5DZ9A

Streptococcus agalactiae agi/ii polypeptide bspa c-terminal domain (mut)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of Cell Wall-anchored Polypeptide Adhesin BspA in Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae serotype iii (strain nem316)
molecule tags Cell adhesion
molecule keywords BspA
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A02
2X9XA 3HR6A 2F68X 2Y1VA 4Z1PA 4IGBA 2X9YA 3RKPA 3KPTA 5DZAA 2WOYA 3QDHA 3PG2A 4IGBD 4Z23A 3OPUA 4HSQA 2XTLA 4P0DA 3V10A 5DZ9A 2WZAA 3PF2A 1AMXA 4OFQA 2OKMA 4IGBB 2X9WA 3QE5A 2Z1PA 3UXFA 3HTLX 4UZGA 2X9ZA 3RPKA 2F6AA 2WQSA 4IGBC
chains in the Genus database with same CATH superfamily
3X3GH 2FD6L 1OB1A 1IM3A 2BO0A 1TJIL 4Y5VB 3T77A 3DRTB 1N3NA 4OZHB 5IB4A 4K07A 3DPBA 4XPFH 1MKFA 4QRUA 3NIGF 2IWKA 4N90E 3F12A 3WY1A 4LU5H 1M7XA 1AGEB 2X7LA 2XX0A 2F1BA 5KYXA 4PTUA 3CX5J 1BAFL 2BSRB 4UANA 2PETA 4U1GB 3GBDA 3MLWH 1KLFB 2NNAB 3CHRA 1GR7A 2PF6A 2WVUA 4LRNH 3BUYB 2GW5A 5DJ6A 2XQ0A 1TZ8A 4TPRL 2OCJA 1QRNB 4CVZA 2NTFA 4P2QD 3V52H 4B9PA 2F53E 5DUPL 2JCCF 3QQNA 2H1LM 1SY6H 3V4VL 2X41A 5C2BH 4P2OA 4PJGB 2I25N 3RIAK 3FCTB 3UIYA 2H47C 4XB7A 1QFWM 4JJHA 1L7TH 3CBRA 5DT1H 2AF2A 3KWTA 3KYNB 5H35A 1YO4A 2E3VA 3MV7A 4K9EC 1QEXA 2JKIS 4I3RL 2C3XA 2FEJA 2EUVA 3I6KB 4UOZA 4L05A 3U2SA 5E9AA 3JWOC 1WC7B 3UTSB 4HOWA 3OSKA 2YBGA 1PDKB 1OTTC 3FSAA 1IJNA 4YE4H 1UM6L 1NKRA 4JFEB 4LKXB 4M6AA 4M93C 4ODSL 1TQBB 2NSMA 1ZHKB 4P5TD 3T1WA 2G75A 2ZF8A 2IBBA 5TE4H 4DTGH 1A7BA 5MEOA 5EU3B 1I7ZA 1R24B 3DC0A 2QVKA 4PJHF 2VABB 2V4LA 1AZZC 2EDEA 2R83A 3TBBA 1EAPA 2PXYA 3KYAA 1LO3L 1N59B 5ESVB 3APFA 2BK8A 1FFRA 1N8OE 3TWCL 4IRSD 4R83A 5GZNA 3EG9A 4JFFA 3REVA 4B9IA 4YDKH 2JE8A 1MNUH 5F7FA 5B22A 4YHPA 5DT1L 2NY1D 4LLVB 1MFCH 2AZAA 4O2FB 5EUKB 1QFUH 1G6VK 4F8QA 4TTGA 5J6SA 2M2DA 3H4FA 2VLRE 4Z78A 1AD9B 1CYXA 5C1MB 2GC7C 4K7PX 4PS8A 2Y1ZA 1AC0A 5EA0H 4PWIA 4RMBA 1E9PA 4PJDF 1OCOB 3E8UH 5I16A 3BPOB 3VA6A 2Y3AA 5F3BA 1G7HA 4FDWA 4IOFC 4PP2A 4DGIH 3ZHKA 5K9JH 3OJDB 3S35L 4L9LA 4YBLB 5JMRA 1E6OL 4I4WA 1GGCH 3GIZH 2VQTA 2DQFB 4BSWA 3WS6C 4ADIA 4WV1A 2VDRB 1NA8A 4GRLD 3VMPA 4BCXA 1JTOA 3BUTA 4PJIA 4BZYA 3O3BA 3ECBB 4ERSH 2QL1A 4NZRL 3FF7A 3I74A 1UCBL 3MBWB 3WYRA 5C9KA 1HTYA 4OZIF 4LLQB 3GRGA 4B50A 4LLVA 3ZDXB 4WU7A 2BP8A 2GTZA 4HIJA 5DLML 1CFSB 1MRFH 4OI7A 3IDYC 3BYYA 4FYSA 1AD9A 1HL5A 5F6HJ 1TQVA 2VDQH 4HXBL 2E9IA 4ZO7A 4RH4A 3OB0K 1G9NC 5AB2A 4WU5A 1E27A 2HJKB 3D5OF 5B7MA 1AGCB 3DBXA 4PJAB 2OK0H 4MA7L 3VXSB 2X1XR 1UM6H 3BQVA 3ES6A 1EANA 4FFYH 5ETUB 1N7MH 2FEEI 2C9SA 1JK9B 2NY5H 3FN3A 3K8KA 1H3GA 5CHNB 1QEWB 1YEEL 3ZXAC 4BSWB 3FT0A 1CDUA 2YMXL 2CHZA 4FTVA 2J4WH 3BIAX 3BKYH 2ROXA 3WMQA 1RIUH 4CILA 4N2OA 2H6PA 1YEJL 2CPCA 5HGBB 3TWCH 4LEXH 1GHFL 4NUGL 4PY8I 1NIDA 3ARDA 5ITFB 3RA7L 3ZDYE 2E9WA 2GJZA 2JCCA 4JHAL 2B0SH 3TJEL 4WDIA 5D1XC 3HAEG 3QC6X 4M4RB 4K5PA 5IFAL 1ES0A 1WUZA 5EC2B 3V6ZB 4JPQA 4A66A 3GSQA 2Z31A 4LESA 1DSYA 2VDPL 5I1JH 3GBEA 4P23D 2ZX6A 4PW9A 3WL9B 1CFQB 2V2TA 2LT9A 3NRPA 4TL5A 3GMPA 3HNSL 3M45A 1T22A 3T0AA 4KJQC 2ATKB 2DM2A 2EVGA 4G11A 1OK0A 1PIFA 3BKCL 3AU0A 4O5LL 1OPGL 2F8XC 2AQRA 4R0LA 8PAZA 1FSKB 3WLBA 4FFVC 3GSNB 4MD0A 3FCGA 3T4AA 5DD6A 5BMFH 3JV4A 4WK4B 4DQAA 4IQHA 5DRWA 1KCVL 3Q9PA 1EUTA 1VZIA 1OAUH 4JO8A 3RLSA 4G8IA 5HP5A 2ID5A 2P1YA 3NFPB 4KDWA 4XX5A 3IJHA 2ZKYA 3G6AB 1QFWH 3SBWC 2ENJA 3Q8BA 5LAXA 3PGFL 3X13A 4NJ9H 4LCCC 5CIPH 4AL8H 1ES0B 2D03H 1CICA 4M93B 2WLIA 4GINA 4JPSA 4BFIB 4FXGC 4R7DB 1JRHL 2VN5A 4R97B 1CQKA 2BVPA 5HVGB 3IDGB 3IPFA 3QI9D 4N6RA 2GT9A 3NTCH 4UMSA 1JZDC 4NT6A 2PPDA 3MJ8A 4B41A 3QDGE 3BQUC 1QZNA 3QUGA 1QABA 4NKIL 2XA8L 4LSSL 4LBEA 2WQAA 2ZG1A 3CHQA 3O2WH 4KQ3H 5T3XL 2YBRB 4R3SA 4IOIA 4Y16B 3WMPA 5H4ZA 5MHSD 1MQKH 2R1YB 1MHPH 3KXFB 2Y7QA 4MDIB 4NBXB 1FA4A 4NJAL 4PWGA 2ZJSL 3LIZA 3OB8A 4U6XA 1DUZB 4WNJA 4PJCA 5TE6H 3VQLA 1PKQB 5I6XC 1GYWA 3FU8A 3C6LD 4E5XB 3RKDC 2X4TA 4G43A 1MIEL 2I69A 2NY7L 3CXHJ 3T3MB 3I9IA 4P3CL 1CTNA 2V9UA 2H3KA 5TGBB 2ADJB 3BAXA 4PRHA 3DVFA 4OLVH 1QLRA 1U30A 4RAVA 1NJ9A 3S5ZA 1QMUA 2EDXA 3HBZA 2Z35A 4LCIL 3DX4A 1X5IA 2EAEA 4PJBB 3VTTA 1XF5B 5EO1A 4Z8FL 2XTSA 1RZFH 2H2PD 4M8UA 5ECJE 3Q5TA 3L8QA 5LUMA 3OR7A 3BKCH 1MJUL 2WQWA 4AV4A 4YJZL 3H2QA 5FV2A 2ERJC 2AHIA 4Y4FD 4M62L 2YD0A 3C5ZB 5LN4A 2BNRD 4MJ5A 2MNWA 2PNDA 2DEYX 2LVCA 1JHKL 4PY7B 4B60A 3QEQD 1WH0A 2XTLA 2Z65C 1JGLH 4G6AC 5JPNC 2JIXB 2DBLH 4DW2L 1N6VA 2RR3A 5IROA 4W9HC 3GKWL 5CILH 4KAQL 3I50H 1KCUH 4FCAA 4B9JA 4HEPA 4OZHE 1PTZA 1B0WA 2CMRL 4OFDA 4XO5A 3RGVD 4WUKH 2X1PA 2C1OB 4ONOA 1S5HB 2V3FA 2F7IA 3KLLA 4DGVL 5ALBL 3UX9B 4KKLC 1WFIA 4XO4A 2QJDA 4QRSB 1AZCA 1LTXA 3NN8B 3QWNA 3RPIA 3DKHA 3U1QA 1T03L 5ENWA 4AGOA 5T1KA 2AEQL 4WO4D 1BVLB 5DZNA 1NC2A 1WEJH 4OKDA 5BQ7A 2DWEA 4NRYB 2VR6A 4S1RH 5GGQH 4XOAA 1PNCA 1S3RA 4WFEE 1IAKB 4MNQB 3FONA 1HSBB 1INQA 4TLKA 5FYLE 4JY4A 2UVFA 5T5FA 4N2LA 2XFGB 4HH9B 3L4XA 3WFCL 2ZCKL 4HPYH 4NPYB 4ZW5A 1QVOA 1CD8A 1EJ6A 4QYOA 4PRID 4G5AA 3MJ7A 3RZCB 4TLTA 4F7MB 4JRWA 4G8GA 1LEGB 2IQ9L 1B9ZA 1WGOA 1A7QH 5JPMB 2CGRH 4ZAKC 5FFOA 3W0WB 1LP9E 1NTDA 3MUHL 3PHOB 4PCTA 5DEZA 3T65A 4BEIA 2Z91A 4WI4A 3R1GH 4YSDA 1AOHA 3F04A 1J5OL 2XIIA 2VLJD 2E8YA 3Q6FA 2X88A 3BIKA 5C0CB 3LRMA 4ZMTA 3L08A 4S2SA 2VW6A 3MBXL 3VXTA 3IKKA 1A21A 2DJ4A 4XNUL 3H9SE 2Z93B 4FZ8H 2ZOLB 1T89C 3NCYP 3LKOA 5FKAA 3ULVD 4MMZC 3TWYA 1UJTA 3ZTNL 4G7QB 4LQFL 4ZW7A 4O02L 4CMHC 5B8CC 8FABA 2C4XA 3NPSB 4FFYA 5LO7A 4KK8D 5A2IH 4W93A 3UPCA 2VDNL 2IQAB 3VFOB 3P3RA 1TQWA 4Y5YA 2XPZA 3IDXL 4N9GA 3CC5A 4NFDA 4CNIB 4HJGB 3K8LA 3QYNA 5F1KC 3UG3A 1MJ8H 1SFHA 5JQIB 2ZCZA 4P46C 4I9WE 3CH8A 2EYRA 3GJFB 4J4PC 1KIUA 3VFTB 1NAMA 4X7TB 3BQUB 5F97E 2GY5A 2VE6A 4BXSV 3LKNB 4PJBE 2X05A 2H2SD 1AG0A 5IMKB 3CMOH 1QNZH 1D9KA 1JPSL 5C3LD 1DSFH 1KPRB 1PS3A 1T20B 2MOVA 5D9SA 4ZX5A 2ORBL 3QDMD 1MG2C 2Z3FA 1JHLH 3V0EA 2NZ1A 1MI5E 3QUMH 4X4MA 4EKXA 3B9VA 3BUBA 4EN3B 4UQCA 2FECI 4Y19E 3KLHC 3B9EA 2E7BA 5KAQF 5H2BB 3SCMA 1P4BH 3DIFA 2LU5A 4D9LL 4PJ7B 3CVHA 2FJFA 1UUSA 3FJTA 4MYPA 2WW8A 1XGUA 2CXKA 2P7TB 1JYWA 2OI9B 3WAJA 2HLAB 1RULL 3IRZA 1T1ZB 3LN5A 4IHOB 4ZW3A 1IKNC 4QKXB 4E41E 1CIDA 3MGTB 2V2WA 3TPKA 3EF4A 1QTSA 2D4FA 4DUWA 1R46A 3LNGA 3LV3B 2DI9A 5DO2D 3IF1A 1RZQA 3IJ7A 3N2JA 3FOLA 3LHPL 4HUXA 1O7DE 3RGBA 2K9FB 4Q0XH 5HDOA 3X11B 4BQ9A 1SBSL 1T04B 4HFUL 4MAYA 1MRDL 1H3WM 1FC2D 1KJVB 2APTA 2AI0L 2GJ6A 1SN0A 4HDIA 4PVBA 3E2HC 4OQTL 1FFTB 2VUYA 2AJXL 3DUSB 2OZ4A 4WJKB 5AUMA 5KYYB 3SODB 2WZPA 2CO1A 3FULA 4R84A 3RKPA 2YKLH 3TESA 4LSUH 2EEXA 2IG2H 4YUEH 5IBLD 3NCEB 2BOCB 2ZNWA 4LRNL 1LP9F 2IADA 1SEBA 5J9PA 3OKNA 5F3HB 1OOAA 4UTAA 3WNKA 1IT9L 5C8JB 2D2CC 3EIFA 2XWDA 4JMNA 3BSZL 3S96B 4A7QA 3BPNC 4HJJL 2CBTA 2GK2A 4DN4H 3PYCA 3GHPA 4F8PA 3DURB 4YXLH 2QKIC 3TEXA 2IDSA 4WI0A 3BOVA 5IIEA 5B3JE 4JPWH 1JZ8A 1NUFA 2OL3H 2DQTH 2LR4A 2ZX5A 3T77B 3L2NA 5FGCE 1QPXA 3UGXA 3D0VB 3I02B 1OGAE 4RDBA 4Z77A 1S5IH 4HK0B 3C60B 5K39B 1HNFA 3TBVA 3GMLB 3ZDZF 4FQXC 2B1AH 2YC1B 4C8XA 2Y7OA 1HI6B 1H0DB 1XGRA 4M5YL 3BXNB 2VGLM 2XZQL 5ICYB 2JELH 4JG0L 3RZCC 1DYZA 2MQGA 2R2BA 2FGWL 2X4RB 4RWHA 3RDTB 2IH1A 4ZAKB 4C83A 2J20A 3CN0A 1UJ3C 1PJWA 4Y4KD 4Z7UF 2X9YA 2XNAB 5B4MC 1J12A 3WE6B 4NHCH 4PIRF 3QHFL 5EUOA 4ZOBA 3QIWD 1XF4A 1VGKA 2CO4A 4M6NH 1DCLA 1SY6L 5D6DC 5MENE 1AGFB 2VDKL 5KJ7E 4Y7MA 4AQEB 1KB5H 4HMEA 3MV01 1ZS8A 1WAAE 5DR5H 3VYNA 2ERJB 4XE0A 1RVFL 1TVHA 2L4OA 2CKNA 3EO9L 1EA9C 4NN6C 3C5ZC 4WEMB 1MFAL 3VXTB 1ZXKA 3FFDA 2BIQA 5ID0B 2EH8L 4HIIA 3LPWA 1XAKA 2ED6A 1OCRB 5TK2A 1U3NA 1YN7B 3CN1A 3KS0J 4D0CB 4L18A 4JJ5A 2QLVB 3VFVA 1UWFA 3MGOA 3QH3A 3K80A 4JHBA 4FQIH 2C9UA 2IG2L 4U0RC 5D1QE 2GTWA 4PRPD 3K2IA 2X4RA 4BM7A 3F7KA 4HT1L 3LRKA 1GW6A 4FQ2L 3WFBL 2X1QA 4MXQC 4KK6C 3W39B 3G5ZA 2MOQA 4YSOA 4XOCA 1V3LA 2R56H 3QRLA 3RFZC 1GGIL 4OGAC 3E1F1 4JRYB 4NQCA 2NYYD 1DVFD 1GZPA 1A14L 3QQ9D 5TE7L 1E5BA 4FQCH 3VI4F 1ACCA 5IM7B 4YDVB 1S9XB 1XHHA 1QFUL 2GFBB 3VJ6B 3W2DH 2QQLH 4FG2A 1G5GA 2VLJE 1GS8A 1UXWA 5AFAA 5HPMA 1IBBA 2RA1A 5E2TH 2P28B 2MFNA 1RK1B 1TCRA 3ET9F 3LEYL 3VFWA 5CP7A 5KSBB 4PWKA 4G9FE 3KXFE 4XBEL 4AIEA 2CA3A 5F1NB 1M05A 3ALPA 2QMJA 3GO1H 2J6EA 4AEFA 4RGNE 3OMNB 1AHWC 1QSFB 3WIIL 3LRLA 4Y16D 1NFDE 3H3KA 2BSDA 5IOKA 5IB5B 4IKLA 2QPDB 3UZQA 4HPOH 3LPGA 1FYTB 5IF0A 1C9SA 5EEXA 1LP9A 2B1HL 4NCC2 1X5ZA 3GSXB 3CSTA 4Z7UB 4KZEL 1UCBH 3ZR5A 1JXDA 1IQWL 1UWEL 4FHJA 3IU3B 1GSMA 4MRBA 5EBGA 2ROYA 4ZPTB 1OVZA 4OF5A 3STZB 4QMEA 1JZJA 4BDVA 3K6SA 4NS0A 4YVNA 2J8UB 1DEDA 1N70A 1K5NB 2EABA 3F7VA 3OZKA 2ODIA 2RALA 1NEZB 4LIQL 4LAQL 1CBVH 3E6HB 4UYPA 4WJ5B 5AVUB 3MRCB 5D2NB 4DOHB 3QZWG 2XZAL 4Z76B 5AW0B 5A7EA 1VADB 5L2KB 5FW7A 1OP5H 1XR9A 4XVSL 5D72H 1XXFC 4B96A 4DP5X 5HYQA 1FAIL 1R1CA 3QXVA 3UAAA 3EH1A 4LCUA 3ZRCC 1PZ5A 1YLBB 4P57A 3IEAA 4GW1A 5AZ2L 1AZVA 4XB8A 2Q87A 4PJDE 1NUDA 2P42B 3N40P 4JANA 4MA7H 4U05A 4RA3A 4I77L 1YEEH 2ETWA 2P26A 5C0NC 3WGUB 3MJWA 2XVKA 3RY6A 4L29A 5JHLH 4HC1L 2YXFA 1HYSD 4ZUWB 1BLNA 5CEZD 1GIGL 2O5ZH 1CU4L 2DDQH 4LPCA 5JORB 1C7TA 4OLWH 1WS8A 1UACL 4ZYKB 2ATKA 3PWJA 3EYOA 3RWEB 5D2NE 1CDIA 2ZKHL 4ZFFB 1VADA 3KYMB 4CBZA 4KK5C 1WUNT 4GBXD 4FA6A 1A5FH 3UTPE 3P77B 4Y2DC 3NJNA 43CAB 3SJVB 3OPZH 4ZXBD 4LSVH 4PJ9D 4A63A 2YAPA 4MNQD 2VDOL 2VSDA 5T8IA 5I1LA 1F56A 1NBVH 1XF2A 1U41A 1BQRA 1XH3A 4K7PL 1P7BA 1SXNA 2Z4QA 4D9RE 4NGHL 4OFIA 2GVYA 1PKQA 5I75B 1NLDL 2B9AA 1CDYA 3UABA 4PRIB 3GXMA 1FFNA 3QJTB 5ILTH 4AGPA 5GIRA 5JNYB 4LHUA 2EUZA 1A3ZA 4NO5B 5IP4A 1TKWB 1J8HD 5FA4A 2JI3A 3CX2A 3E2HB 4G59C 4HK3J 4N0FB 2H26A 2ENYA 4JE4B 1TMQA 3FTSA 1HCYA 3QRFM 3MOBL 5EZLB 1WVZA 3HE7C 4LLMA 2EKSB 5LKNA 3T71A 3DV6A 1UGKA 3SOTA 5JHAA 3VI4A 5C6PB 2VQ1A 4U6VL 2XFXA 1RPQA 3HZMA 3VD7A 1VFAA 1NPUA 3NIFF 4Q9BA 3Q1EA 3QULB 3LIZH 4JHWH 3V8OA 1A4JB 2NY2D 4CAGA 3RWDB 3P73B 1S9WA 4Z3GA 1HQRB 1ECYA 2E7LC 1RJYB 4ZS6D 4AY0A 2FYYA 1F11A 2LGNA 3KLAB 4ELMB 1AACA 4YWGL 5J06A 1NCJA 1A66A 4HIHB 4DTGL 2UXVA 3NZ8A 1N0LA 4R8WL 1K8DB 4HS3A 5EOCH 1ZE3H 1UG9A 5EU6E 3SDCC 5DEFA 1T5KA 1XGYH 4JPKH 1FPTL 4H1LG 2KQMA 3AXLB 1IE5A 1PAZA 3DROA 4GLRH 5E5MB 2AEPH 3UO1L 2E7HA 4M1CC 3R06B 3Q3GA 2VR5A 4QHNB 3EHBB 2I9TB 4FABH 2BCKB 4NNYA 1AKJB 2DRUA 4OGQC 3UYRH 3OMAB 3IXAB 2RH0A 3S0PA 3IWVA 4P04A 5BUGA 4XMPL 4KV5F 3TVMA 1UJ3B 3GHEH 1ESOA 1N6UA 2UY7B 1TQUA 3ZE2E 1QSFA 5I18H 1H3VA 1L9MA 4HJTA 1ZV9A 1ODUA 1UXSB 1I7UB 2EICA 2Q3ZA 5I8CB 3P3SA 1NGPH 1QLEL 4PY7A 4G1EA 4OZFB 4Q9QL 3JV6A 1KB9J 1XDTT 5E4IA 1P7QD 3PIQB 4I0PD 3CFJA 1MCRA 1F6AB 4QYOB 1JNJA 3WJLC 1TQCC 4I18C 3MJ7B 2W9EH 2Y6SC 5CS7A 4P59L 2IIJA 1FNSL 2F58L 3BZ4A 4ANXA 3UADA 2G4GA 4KROC 2BP0B 5D2NC 5HGDB 4EBQH 1AIZA 1U2YA 5ILTL 5IREA 2A6IB 4DHLA 3GSUA 1JS4A 3RWGA 3L5XL 3HHRB 3V0WH 4NJAH 4MB1A 1LEKA 5F3BB 3DYPA 4XP1H 3DX9A 2QADC 4Z7QF 3RHWF 5HYEA 4J6RL 1TJGH 4CUCA 2NQCA 2DD8H 3K8MA 1XGQB 3ME0A 5LBSA 2OPCA 2Z93A 1B4JL 2PCFB 2L7QA 4JDEB 4OLZL 4YQXL 5KBLA 5E08H 3V0FA 3WGVB 5FM5O 2EIKB 4L4TA 4XWOC 2Z8WC 3UZEC 1LK2A 4PSRA 3Q43A 2OMWA 4HGWA 1U3HD 1F8TH 1ZT1B 1NGZA 2E4TA 2VH5H 3Q8EA 4ONHA 4F27A 5FOBB 2HSIA 2WCSA 1HQ4A 2AEIT 2FIKB 2WSDA 5A40E 5T1MB 2DQUH 4UBDC 2ZCLH 1D6VL 4F8TA 2WLJA 3QUYB 4UQ3A 3D25B 4PV8A 4A67A 2DLEA 1CGVA 1E4WH 3WN5C 5F9DC 2IEPA 2RMNA 4DKTA 1GAFH 3KM2A 3HB3B 1A7QL 3RWGB 1FBIL 1IGTA 2COQA 1IIIA 2GEEA 4WEUD 3UG4A 4OZHF 2CNYA 5E1GA 3P4OB 4K4KA 3FYEB 2AKRA 4XC3L 3W3BA 1EMTH 1HWGB 1MWAH 3WLWD 2EDNA 9CGTA 3C60D 5I5MA 4U1SA 2AXGA 1LMKA 4FQLH 2HFFA 2VLRD 2AANA 2DIAA 5B8CA 2BY2A 2F5AH 3UIZA 1XB3A 2X2IA 1SY6A 3P3YA 5T3ZD 2NW3B 1CDCA 4XOEA 5C0FA 1HWWA 1AI1L 3RTQA 1L3WA 4LNVA 4WSKA 4DPRA 4UQBA 1DL7H 4AXWB 1WFMA 4AYFA 2I27N 2L0DA 2PW1A 2FJFB 1FFQA 1A9EA 5ACMA 1DJXA 3KE0A 3CFBA 5HDBE 3C8KB 3B2UC 4Z9KB 1PX8A 4OCYL 2YHGA 3KD4A 4M1GL 5GGSB 1LWHA 5EMYA 4GO8A 2H5UA 3NACH 5EF0A 3FUDA 1Z0NA 4Y1AE 4GH7B 1U58B 3VXNB 2XX1A 3GMPB 4NO3A 4JS7A 1X5XA 1OAQL 2FZ3A 2Y22A 5H37A 1C12A 2YEZB 3CVHL 3QQXA 5EBWA 4OCLC 2XI9A 2RQEA 3U4EA 1PY0A 4NEHB 2GJ6B 3AC0A 2BHYA 5LG6A 1HK6A 3VXRB 1MELA 3IVKA 4ZQKB 1M3JA 2WWNA 3ARED 5ES4B 3NJJA 2IANA 1S9WB 2ZX7A 3CFNA 4OLZH 4QDGA 4GRLA 3TZVC 1OTSD 2DL2A 1KYOK 1FN4B 1T0MA 1YY9D 2WIIA 4HV8B 4PJ5A 4HUVB 4K8RC 3MLYH 4J2QA 3I85A 4TNWF 2VTFA 3QIUD 2EO1A 3G5YA 4L3CA 3TJPA 3L4YA 3V0HA 4L8BA 1D9KD 4KQ0A 3HPJB 1PZCA 3RX9A 1WGVA 1GGYA 1R3KB 2KLSA 2ZWZA 3VNYA 1B4RA 5IIEB 5GS0D 1X5JA 4NZJA 4RETB 3S36X 4LLDA 3C75A 3FCSB 1CN4A 2XIDA 2YO3A 1U58A 3FT4A 2HFEB 2B1OA 4HX1B 4Y1AD 1TZHA 2BFGA 3QIUA 4WWKD 2DTML 2EE0A 5DWUH 4KKCC 3TO2A 3FRUA 4PCKA 2XG4A 4MD5B 4NQCE 5EU6B 1AQDA 3E1ZA 4XMZA 4Z7OB 5BW7C 2ZYRA 3MBEC 2DY2A 4RA0C 3BT0A 5I75C 4YIQA 1C08B 3C2SA 3EBHA 4W6XB 1P4UA 4BZ2H 2QHLA 3QNYA 3AWEA 4KROB 1OK8A 4PGEA 4HV8A 2W65B 1CO1A 2ZUYA 2ZG3A 5IB1B 3X17A 1FYTD 4GAGH 5EO0A 3KH4A 4GQ9H 4CMMA 1CLYH 15C8H 3ESMA 2QADB 4XHJD 4OCYH 4BV1A 1NCBL 2ZXAA 2JSFA 5CM1A 4E0RB 5CP3A 4JMXA 3H7BB 3PP4H 1FNAA 3EGSA 3VRIA 4GKZA 4Y9EA 1L0XA 3O0RH 3GSRA 4U49A 5EO1B 3FL7A 5C9JB 1XWVA 1D6EA 1HOCB 2NW2A 4F33B 1C16B 4I1RA 4JG9A 1P6AB 3M17B 1X4YA 2WCPA 5DURD 3NJMA 1MVUB 4XBGA 3RVVC 5BOZG 2W07B 1G84A 4GLRI 1D3CA 4P3DB 3QIBC 3WNPA 2OMVA 5FECB 3BVNA 4C58B 1G7JB 3GK8H 4AC2A 4DESA 4L23A 5IB3A 4F3FA 5EU4A 3F7YB 1MEXL 4JX0A 4NFCA 4R4BA 2RFXB 5J3HC 1ZTMA 2PUQT 4FTVE 1D5BB 3B2MA 3DHJA 3V4PA 1AGFA 2C8NA 2YPLA 2YPKA 3FUHA 1S4IA 4O2CB 3S37H 3IAQA 4PU2A 5J4MA 1HXMB 3BGAA 3RIFF 5AYUL 3F58L 2ZOUA 5JHDA 3TO4B 2IV8A 1YNKL 3ZYOA 7PAZA 3MPCA 2H3NA 3FMGL 4F7KA 1OCWL 2FJSA 4S1DD 1OZTG 4JJ5B 4MMXC 3TT1H 4E9SA 3QIWA 2YJLA 4KRPD 5CD5D 1VKXB 2AI0H 1O5PA 1KEMH 3FTUA 3D85D 3QUKB 3CMGA 4EN2A 3EJZC 3K5RA 4LDEB 3SPVB 2AJZA 2GB2A 4E9XA 4H1LA 3GBLA 1UKTA 3N6YA 4FKHA 3UERA 2YA0A 4W1TA 1BBDL 3GEFA 3P4NA 2DWTA 4QAMB 4GKSA 3TIDA 1IJ9A 3BRGC 4FYTA 5DD3L 3TT3H 4BIKA 2WTPA 1MQ8A 1BFVH 4YDVA 3HG5A 3QNXB 4ODTH 2WNWA 3FB7B 2WY3B 2VUOA 3L6FB 1NICA 4PCSA 3JTTB 1Z66A 1NMCC 1EEQA 2O61A 5JO5B 3BW9B 4FQCL 1KLUB 4EVNA 1QHOA 1ZHBA 5EU3A 4DP9X 3QJXA 5C7XL 5AAPA 3ZKMD 2FATL 4TS6A 2CJ3A 4Y5VA 5J6GA 4OFKA 1HHKB 1UHVA 1OGTA 1ZA6B 2WAHA 5T1DH 1BVZA 3ARPA 3V4UH 2A9NH 2DJMA 1CC3A 2VN4A 1U8IA 2NZ9C 4ODUB 4XCEB 1HH9A 1W72A 4I77H 3HB3C 1P9MA 4U1NB 1YQVH 4PJGF 5JA9A 2FX9H 2PCYA 4V2CB 5BO1L 1NFKA 1OWRM 5C08D 1RUPH 4HPOL 3BUYA 5DJ6B 3RWJB 3KWWA 4C57C 4LFHD 1QRNA 5IESH 4Y2OA 4MAZA 4PVLA 4F1ZA 3A6OA 4DP0X 2D7PA 3DXAD 3V6OE 3V79C 5A2KH 2F1EA 3OJMB 4ILDA 4PEEA 4AUUA 3VXMB 1E27B 2HJKA 1NBZA 4PRHE 1AKJD 2DEWX 1E5YA 3U0TA 3U9PH 5I2IA 2IDQA 4PH8A 3W9DB 4IDJH 3QZMA 1BBJB 3RUGE 5L4IA 4GI6A 2CLVA 1A1OA 3W2DL 1KENL 4WFGD 2WJ7A 2EE9A 4JW3A 5AAWC 3KW7A 4QO1B 4AVKA 1L9QA 1D5XA 4JY5H 1AR1D 1FFOA 3VACA 2QSVA 1HCVA 4LVNB 3N43B 4ODUA 1Z6JT 2AVGA 5DFTA 1E6OH 1YJDL 2O6EA 3WFEH 3HCVB 2Q6WA 4Z7IA 2ZD0A 3V5HB 5TPWL 4W4OA 3RILA 4I5BB 1FWXA 4ZMAT 3P4MA 4KKQA 4PS4L 1UZGA 4TLSA 1HHIB 3F6LA 1ZHLA 2J8UF 3NA4A 4HWBA 5DC0A 3MXWL 5FCUH 5FO7B 5EZLA 5C0DA 2Z8SA 4FI8A 3U79A 3X1FA 1NAMH 1ZSDB 1FO0H 2X6CA 1IQWH 1UWEH 2PR4H 3MRBB 2GJ6E 3KDMA 5ETUA 5EG6C 1PZBA 1FFPA 1F5WA 1JK9A 4G7VH 4JPWL 2FHCA 3KLKA 3BP6A 3JV4B 3KPQB 5HJGA 3BT2H 4X2UA 3ZR6A 3GDBA 3O4LD 2G9HA 2EDJA 1J9QA 3V55A 1XZWA 3UP6A 3W37A 3FU5A 4J23A 2I60H 3HC3H 3SDCA 3OPZL 1W8EA 1LJMA 1MJJA 4QRPA 2GJZB 3G04B 3S8WA 2WB1A 4JL2A 1AAJA 1G9MH 5FO9B 2X09A 3T0ED 1DQTA 3CQQA 4ODBD 4YSSA 4L8DB 5AOIA 3CSBA 2Z31B 4U2ZA 1U33A 2YN5A 2IBZX 3W5NA 2YRPA 2BSTB 1OKEA 5E5MA 3VD1A 3KPMB 2FEDD 4FFTA 5E1AB 2R7EB 4Z7VB 2OSWA 1BOGA 4XNQB 5FGCB 1U6AH 2FJUB 1ZPUA 2ADGB 3HZYB 3L3KB 3S2AA 4AGNA 2NY5C 3GKZA 1LXMA 3LDBB 3IFOB 4UT9L 3OLEA 3HS9A 4OIIL 3ZHNA 2WXNA 1I7UA 6PCYA 2NZIA 1MHCA 1NSNH 2BDNH 3Q7JA 2ZUVA 3BH4A 3E9UA 4KJPD 2P5WB 2HT3C 4OJFH 5EEUA 1I8UA 3VX1A 3P4NB 4GW4B 5LGHL 4FLRA 5FHAL 5HYSG 4GBXA 5DK3A 1JG9A 2N0KA 4G9FD 1E4KC 1U21A 2V33A 3VDAA 1ZJBA 1EHAA 4D3CL 4NKDA 4N0UB 3D4GA 2C3VB 5C09B 3IMUA 1SJEA 1MIML 1T1WB 3Q3GB 2ZKWA 1DQJA 3L5XH 4YO0B 1ZLWK 2BCKA 4NNYB 4JFPA 4Q14A 2X70A 3V0WL 3ARVA 4KZ0A 5AOMA 2CCVA 3VG0H 2GEQA 2Z8RA 3SY0A 1Z32X 2GJ6D 5GGTL 1BZ9A 4PMFA 4M6OL 2Y07L 3B8SA 3CSYA 1J5CA 2VXVL 4PB0H 1TNNA 5GRVK 5D96B 4BFOA 2OTPA 5E08L 4HJIA 1FIGL 3DI2B 4UOW1 4KK9C 1RUML 3TNMA 5CEZH 3NIDE 3QFJD 4ZRGA 3UBHA 3S5YA 3TEWA 5GZNC 3NIFE 4FL4C 2ITDB 5AAMA 3M07A 4W9ZA 4KXCA 4NGHH 5IVXE 3TO4C 25C8H 5I6PA 2A5UA 3INOA 1BVOA 3BE1H 1KN4L 4X50A 1OOWA 1XMEB 5TGBA 5ICZA 4PJ5E 4HMDA 3UG5A 4YH6A 1Z5LA 4DP2X 1PPIA 2CHXA 4I18A 2C9RA 1YYCA 5HPMB 5B3SB 3ZLQC 2G2NA 2VLJA 3AGWA 4HFWB 1CLCA 1LEIB 2HVBA 3NFSH 4ALAH 1EX0A 4AQOA 1AQKL 4WEBL 5KSAD 1PG7H 3HAEH 2F0CA 4BRVA 4X6DB 4ACTA 1T5XB 1IM3B 2ISDA 4WI5A 3T2QA 3MOAL 2EDQA 3EOAB 3L1GA 4WUUB 1NC4A 1E8ZA 3DNKA 4KVPA 5IB4B 3GBNL 4R7DA 3GLAA 5G4OA 5I19L 4A6YA 2IAAC 4R96B 1Q1JL 5E8NB 2DQEL 5EFIB 2YXMA 3HCVA 2Q6WB 4IRJA 2VDOH 4IJTA 1RZJC 2DQHL 2F19H 1GS6X 3HI5H 3ULSB 1E43A 3ZPDA 4G70B 1NMCB 5TQ0H 1EZVY 3QPKA 1M53A 4M5TA 4APQD 3MYJA 4O9HH 1RJCA 3IK2A 4NNXB 2EZ0D 4CU6A 2MEJB 4TSCL 4MJ2A 4DPBX 2X53A 3V9EA 2LU4A 2P43B 2AITA 4IK6A 5INDB 3HBPA 4G6KL 4XX1E 1BZ7A 1H19A 2BHFA 3FCTA 4KXDA 4QHMA 5CILL 4XVUC 5GJTH 3UBXI 5BS0E 1MCEA 4HJ0D 5HJ3A 1LE5B 4JRYD 1CU4H 2DDQL 3ZZSA 2R9HD 2AXHA 3VRJB 8CGTA 1EMTL 1MWAL 3QWOB 1JPTH 3O8XA 3FFCB 2EINB 4L1LA 4P2RB 4JFQB 5CLYA 4Z18A 4N24A 3B34A 3DRTA 4XP4L 2JJWA 3EXJA 3GFUA 4ANVA 3RFZA 4FCHA 5FYKH 4XBPB 3ABGA 1UA7A 1JOIA 2BP8B 2JTDA 2GTZB 1EH9A 1KIPB 3E3QE 5BZDA 1S7VA 4H1LH 4L4VE 4MQXD 2XU9A 5JXAH 1W0WA 2BSTA 1IC5L 4MS6A 5JA8B 3GLZA 3OKOA 3ARBA 1K2DA 3MJGX 6FABL 2O6FA 3MNZB 4FNTA 4NO0A 3PGCA 2N0MA 3ML9A 1HE8A 4QXUL 4UOQA 1OAUL 3X2QB 4QRFA 2B08A 3F64A 3IFNL 5I82A 2VR3A 3IMRA 2Y5QA 1PKOA 3EJPA 3MV9D 3KVQA 2XETA 1A02N 5BVPL 3I2CH 2WXRA 3DO7A 5CUSL 3UYOD 1SLWA 2IOIA 2KBGA 1YNTA 1LE5A 4FLSA 4GG8B 2W9DH 4F5CE 1SMOA 2PYED 4FNRA 3D0LA 3K4ZA 2QTEA 3GHEL 3LAFA 3RPIB 4YHYB 3I9AA 4M6MH 4TQ8A 4AM0A 4JDTL 5D70H 5JXAL 3N44F 1RURH 2XV2A 4Z3HA 2F68X 4PR5B 1FLRH 5E6UB 1JP5A 2XA8H 3D18A 1AKPA 2P8PB 4ZS7L 4BINA 3U9UB 4AEHH 3ABMB 3RY6C 5HY9B 4NQDE 1CGTA 2H9GB 1FZKA 2F1AA 2WWMC 3DUUB 4ZX3A 2DM7A 3B83A 3X3FH 1XIWB 3OKKB 2XWEA 1ASQA 4F7MA 1FBIH 5DEGB 2XA3A 2WCGA 3TBCA 3D2UA 3SYQA 1RLWA 4P46A 4K94H 3SE4A 1BECA 1JGDB 3FC8A 5MEQA 4HHWA 1NC4D 5TDOA 1DVTA 3MUZ1 2UX7A 1RJYA 1IFGA 4CA4A 4PJ7A 2E56A 4GKLA 3SD5A 2CO6A 3GJFK 3M6DA 3ARGB 5HYFA 1M3IA 4ELME 5I16B 5D7SH 4NAQA 5D1ZC 5IB2B 3VA2C 1IFRA 3B7UX 1DHKA 1AANA 3BN9D 2IMNA 1FYTE 1WRFA 4V2BA 4YHOL 3E6FB 4AEHL 3QDMA 3E0GA 5DJDB 1B6DA 1OANA 1UWGH 3DO3A 3ZN6A 4L37A 1L5GB 15C8L 5T3XH 4JGUA 1XT5A 2VDMB 1S8DB 1HXYB 1E4HA 2NW2B 4MNGA 4X7DC 4NKOA 1E4WL 2JCCB 4TUKL 5L9DH 1XB6A 4X83A 3ZHFA 3PJLA 4NUPA 5F71A 1ZLEA 4JFXA 5D4IA 5KYUB 1QSED 2XWZA 2ZUUA 1AGDB 3L5HA 4R96A 2DV6A 1T6BX 1OT2A 4ZXBA 2AEOA 3F7PC 3QA3B 3RDTA 4F7TA 1QKZH 3CHOA 5E2JA 4PJXF 2CO2A 4I48B 3LXAA 1WBXA 5IMOB 1UA6H 2YAOA 3NEOA 2YGPA 3AQZA 3CBJB 2FE0A 4MA8L 5SWSA 1ZGLB 5IKCA 4OQTA 1ACXA 1O6VA 3DX3A 2WOYA 2NX5E 3SDYH 2R0ZH 5C08A 1T1YB 1A8ZA 3BLBA 3R18A 1YY8A 3AS3A 7CGTA 4Q7DA 4GXUM 1RD6A 4LSDA 4RAVB 4M7ZC 4QIRA 1JGUH 4TF4A 5D7LA 2H41A 3N1QC 1UB5B 3L81A 4A37A 5TFSL 4P2QB 5D6DA 4G8IB 3V0IA 3WFCH 5HXMA 4YX2L 5D96C 1OF2A 1RP8A 4HIIB 4CSPA 3BKMH 4NFBA 1BQHA 3V6FB 3TN0B 4XCNB 3DMMA 1H6FA 2C9XA 3EOYG 4MJ5B 5AVVB 4ZX6A 5D7LD 1KEGH 3BEWA 3ULVL 3ARFB 5K69A 5D5MF 4LOFA 4AT6B 5B7FA 2VSMB 3PL6C 1UOKA 4X7FC 1IVTA 3GPSA 2Q7NA 3WIAA 4ODWB 5FHBL 1TG8A 1F4XL 2CZNA 1P4IH 5A16B 5JR1H 3G5ZB 4HOXA 4MVBD 1FV1A 2CBQA 4K73A 2BIPA 4HXAH 2QPFA 1DVXA 5E03A 1K2DB 2EXWC 3B9DA 5HYJB 5H35B 2KQNA 1BQLL 3L7FA 2R51A 2YEVB 2JKJA 5ALCL 3V9CA 5IHZB 3H9HA 3BESR 3JYCA 1RZGB 1HFUA 1GCYA 1SFDA 3K4AA 4DK5A 2DQJH 3HI1A 3K6OA 2R1WB 4AEIL 3GI9L 1J0HA 2CDFB 3DOSA 4PVNA 1QUNB 4IIQB 4CDHA 3KLQA 1XSJA 1BP3B 3X1NA 4HJSA 3PFQA 1WLHA 4WI0B 4MQ7B 3OKLA 2R59A 3Q2NA 2WXJA 5HJBA 2APSA 2CLVB 3CHSA 1MUJB 5GZOD 1P9MC 5DO8A 4ZUVA 2VLKB 3MLSL 3BRDA 1RZKH 3MODH 1T0NA 1WWAX 4U1JB 5DJYA 2K45A 2P5WD 2MQ0A 3F05A 4HKJA 1IGML 2X4SB 2AK4E 1NDMB 1BX2B 4Z3JA 1ZA3A 4H8QA 5KOVC 3N5AA 4F9LC 1CI5A 4LB8A 3RWJA 4BFFA 1FVEA 1SEQL 1HIMH 1S7TB 3A22A 3AU1B 3O9WB 4TKWA 1RZKC 1I1AA 2A74A 1DBML 3ULUC 5DVPA 3ZTNH 4JKWA 3M1BA 4D0BA 2AC0A 4L8SA 5CSZB 3VE0A 4OB5L 3OKMB 2J6EH 4NSKA 3HE6C 3S88L 3LEVL 5A6IA 2P48B 1QBLH 4MA3A 5AVRB 4ENZA 3VG9B 3IDIB 8FABB 4Q6IC 1F2QA 3DX7B 1GC1L 1KFAH 5CMAB 4DAGH 5D6CA 2FLRT 2GTQA 1AE6L 4OVUA 2VLKA 1HNYA 3QIBA 2A74C 1DO5A 3WSQH 4UINL 4GNKB 5JIKA 2BSRA 1ML0A 1NDMA 1UB6B 4H26A 4LNRB 2YZ1A 3WV0A 4UZGA 4AJWA 4XPFL 2DYSB 4YGVA 4FG0A 1JF1B 3ESVF 4O4YL 1IKNA 3EUUA 3L9RA 5A2FA 1UC6A 4KMQA 4XMWA 2KZWA 3RGVA 3B6SB 3CFKB 2NY0B 3OHMB 1BAFH 1XD0A 4PAZA 5IMKA 5KYWA 1TZGH 2C7UA 4E42B 3L3GB 1XR9B 2BERA 3O3DA 2D7TL 1KPRA 3F8UB 4LHUD 5HYQB 2BNQD 4F2ME 5MERB 4KRNA 3FOMA 1KLGB 2FJGB 4S10A 4TNGA 4HUKB 4IRZH 4MSWB 5T33L 2YJQA 2YZ8A 4UAOC 1FGNL 3F65A 1G6RB 3MRPB 1C5CL 4JK0D 1ZANH 3DIVA 5IJVB 1A2YB 3LSOB 4MFHA 2IV9A 4WWKA 1IL1B 5D1QB 1OCWH 1PDKA 1CXIA 5FUZH 3VFGL 2HG5A 3UEQA 4OF8A 1NMBL 2BVEA 2ENQA 2CIIB 2EKJA 5T1KB 2AQ1A 5FPIA 3D3VE 4Y9GA 3MNMA 5HVHB 1OAKH 3S35H 2I60L 1HJBC 5ANHA 4LEOA 3WUWB 3PP3K 1QO3B 2W95A 4ODSH 3TV3L 4OM0H 5DEJA 4GT0A 5IB5A 2WVTA 1ITCA 3BD4A 2RACA 1VGEL 5EF2A 3IJSB 2RCSH 1BQHB 3M8OH 4N0CD 4PJ8A 3V6FA 3ARFC 3BH8A 1I9EA 1ND0A 2J88H 2ARJQ 1K9TA 3ZYZA 2XTJD 3IFOA 3FYIB 3C5JA 3T0EA 1KCWA 4XP6H 2GHWB 2XZCL 3S8FB 4YHIB 4AVHA 2LW3A 4QXTA 3QUHA 3D69A 5GS0H 4NBZB 4Y1AB 3H42L 3KPRD 2FD6H 4F7PA 1A2YA 2E27L 4WWKB 4I0PA 2PR4L 4YXKH 3TNMB 2HP4A 1CZ8L 3FUJA 5IJKC 3EYUH 2R23B 3LB6C 4TTDC 3HI6L 4DH2A 4EI0A 3PWVA 2HUEA 2P45B 1K8DA 5FR3A 1VLXA 5B1BB 1HXMA 2WXQA 4X5PA 3K6NA 3ZDZB 1EDYA 2UY6B 4FNPA 1T5WB 4OUUA 5BRZA 4Z77B 2XZQH 4BFGA 4OZIA 4I0CC 3QCVL 4GW5A 3KXFD 3DV6B 1BBDH 4NQSA 1U93B 4M1DL 1H8SA 4GMTL 2LLLA 3APNA 3HUJF 4ALAL 3EO1B 4CW1B 5HGAA 4HIJB 4G9FA 2ZIDA 4OD2B 3U7WH 3MLXH 2XQBL 1KJMA 3GS7A 3OL2A 4H40A 3L1OH 1NGXA 5JDSB 1IM9A 4H1LB 3NPZB 3SE6A 3EFFA 2JKXA 4XPTH 3CH1B 4OKVA 5K9OB 3BAJA 1LMIA 3KXFA 3G5VB 3U46B 1XBDA 2NCEA 4PBWD 3O9WC 4M7ZB 2CNZA 1UGNA 3P11L 4GRWF 2BHUA 4L9DA 4Z23A 1AH1A 1NWOA 4CL7A 1OPGH 1URIA 1THCA 3NQKA 1MHHB 1MREL 4HCIA 3SJVA 1DJYA 2V7HA 2ZWNA 2A38A 2WLIB 2YUWA 3HE6B 2B5IB 1GYAA 5D93B 1YEIH 3DPBB 3ZE2F 1PLBA 1DBAH 4L5FE 4NO0D 3S36H 5FUCC 4YFLI 2FWOA 1KGWA 5CJ8A 1NBVL 4OF3A 3WN5A 5LNEA 4POYA 5HHPB 2WHVA 5HDBF 3VGGA 4A2HA 5KBNC 3G6AA 4IHOA 2Y2WA 3EFOA 4H7VA 4PV1C 3SCMC 3P1VA 2WZPD 5GSVA 4XZUA 1PZDA 2K3TA 1S46A 1KYUA 3CDZB 4Y19B 4A7GA 1C5BL 4HC1A 5SWZD 2IPUG 3GSVA 4FABL 1HHHA 4U6XB 5LB1A 3FCBA 2J1XA 2YD1A 3MOAH 1ZLWH 3VUAA 1TLMA 2IVFC 5D72L 3ELQA 4TUJB 3DHMA 1CD1B 3RPKA 1JF1A 1XX9C 1C5DB 5E8DL 4JZNA 2DYRB 2G5UA 3N42B 1HJCA 4N5UA 5DD6B 5DHXB 4ZMLA 4F57L 2NY1C 1Y6KR 3Q2VA 3RHWK 2M26A 1OAJA 4XNZB 2ADFH 3OAUL 1DBJL 3DHPA 5C08E 3U82B 1OLLA 4G82A 5DDHB 4KI5C 3ALXA 3HAEB 4JDVA 1OM9A 4K9EL 1KDIA 5GS1C 5SWSE 4JBSA 3EXLA 3JT0A 3BHBA 32C2A 4LVOC 4CN1A 3ZTDC 1JDCA 2JJSC 2P8LB 1IKFL 3L1FA 2QV4A 3QORD 4X4YB 3WJLA 3W0WD 3WKPA 2DMCA 3D87B 4JB9H 4JQIL 1MIEH 2XRAL 4ZUSB 5DYOB 3SDDC 4RIRB 4HPHA 2O5YL 2A9AA 2EVHA 1A3RH 2HVKB 5I1AA 3ASWA 2VNCA 3HFML 3IBOA 4AM0Q 1S78D 2A4EA 1L7TL 4PJFB 4J27A 4AM0B 1YPZA 2V6HA 3IU3A 1D5RA 3J2PA 4OJEH 2QQKL 1C5DA 4XRCA 5DSCA 5DYFA 4QNPF 2IMMA 2OQJA 4IOIB 2CWRA 4Y16A 2NY4D 3GS4A 1R6VA 3STLB 2HUHA 4K7PH 3V5DA 4PTTA 5FK9B 3QUMB 4XPGH 5IR1B 2ZXDA 1AXTL 4PGDB 4JCMA 4LCUB 2X4NB 1T21B 2VC2B 1FAKT 3LXBA 1ACZA 1FH2A 2DLGA 2EADA 4KMTH 4TYUA 3N9GH 4LPUA 1NEZG 2BJMH 2XPGA 5C0FB 5A6MA 4PJIB 1E3FA 4AWJC 4HIQA 1FNGA 2GFBA 2FB4L 3VJ6A 5A2CA 4XXWA 3FO9B 4IBUA 4I85A 2HKFH 4EDWH 4UAHA 5ALBH 4QHKI 5D7EA 4Q6IA 2R0LH 3DOIA 2KDYA 4WHYH 3H1ZA 4QHLB 2IAMC 4OZFG 3QR0A 3T1FB 3N40F 1QUPA 3QAZC 1ZT7B 4NO3B 2YXWA 1PBYA 4OSUL 5SX5H 4N2GA 4CU7A 4WW1B 5IVZB 2EVIA 1FZKB 4WU5B 1I9JL 1ZT1A 1EO8H 4ONHB 4UAOB 5FKPB 3GXTA 3SKNB 3X12A 4ELMA 1AXTH 1G7IB 1RJLB 3HC2A 5AL8A 5K9KB 1KN4H 2F53A 1BMWA 1PVHA 2N7SA 3CPLA 4IK7A 5D7IF 1IMHC 1NBYA 4DPAX 4TVSa 1T20A 1RQ5A 3VXQA 1BVKA 1CGYA 2J4WL 5F1IA 4X6EA 2AJUL 2W8CA 2J55A 5KJ4A 3MRDA 3QUXD 4HBCL 3PNWA 5GSRA 2H8PB 4BUHA 3PUCA 1GZPB 3F2LA 4Q2ZA 4FFVD 4HJ1A 3RA7H 5GGRB 1S9XA 2R69A 1PU0A 3OXRA 4XH2B 1WBXB 4GS7B 2E7LA 1K4DA 4ZG1A 3AG4B 3UYRL 4ZTPL 2IH8A 3EH5B 5B1JA 2VISB 2Q9OA 4I4WB 3CC5B 3N0PB 3QI9A 4NHUA 5I19H 3U7YH 1I31A 1QI5A 1GPOL 5L6YL 3PABA 4KX7A 1IBZA 4K2UL 4EUPG 4PHZA 4DZBA 5I5JA 1HSBA 5C0BA 1TTGA 1WEJL 2NT0A 5KVGE 4DK3A 5IVOA 4HH9A 4A7TA 5I1IL 4LQFH 4WGWB 1U36A 4QT5B 1JGUL 3M88A 3O6KH 4NKOB 1FGVH 1MQKL 3SY0B 1MJUH 3MBEA 3O11B 3WHXB 3DX6B 2NQDA 4J6IA 1J7VR 1O6SB 1N19A 3L5WB 4QF1B 5AVXB 3QULA 2RHEA 2NNXA 5BVPH 2YGVA 3QI9C 5B21A 1E6JH 3PLYA 2EUXA 1G0DA 3LQAH 3PWPA 4Z7NF 4FI6A 3VXOB 3WS3A 1N8ZA 2DBLL 1QWUA 5A6LA 4Y4KA 5EBWB 2DYPA 3H9ZA 3UO1H 3FT3A 2ILLA 4WK0B 2WN3A 3E80A 3D2UD 4E41D 5I1CH 2JQAA 1DDTA 1JPTL 4I3GA 4M6ML 1YEHL 4F58H 1R0AH 4GXUN 1I8MA 3DROB 4RMVA 2XWJB 4Q97A 1QNIA 4NWTL 4NERA 4OIBA 1FVCA 1QSEA 3WO3B 3R06A 1YPZF 4DPCX 4WV1B 4GP8B 4JGJA 2IWGA 2O6CA 4OLYH 3RDTD 4MAYB 4CC1A 1FL3A 3ESUF 4MA1C 4UT6H 2IF7A 4N26A 1K8IB 4PLJC 2FWSA 3MRQB 3VXSE 5KSVB 1MFBH 4M4RA 3R4DA 5BQDA 2CDEA 5T1JA 4O9HL 4B9KC 4NZTL 1MCOL 2YSSA 3O0LA 3TASA 5C3IA 3BXNA 3VD9A 1CL7L 1CFMA 1HSAB 2H2PC 5IMLA 1IAIH 2YAFA 1F00I 2WKOA 3P3UA 3SE4C 4M03A 4P48A 5KN5B 2F74B 1E8WA 4ZYKA 4ZFZA 2NY3D 1ZY9A 2D3NA 2DTMH 2EYTB 4ZDHB 1RZ7H 3O4LE 3T4AB 5T1KD 4OZ4A 1KYOJ 1GVIA 3GDCA 4XPBL 4YAQB 4J5VA 3MROB 1JVLA 3BVXA 1X7SA 2VDML 4ONFH 3TPUB 3VDBA 5EOCJ 5CU9A 3STLA 1CDBA 1XV8A 2DAVA 2AAAA 1L6XA 1VSCA 3BLKA 3SCMB 2LV4A 3B9KC 4QRUB 3U48A 1B6UA 4BD4A 4ENEC 4DFIA 1RJZB 1VIWA 2CUHA 1HZLA 2F53D 2QR0B 4K5OA 1F8TL 2CM5A 2VH5L 2VN3A 3GRBA 4HK3N 3ROLA 1I3VA 3U1SH 4PRIA 2HT2C 4D9QE 5KVGL 4L4TB 3VGFA 1FNFA 2A9DA 4RQQB 4OUOA 4UTBH 2JCCE 1NCOA 3QUXA 4KOCA 4WO4C 1F4AA 2YRZA 3NQIA 4AQAB 4HUXB 5CBAA 2G3NA 3L4UA 3RVWD 4BYHA 5HJDA 3MCG1 3ZHLA 1S7VB 1FHGA 1T4KB 5E6ID 4LFHG 4JZJA 5D7IB 5IG7B 2F7QA 4H8WL 3KPSB 3KCPB 3Q44A 3VFUA 3WDIA 4AVIA 2Y23A 1G7QA 4YDMA 1J8KA 1I1AB 4ZNCD 3EYSL 2ICWI 1JMZA 1T03H 1EGJL 4NCC1 1X9LA 1UUNA 4PYHA 1F4XH 3ATBA 4MJ6A 3IFLH 4UILH 3D4YA 4YK4C 2IPUK 3GK8L 3T9WA 4PJ8D 5JLZB 3OSVA 1KULA 3PUUA 1D5BA 5IHHA 1FZMA 2MSPA 4H20H 4LF3A 2YA1A 4OFPA 1Z9PA 4U1LA 5C0EA 4M6NL 2OAAA 3LEVH 3QXTA 3VD4A 2JK5A 3H85A 2FCBA 3L3JB 4M5ZH 2IGLA 2OP4L 5IW1A 3ULVC 4TOYH 4U1GC 3BAKA 2JKNA 4QHNA 4FQQB 1BEXA 3I50L 5E7BA 5FW6A 3UEZA 5LGKA 1F4HA 1DZBA 2BM3A 3T8XA 4LSPH 3PHOA 2Y2YA 4KKAD 2NXYD 2WBJD 4OLUL 1KNOB 1INDH 5D5MB 4BHUI 2A4CA 3LNEA 3KZ8A 5HGHB 1OARH 1IGMH 5DFVC 5DWPA 2BWDA 2CG9X 1RLBA 4WWPA 1QR1A 3SGEI 1G7HB 12E8H 2W0FA 2XLLA 3OJDA 4L1BA 1CLYL 5FKAB 5ISZE 3OX8B 1XGTA 2WMPA 2HJFB 3KYNA 1OPOA 2HTKD 2C1OA 3DBSA 3HHSA 1R3JA 1TQTA 5GRUL 2XZCH 3IDNB 2QSCL 1P5UB 2CQVA 3OR6B 5KVDL 1GOHA 1CE6A 4X6CB 4UCFA 3V0DA 4EAEA 4Y1SA 5E94B 4Z1PA 1AFVH 4LSPL 2R0WH 1X5YA 4PP1D 1NIBA 5FYKU 2PWHA 3NA9L 1CFVL 1E90A 1KFAL 1RXLA 2A6KB 4MAYC 2OYKA 4Z7AA 2UZXA 5J6GB 1NEZA 2WXOA 4L1TA 3R0NA 4H0GA 1T5WA 4OUUB 4RMUA 3T2NH 4APXB 1BHGA 4XNQA 2AQQA 4LU5L 4WI3A 2CE6A 1A1MA 4BFRA 4GAYB 2CJUL 2QELA 3MTXA 2Q7YA 3T0WA 4JFXB 1JGVH 1D7FA 3H53A 2AJVH 4H8WC 4WNQB 3MLWL 5E1HB 1GY2A 1X44A 2BINA 1E5AA 2XKNB 3CFMA 5BS0B 4R7LA 4KZEH 1LD9B 1V3MA 1IEAB 1F3DH 2CGYA 3L1OL 3KNBB 4PGEB 3S7GA 4DO4A 4F8NA 1K6QL 1P5UA 2RBLA 3OR6A 1ZVYA 1GC1H 4FG4A 5C0CA 3UBFA 2JIXD 4OTXH 1TU2B 4R7NB 1BXAA 4R90H 1OEZW 3EOBA 3ZT7A 3G5XB 5LGJA 4PRBA 1EEUA 1R3LA 2C9AA 3VSQA 1RIVL 3L3OA 5D71H 2P46B 5CJBA 4X4XA 3U6RA 5IT2H 4GAJH 4AV5A 4QEGA 4O4YH 5J7CC 5CCKH 4NBYB 3VDCA 3SKUD 2O5NA 2P5WE 5CZXC 1LO2H 2OR7A 1BQSA 2GSIA 3LZPA 3VVWA 2D9CA 4GUOA 1CQYA 2ZWYA 3CFDA 5FGSA 5KSAA 3UDWA 4AKOA 1R3KA 1RIHL 1BZ9B 3L3HB 3GBML 3VI3E 4X6DE 1QQDB 1OTUC 2HRGA 3GJEA 7FABH 4I5BA 1LWJA 4B3VA 1KIUB 3VFTA 4ZJ9A 3OWRA 3TBWB 2FL5B 4FQXD 1TSRA 2V9TA 3ETSA 3PWJB 4IHBA 1PFOA 4JO4L 3Q1SL 4N2KA 2APWA 2A6JA 2MH4A 4RFNB 4YHNB 2WYZA 3ZTCC 4LAQH 1NMBH 4YIQB 3MRHB 4NQQA 4UU9A 4Y4KC 3NA9H 4GI8A 1HYRC 4FE9A 2YS4A 4AIOA 3NESA 4FQXA 2ZWSA 3PHQA 5I6XB 5HSFA 3K0WA 1T3FB 1KJ2A 2DJSA 5D1XB 1JL8A 3APMA 2FSDA 4Z95H 4L29B 5IWLC 3L4TA 4IGBC 2X9XA 1Z1WA 1XCTA 1FFNB 3LQZB 3MJ8B 4QXVA 1G9ML 3HPJA 1E3XA 1HL4A 2KS0A 5GSVB 1PJ9A 4LBEB 3H7BA 3ECQA 1G9EA 4R2GD 2VDOB 1AO7A 3GSVB 3HZVA 5AKRA 4NZRH 2VDLB 1W0YT 2L3BA 2K6YA 3MO1B 2PN5A 3MOQA 3BD5A 2XJKA 4IU2B 4NAMA 4X7TA 1K6QH 1FG2A 4DN4L 3NJGA 2LQRA 3PDDA 4N1EA 2JLLA 2XOTA 3VGBA 3CDGB 4Z3IA 2ZKXA 2FNBA 3A4AA 2N1KA 4PREB 1LK3L 4NNPH 2I5YL 3H9SD 4KK6D 2XY1A 4XPAH 4EI5B 3M1BB 4HQQH 5FYKD 5BRZE 4G1MA 4OGXH 1T1XB 4OZGA 1Q8MA 2X4UB 1JWUB 3HAEA 4JDVB 3V5DB 5IR1A 3QO0A 4ZFOA 4AL8C 3CU7A 1J10A 1KV3A 1VFOA 1F2XK 3FB5A 1LNUA 4BWUA 3MSPA 4S11A 4MS8C 4P5KB 1JNLH 3OAYK 4DGIL 3APDA 4NO5A 3LQZA 4JFZH 5I66A 3TF7C 1AHMA 5BO1H 1U0QA 2EILB 4M29A 3NIGE 5JIHA 3GTTA 1I1YA 2Z4TA 2AK1H 4P4KC 2HJLA 1NGZB 2BIMA 1JVKA 1AOZA 4JQIH 5HI3D 4ICWA 3QXAA 3AROA 4IRJB 3VB8A 1ZK5A 4Y16C 2LOEA 2O5ZL 3TURA 1UT1A 1IARB 2XV6B 4C54A 5IJKA 3CDGA 3HFMH 4OV5B 3M17A 5TK4A 4FYRA 4KI1A 3ARBB 4XPAL 3TTYA 5IM7A 3QORA 1OM3L 3LNFA 3CV5A 3LJ3A 3FO2B 1J8RA 1IGTB 1KENH 4EQ3A 4OCSH 4X4KA 2GBVA 3NZUA 4N8VA 5GRZA 2XTJE 5L7XH 2NY6C 3P54A 4G6FD 4JDZA 1CD9B 4JN2A 1MLBB 1L9OA 3BDXA 2WXLA 5G5DA 2EXYD 3VWJC 5ERWB 3EBIA 5FGRA 3L9EA 3O41B 1NCWH 4N2FA 2ADFL 5DHEA 4GOSA 2E6JA 4EBQL 3PNWB 3B2XA 3OKEB 3L6FA 4CSZA 3WKQA 2VMDA 1GIGH 5DJAA 1GKOA 4O00A 5FOBA 2WTRB 1ZVHA 3P0VH 3T8MA 3KJ4C 1XEUA 4U6HB 1MHEA 5CJOL 1RIUL 4PLKC 3HFFA 5CNHA 4FMFA 2UY7A 3U4BL 1BVNP 4GP4B 5FGBA 3TJEH 2G4EA 1OM3H 1IC7L 3WE1A 3GZOA 4XMPH 2QGEA 2R39A 3IMBA 7TAAA 2AJZB 5K9KA 5AZ2H 3HI6H 3JZ7A 2LFGA 5TDNA 2HLFD 4MJHA 4ZOAA 4D8PA 1MFVA 1BIIB 4P9MH 5E5UB 2ICWJ 3WUWG 1QQDA 2ZP8A 5G5DB 3D39D 1NCWL 1KPUB 5I0ZA 5ERWA 1ETZA 4P46B 1WD9A 2EC9U 5B3NA 3Q48A 1XCQA 4HWZB 3T6VA 3B3BA 1S6NA 5MEQB 1JFQH 2BSEA 1GKEA 2FTAA 3ISYA 5IBTL 1QLRB 4PJIF 1MHPL 3UBXA 3NRFA 5D55A 3FDWA 1PCXA 3MV9E 4CBPA 4HUVA 2JNZA 3K2MC 3OXRB 4TSAL 4XH2A 5D7JC 4QRPB 1ECZA 1E5ZA 2IFFH 3C6SA 5DJCA 4ZXBC 3GEWB 3S34H 2HKHH 2LU3A 4YDKL 1OSZB 3LRSA 5FW8A 5ACZB 3E6FA 5F1OB 3ZBMA 2H1XA 1E28A 1ULVA 1YN7A 2ZXEB 3QDGD 1MH5A 5CIPA 4ZMWA 1LK2B 5KAQG 5ESVA 2H6OA 3DGCR 4HEPG 4OIIH 2YEZA 3ML8A 1GPOH 4X0KB 4GAAA 3HMWL 2K4WA 1YMHB 3W11C 1M1XA 2IAMA 1QRKA 2Y1VA 1VCBC 4MKTA 5D4HA 3US1A 2MOGA 1KF9B 2VDPB 4OZGF 2VDLH 4ZTEA 5T1LB 1OY3B 3G6JA 3K71B 5ITBH 1J1PH 4DKEL 2NLJA 1T7YA 1F86A 2AABH 1BG9A 3ULUH 4KDTC 1JK8B 3KWWB 4X42A 3EDDA 3LPPA 3PGCB 4ELMF 4WI2A 3OGOE 4JREC 5AW3B 4PRPB 1DFXA 3WIHL 1OAYL 3FU3A 3FO0H 5F89B 5KN5A 2YD6A 1XQ4A 4L3CB 2ZP0T 5HYIA 4HZAA 2O6DA 4N2IA 2KPNA 1SQMA 1JTTA 2GSGB 5BQ7B 4DQOH 1IV8A 2NY2C 3KCWA 4PREA 5EORL 2Y7NA 3ZX1A 4ALAC 4DO5A 5B8CB 5AVZB 5DURB 1U8OB 2N1TE 2YIHA 3WTVA 1UD2A 4TQEL 4FP8L 3CIQA 4XAWL 3COOA 4J2XA 3IF1B 4HYTB 3FT2A 2EKSA 5C07E 1DO6A 2XSKA 2F61A 1RJZA 2WIMA 3NJFA 3WY2A 3O45A 1AXSA 4XODA 1EZVX 2CD0A 2FJHB 2FR4A 4JFDE 3NIGB 1HCFX 4KUZH 2NNAA 5IGXH 5J0BA 4M62H 1G0YR 2ADIB 3CVBA 1N12A 5SWZE 3UGUA 3Q6FB 2VE6B 3NACL 1N0LB 3CK0H 4XO3A 3MCLH 1GY1A 4N8CH 2APFA 4YSRA 3QR1A 1AQKH 3ARWA 4I0PC 3GD1C 2HKHL 4P3WA 2FX8L 1PQZB 3SO3C 4IGBB 4GW1B 4Z7NE 1BFOB 3PAUA 4E36A 1BEYH 2VL5B 5IHZA 1NM9A 4IBQA 5D7LE 4X5LA 2Q5BA 4M8QB 3NGBC 2UZYA 4BZ2L 2FLBT 1D7BA 1A3LH 4WTWA 3RVUD 4MA8H 3O2DL 4JFOA 3V4LA 3VI3F 1JZ4A 1G7PA 2HVJA 4Y0GA 1X3DA 2HLAA 5I1GL 3AW5A 5IZ7A 2AERT 3US0A 4BWTA 1CYGA 1VCAA 3HS0A 1TNMA 1MUJA 2A3TA 4PBDA 3QEUA 1GTFA 4ZUTB 2ZP9A 3ULUL 3CFUA 4ZUVB 3EGXA 1UWGL 2XV3A 2ESVE 4QOKB 4XPGL 5EO9A 2Y7SA 4P5TB 1TVBA 1PCSA 5DLLA 3O6ML 3QQDB 4L5FH 3WLBB 3ETTA 4JR9L 4ZOEA 1QHQA 4YHML 1U3HC 3QDHA 4FYQA 4X5QA 3RFRA 2WLLB 3NP4A 2D7OA 2OTWB 1FYHB 4ZTPH 1SF3A 1JZFA 4KFMA 4PJXE 2R2EB 1VB9A 5A2JH 4Y4HC 4KDTA 4U3CA 4R5TA 1KWGA 2W0FB 1CLZL 1QPPA 1DSWA 4X9IA 5ADOL 5E6IA 4ABUA 1BXUA 3K2KA 4LVOB 5JHMA 2PYFA 2LABA 4TV3A 5L88H 1P4LA 3BZFB 2VMJA 4PRHD 1KIRA 2ZX9A 3IXTA 4Y7OC 4P4KA 5DD0L 3WLWC 2C7FA 2NT1A 3HRZB 5AALA 1JYVA 5IMMB 2P80A 3RU8L 1LEIA 3P9LB 4TVPE 1JHTA 4OR1A 3MRMA 3VI3B 5J56B 4YO0A 2VXTH 1VEMA 4WUUE 4R9HA 4L2LA 4R0LB 5ADPH 3QNZB 2HKAA 3LZLA 1CFVH 3RVXC 4KNSA 5E8PB 4D0DB 1XVSA 5F7DB 1EJ8A 3FCUB 1CLOH 1MFDH 3AY4A 3BVWA 2WQVA 2XWRA 3QUKA 3CZSA 2IAND 4HS8L 4XI5C 5IB3B 4LGSB 3GT6A 3QHZH 1A3QA 2MQ3A 3TFKC 5F7EL 1GMEA 4NWTH 1TCRB 5D1ZI 3VFWB 5KBMA 3WE6A 3HNVH 1XGTB 4JAMB 2V17L 3SKMA 4NC0B 4YDLB 2Q0ZX 1IGYA 3N0AA 4PMEA 1CDHA 3GSUB 3S5LB 3ZYJA 1MCFA 4AYSA 4IDLA 3ZK0A 3OZ9H 4NQDD 1G6RA 2HRLA 3FQWA 1EJOH 3MTRA 5LWYH 3AXLA 2DWYA 3VFSB 3DX9B 3RB5A 1I9IH 5JHDB 2J43A 3HRZA 3QJHA 3EBAA 1LQSR 3TX4A 2D0GA 2HG5B 3DX0A 4PVMA 4ZMZA 2OYMA 3AREC 4NHUB 1RK7A 3UJIL 3AM8A 1D5ZB 1D6VH 2QEJA 3BFOA 1DQQA 4N8VG 2CALA 3PWLA 3SBPA 1T7ZA 2C9VA 2CLZA 5EWIH 5C6TH 1YY9C 3WEXB 3E9TA 4K8RD 3SGKA 1VZHA 3VFNA 3KL3A 4PRDA 3K4DA 4POUB 3ARQA 1D7DA 5LVEA 1QWNA 3A0OA 3HUJA 3QAZB 1WA1X 2BX5A 2NTFB 4QGYA 2C7UB 5C0IA 2H0FA 5AB1A 2BVOA 2BH0A 4G1EB 4IOSA 3RFZB 3KL5A 4P2OB 4IRZA 5DZLA 2XQYG 4XN1A 3T2NL 4AMWA 2R0ZL 4P23B 1I4FA 3NCBB 3GSNA 4MD0B 1CCZA 4IS6B 1RPUA 2CHNA 3LY6A 4H4NA 4WWID 1L0PA 5A2LH 4NKMA 2UWEA 5EU7E 2NR6D 3GHBH 2BZCA 4JZOA 4WW2C 4U3SA 5HHMD 1UEYA 1XCXA 3MBED 3LEXA 4QCIB 4OD3H 4X9HA 2YWYA 2R23A 3I6GA 1AHWB 3A6CL 4NZTH 1CPUA 1IBGH 2IO5A 1A7NH 1G9HA 4YHNA 1SXAA 3QQ3B 1BFOA 4NN7C 4ZFOL 4FTVD 2BPBA 3JWOH 3RTQB 3VXUE 4YFEA 4PSPA 2YPLE 3ARBD 1BPVA 1IC4H 3NIFB 1AFVL 4FJYA 1FVDB 1S9VA 1KT2B 2BVYA 1CLOL 3CGTA 3GMMA 2VDRH 3MCKB 1OGAD 2X3CA 1JCVA 3MI6A 4PJGA 4QRAA 1KJ3H 2Q76B 3BH8B 3FH5A 3UAEA 5EZIH 3STBA 4DK6A 3L3HA 3HR5B 2X0WA 5F7EH 3ZSSA 3BZEB 1URZA 2Z34A 2ZSWA 4PJXB 2P8PA 5BZDB 2N7AA 4V33A 5BV7H 1LO0L 4A2EA 5I8OL 3ZE1B 2V5SA 4NC1E 4HIPA 4OIAA 3NP3A 1QLEB 3Q0HA 4ZTOH 4DSYA 2L7UA 4M5YH 3QZBA 3ILQD 2COVD 2P52A 3U46A 3IDYB 5FO7A 5C0DB 3UAJD 3VXPB 1QTPA 4AQ1C 2Y7QB 3A6CH 3FUEA 2NDGA 3QRBA 3QJUB 3EYVB 3B9KA 3RI5F 3O2VL 4KZDH 3BFQG 4KXZH 4DZ8B 1NUNB 2FEEL 5E1AA 4FJ6A 3JSSA 3REWB 3ATAA 4G7SB 1J8HE 3ABLB 3BO8A 1YUHB 1DBKL 2CAKA 3QXWA 3FS9A 1NEPA 2DWDA 4WGKA 3BMVA 3C8DA 4MJIE 3UYPB 4XN7A 2Y25A 5EOQL 3EDKA 3V0AC 2BVQA 2I9LB 4X6CE 3ULAB 3HZMB 1JWMA 5DCCA 4AITA 1H3UA 1KTDA 1O7SA 4YHLL 4Z5RB 1L9SA 5T1DL 2Q86A 1KOAA 2X1WL 4WKZA 3EHBC 4YGAB 3D06A 4NCDA 4IMLB 3NSDA 1JV5B 4N2EA 1UWYA 4S1DC 5J12B 1RAMA 5HI4D 2ZOOA 4KRPC 3FRUB 5IFJB 4Z0BH 5E1IA 3S88H 2UUDH 4KI5F 4PJAA 4A2GA 2P8MB 3UZEA 3BIKB 3C08H 3HEIB 4PJEB 4ODVH 1BF8A 4NB7A 4WHCA 2KH2B 1IAII 4FJZA 4YXLL 2IDFA 2XN9D 3MXWH 1BXVA 3SGJA 3LH2L 1ASPA 2CA4A 1BCIA 4EN3A 3VXME 3OD3A 3TEUA 2B59A 3FKUS 4N4YB 4I18B 4HIXH 3RX7A 4XN2A 1CXLA 3BPCA 1RP9A 2W9LA 2BC4A 5JW3H 5IKCB 4YHZH 4LLQA 3E8UL 3RWHA 4XZ4A 3MVSA 1TYRA 5IB2A 1OAZH 5I74C 3UMTA 4YHLH 1MVFA 5INCB 1NGQL 3BAYA 2OXGA 2LLGA 3G08B 3GMNB 1CD0A 2JELL 4JG0H 3ZO9A 3F85A 3D30A 2CDGB 3LZNA 2I26N 5TE4L 2FBJH 3VWKD 4JFPB 4FG6D 1JXFA 4FXGB 2V9QA 4QHKJ 3MUJA 1H6EA 1FHNA 3QGVA 4GEJA 3Q1SH 2ZONA 5F0MB 4WAFA 1NGXB 1GOGA 3BVDB 2C5DC 1X9RA 3GXDA 3KPLA 5DUPH 3SDAA 5K9OA 4OTXL 4LCVA 2R29A 1DJGA 1HL9A 1BZQK 1QFOA 3VGEA 5D1ZA 1TSHA 3ORJA 1GH7A 2V37A 3BPCB 4P2RD 3ZYIA 1K3ZA 5C7XH 3KBHE 3VCLB 2VLLA 3I6SA 2HJFA 1DP0A 3BGFB 2QFPA 2PMZA 3V4UL 4DP4X 4ZFGH 1P69B 1J9TA 1QSEE 3MGAA 4M7LH 4K8RH 3H9HB 1FL5A 3OKEA 1XEDA 3WEOA 3UJTL 5DJAB 2AXFA 4YEFA 5HD8D 2Y6TE 1PG7W 3GBMH 1R5IB 1U8NB 2GJPA 1SXSA 3FW6A 4KGLA 4PGBA 3FUKA 1HZHL 1D6EB 1W16A 5I6LA 3MV9B 3BWAA 1J9SA 1YEJH 4WFED 3H56A 4JO1L 1IAOB 4QJ3B 2JLPA 4XPHL 1F42A 1UD4A 2V2XA 1A8JH 2RD0A 3IJEA 3RWDA 4HOZA 4YDLC 3L3GA 3GINA 5CJQH 1I3RB 4OZFA 5E7FA 5KTEH 3D1MC 4WJG3 1NFIA 2GCYB 1PYWA 4YBHA 3R7RA 1BSIA 2NDFA 4L3FA 2E9JA 3OAYH 3LOWA 4B27A 1A1OB 1RIVH 2BIHA 1ZDQA 2QFRA 1ZS8B 3FFCA 4P9ML 2Y06L 3FH7A 4ANUA 2BOBA 4NO2B 1S7WB 4U3XA 1JNHB 5DTFA 4Z7WB 5LXVA 1Z9NA 1P84K 4NUMA 1DN0A 1Q4NX 3QEQB 4R8WH 2FX9L 1IFHH 3GIZL 3C2AH 3BWAB 3D6GA 4DEWA 3EADA 5CGBA 4I3SH 3EDJA 5IW6B 5EORH 3FF8A 1GXEA 1EZSA 4WFGE 1KTBA 5ICYA 5GJSH 2B3RA 5BZXA 1CBVL 2A9CA 5I1AB 4M3JA 4H25B 1CLVA 1WZAA 3ARTA 1A3RL 1JTPA 2EO9A 3DYOA 4EUPA 3CLFL 3CZFB 4WW2B 2EQDA 4GMSH 4RGNB 2P4AB 3C5JB 1T04A 2FEDC 1MCPH 2EACA 2X4TB 2XG5B 3H55A 4KQ4L 4NN5C 1ZEAH 3B2VH 3LKRB 4IRSC 1IBFA 3MJ9A 1SDAB 4PRHB 1S7TA 4TL4A 3RAJH 1HILB 4M7LL 5E6ZA 3K5SA 1O6TA 2FGZA 1MW3A 3VXMA 5TQ0L 3DARA 1HS6A 3D09A 2EO7A 1FH5L 2X7LB 2P44B 5C8JA 5CD3A 1R17A 4FQPA 1IC0A 4PTUB 3O3AA 4FA8A 1TDQA 5BS0D 5J1AB 4OAWA 1QLFA 3C5ZA 1S9KC 4IOFD 3A47A 2J7LA 1T3FA 3N1MC 5FF6B 1ETA1 4GSRA 2UZYB 4M02A 5C0JA 4GSQA 3IAGC 2HKFL 3BJLA 4GY4A 1XSKA 2CO7A 2ED7A 3QCTL 4JCLA 4FHKA 1A9EB 5AWNH 2AS5M 5K33A 1NGYB 1W0WB 4X99B 3ZMNA 2APVA 1P53A 3OKOB 3QJFB 4OCSL 3OVUB 4FQJL 3L9BA 3ZE0E 2GK0A 3HZVB 1U8HA 1S7SA 4PWFA 5K9QG 4FEIA 4XT1C 2BNUA 2W60A 3OGCB 2DH2A 2QKIB 4HUMB 2EDOA 3JVFC 3WNIA 1C12B 4EZMA 5T3ZL 4YSTA 1KBKA 2AKRB 1AIFB 3CJJA 1NPJA 4NZFA 3O6MH 3OLDA 1TZIB 1YUKB 5KVEL 1K4CB 5A7BA 4JFZL 3X14B 1F90L 4UQDA 3DSFL 2ZOLA 5DZ9A 3VI4E 5LXGH 3LXUX 3SYOA 4YNYA 4J3OD 4JR9H 4NM4H 2VQUA 1T1WA 2AJUH 2WLYA 4L1SA 4YXHH 4G6KH 2O93L 2D31B 1F4YH 1D2PA 1HXYA 4HWBL 4MJIA 3CZUB 2V9RA 3MV8E 4W4NA 1EJFA 1GGTA 2DQ6A 2YR3A 5I1CL 1UASA 1NH6A 1DEEB 1UACH 4HEMA 3ARRA 4JVWA 4KO7A 3SPJA 2VDQL 1X7QA 4HXBH 1B4TA 1NCTA 4FQJH 2A6DA 4G5ZH 1JXJA 2F7RA 1F1AA 4UB0H 3WY4A 2NXZD 3NFNB 1K5NA 5IHBA 4GW5B 4OLYL 3LVEA 3KYMA 1IGJB 2WQRA 5D1XD 4GI9A 3WJJA 1AR1B 4JN1H 3MBEB 1BYOA 1DFBH 3WFHA 2PPFA 2E9GA 5BO0D 3WCYA 1TXKA 2KZ1B 2UXTA 3S3DB 1TJMA 4FTVB 5A2AA 1ASOA 4UDUA 5IJBC 5LQBL 3DV4A 4RX4A 5CN2A 4AZ8B 5FA3B 1NKOA 3O8XD 2OSYA 3DDFA 5AAWA 1KC5H 1KACB 1SYVB 3OHXA 4N1CA 4KKPA 5AEAA 3SDAC 3FNKA 4F7CB 2OMTA 5LDSA 2HX7A 4X9FA 2C3WA 4PGCA 1RK1A 3UXFA 5KSBA 4Y2NA 2QPEB 2DKSA 3BCDA 3MRIB 2WQXA 1R33A 2HMID 3BPNB 1TYEB 1PG7X 3DK0A 4L37B 1E9OA 4UM9A 1UA3A 2B3IA 3U6XA 4FLQA 4HJ0C 1NAMB 1JHTB 3IETA 1NMAL 3VI3A 5DU7A 4NQEE 5ITBL 5CKAA 1N59A 1PLGL 4O02H 3GSRB 4PJDA 5F7UA 2NX5D 3MKKA 5I1GH 4A2FA 2VZ1A 2W0KA 1OSEA 1FDLH 1VDGA 4WHTA 1D5ZA 3TJHD 5K1JA 2OMUA 5HYJA 3WFHB 1IQDB 3QG7H 3PXHA 1JUFA 3WEXA 5BV7C 2QSTA 4N25A 4ZNEE 1F90H 4NOFA 4ATTA 4XN9A 1MCOH 4R7VA 2NTSP 2Y36H 3KJ6H 5CUSH 2AJ3A 1UXMA 4QWWC 2FX8H 3HVDA 1NFDF 3KLAA 3QEGL 2PYEA 4Q56A 3L5IA 1A6WL 3U36B 5CAYB 4YOKA 4OJYA 1DANT 1MFDL 4GEIA 4PP2B 4Y8DC 4QNPE 1LO5B 3JWDH 4WUKL 1IE4A 1KXVC 1SJMA 4ZX4A 2YPLB 1UADC 3OQRA 1XGPB 3DECA 4N0UA 4H0LC 3LZFL 4UQ9A 5I0VA 3DJSA 4P2QA 2H26B 2NY0D 4Y1TA 4FZ8L 3C6LC 4NDMB 1X4ZA 1ZVNA 1TTRA 1CE6B 1WJ3A 3LS4L 4K71C 4X6CA 4FAAB 1WWCA 4OM1H 2X6UA 5FYKE 3AACA 4LLMB 2Q7AA 3PDOB 3MBWA 3ZE2B 3W1ZA 3ZDWA 2ZNXA 4ECNA 5BMFL 3QIWB 1ZT7A 2YBRA 4R3SB 1BOYA 3DYMA 1RUAH 3W56A 2QGCA 3ZKNC 3BH9B 3GMRB 5A2BA 4P99A 2P80D 1X5AA 5H94B 2P9RA 2AJ3B 3FN0L 3LIUA 5J9PB 1NANI 4Y19A 3EDFA 1A1MB 1A6WH 3LQAC 4GSUA 3AXIA 4JL1A 4LKCA 5D1QD 5FYJH 5H8DA 5MI0B 4KKBC 4DQOL 2XNAA 4JZJB 5D7IA 1YAZA 4M7JH 2CR3A 5MERA 4UV7L 4AE0A 1KLGA 2FJGA 1S7SB 1BQKA 2WWMD 3I3BA 3N44B 3AU1A 1OT4A 3O9WA 4XXDA 3OAZK 3X13B 4Q2ZB 2YAQA 3P77A 5DD5H 3D0VA 3I02A 5I8OH 1R5VB 1YN6A 5FYJD 1INEH 1J86A 4DVRL 1RURL 5JIIA 4L0YA 2K4AA 3IMSA 5E2VH 4DEPB 4D0BB 3LN4B 5DD0H 5HHXH 1TTCA 3N41B 4PR5A 4CADB 5GRYA 2EC9T 3IXAA 2IDTA 3AT0A 1AS7A 4KKLD 3O4LA 3IFPA 3T3ME 4LSSH 4GRMA 4U7SA 3WTWA 1G4RA 4I7ZC 1A4KA 4WY7H 2QGDA 2X42A 4UIKL 4AE1A 4U1HA 4CVZB 5CMAA 5LBVA 2GIYA 4XCYB 2EVJA 2QZQA 2RAMA 2R1YA 2YPVA 3WL9A 5JIDA 2V2TB 4TNVK 3BVUA 5KWYC 1CGXA 2BY0A 3TBYA 3LNIA 3BZEA 4OLXH 3W9EA 1ZIBA 4XPBH 3CDFA 5EC1A 2HG0A 2XWXA 3TH2T 1CE1L 3IGAA 3QAQA 3OV6A 5SX4H 1EBAA 3VAEA 1UM4H 5GPRA 2V7NB 4OLVL 1INDL 2P24A 5E2VL 5C0BE 1YN6B 2ZKMX 4YDIH 4JREB 3VWKA 4MX7B 3KPPA 3OKMA 3S3BB 3O3DB 4FERA 1YECH 2OBGA 4YSPA 4LRIC 1TFHA 3V2AR 5HDRA 1MFBL 3R8QA 1SVZA 5C07D 2OL3A 2DB8A 1QPKA 2ZE0A 1E0OB 3BSZH 5AOKA 3VH8B 4U1HB 3L95B 3UC0H 1K4DB 2IQ9H 4P2RA 3SBWA 5EV7A 4OFQA 5KVDH 2OMWB 3BDBA 4HGWB 3C8KA 1BZOA 4TUUA 4U4IA 1LDPL 1KCSH 1X9QA 1RK0B 1ZLVK 5FB8B 1KXTB 4HHAA 3QEHA 3FPYA 1T83C 2W92A 3LN9A 4AQZA 3PP3H 4Z7VF 3SPCA 2BSBA 3P4MB 4KX9A 1YEDA 2DQCH 2A9NL 3HC0A 1WAAA 3RUGA 4L3EE 2DS4A 4NO0B 1UXWB 4FQIL 1ITBB 5D2NA 3ZL4L 4OM0L 1HDMB 5FKPA 4OQ1A 1MN4A 3GMQA 3GZPA 3WEAA 1M9SA 3L5WA 1OP4A 4XNYH 2FGWH 3QE5A 3PL6D 5C6WH 2XKNA 3AMLA 2H2SC 4AQ8C 5IESL 1KBWA 1P1ZA 5CZVL 2A0LC 5F9WB 4UIMB 5KG9B 4Q8BA 3RBSA 3K6IA 3ISWA 4WHYG 4UTBL 1NPNA 1XB8A 4FL4B 3D85A 4Y19D 3U2IA 4TOYL 5F9OL 1QBMH 2IQAA 3NGBB 3VFOA 1FYTA 2CK2A 5GGRA 5IF0B 5FWRA 1KZQA 4XVTL 4F91B 2J71A 4XCNA 4R5XA 1FNEB 5AG9A 3NABH 4IDJL 3KLHD 1R3LB 1F58L 2GQHA 2QZ5A 4TUOB 1FL5B 4RFOH 3BWSA 1HEJC 1OGPA 2R29L 4N2CA 4F9LA 4K8RL 1JPSH 3OG4B 2Z91B 3V7AE 3CNKA 1O5DT 5LG1A 2X5PA 1I8IA 2FQEA 4ZTOL 1MEXH 2CKBH 3KVPA 1NDGA 3MLZH 3V4PH 2MCPL 4RFEA 5JPNB 3QNZA 3BP7A 3HZKA 2BY1A 5MI0C 4HVBA 3GRWA 1MY7A 2F18A 1AZNA 4QF1A 5D5ME 1BIHA 3MA9L 4ZK8A 4PS4H 3SDAB 2BP5M 3TIEB 7FABL 1P7KB 3FQXA 3O6LL 5IW3A 4BCZA 1QBLL 2AQNA 1P1ZB 1R5WA 4B5EA 4BFKA 4Z0BL 1MCSA 1BWWA 3NJXA 3TTSA 5SV4A 2FAUA 4LSTH 4X5XA 1VEOA 4JG5A 1SUJA 4JN2B 1WFJA 3ULUD 1DBKH 1EVTC 3UTQA