BBJA 2X4QA 1V55B 4FZEL 2IGFL 2J73A 3NIGF 4HLZH 4O02L 3JTBA 4XZ4A 4AT6A 2HG5B 3QRLA 1MNUL 3GBEA 4G9DA 3QQDA 3MRDB 2VJXA 4JCMA 4M6AA 4NBYB 3WY2A 4YDLB 4GAYA 5GXBB 3GRWH 3JV5A 2ZE0A 2BC4B 4EDWH 1MHPL 4XAWH 5FGCE 2BRQA 3DSFH 4PSRA 2ZXDA 1U93A 5DHYB 3VYNA 2V2WB 4X5XA 4XRCA 2XWBA 5BJTA 1RPKA 5M7QA 2FH8A 1I3VA 1FRGH 2Q2EB 1PW3A 1OT4A 2VXTL 3PNRB 4G6MH 1TNMA 3NA9H 4GAYB 3SCMA 1JXFA 3MZTA 3QEHB 3P11H 5F9AC 3NFNA 4P2YA 1U93B 4K0OA 5KEZA 5HGHB 3OJDA 4XRCB 2FGZA 1UD2A 1CDGA 5A6IA 3B5HA 3KPPA 4HXBL 4AJWA 3SCMB 3T4YA 3ELQA 2RHEA 2WQVA 1ML0A 3RWCA 3M07A 4PTUA 5LN4A 4AM0Q 4KTDL 2QGDA 4G8IB 2J6WA 1PLAA 3VRJA 1DVSA 5F6IB 2QBWA 1EO7A 4MDRA 4YPGA 4W6YB 3VFMB 3FDWA 5FA3B 2JELL 1U8OA 1WITA 3KPPB 4IRZA 3CWGA 3MCKB 4LAQL 3RWCB 2PXYA 1F4HA 5IJCC 2NOYA 4P4KA 2WKLA 1E5AA 5KS9F 4KZEH 1TJHL 3N44B 3VRJB 1BD2D 4Y2DA 4PJAA 4ZYKA 1NGPL 5HD8C 1U8OB 4X8GA 1U58A 2PXYB 4FP8H 4N0UB 3Q2NA 5IHUL 4PJAB 4ZFGL 4PB0L 4JZNA 3FT4B 1U58B 3LSOA 4OM1L 3QUXD 3MLZH 5E4EB 3NT0A 3TFBA 2G3XA 1KCSL 1DSFH 4MLSA 5DRNA 3VQMA 1I1AA 1L0QA 4JZNB 4PW9A 4DW2L 2EEFA 2WK2A 5I1HL 3LEYL 1YUHB 3EJTA 2FQFA 4H26A 5DRNB 4YXLL 4OCWH 4CRPA 4G1MA 1UM5L 5DS8A 2CO3A 2G2RA 4IGBB 1XR9A 4B0MM 5D7KD 4DFIA 5I75B 1EWHA 3TF7C 3AACA 1QFHA 4G1MB 1E8ZA 2VDNB 5DS8B 1SVBA 2G2RB 3UDWA 2YA1A 1F4AA 4BZ2L 2OMZA 1D6VH 1B4RA 2VOTA 1OAZH 1FNFA 2I9TA 1MQ8A 3QRGL 1M7XA 1XH2A 1T1XB 4EUPG 3EOTL 3KYAA 5JUEH 1RY7B 3N40F 2NY0D 1U8MA 2XYCA 3NSXA 4K3GA 4NZRH 2WWNA 1KGCE 3Q6FB 4M43L 3KPQA 2ED6A 4TUKL 3NEOA 4OF0A 2M83A 3FN0H 5BRZE 3GYRA 1U8MB 2R69H 2ZOOA 3BAJA 2NXZB 3MLUL 3HI5H 1OK8A 3M7OA 4DERA 4MNQB 4X9HA 5FX3A 3RKDC 5C0CD 2N7BA 3CFMA 4RISH 2FWUA 1DUZB 2Z31B 1GGIL 4PY8J 3OB0K 5F70A 2DI7A 1OM9A 4HG4J 2JIXA 3E9UA 1JV5A 1JXDA 3LZRA 2NY4D 3KPRE 1EEZA 5GS1C 4A7UA 3CVBA 3LKRA 1JHLH 3ZQWA 3P4NB 1HWWA 3KLKA 4IDJH 4I2XE 4JCLA 4WI8A 5D1ZC 1ODAA 3JWOL 2VDQL 2JIXB 4UOW0 4Z7WE 5FO8A 1CD9B 1JV5B 2UZPA 2PTTA 1I8KB 1OAUH 2IC2A 2B1AL 3AM8C 3WNOA 1K5WA 2P47B 3LKRB 2AJSL 2WO4A 1X6NA 1YDPA 2AJUL 1ZMYA 4D8OA 4RFOL 1VA9A 4ZTPL 4KXAA 2BY2A 1EXGA 4ONGL 1UXSA 5BW7C 1AMXA 2YKLL 3EJUA 5FO8B 5I66B 3NZSA 1TQTA 4QO1B 3MLYH 4G83A 1WZAA 2HTLD 2X6BA 4O51A 3BCFA 1TQUA 3ZMNA 3SDXF 4OZFB 1G9MH 1KIQA 1N0LA 3V0GA 1WWWX 2AXGA 4X8XA 5CSZB 1ZT1B 4KJQD 4R5TA 1M57B 2NY2B 5ECJE 4MMXB 5F6HI 2BS8A 2AV7B 2XXGA 6FABH 1F3JA 4MKMA 3WHXB 1PZBA 1N0LB 3S36L 1DFXA 4N25A 3VFRA 1RUQH 4KAQH 2R2HB 1T83A 2UXFA 2IBZX 2X0UA 4PJDB 3C9NA 1C9SA 3D0LA 4HC1A 5TH2A 2NXYD 5LHDA 2H6PA 5D7IF 4NC0B 3ULUH 4GO6B 5HHMD 2A9ML 2X1XR 1PVHA 5CF3A 4FG6C 2X44D 1CFNB 2FR4A 3D0LB 5TH2B 5I1CL 1ZTXH 4LPCA 2H6PB 1CGWA 3D08A 1UACL 3VYPA 4GO8A 3ZYJA 2VITA 1XWVA 1H8OA 3BZDA 5E9DD 2DI9A 3V5DB 4Y5YB 1INQA 4JEGB 5MEPB 2Z0BA 3NGBB 3RWJB 4GQ9L 3TFKD 1UGKA 3MRBA 2NY7H 5IESH 5EZIH 4XNZC 3ROOA 5EA0L 3T6ZA 2QT6A 3KWTA 3SDYH 4E9XA 4Y4HA 2J71A 2ADFH 2V5TA 1INQB 2ZNWA 3ULSA 1KBWA 5D93B 3ISYA 3PQYA 4NFDA 2CALA 4LK4A 2J5WA 2RQ8A 1OE3A 5LQBH 3CHPA 2KPWA 4G42B 3FCSA 4V2CB 3CVDA 4ENZA 3FTUA 1QEWA 4BA0A 1ETZA 4PD4J 1KULA 3UTPE 5LDSA 4Q9QH 1GAFL 1AOZA 5IJKA 2XBDA 2QMKA 2A77L 3QUYA 3ARFA 4FXGC 5D4QA 1E9PB 1MDAA 4ACPA 4F24A 1RI8A 1WWAX 4M3HA 1ETZB 2ADIA 4KROC 3MRFB 3FBKA 3WGUB 1O9VA 1VAHA 2IPTH 3B2UC 1S5IH 5BV7B 2YC1B 2OS7A 3JTTB 4QNPF 1CICA 3P4MA 1WCBB 4M7KH 3TT1L 4EJ1C 4WZ9A 3FRUA 2BY1A 4MVBD 5DO2D 2NUPA 4I18B 4N3UA 1F4WL 2PLTA 15C8H 2UZXA 2R23B 2R0LH 1CICB 2VB5A 2UY7A 4Q6YA 4C56E 3VI4F 1K9TA 3EYFB 2N4IA 5GGVH 2HVKB 2NUPB 3HN3A 4YBLB 3UTZA 2ADJA 3MV7A 4FFWD 4XTRC 2YUZA 1EXUB 1U3YA 4MXWL 3TURA 1SRDA 2UY7B 4FNQA 3ZE1F 4YHYC 1S9WA 2AJ3B 4XMWA 1ORSA 4OGAC 3UTZB 3MV7B 3DECA 5DRXB 2AHIA 1A4CA 1LM8V 1OLZA 2EYSB 3EOBA 3D39E 3O3UN 4L4TB 1RURH 4RBPK 5SWQA 3U30C 2R9HC 2G4GA 5JLZB 2YUWA 1S9WB 2X6AA 5I8KH 4OCRL 5HGAB 1ORSB 2NNFA 3UABA 1BEYH 1S7TB 2CBMA 3EOBB 3W37A 3DBXB 1KDIA 4JFEE 2PMZA 4NQUA 4JB9H 3OBAA 3WHE0 4OJAA 3W82A 4MBRA 4X7TB 4KZCA 1OCZB 3C6LD 3NTCL 2XZQH 3RIKA 2CJUL 1LK3H 4LSQL 1A22B 1NCDL 3S97C 3MBWA 2AKRA 1BXXA 4NQEE 5AVXB 4J6RH 3I74A 2H0FA 4E41A 4ZFFA 1NJ9B 1A7PH 1DBAL 4NPYB 1SYVA 3FNKA 4ZUUB 2X88A 1E65A 2F7PA 4G6JL 1KLFA 4PJEE 2AKRB 2FX7H 3GKWL 3GEWB 5KANI 1JAEA 1QRNB 4DQOH 4E41B 4KI5C 1UXLA 4ZFFB 4IOFD 5FCUH 1KJVA 3RWIA 1SYVB 2X4OA 4TQPA 4QLRA 1CXFA 3GMPA 1KLFB 1U41A 5ERWB 2P80A 3QHFL 2UXTA 5EUOB 3Q8EA 2BERA 1MCBA 3CC5B 4HWBH 3QDGB 4ODVH 1OP4A 3JWNG 4PRHE 3UTTA 1Z9NA 3ZUNC 5TQ0L 4LSTH 1CGSH 1QNZH 1RV6X 2BWIA 4Z76A 5KSAC 1H5BA 1TYEB 1NCBH 4FABL 2V7HA 3ILQC 3EO1B 2QLYA 2AGJH 2Y1VA 1COBA 3V10A 3UZVB 3HJ0A 3QC5X 2XSKA 3OXRB 3KH3A 4P2RD 4IBTA 1H5BB 4GB9A 1GMIA 3W11D 5GJTH 2CHXA 3BFWA 5AVYB 5C6TL 2J1WA 3ARYA 4MD5A 4BBWA 4ZDHA 5DHEA 2EYRA 2WHVA 3GZPA 3NJVA 3ABLB 3O6ML 2GJ6E 3CU7A 3BWAA 2F5BL 4O2EA 5F7YC 4PGCA 3VH8G 2G9HB 5L4JA 2G9KA 2OLDA 2J2ZA 3IRZA 3OQ3B 4MD5B 4QR7A 4ZDHB 3WTXA 2EYRB 3GIZH 3M6DA 3ES6A 1I9EA 1V05A 2NY1B 3ASOB 3M17A 4NS0A 3CFDA 4AEHL 3BWAB 1NDTA 4MJ5B 4PTTA 4Y1TA 2XDHA 4FJ6A 2ICWA 3HZVB 1E6JH 5I15H 1YAZA 1SUJA 4W4OC 2J2ZB 4QRPA 4KRPD 2XFXA 2VDNL 1A2YB 5CN1A 4R90H 4Z7QE 2MRYA 1I8AA 3CFDB 4FMVA 4ODWA 5AW0B 3H9SE 4PTTB 5AKSA 1WD8A 4ANWA 3MJWA 2JFCA 1X5LA 2ICWB 3MBEA 4WDIA 4NKIL 4PJFF 1ZDQA 2A0LD 4JG0H 3IWVA 2YHGA 2JCWA 3VFVA 3IDXH 4DVRH 5TDPA 1GYAA 3KCWA 3WMQA 5T1DH 3P69A 3MBEB 3D87B 4WDIB 1KC5H 1LEGB 4PW3A 5TF0A 2FEDD 3QZWB 4HS6A 2OMNA 3ZU8A 4IKIA 3NIGB 5B39A 3G5ZB 4JPWL 2YAOA 1YYML 5E2VL 1IGCL 3AABA 4F9PA 1FUNA 1JWMA 2ERJB 5JIDA 2IADA 4K3HA 4KJWC 1NLDH 4GBXB 5DURD 5B39B 2KBGA 2OR9H 3JSSA 1FDLH 1QFOA 3K80A 3QDHA 3N06B 4JDTH 4RDQG 1BAGA 5EULV 3ZMRA 1HAWA 2X2HA 3BN3B 3KGSA 3GZOA 4A7GF 4ADGA 2WXKA 1JWMB 4L1SA 1ZA6B 2IADB 3QORC 1TQCB 4ZW8A 5GRUL 3G5XA 3QIUC 1ZSDB 1BVKB 3QDJD 4IRJC 2E7BA 3FUNA 1PLCA 1FGNL 3QIBA 5E5LA 3SGKC 1YN7A 2BSBA 1U95B 4B5EA 3Q44A 4BH8A 1JJUA 4GXVL 3KPMB 3PJSB 1D2OA 3T2PA 1CDCA 4F5CE 3QIBB 1BIIA 5GRJH 3WTWA 4KI5F 4OM0L 1BQLH 3V6BR 3RZCC 3QPQC 3IDMA 1PY9A 2VJ8A 1DL7L 2YD5A 2OCFD 1E42A 2YD1A 4HBCL 1WPCA 4G7QB 4HKXB 2D9CA 3OB8A 2HA1A 1Q1PA 4UQIM 4YVUA 2MOQA 3GMLB 2R4RH 4YHPA 1QASA 5HYSG 1MAMH 5K1JA 3HZKB 3IDMB 2VM3A 2XN9A 1XF2B 1IKNC 3LN4A 4MJJA 2RQEA 3D18B 1K4DB 4OZHE 4AENA 1SQ2N 3CUPA 2WQRA 4PRPE 5E8EA 2BS71 3X1FA 2X42A 3CFNA 3GB7A 3HC2A 2E4FA 2XN9B 5GGQL 2P5EB 3L2NA 2DL9A 3OKDA 4J2XA 2EECA 4N2DA 4XAKD 1K85A 3DIFB 3FMGH 3IXTA 3OKKA 2J6EH 1I1AD 1BZ9A 4OKVA 1CFVH 1RZ8A 1MFDL 5BUPA 4BZ1A 1FBIL 2E3VA 3L4TA 1NCCH 4GAAA 2VNCA 4ETQB 5J0BA 1BYPA 5D2LE 3HB3D 3KL0A 4GQQA 5JNYA 2J4WH 5T1LB 1DUYA 4JO4L 1RZ8B 3MRRA 2FL5A 5DT1L 3DVFA 3HAEA 3G5YA 3VYOA 1EFXD 2NW2A 5CCKL 4G6KL 4CN6A 1MFCL 3KGUA 4N2NA 5EORL 5LBGA 2D0HA 5JNYB 1P9MC 4X6EA 1DUYB 4KKLD 2PWFA 3VX1A 4AI7A 3MRRB 4YSSA 2R4SH 4PJIA 3BE1L 3HAEB 3KEDA 3WS6C 2A1WH 3G5YB 3T4AB 3OKOA 4JFPB 3P1VA 1SLVA 3LZOA 4RETB 4X6EB 4JKKA 3C09C 5C09B 4PJIB 3OR6B 4B9GA 1L6ZA 2VLME 2IV8A 4HIXH 1DVYA 4JUTA 2DKSA 5HHXH 1JI2A 3DIVA 1KGIA 5AOZA 3O11A 1P7KB 1R3IL 1YAIA 3CE1A 3EBAA 3MJ9L 2VL4A 4KPHH 1Z5HA 4NENA 4RFEB 3D3VB 4WHYH 2P7TA 4FFZL 4WW2A 5BV7L 3LX9A 5EN3A 1AGFB 1H6TA 2OTUA 3D5OF 2LTQC 4NENB 2DQGH 2AEWA 1OSPH 4DETA 1WS7A 4KVCH 2D7QA 3TONA 2VSDA 4WW2B 1U8QA 2P7TB 5D1QD 5F1IA 5ACLA 3CNKA 1RUPL 4OGQC 4AQEB 2OTUB 2K78A 5IF0A 2L04A 4PP1D 5D72L 2VDLH 3RY6A 2KZBA 1OTTD 4J7RA 4RFNB 3K2UH 5GISL 5AOJA 1Y18A 3L9YA 1AOHA 2ITCB 3NIDF 3STZA 4Y5XB 4OZGE 2E7MA 3EO9H 4Z7NE 1BGXH 1VB9A 2JB5H 1DBKH 4LAJH 4LU5L 2I32A 4JL1A 1A6UH 1NCTA 3CHQA 3FXIC 3ZIYA 1TMQA 4DK6A 3PGDA 5BS0D 2JI2A 3C87A 4PN6A 4L0PB 3DX2A 4EE2A 4MWFA 1XEUA 3Q3GA 4PWIA 4TNGA 4JFQA 1CVRA 3PGDB 4HJJL 1XB8A 3MV11 4JGUA 4PBXA 5JR1L 4HDIB 3UH8A 2BVOA 2HKAA 1NGXA 2YEQA 1O7DE 3ME0A 1BG9A 3C5ZC 5BUGA 4MWFB 3RWDA 3Q3GB 3CPUA 1CDUA 2QPFA 4GRLC 4JFDE 4PGEA 4LE8A 1DJXA 1N3NA 3KWVA 2ZWKA 3GSRB 1KFAL 4KJPD 5D7IB 5ETUA 3GO1L 3ME0B 1S3RA 5LBVA 1EQWA 2DLEA 3RWDB 3O9WA 1KWKA 1KIRA 4DKDC 2WUCL 4PGEB 4BQ6A 2WXMA 4DKAA 2EADA 4QXTB 3UO1L 4GFTB 4L8CA 1A8JH 5ETUB 4G6AC 4GXFA 1QAWA 3KPOA 1N6UA 3B9EA 3F12A 1RLBA 3O9WB 2DMKA 2L7QA 4ONFL 4NM8L 4AGLA 4RMUA 2VR5A 1YPZE 4JY6A 2W94A 4GUCA 2IV9A 1C1EH 3PGFH 3WKMH 4N2FA 1R34A 3EGXB 4YHOL 2YAQA 4JQIH 1YEEH 3QIWA 4H5SA 3HPLA 4Y1AE 4W9IC 4LIQH 1NFKA 3PWVA 1L7TL 3HKFA 3PQYD 1SXZA 4AYDC 1P7QD 4WCYH 4ATWA 4Z0XB 4WFHD 2EDEA 1DVFC 3PWVB 4WWKC 3S3PA 3PF2A 2O5ZL 4YHKL 1OCWH 1NSNH 5DU7A 3UYRL 1ZE3H 1GZPA 2BJMH 3HG1E 1JTPA 3QUYD 4FQXC 4HUXA 1PMYA 3LPWA 4OVVA 5CZKA 1RPUA 2R0ZH 3QJVB 3CBJB 3V95A 3BISA 4Z7VF 3T1FB 4EO5A 3ULVH 4ODTH 3KR3L 1XGZA 3BT2L 4GSRA 3IXAB 1FZOA 4X4YA 5KYYA 1GZPB 4HUXB 5HHVH 1WA1X 1IB5A 1NBYB 4HSQA 4B27A 1ASPA 1WHOA 3MLTB 3F6LA 4LF3B 1GOGA 1KCUL 5CHNA 4A7VA 5BVJB 4K9EL 3BW9B 2DD8H 3BIBX 3V4VB 3IMRA 4H25A 3S34H 3HZYA 4X4YB 5KYYB 2VERN 1AJ7H 1J8SA 1NCWL 2C34A 1RZPA 1GIGH 3WJLC 1I7TA 3O3BA 2NZ1A 3F7RA 2C1OA 4H25B 2XG4A 4LPWA 2V9UA 4KUCD 3ZE1B 3SQRA 2E5EA 3LMJH 2CMRL 1SJXA 2J1YA 3A67L 3S5YA 4IHOA 2JSFA 4I9WD 3FOMA 1DEEB 4M7LH 4CL7A 5D1ZB 3QT2A 3ZTNH 4Z6AT 2XG4B 2EVIA 4M6OH 3ZTEA 1MKFA 5GHWL 3FFDA 3U4BL 3F83A 1A0QL 2YMTA 3WEXA 5B7MA 2JTYA 5C1MB 1NANI 3ZGHA 1RZGB 2CLRB 1KB9K 3T2QA 2IGLA 3FT3A 4I3RH 2F19H 2APXA 3RU8L 1H8NA 2BSTA 1JPFA 2NX5A 4FL4C 3MOBL 3TYGL 3WEXB 3X13B 4XP9L 5C3TA 5C0RH 1L9MA 1NPNA 1H6FA 5F1KC 3FQUA 3UZQB 4HJ0C 3CXDL 1OSZA 1E8YA 3KPSE 3NCJL 3CDGB 3J8F7 4FMFA 3CFJB 5GZNC 1G6RL 1VFAB 5TDNA 3RTQA 4N22A 4NO0D 4UTAH 1HOCA 2O6EA 3FQRB 3VA6A 5JPNA 1D5IH 1VLXA 3ZHFA 1A8ZA 5K9OB 2ALWA 2MKWA 1R5VA 2XJKA 1FYTD 2Z92A 3TBWA 1T7YA 3WY3A 1RPQA 1ZHKA 1IAKB 3KLHC 5DSCA 1DQKA 4APQA 5I76A 1JYWA 1RVFL 1WS8A 5JPNB 1PKQA 1VF5C 1YYCA 3UC0L 4XC1H 2UX6A 1R5VB 2P52A 3TBWB 2JJSA 3CDYA 4Y5VC 4XNXH 1EBPA 1IM3B 3GLDA 1ZHKB 3KWWB 1ITBB 2QZ5A 2XXMB 3IMSA 4H0HB 5AW4B 4N0YH 3OGCA 1YMMD 5DLML 2K7QA 4WRLA 1IBBA 4LOVA 2H3KA 4XNZB 1RU9L 5C07A 3I9AA 3SZKC 4V1DD 3OGCB 3FAWA 1FSKC 1PG7W 4DCQA 5HI4D 4N5EC 1DQLL 2P46B 3C8KB 3ZYZA 1BVOA 1EH9A 5C07B 1UC6A 2GTZB 1NOAA 2BY0A 2XCMC 4YDKL 1UCBH 1ORQB 3L9RA 4KHXH 4N2AA 1FNEB 2QFRA 1UH3A 2KMWA 1ZEAH 4XNUL 4FQIH 2WP3O 2ZX5A 2PPFA 3EDEA 2RCSL 4UIKL 5L0QC 3L5XH 3NFSH 2F15A 1HXKA 4N0UE 4Q8BA 1HX0A 5F7NC 4MAYD 2YZ1A 3OPZH 1JMZA 3ARGD 5H2BA 5TJWK 5IFHL 4OD3L 1W72H 3ALWA 2VH5L 4DKFL 4BSWA 4L1DA 2QELA 2O6FA 4S1RH 5F7BA 1UASA 2EDLA 1W2KT 2QQLL 2VLJB 3LKPA 3WFEH 4BUHA 5D5ME 5IUCA 3NDYE 4M48L 4QXGL 3DRQB 4GW4A 3B4NA 5DMGD 1R6VA 1TT6A 3T0VA 1XGYL 4ODSH 2OP4H 3GI9L 1F0LA 1KBGH 4WFGE 1WAPA 4IU3B 2QSTA 3QXDA 3TA3A 3VXRB 3QEQA 2KL6A 5H35A 3DOSB 3S88L 2FBJL 2XBZA 2D03L 2WQ8A 1NC2A 2Z4QA 3FCTA 5DEGA 5IVXF 3WFZA 1IILE 5EOQH 4HJSA 4NUJA 2XWXA 4PGDA 5GSVA 3U25A 1AY1H 4XPGH 5E9AA 3JWDL 5H35B 4X4ZA 3S8GB 2HZHA 3FCTB 2Z4QB 3MXWL 6TAAA 5DEGB 5D7JA 3MREA 4HFWA 4OGYH 3MUGA 3R0MA 4NUJB 2IXQB 4PGDB 5GSVB 1DQDL 4F2FA 5I6MA 1IFHH 2YWYA 4W6XB 2O5YL 4L4VD 4QHLA 3WFBL 3I6KB 1LE5B 1OY3B 3WLWC 3EYSH 5LG6A 3NJLA 1F56A 3U6RA 1J11A 5D7JB 3VXUD 3MRGB 5F7EL 4QOKA 1QKZH 4MCZA 3MGTB 1DR9A 1OQOA 3B2VH 4XNAA 3BP5B 4P2OD 4P57B 1AS7A 5HHOA 5MENA 5D96C 1TQWA 4GW1B 3LH9A 5C08A 1BXAA 3B7TA 4HPOH 2IOOA 5KZCD 3UAJC 4F7MB 4MCZB 4KUZH 3AC0A 4MNQE 4OZIA 4UTCA 1ROWA 3ORJA 2A3TA 1P84J 1V3JA 3SO3B 6CGTA 3A6BL 3FQNA 3ET9F 3QDMA 4F92B 2NY6D 1E4HA 2MTPA 4TL4A 1WZKA 2VDPB 2OYLA 1XFPA 3C60C 4DPAX 1WDAA 4X6CF 3EXLA 3C12A 4HFUL 2YGVA 3DX1A 1HAUA 5D1XA 5AEAA 2EVJA 1UYWL 1J8HB 4OJCA 1JL8A 2WVUA 3QDMB 3GKZA 3I50H 2J44A 4X5RA 1AIFA 4JG9A 4K5PA 1OWRM 2DZEA 5AVQB 1AQDA 2JF1A 4NDMA 2QJDA 5D1XB 2BHUA 4Y2NA 3FB7A 3ENEA 5CJQH 1YEFL 3K0YA 4ZS6D 3C6SB 1EO8L 2L0DA 4XBGA 3RFZA 1AIFB 3PL6C 2H1PH 3DV4A 3JZ7A 2JH2A 1AQDB 3WG7B 1JDAA 4YGVA 3ZUCA 4QF1B 2ZX8A 3BZEA 1LQBC 5IQ9A 3QQ9D 3US1A 4RH4A 3FH8A 3FB7B 3RFZB 1U2HA 4HOWA 4KV5F 4L9LA 1LJMA 4YGVB 2Z3FA 3UBGA 4TNVK 1IGIL 5IQ7L 3O2DH 3U0TA 2MPAL 3DHUA 3OXSB 2YD9A 3V4PH 4PJDE 2EP6A 1KBPA 1MCJA 2R0WL 3GSNA 3IU4L 3OMZA 3O2WH 2EIEA 4L9LB 4GSDL 1FZKA 3L5HA 5ESAB 2AVFA 4JFXB 3BH9A 3ZRFC 4OQTH 5C71A 4JX0A 3U0TB 1CK0L 3VGHA 5GGTH 4YBQD 1NIFA 1NBQA 5PAZA 2E9JA 4KTGA 1HFUA 2FEJA 4XVUD 1R4XA 2HWZL 1L6XA 1N7ML 1MRFH 5AOKA 5CEXA 5FM5O 4AY0A 2EXWC 2ITEA 3VI3E 3HNVH 3ARBD 4MZRA 1CL7H 3L1OH 1RUKL 4K23H 4LO9A 4AKQA 3BD3A 3IKCA 2WQWA 1OP3H 1Q0XL 4WGKA 3OV6A 1NFDA 4PIRF 1T1YA 1W8EA 1KJMB 4HK0A 5F21B 5I8CA 1A4BA 1SPDA 3MLSL 3PJNA 4FQ1L 4OVUA 1GTFA 1KYDA 1T66D 3DMMD 4Q14A 1G94A 1SJVA 2QQKL 3L8QA 4PWFA 1B6UA 3GLZA 4NP4H 4B9JA 5HYJA 4J28A 4YXKH 1HKLH 5I8CB 1BJ1J 2OMVA 4PS7A 1CGXA 3SHSA 1EZVY 4E0RA 1CE1H 4WSKA 3QCUL 5LBSL 3V4VL 4ESKA 1U8KA 1CI5A 1YHPA 5E6IA 1WQVT 5HYJB 2NT1A 4CBPA 3KZ8A 4ABQA 2CKBL 2OMVB 4MCMA 4QRRA 4C83A 2WSDA 1JPTL 3V6OE 2EKJA 2G75A 3VFNA 3CDFA 5SWSE 2GVYA 1YZZA 4AE0A 1BF8A 3NIDB 4GKLA 5BRZD 1FFRA 2FIRT 2KLSA 3QORB 1MZZA 4QRRB 5FGSA 3G5WA 2DQUH 4IRJB 2KPNA 1BZ7B 2G75B 1JNJA 4IRSC 5IKCA 1MCCA 4Y4FA 5E2WL 2YPKA 5T1KB 3CLWA 2D4DA 3ZDWA 2YPLA 1UJ3C 4MZ3A 3KPRD 3L4YA 3FHAA 3SPCA 1JGDA 2AK4A 1PSKL 3DX3A 2YPKB 4AITA 1OCCB 2A9DA 4L4TE 2K8MA 4P3CH 3INUH 4ZMXA 4G2AA 2VXUL 4WW1B 5E1AA 1QBML 5I1GH 1T1WA 4LKCA 2AK4B 3TC9A 1LP9F 1ZLUH 4L05A 5D4JA 2B1HL 2QEJA 5FYJL 1I8LA 1HHIB 1S9XA 3OF6D 3ZTJG 1J9SA 4FHBD 4S1QL 1A3RH 1ZV5A 5CD5D 4N1CA 5GGUB 3A6OA 1DJIA 3QWOA 4MKTA 1ZHNA 4ZUWA 2Q20A 1MJ8L 5IB1B 1S2EA 4AYFA 2HUHA 4QHMB 2GSIB 1TJIL 1UB5A 3FOLA 2Y3AA 2YD0A 1QABA 4R26H 3DLQR 1C5BL 2QVMA 1QRNE 4ORGB 4PUBH 4QRUA 4JMNA 1T04A 1UKSA 5B3JE 4K3DH 3CFBA 2Q8AH 5DFTA 2J55A 3E2HC 1ZA3A 4L1HA 1Q1JL 2P44B 2FT7A 1E9QB 1U2YA 2DH3A 4QRUB 3A0OA 1CJYA 5EUOE 3U2JA 3DK2A 2WCGA 3KW8A 3CFBB 4F7TA 1QLEB 1W6LA 9CGTA 1ZA3B 2P26A 3LZQA 5DZOA 1W80A 2WVVB 3QDGE 3AWFA 4JREC 3RHWK 2GC7C 1BM7A 1VFBB 4ONHA 5D2NC 5F0MB 4GRWH 4F7TB 1MREH 1E4XI 2YAPA 4D7BA 4E9YA 3JVGC 5LGKA 3FT0A 3TV3H 4A7SA 4DK5A 4K73A 1Y7VA 1VERA 2UWEA 4F9LC 1TZGH 4P3WA 4KKCC 4OCXL 3PFUA 2JXMB 5GRZA 4ONHB 4A2MA 4PFEA 2O6DA 3RJOA 3KYOA 1G5AA 4W9HC 1IO4C 3D2TA 2X70A 3JT0A 2UWEB 2Q7NA 3TO4A 3UTPD 4NEHB 1AGDB 5JQHC 4A04A 3QISA 2LTQB 3O3DA 3K0WA 1P4LA 1SJEA 5IROA 1E4WH 4M62L 1DVTA 2X70B 5CXPA 4APXA 3AITA 3QWRA 4NKOA 3PCYA 4FQ2H 2FD6L 4DO6A 3AGWA 5JHMA 2KLRA 3VD7A 2V33A 1J5CA 2J8UF 1IVLA 1NUDA 3KS0J 2N7SA 3ABKB 2LU4A 2FATL 1ICTA 4APXB 2DQTL 4U05A 1MEXL 2E6JA 5L7XL 4P4RA 4PJHA 5DHMC 3IDIA 1C12A 2VAJA 2O6PA 3BUQA 2PCXA 1OF2A 4C4KO 3WKNA 4YR6A 1A14L 2JCCE 3NCXA 2R0KH 4C56D 1RXLA 3ARXA 3A4AA 2X2YA 1UD6A 4P4RB 3ALPA 3FCGA 1C12B 2YAFA 3KJ6H 1OF2B 2YGPA 3SD2A 2CRYA 4HCRL 4YR6B 1VSCA 4ISVA 2YR3A 5CLTA 4AEIH 2VMFA 3WLBA 2O4EA 4OQ1A 3G6AB 3ULUC 4BFGA 4W93A 3NIGE 3QJXA 2ZSVA 1SDDA 5D8JH 4F1SA 5GRVL 1E9OB 2WJ7A 4GRLB 5DVKA 1A1OA 3RTQD 5GRWA 1X5GA 2YA0A 5KBKA 4YDIH 1KB5A 2N0MA 2FEEL 2MMXA 2XZZA 1TVDA 4TQIA 2VERA 2UZYA 4UYPA 1NIBA 2ZSVB 1SDDB 1AO7B 1HZHL 3B5GA 3L3DA 3R8BB 4LSVL 4MNGB 2AC0A 1A1OB 4JQVA 1R5WB 4APQD 4BQ8A 3QZMA 3AG1B 2VDPL 1KB5B 2DLTA 1QFWH 1QYGL 2OFQA 2KZKA 5TE4L 1MSPA 3A21A 1XZWA 3L3DB 2B3RA 5ITFB 3WL9A 1L7IL 3N85L 4QXUL 2C9VA 4NQED 2P42B 4FFYL 4UQ3A 5DJDA 1AXSA 4TLUA 1QBLH 5HHNB 2IH8A 4DP9X 1J0JA 4N68A 5BZXA 4H20H 1I7RB 1YEKH 4LOUC 4P04A 4D3CH 3K71A 3K3QA 1LWRA 4FRWA 1CFSB 1AXSB 2DBLH 5CP7B 4DGWC 4F27A 2DEWX 4YX2L 4S1DD 1AG6A 1J5OL 3FU8A 3QNFA 5CIPH 2AAVA 3K71B 2XKNA 2Y7OA 2R7EB 5DHVA 3SGJC 3UIYA 1AD9A 3KJ4B 1JNNH 4OCLC 5E8OA 1A7RH 4DP1X 5C92A 1FIGH 2K4WA 4BFRA 4DF9A 3STBA 1A7QL 3B7UX 4PRHD 2JKWA 3JYCA 5DHVB 1NDGB 1AD9B 3E1ZA 5E8OB 1W16A 4GIOA 3BQUC 3NP3A 5BXFA 1HNYA 4TN9A 1AI1L 2P5EE 2W5PA 3EBHA 1MNUH 3B8YA 4M93C 5E5RB 1RIUL 2DMGA 1KXVC 1TO5A 2FGWH 5EO9A 1JFQH 1MHPH 4EAEA 5BXFB 4LCYA 1HE8A 4WUUA 4LEOB 4F2ME 4JL2A 1AQ8A 5DQDL 1CC3A 2BNQB 2H7WA 3MRQB 4JRXA 2B1OA 3B2DC 3CLEL 2QSQA 2BOCA 5FUZL 4DGVH 3P9WB 5A2AA 4LCYB 4WUUB 1TETL 2BIHA 4RAVA 4N2IA 4JRXB 5JW4R 5MP6L 2YGOA 3S8WA 1B4LA 1H19A 3Q7JA 5ADOH 2BOCB 3D12B 1PX3A 1LO3H 2W60A 3G6DL 1IC0A 1C16A 4U6HA 1ZKAA 5J4MA 4BK5A 4RAVB 4LDLB 5C3LD 3BZ4B 4L8BB 2ZUQC 3ILEA 1CGTA 4LT7A 2NZ9C 2P24B 4G9FA 5C09E 4IS6B 1P53A 4WTZG 3H9SD 4PJIE 4U6HB 1BFVH 1CFTA 2JQZA 4P2QA 4HIIA 3U4AA 3ZJAA 3RVUD 4NQXA 1HXYA 2EXSA 5GS0H 4QOKD 5EOTA 4AIZA 2OZ4H 3ISWA 4YSRA 4I77H 4UT7H 5HHOD 5MEND 5AAMA 1ZANL 4ODHL 4QDGA 3I9GL 5IQ7H 3DUHA 1A7NH 2R83A 3D3VE 4P2QB 4HIIB 3TN0B 3WSQH 4NQXB 1HXYB 1F8TL 4J5VA 1ZJBA 4IIQA 5INDA 3CG8A 3VFPB 1J1OL 4NN6B 4YO0A 1IMHC 3ULUF 3O8XC 1ED3B 5FHBH 5FW6A 1EHLL 3D85A 1CLCA 4IOIB 4OM1H 1WAEA 3GHEL 3OJMB 2EXYC 5CKGA 4HW6A 1KPUA 4YO0B 4FNPA 2DPKA 1S9VA 1XXFC 1HL4A 2ZCLL 4X6CB 2ESVE 5KSBF 3QFJB 4ZUVA 4ZTOL 3UTSA 3OKNB 3B9DA 3UIZA 3IDUA 3OLGA 5BVPL 2R2EA 2ZAHA 1A9BA 3G9VA 1UM5H 3S3BB 1GHFH 2FJHA 3BAYA 5J1TC 1B3IA 2PR9A 3GMOA 4OW6A 4HIQA 1OT1A 4ZUVB 3RQ3A 1HCVA 1ZHBB 3QAQA 4HULB 4Z5RA 4K07A 4UAOC 2C9QA 2R2EB 3GI8H 3MN8A 2H9GA 5EZPA 1SEQL 1Q9LA 1PLGH 4PY8I 2VXVL 3V0VA 4BE5A 3AGVA 3F8UB 1I3GL 2FJFB 1XGRB 1GW6A 3GMOB 4XVSL 3SDXE 4NI6A 3O6KH 1UWYA 2EH7H 2YSSB 1JUFB 1A7OH 2ATPA 2H9GB 3LS4H 3V0VB 3BGFC 2BW4A 5B7FA 3AT8A 1S7VB 4UTBA 5JQ6H 1WWBX 3LH2H 1CU4H 4NKMB 1WZMA 4UM9A 1L5GB 4HV8A 4BFIB 4I48A 3DPBA 4LGRB 3MACH 5D7IE 3N91A 5FYLL 1T2JA 1IJ9A 1QSFE 1Z5YD 2JJWA 3VD9A 3V9EA 3CX2A 1TITA 3RUGA 2DV6A 1T2QL 1F13A 4UM9B 4TL5A 5AW1B 5J6GA 2WBJA 2R8SH 4I48B 4QUOA 2X4SB 2BIIA 1XVSA 4KU1A 4MCYB 5DJ2B 1QW8A 2L7JA 4LHUD 1NMCC 3H7LA 3S0PA 3CVHH 3TNNB 4M4PA 5J6GB 1JVKA 3VWKA 1JZIA 1RK0A 4K7FB 3LKOA 4F37F 2HCZX 1PY0A 3FF7A 1FH5H 4XXDA 1K2DB 1KTLA 1QLEL 1HQ4B 3BMWA 3ARUA 4RGNB 3TWYA 3VWKB 1RK0B 4AG4L 3LKOB 4K5NA 3X1NA 5HVWA 4ZS7L 1CZ8H 1C5DA 4NXSA 4QTHB 3NACH 3UTQA 4XN2A 1BAFL 3DX4A 4ZTPH 3HRPA 2YKLH 4C58B 5HVHC 5AYTA 4ZAKC 4HG4K 3L3OA 4JDZB 1DLHA 3P30L 2KLTA 1PKOA 3L4ZA 3TL5A 3UTQB 4OI7A 4O2FA 3HMXL 3Q8AA 4TVPL 4WFFD 5F3FA 5IJDC 4XP4L 4PG9B 4JM2D 4WENB 1QWNA 2EDXA 1P6FA 2E9BA 2J88L 1UUNA 2OMWB 1EHAA 2VLMD 4MA1C 1BZEA 3S36H 5DGRA 4QNPE 1AS6A 1MUJB 3H4HA 4JGMA 3MV8B 4DK3A 2VMCA 1M2VB 1FL5A 1H9DA 5K9KA 2ODIA 1U3HD 2IH1A 4EI0A 5L9DL 1FFOA 2CM6A 1CDHA 3VI4E 4HKBA 2N3JA 1T0PB 3VWJC 1MFMA 1AGBA 1FL5B 1P2CA 2I9LB 4Y4FD 3RGVA 4DEPC 4OI8A 2VR3A 1FL3A 1QUNA 2Q86A 2YPLD 1YY9C 3ZE1E 1QLRA 1S8DB 4KHTH 1I85C 2X4NA 3ETBF 3PWNA 5TE6H 2NMSA 3X12B 3ZL4L 1AGBB 4PJ8D 4GPVA 1AACA 4GUPB 4I7ZC 1HILA 2OMUB 1FL3B 4ECNA 2D9QB 2EEBA 2B2XL 2PTUA 1CLOH 3FU9A 1FNSH 2X4NB 3MBXH 1YO4A 3KLAA 3RDJA 3O41B 4JHWL 3WFHA 3MOAL 2AQ3A 4NJ9L 4KXZI 4N2BA 1KWGA 4ZPVA 2X4PA 3NRFA 2PYFA 4GT7A 2KERA 3NZHH 1A3LL 5GJSL 5E5MA 1IAII 1KXHA 2KS0A 3EZJB 4YDZA 5AKRA 5JIKA 5CR1A 4R83A 3LOWA 1MRDH 3CHRA 1EGJH 3OG6B 2PYFB 5FYJE 4X98B 5EZLA 4DZ8A 2HRGA 1N5AA 5CCHE 5E5MB 2Y23A 4FX5A 1C08A 4LSSL 4Z7AA 2OR7A 1KB5L 4WI5A 5EF1A 2BXZA 3BRGC 5HI3D 2OK0H 3FO9B 1XSJA 3LPOA 4JHAL 3UPRA 3QAZC 1Q72H 4H88L 1Q0YH 3QRBA 2F53A 4FN0A 1C08B 3QP3A 4Y2OA 3RI5K 5MEQB 3APCA 1YLBB 4V11A 2WXRA 5F72S 1CTMA 2C3WA 4PP2A 3T0EC 2FWLB 1RZ7L 4BFNA 1T5KA 5G4OA 3LZNA 4Y2OB 3U7WH 1AXTH 1JIBA 1YUKB 2DH2A 1LLAA 4TSBH 5HVFB 2VDMB 4Z23A 1HEJC 3ZKMC 3Q5TA 4XXCA 4P5KA 3GXUB 3FFOA 1UQSB 5IT2H 3OSKA 4YLBA 4DP7X 1Z9PA 5DS2A 4P07A 4PWJA 1GYWA 1IGMH 1WC7B 2H6UA 4HQQH 4K3EL 4XX1E 1CYXA 4LHUG 4Y1AD 2ZKMX 1JWUA 3D0VB 4LASL 4I0PA 3FU6A 4P5KB 5IHZA 4LL9A 3QNYA 1RSYA 2Y6SC 3HVNA 5DDHA 3POHA 1AHKA 4AK1A 4X0KB 4BH7A 3H4FA 1V3MA 3SDAB 1F6LL 1MFUA 2OL3A 4YL9A 1JWUB 1JZHA 3TO4D 4PLOB 5IHZB 2VIRA 3PWLA 4Z77A 1S7XB 4LLAA 3VXPB 3NTCH 1AR1B 3BXNA 3HG1D 2X38A 5DDHB 2Y25A 1ASOA 4KMTL 3APMA 2OL3B 2JJTA 1IQWH 5CJ5A 4AYSA 1OAKL 5L4IA 1VPOL 3NOIA 4TNFA 3QWNA 3QWRD 2J8UB 1JPSH 4PW4A 2VIRB 3QXVA 3UZEA 4Z77B 2WO3B 2VLJE 3BXNB 5DMKA 1J0HA 2BRRL 5CD3B 1CG9A 4XMVA 3UOAB 2I5YH 3FTYA 1MF2H 2HKFH 3N9GH 1NBZA 2WUBL 3VXRE 5CBAA 4JZOA 4ZQKB 1CLZL 4IRSB 3GS4A 5JO5B 5DMKB 5A7BA 4Q9RL 1CG9B 2ID5A 4NI3A 2XA8L 2APTA 3FRPB 3QXTA 4PJFE 5GIRA 4P46C 5DFVD 1GS6X 5E8NB 3UXFA 1NBZB 4I1RA 1ROCA 4FEMA 1JHTA 4FNLH 5CBAB 1E27B 5IVOA 4JZOB 2QVTA 1KY7A 3PP4H 1MCIA 3GPEA 4GEIA 3AT0A 4X8JA 4EZJA 1JHTB 2PYEB 5DUML 5I6XB 4IRZH 2HN7A 1EAQA 2DYPA 4PJ9A 3MRPA 4JE0A 4AMKH 1LEKB 5D71H 1F2QA 4X8JB 3L1EA 1YNTA 5FFGA 4LCWA 3PU7A 4XCNA 4BFOA 4WK4B 2HN7B 3PWPE 5A16B 3MRPB 5KW9L 1RUAH 3CMOH 5JZ7C 3KWUA 3P73A 3SDCB 3T0WA 4WNJA 1VADA 3WELA 4EN3C 5DJCA 3WXVL 3WAJA 4ATTA 4O5LH 5J13C 4KO7A 1VFOA 2YGQA 4LCWB 4XCNB 2BZ7A 2OJZL 4FERA 3NIFF 3IDJA 5BRPA 3NFPB 3UAFA 4HUMB 3SKMA 1DSWA 3RB7A 3KPSD 4DO4A 5CZXD 4BFKA 1VADB 2QKIA 4WKZA 2DQFB 1H3XA 3CDCA 2CLZA 3TASA 1VFUA 3O3AA 5ITBL 2PTVA 5KVGL 3I84A 1FCGA 3B2PA 2WTRA 3SKMB 1GL4B 2EE6A 4FKEA 3FFCB 1UM6L 1ODUA 4U4IA 3WTYA 4EF3A 5MERA 4WKZB 1U8JA 4KQ0A 2VDNH 2C5DC 2CLZB 2BFVL 3AY4C 1NBVH 4KI5E 1ZE3C 1CYWA 3MUHL 5AVRB 4YMPA 5KBPA 1QPPA 5J56B 1J8HE 35C8H 1IIKA 1V7ML 2WZPA 2Z35A 3EYOB 4AIEA 1TTBA 3VSQA 3ZR5A 4DOHB 3ATFA 3ASWA 2ITDA 2ZUTA 4EI5A 4FZ8H 1P1ZA 4UT9L 1GS7A 2Y22A 2Z35B 3CZKA 4LLYA 5AYUL 1ZS8A 5JHLA 2C3XA 4KZ0A 4NNYA 5E2VH 3DVGA 3K4AA 1EUTA 4UQCA 4R7DB 5KS9A 2Q3XA 1N4XH 1MHCB 3T77B 4LLYB 5JA9A 2ZNXA 3BPCA 3QO0A 2BINA 3K5RA 4HX1A 2B5IC 3DVGB 3KYNA 5FHAL 2Y4SA 3MRLA 4KH2A 4YFEA 4KI1A 3LQAH 5EWIL 3MQIA 1FHNA 3GNMH 2COVD 4HX1B 3HEIB 4OLXL 1NGYA 3TV8A 3KYNB 3VFTA 2YMXH 4ETYA 1KCRL 3MRLB 4K7PL 5FO7B 1NTDA 3OWEA 5H37A 5JHAA 3WNIA 1P7HL 3NUKA 2HT4D 4JUSA 2QKSA 3CN2A 3VFTB 4GFXA 4YHLL 4XP5H 4PH8A 1O6SA 3DETD 2ZXEB 5JIMA 4JKLA 5DD5L 1JGIA 5C8JB 4TTDD 2Y9RT 1AZRA 2GIMA 4G9FD 1AKJD 4M1GL 4UMSA 4NC2B 2J1KA 3GXMA 4QWWC 4XZUA 5C9JA 3MRCA 3RLSA 3H0TB 3IJHB 4HT1L 4NNPL 2LFEA 3BP7B 1O6SB 5CFHA 2GAZB 5BOZG 2C3GA 4EPSA 1F5WA 2X6CA 4AKOA 4CVZA 3QYCA 2JVUA 1ZJAA 2HT3C 3NG5A 4NZTH 3BAEH 4ZX4A 1QVOA 5C9JB 1KJ2L 3OPUA 3RTLA 3NPSC 3QCVL 4DN3L 1CE6A 1S9YB 3KW7A 3D85D 4WFEE 5EIVA 3STLA 1CTOA 3P4LA 1DJHA 4PCKA 5GGQH 4NQDA 3TBTA 2DWEA 3FK3A 4FJYA 1XCQA 3EYUH 3L54A 1CE6B 3L9BA 5TGBA 5KSBB 5HDOA 4HC1H <