5DZ9A

Streptococcus agalactiae agi/ii polypeptide bspa c-terminal domain (mut)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
b'VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BspA
publication title Structural and Functional Analysis of Cell Wall-anchored Polypeptide Adhesin BspA in Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae serotype iii (strain nem316)
molecule tags Cell adhesion
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dz9A02
2WZAA 2Y1VA 3QDHA 2OKMA 3V10A 4IGBD 3PG2A 5DZAA 3HTLX 2F68X 4HSQA 3KPTA 4OFQA 4P0DA 3RPKA 2X9YA 2WQSA 1AMXA 4IGBC 3UXFA 2XTLA 2X9XA 2F6AA 2WOYA 2X9WA 4Z1PA 3QE5A 5DZ9A 3PF2A 3HR6A 3OPUA 4UZGA 2X9ZA 4IGBB 4Z23A 2Z1PA 4IGBA 3RKPA
chains in the Genus database with same CATH superfamily
2G0KA 4GKLA 4GJTB 4JO2H 5C97A 3TT3L 1ADWA 3CHQA 4JO5A 3H42H 4P5SA 4QRRB 1KACB 3V6FB 2WUBH 2H1PH 3MRLA 1K85A 5GGVH 4X4MA 1IMHC 2A1WH 5IT2H 5INCB 4YZWA 5A16A 3B5TA 2IV8A 4U6TA 3V4LA 2ID5A 3GI8H 1UD2A 4AKQA 1SJHA 3IGAB 5SV4A 5L2KA 4QHUA 4UT9A 2VZ3A 4PJ7A 3AITA 1B0RA 3EDFA 4G42B 2Z7UA 4TUOB 5I82A 5DYFA 5E1QA 1WFUA 1RD6A 2ARJA 3QYMA 1I7UB 4KUCF 2X7LB 3MCKB 1HIML 5HYJA 5EBMA 5C0CB 3RL2A 2E9IA 2X2JA 3GSUA 3JWOL 5D7LE 3GJFA 3MJ6A 5SX5K 2FYYA 5I0YA 2FSEA 2EJ1A 4AGMA 2VT0A 4ATWA 5C9JB 4R0LC 2QGBA 3P4OB 3UZQB 1PAZA 3U30B 3HBGA 4LVHB 4YIQB 1QWUA 3EBHA 3GPEA 4HEMA 5CS7A 3SDAD 1MCWM 1MVYA 4PLJC 3T6QC 3NSFA 1TJMA 5KBKA 1NFDA 4JDVB 3VXQB 3QORB 1CFTA 3ZL4H 2WNWA 3WLWD 5GS1B 3MACL 1N8ZA 2WZ6A 4LLUB 1S7VA 1UOLA 3RWHA 2XN9A 5J13C 4ZTPH 2DWSA 4G6JL 3FFCE 3D2UA 2DN7A 3T8XB 4QXTB 4Z0BL 5J5EA 1QBBA 2K1MA 3QNXA 4X6BA 4N3TA 1OM3H 1E9PA 4QRFA 2TSBA 4NKDA 4Z7VF 1KCVL 1NCBH 5KVEE 3WY2A 1X5XA 3QCVL 2WOBA 4HBCL 4OCYL 5D4QA 3IFLH 4NLAA 5LGJB 1EHXA 4N90E 2VE6A 3FFOA 2VZTA 4R26H 1KY7A 3IU4L 3L1OH 1BXVA 5IFJA 2VLLB 5DGRA 4G1EB 3QEHB 3VFTA 3WSQL 1PKOA 5I73C 3QUXC 1U8QA 2EDMA 2Z3FA 2YAFA 2Z31C 3WS6C 3U4EB 1QHOA 3OQRA 3D52A 2PW2A 5HVHC 1ULVA 2QV2A 5TH2B 2BNRB 4YGVB 3G5XA 2A9BA 4P4RB 2KDGA 3PP3K 4L3CB 1GC1C 2K4AA 4MNQB 5ELIA 3BAIA 2HA1A 1KB9J 4C4KO 2XTJD 3QFJB 4GAJH 4P46A 2H26B 4ZFQA 5A7EA 1T2QH 3SKUD 2FJHA 2NLJB 7FABL 1U4FA 2BJML 2WZAA 5JA8B 3VXME 4KKBC 1P4LA 5AKVA 1BQ5A 4PGBB 3RWDA 3NJGA 5IQNA 2VLKD 4WW2A 4HMCA 2W94A 1E65A 1TZOA 3PQYA 1JZ6A 3MRKB 7CGTA 4GQRA 3MUGA 5L6YH 4Q97A 3B2PA 4OUUA 2Y6TE 4QNPE 3BUPA 4Z7NF 3K46A 4K9EH 3WFZA 2IDQA 4KY1L 4XOAA 3QGVA 2XPYA 4HJGB 1LHZA 1NOLA 4TSBH 4M48H 3KR3L 2IANE 3KCPA 4XCCL 4L3EA 5C3TA 2OP4L 3NVQA 4E5XG 4Q9QH 3D39A 2RAMA 4HK3N 4Y19D 5A2CA 5DO2C 3RGVB 3VD1A 4QOKD 3N1MC 5IVXE 2PO6A 5TPWH 2CGYA 1PTZA 2QFRA 3MNWB 1QBLH 3AY2A 3OAZH 5FX3A 2K3TA 3V4PL 3LKPB 2DQTL 3KWVA 3P0GB 5AZEL 3C6LD 4KOCA 2ITEA 1HI6B 4HGKC 4KUCD 1C5CH 2DD8L 1AACA 1GZHC 2B16A 4YE4H 4JRYA 3LPOA 4IOFC 3V9EA 4UDTA 5IB1B 1RP8A 3ULVE 3E3QE 3HI1A 4RBPH 3MGAA 1H5BB 3G5ZA 3EH1A 3UIYA 4HJEA 3Q8BA 5AOKA 5LUMA 1FCGA 3LHAA 2LW3A 3AS1A 1AGCB 3DMMC 3PHQB 2XZCL 2C1OB 2ZXWB 3K2KA 1H0DB 4N8VB 4OKVA 4Y5YC 5D1XE 1OWRM 5I8CA 5KVMC 1L9MA 2CO4A 2ZUXA 2X88A 2P3YA 4IBYA 4HIIA 1IE4A 3ECWA 4RISH 4YK4B 3I84A 3WTVA 1QHQA 3K7UA 4GRWB 4YXHL 3P0YL 5ERWA 2QSTA 5JXEC 2J4WH 4TPRH 1OARH 4I18A 3A24A 3MBXH 2A74A 1GZQB 1BVLB 1WCBB 5IKCA 4PMEA 4OQTL 1CIUA 4Z8FL 1AKJA 1KC5H 3RPKA 2YBRB 4OZIA 3EJJX 1CGXA 4APXA 2DYPB 3Q8CA 1NCTA 4Y4HD 3GUFA 4HGMA 2CO3A 1O7DE 4ORGA 5H37A 1EGJH 4JAMB 3UP6A 3WKNA 4OSUL 2AJVL 1CYGA 3E9UA 1NDGA 3RWGB 4KUZH 5E2WH 1XVSA 2KUTA 2WYHA 3IDNA 3QNZA 1O5PA 1U6AL 1F0LA 3APFA 5GGQL 2JKSA 2EH8L 1JERA 4CRPA 4LBAA 1YPZB 1Q94A 3GO1L 4BKLA 3D3VD 2GY5A 3GSNA 1LO4H 3ZJAA 2BWQA 3LTVA 2B0SH 3CWGA 3BKMH 1QLEL 2RBLA 1T3FA 3FB8A 3CBRA 5E1AB 4ODWA 4NO2B 4FKEA 1FZMA 4BZ2H 2JCCA 2JCWA 4MXVE 2KZWA 2VOTA 3SO5A 2QJDA 2XIBA 3UTPE 4XMXA 2ZSWA 4NEHB 1NUNB 1DBJL 1Z6JT 4JG0H 4RRPA 4M6OL 4X7DC 5FKAA 5CINH 3QQ3A 5TF1H 4NXSA 1HKLL 3L48A 4WI7A 3T0EE 1MRCL 1ZT4B 3UAAA 2KERA 2JXMA 4BZ1H 2NW2A 5D7JC 1ZTMA 2FL5A 1P7HL 1HZKA 2WINB 1WZLA 5F8QC 2FAUA 4B41A 5KYWB 2PR4H 4OCLC 3KPNB 2OQJB 3MJ7A 5DMIH 1EFQA 3BQUC 1IAKB 1WVZA 1LE5B 2OMBA 4DAGL 4EIZC 4NWUL 2WVTA 2IPUG 3SGEH 3WIFB 1XZ0B 4JE4B 5JUEH 4NBXB 4MLSA 4P9HC 5LBVA 4QT5A 4GRWH 1N5AB 5C0AE 2FT7A 1O5DT 1JG9A 3CDZA 2BOCB 3JBG7 3H9SB 4NQUA 2LQRA 3D08A 2EUVA 2ARJQ 2JKJA 2E46A 1ZA3B 3PHOA 1GIGH 3PWJB 5EV7A 4ZOEA 2D0FA 1HFUA 4KH9A 1G7MA 4DPCX 1RULH 2EUZA 1X7QB 4J2XA 3RY4A 5EZOH 1ZANL 4A6YL 4U1GB 3ML9A 3U6RB 2CM5A 3OKNB 4NNPH 3WE6A 5INDA 3VWKD 1SBSL 5M95B 3NCCB 1PX8A 3MUUA 1NBCA 1NBQA 4KK5D 4BK8A 1JVLA 4GIAA 4YDMA 3ZE1B 4ZBJA 1FORL 1J9CT 5FYLD 3U7AA 1VKXB 4AXWB 4ODVH 3TBTA 3GXMA 2QKSA 5IIEB 3R8BB 2DOCA 4K5NA 3WFHB 2LFGA 2ZT9C 1I9JL 3KW7A 5D2LA 2XI9A 5C6TH 5ALCH 1FN4B 4J6IA 4Z7UA 4N6RB 3RU8L 1SHSA 1W0YT 2O4EA 1XH0A 4G9DB 4OM1L 1QPXA 3HRZC 3IDGA 3MNVA 4M93C 5HDQH 1VF5C 2VCOA 4N1CA 3TOPA 3MX0A 3PY9A 3L7EB 3DSNA 1LO3H 4NDMB 3T3MF 2Q7AA 3BWAB 3OZLA 2X1PA 5SX4H 3LN9A 3AG2B 5DHEA 3T08A 1KPUB 3NSXA 1SN2A 4F24A 1V3LA 3BH9A 3ISYA 2EXWD 3V0WH 3WUWG 4PIRF 4AJYV 4ZO8A 1AXIB 1QRNA 4XI5C 5F8RC 2ICEA 1CCZA 1K9TA 3WO4B 1NLDL 5D2NA 3UZVA 1P53A 3J2PA 4PLKC 2EVFA 5GGRB 1T1YA 4JB9H 1TVHB 1IZKA 2DRUA 3NCMA 2ZXAA 2GAZB 1M9WA 3GB7B 3QPXL 1XH3B 5HHQB 3HS0C 1QX1A 3MYJB 1HS6A 1PAMA 4LARL 2VGLM 3VFGH 4ESKA 4FFZL 5E4OA 2FBJH 2WKOF 3DBXA 2AK4E 3IN0A 4ATTA 1KNOB 5AW1B 4YHMH 4ZTEA 4PJAA 4YZFF 5AUMB 4IW4C 1F4YL 2WBJD 2UXVA 2BNQB 1UD6A 2GJZB 5KW9H 2QQNL 3MV8B 1IGJB 4H1LB 5FK9A 3KEHA 5HVFB 4IGBB 4NN6C 4Y8AA 5FFLA 4D9RE 2P5EA 1BECA 3S37H 1PSKH 1UKQA 1AZBA 4LGPB 3ZN6A 1WAAA 4FMFA 3O11A 3MNZB 3Q6FA 1QZ1A 2VUYA 4KHTL 1U8LA 3EGSB 1LNUB 4X5QA 2JKNA 1CD1B 1VJSA 4DP5X 5SWZB 3T0XA 1SN0A 5C0GB 1TQTA 3ALWA 2N1KA 1AKPA 4WI3A 2X70A 4L0ZA 3ZDXF 1E8WA 3NIGF 3MRBB 2H3NB 3CNKA 4ADIA 5I15H 1U2YA 2D8KA 2F19H 4MHHI 5MENE 1JHTA 3M7FB 4OLWL 4J3OF 3AT8A 4C56D 4JFSA 4R9HA 1V27A 3NZ8B 3THML 2W92A 4FMVA 3D4YA 1CLVA 1XMWA 2MKWA 5D6DC 1T89C 5K39B 4AEIL 5HYIA 4UQ2B 4JZJC 2CKNA 5KSBB 5DWUH 5FYKH 4R7NA 3SOBH 4F2MA 3CH8A 2VR7A 5I6LA 3RFZB 2W07B 3VE0B 3HG2A 4DPAX 1LP9A 3IJSA 3L1FA 3BP7A 5C08D 2XTJE 2VO8A 3K2MC 4KJWD 4XNZB 4PG9A 5ISZE 5I1IL 3OKEB 4TTGA 5FYKU 3O2DH 4MA7H 3R06B 5E9DE 3GSQB 4G6MH 4ELKB 4FQ2L 4N5UA 3W9EA 4G83A 4NP4L 4OGQC 3V0VB 1PDKB 5BRZB 4UTBA 5JHLA 4LLMB 3KPOB 4XNQA 5E8OA 4D0DB 3DVGA 1D9KD 4TQHA 1NMAH 3ZE0F 2ORBH 4K7FB 2YRBA 4PS7A 4FA8A 4WO0A 2B3IA 2Z8VC 4P2YA 4LKXA 2UYLB 35C8H 5DC9B 3VYPA 3VI4B 3X17A 3OVUB 1AGEB 4OGXL 1Z3RA 2ZCLH 2ZCHL 2CCWA 4NRZA 3BVNB 1NEUA 2TRHA 4EQ3A 1CFQB 4XVTL 4YDIH 3RTQA 3TN0D 3BVWA 1OL0A 3B8YA 1PCXA 3BX7C 1SZNA 3NEXA 5HGAB 1U95B 1ZGLM 1NEZA 1ZE3H 3I9AA 5AYTA 3S2CA 3OJDB 3H9YA 4WWKC 3MJ8A 1Z5HA 4FFVD 1JYNA 3D87B 3K0WA 4PRAA 2WPGA 4Y19E 1TR7A 4QAMB 4QOKE 3V10A 5F7DA 4H1LH 3GEWB 2AZUA 3SB3A 3SE4A 2VZVA 5F7FA 3I75A 2ADFL 4M1GH 3RVWC 1E5AA 3MLZL 2Y24A 4NQXA 4UYPA 5DJZB 3GS7A 4RFOH 5EC2B 4MJID 4NZUL 3ZGIA 3HLAA 3LZOA 2O5YL 4HEPG 4Q0XH 3GRWH 1JTTA 3O45A 2ZUYA 3GSWA 2CAKA 3VQ1C 3QCTH 5CSGA 3ULVC 5KUMA 3E3QC 5DK3A 3CN2A 4M7JH 3QEGH 4LSPH 5DURD 2APXA 4XAWH 5CJOH 4DIXA 4XVSL 3C5ZA 2ED9A 2P80D 1QPKA 5LCVA 1XB8A 1B2WH 4HD9A 2VLME 4XP1L 2NUPA 3CN1A 4KTDH 3HJEA 2WLYA 4JDTL 2WXHA 1MWAL 4I5BB 3V6ZB 1FP5A 4FYRA 1JPTH 1A3RL 3I02A 3SKNB 1L0QA 4GI9A 3LRGA 5C07A 3FO2B 1TQWA 2V33A 4L8SC 1RUKL 1BDYA 4Z7VE 1OAZH 4RGMC 3ARWA 3MLYH 1R5WB 2WLLA 3QUKB 1GKOA 1ED3B 2VXQL 1T0OA 4QTIH 1IBGH 3O3UN 3GJFK 4P05A 2F1BA 3JWDL 5CCHE 4PJ6A 3PJSB 1QHPA 2AJZA 1O7DC 4IK7A 1M7IA 1W72L 3ROOB 4FC3E 4JO3H 4OD2A 3JYCA 1D5MA 4ES8A 2QDWA 3DETC 4IRZA 5I6PA 3L5HA 2CDFB 2IV9A 2XJLA 3JV6A 3QQDB 4GMSH 1S7TA 4N20A 2OL3A 2R0KL 4WGVB 4XMPL 1Q9OA 4LCIL 2WP3O 5JMRA 1HXMB 1GMIA 4RESB 2MHAA 4DP9X 4MXQD 2ADYA 4PGCB 1JUFA 5J13B 4WTWA 2DTML 1DUYA 1IAOB 5IBLD 2FEEI 4XTRC 2HJLA 2WXOA 4KKAD 1RSYA 2AV7B 4MD4A 2LT9A 4R83A 4E42B 3NK4A 3Q2CA 4MKMA 4X2UA 5J12C 2KS0A 1JXGA 4M9OA 3IAPA 3MXVH 4HU8A 1QSZA 3MJGX 4PGDB 4LLQB 4E0RB 1M7XA 1D5ZB 1IC4H 5KG9A 3LRHA 1P2CA 3HI5L 3BKCL 2HVJB 2YAHA 4BCZA 1HH6A 4OZGB 3T0EC 2NNXA 3ZDZB 3P2DA 5K9KB 2VERA 1L9PA 4Z7NE 4KVNL 5I73B 2EE2A 3QUXB 1GGCL 2SEBB 3BD5A 3NACH 4RWYH 2Z31B 5HI5D 4ZFFA 3SGDI 3WOVA 2KH2B 1A2YA 1KWKA 2F8VA 4I4WB 5HVHB 3FO1A 5EA0L 3PPEA 1V10A 1DDHB 1EO8H 5DO8A 1F58H 1NWPA 2CJ3A 2CM6A 2PYED 5HHXH 5TE7L 1FI8C 1F97A 2OMVA 4UT9L 3V0DA 5EU6A 2XTSA 1QFPA 3MRJA 4JJ5B 5C3LD 3CLFL 1W8OA 1GGUA 2PW1A 2G2RA 3H3KA 4N5ED 5GZNC 2EUWA 4Y2DC 1HEHC 1KGCD 3FB7A 3D85A 3NCWA 2BDNH 4UOW0 4RLDA 1KIUB 1AQMA 5JW3L 2XIDA 3EFDL 3KNBA 4HWBL 3V4VA 4X42A 3VVVA 1JNNH 1KN4H 2OFQA 3LN5B 1N4XL 1NC2A 4PJFF 4YXKL 1YY8B 2LE9A 1TQCC 5CNHA 1MHHB 1KIQB 2IDTA 3DGCR 3EGXB 3QR2A 3CSYB 1CZ8L 3ZT6A 5C70A 1RLBA 3ZYZA 4HJ1A 2C3VA 3P3UA 2OTUA 3DHJA 1MCDA 1CICA 4B9IA 3JUZA 2YUWA 1BOYA 4MD5A 5E51A 4L18A 3CIQA 4YQXH 4BGLA 5C2BL 1OWWA 4F57L 3SPVB 1OHZA 3AWEA 4N3UA 1GYWA 2B77A 3BC9A 4O02B 1JGDA 2GSMB 4Y1TA 2V8LA 3ET9F 3F05A 4NQVB 1WBYA 3QXAA 1UGNA 2G3NA 3L3GA 4JFTA 1AQKH 1JHLL 3ZSTA 1BYPA 2Q8BL 4DTGH 1Q9KB 3MR9B 3NN8A 2UWEF 3AXLB 2ZX7A 3U46A 5L2JB 1Q0YL 4G3YH 5DO2D 5DXWA 2D0GA 3U2SA 2YS4A 1MF2L 3F58H 4XPAH 2MOGA 4W6WB 2WUCH 5T1LD 5FO9B 1YEGH 4JS7A 3AMLA 1HE7A 2JTYA 2XA8L 3MBED 4JL1A 4XPGH 3U36A 4UF7C 2EVGA 1IEAA 4RH4A 2EDEA 2A5UA 3DMMB 4R90L 3AT9A 1D5BA 3CVDA 3CZLA 3UABA 4Y5YB 1IL1B 3ARDD 3L3IB 3L2LA 2N0KA 1AFVH 2UY7A 5LXGL 4OGAC 4R7LA 3HAEG 1NPJA 4WEBH 5BNXD 3HI6L 3FPYA 3FU7B 3N1QC 3TBBA 1UFGA 2JWYA 5BOZG 1GC1H 2Z65C 1AMYA 5IW3A 4BM7A 3RDTB 2WIIA 5G2NA 3WXWH 1SDDA 2QL1A 3BESR 3FH5A 4B3VA 3ZYIA 1TZAA 2DJ4A 2X4OA 4H20H 1QNZH 4AYEC 3I6LD 3PCYA 2WB7A 4FQLL 4AZ8A 2J8UA 4KVCL 4LF3B 4NQDB 3QRBA 2NX5A 5IJVB 1ERNA 3HC0A 4MA8H 1PZBA 5EZJA 1RXLA 2APTA 5G4MA 2E9JA 4N68A 3TESA 3K6SA 3AREC 3DX9A 3B2MA 1OF2A 4C56E 2EICA 4X83A 3E1F1 3OX8A 3LNGA 2VL5A 4JZNB 3UBGA 2VABB 2Z7WA 3WNKA 5FV1L 1EEUA 5IFAH 2PYFA 3LEXB 1NUFA 4R5VA 3HBQA 2V2TA 1V05A 1O7SA 1FVCA 4G8IB 4W4OA 3CX5J 4XN7A 4AQ8C 2XZAL 2NNRA 2ITDB 4X98A 5EC1B 1DVQA 1AE6L 1A0QL 3LRSA 5C08E 1SLVA 3EH2A 4LCCC 4FADA 5JIPA 1WD9A 2IALB 3OAUH 4O02H 5ITFB 1YMMB 1JGUL 1FBIH 1S7QB 3HJ0A 3OKMB 3QO1B 4OKDA 5L4IA 3RVXC 4R2GD 2HJFA 3QDMB 5DD1L 1THAA 2YD6A 4KKQA 5KS9F 5CSZB 3IN2A 4YHPA 1RZGA 4R4BB 5EIIB 2OBGA 1P1ZA 2Y06L 1U8MA 4X6DF 1MRDH 1VAHA 2ZX5A 3QDMD 4UV7H 1UCTA 4G70B 2XPZA 1KTKE 5D7JB 4BRJA 5F88A 4NM8L 4AIOA 4QXGH 1U8HA 4M6NL 4MMYB 3B7TA 3FU6A 3L4ZA 1IGCL 3QZMA 5ALBH 3B9KA 4JHAL 2DQUL 2C9RA 5FOBA 3N43F 3VXPB 1WYJA 4ZT1A 4I1NB 1Q4NX 4M3KB 4PJBF 1J8KA 2X89D 4YXLH 3QFDA 5LVEA 3BQUB 2F1EA 3R0NA 2VDPL 4NHCL 2EDXA 1WEJL 4OZHF 4UT7H 3RUGE 5I19L 4N2LA 4F8OA 1FL6A 2L3BA 3CZFB 2BIIA 4NQEA 1I4FB 4JHUA 1WT5C 3Q1SH 2ADIA 4WVRA 3GLZA 4QY8B 2X05A 3QI9C 4DP2X 4GRLD 2VSDA 3CFDA 4QHMA 4YDKL 1DSFL 1GJIA 2X2UA 2R56L 4WUKH 1WFIA 5EN2A 4DVBB 1KWGA 1CGSL 1A6VL 2BSTA 4N8UA 3WIIH 3PAVA 4XXCA 1VGEL 2ZX6A 5T1MB 1TZHB 2MOQA 2B14A 1CUOA 4FNTA 3GSNL 3CN3A 3IDJB 5FWRA 3UJIH 4F8QA 1V7NH 4MQXC 3KPPA 1G7PA 4OJDH 5IJKC 4PREB 3H3PH 4KJYA 2GEEA 3ATEA 3J7HA 3LS4H 3O6KH 1UOWA 3CFUA 1NAKH 4PLOB 4YHLL 3BSHA 3LKSA 3QP3A 4PP2A 5EZLA 1QSFB 4YZFE 1OB1A 1UADC 3KAAA 4NQQA 2EYSA 2ATKB 3HC3H 1BVKB 3HRZB 4M93B 4NNXA 5TDPB 3TO4C 4CMMA 3WUWA 1TQSA 5CLYA 3WHXB 3GHBH 5I1JL 4KJPC 2IWGA 2AQ3A 5I1HL 3MO1A 2YN3A 2DQCL 3WJLC 6PAZA 1A7OL 3NJKA 5GSVB 4UAHA 2AV1A 4AGPA 1OTSD 1BWMA 1A9BB 3RVTD 2HLFC 1L3WA 2OLDA 5D7HA 2B9BA 2J21A 3IJ9A 3TV3L 4H8WL 2JKIS 3NIGE 2XG5B 2WGNB 3CDGB 5C92A 4CL7A 2HFGL 5EU7C 5J6HA 2E3VA 4EF3A 2A38A 1T7YA 2HFFA 3GM8A 5D7LB 2NTFA 4JZOB 4Q9RH 2HN7B 1SOQA 3HS0B 4LCWD 2BIOA 2ZWZA 1N64L 5DJDA 3ZKXC 1TQVA 2FNWA 1I1AA 3S8GB 1AD9A 1DBML 1GA2A 5CGYC 1LYQA 4PJXA 2YLKA 2APWA 4XO8A 1C16B 1E6OL 5ICXA 5IV2A 3OSVA 2VZ1A 5E03A 1F8TH 4AL8L 1FNEB 1OKEA 3PDDA 2WNGA 4LO9A 5AWNL 2F9BT 2VDQH 5H35B 1T22B 1ITBB 2IAMC 3HZYB 4HS8L 3SZ6A 1FFOA 4ETYA 5DHVB 5D1QC 3I9PA 1Z7JA 2R15A 3FONB 1BFTA 4FFYA 2Y5EA 5GRXG 1JS4A 2BRRH 3NIDB 4NN6B 4P9HH 4H0LC 4WHTB 4YBLC 5HGBB 4FXTA 3EFFA 3UAJA 3FFCB 3VFNB 2XZQH 1HHGB 4LSTL 1MDTA 4P23D 4AQZA 2G3ZA 3DX4A 4M6AA 3UIZA 3H85A 3ZE0E 2IO5A 2P5WA 2Z64C 3ULUC 3RWIB 1X5HA 4GBXA 5DJ6B 4Z95L 3UO1L 1JZ8A 1NEPA 3B7SA 3OWEA 2X1OA 3HMXA 2F18A 4J23A 3ZE2F 4XP5H 4FZEL 3GIZL 5IUSA 1B4TA 3FTWA 1ECZA 1ZA6B 1T21B 1MEXH 3IPEA 1EJFA 5GGTA 1M3JA 2AKRA 4X9HA 2MQ3A 1S7XA 4AE0A 1G0DA 3FBQA 5HGHB 4BBWA 2Z0UA 4K8RD 3FQUB 4FULA 1K6QH 5DFWH 4ZUUA 4JZJB 4X8XA 5SX5H 4YSPA 5CBEB 1MH5B 4LGRB 1E8XA 1VGKB 4ZZFA 2PR9A 1FFNA 2VAAB 4P4KD 1I1YB 1LL1A 3HZKB 4JFXB 2Y07L 4OLUL 5DU7A 4GKSB 1U3HD 2XWBB 4UT6L 4N25A 5DQJA 5J9PA 2DI7A 2VDOB 1JDAA 1A6WH 4OI9A 1INQB 4U6VH 1IJ9A 4D2NA 5FYJD 2Q3AA 5IVNA 3LNFA 3MJ9H 4LBEA 4JPQA 4NBYB 4UNIA 4EUPB 4AENB 2FYVA 2VRKA 1DANT 4LHUA 3CU7A 4C4UA 2XXFA 5F9JB 4PRNB 3BRGC 2QVKA 1N7MH 1VCAA 3MRCA 1OSPH 1ODUA 4FNQA 1LILA 3GI9H 4AMXA 3CFCL 5EBGA 3OZ9L 3QDJD 5FS5A 4OM0H 3IDXH 3PL6A 3TNMB 3WIHL 1D2PA 3GZOA 2PTUA 4EEEA 2KI6A 3STLB 2RHEA 1J8HD 3V79C 4XWGL 4V2BA 5FF6A 2DMKA 1MUJA 3CFQA 3PV7A 1O6SB 4YR6A 4AY0A 4HJJL 2BVPB 4PJ8D 4WWKB 1XB3A 1MFNA 5AW5B 2P8MB 4DQOH 2R1WB 4UQBA 2IANB 2PCFA 3HE6D 4MJ2A 5CILH 5DHVH 4P3WA 3QIWD 3T2LA 4NHUB 2XACC 3FT3B 4TQEL 1IM3A 5IVXB 3ZMNA 3CPLB 2JE8A 4RMUA 4HIEA 5EOCL 1ORSB 1QSED 1JNLH 4UTAA 3WHE1 4AV4A 4E9TA 2IH9A 4FQ1H 4K3EL 3WDIA 4ZMZA 2V5TA 3L95A 4EI5A 1MIEL 4QYAA 2NY5C 2WCPA 4XBGB 4N0FB 2Q8AH 1AO7A 4PHZA 3KW8A 4AYID 5I9QC 1RHHB 4M1DL 4K8RH 4JN2A 5B7FA 1FFPB 3BAJA 4R3SB 2R39A 2R1YB 3LIZL 1KTDB 3HE7C 5BQ7B 4PJ9D 4G82A 3MZTA 1M6OB 1UT1A 1L0YA 5ESAA 1TPXC 1VZGA 1VCBC 5CFAA 5I8EA 3E6HB 4WI6A 1Z1WA 3WTWA 1ZGLA 1IEBA 1WBXA 4MCYA 1SQMA 2BSEA 5AVUB 2FGWH 3QDGD 1O9WA 2O6DA 5DVPA 1HZLA 1LE9A 2PCPB 3N2JA 5E5UB 5TQ0L 2CO6A 3ZR5A 4XZUB 1VACA 5DJYB 3RNKA 2VDOH 2PLTA 1WC7B 4Z7QF 3BFWA 5DHXB 4L8SB 2FJGB 1A7PH 1X9UA 3KGTA 1DUZA 4RGMB 1R6VA 3Q2VA 2IGFL 4PJ5E 5CSBA 3UYPB 2EC8A 3BWSA 3PWPD 4EUPH 1S7SA 5I1GL 6FABH 5HTSA 5HHVL 2DI8A 3RZCD 4JRXD 5L88H 4HXAL 4LSDA 1E9OA 2H6PB 2ZKYA 4M4PA 3SDXF 4MTMA 2EE6A 2RFXB 1MI5A 3D06A 3DO3A 5GRJL 3DNKA 4FG6C 4U1SB 4CC1A 4FTVD 3OD3A 3DDGA 4KNSA 4LAQH 1L6PA 1IGIH 2HX8A 4H25A 1WHPA 5LAPA 1VFBB 1ZLWK 4JVWA 3C5SA 4D9QD 4M02A 2FT8A 1NCWL 4O4YH 1F90L 3DETD 3KPRA 4I3SL 1N3NA 2VITB 1QFHA 5HHNB 1YYMH 3NSCA 2YD3A 3DTUB 1R3IH 2PETA 2AJYH 3GMNB 3IJYA 5KN5B 3HZVA 5J12B 4Y1AA 4W9ZA 5DD6B 1KZYA 5CJQH 1HZHL 1CGWA 1FIEA 1CBVH 3WNLA 1KTLB 4FG4A 2NW3A 4JFFE 4HT1L 4PJFE 1H8OA 1OGAA 5DRWA 5HHOA 1IGYA 1JNJA 2Z9TA 4AEEA 3HNTH 3T0EB 1TF4A 2EACA 2GJ6A 4UIMB 3VU2A 5MP6H 3ULVH 1KLFA 3EJRA 1NFAA 1E8ZA 4PY7B 3V52L 2OX5A 1K3ZA 2OM5A 1IAMA 5CO1A 2FWOB 3D9AH 4GAYB 1UXMA 2VDNL 1EZLA 2BNUA 2QBWA 1J05B 3IE4A 3N42B 4F92B 3ZL1A 2IH8A 1IM9A 3EO0A 3MLTA 1FJ1B 1IGTB 1YCSA 3BW9B 4TL5A 5E99H 3LKOA 2VC2L 4WI9A 1JYVA 4JKMA 3D50A 3AM8A 3RBSA 2UWEE 1HILB 5C0AB 3G5VB 3PABB 1BEYH 5JPNC 2WP3T 3GBNH 4Y2DB 4EE2A 1J5CA 1XFPA 2OR9H 1YQVH 1OCCB 2WSPA 3NSDA 3SE8L 4A7TA 5DJ2A 5TJWK 3WJMB 3PV6A 4MAUL 3F62A 1YMHB 4OBSA 3TCLB 1GGYA 1OGTA 4IRZL 4Q6IA 1KDIA 4TSCH 5IHHA 2GBAA 1SXAA 4QRSB 4WY7H 4U3HA 2AEWA 2CBQA 2WTRB 3LY6A 4WNJA 2F0CA 3CMGA 3Q8FA 1TQCB 4GS7C 3CN4A 3PG2A 4JLRB 4MQTB 2NY4D 1PZ5A 2V37A 1F1GA 2FB4L 2R0LL 4OD1H 1YN7B 4KX8A 3BE1L 5EBWA 3TIDA 3UG4A 4AG4H 1H3PH 1K3IA 2O6FA 4RQQA 1DE4B 5EH1A 2WLKA 2EIDA 2ICWJ 4NRXA 4XNMB 5HHPA 2N7SA 4FFTA 3RWFA 5ID1A 4LK4A 4LU5L 4UTCA 3FF8A 4JFQB 1T0PB 4E9XA 3FCUB 5TDNB 4QTHA 1UZ8B 5DEFB 3V6OE 1BPVA 2DQJL 4XC1H 2H7WA 4ZMPA 1TMCB 3X13B 3SDCC 1E4WL 2FECI 3FK3A 3GBMH 5JO5B 3RY6A 3Q43A 1G1OA 2A0LD 2WQRA 3APNA 3OF6D 1NGXA 2A9AA 4GKOA 1MIML 3L5IA 1QA9A 1C5BL 1J9QA 3QZOA 1S7WB 1RZIB 4FEMA 5E8PB 3ZYJA 4KX7A 2F5BL 3ARBD 1DL7H 4EBQH 1VFAA 1PKQA 2FUQA 4J3OC 4LCWE 4WU7A 4Y5XA 3HAEA 2E9WA 2L7EA 1UT9A 3VI3A 3KBEA 1GW6A 4ZX3A 4WFEE 3L7FA 4PJ7F 43CAA 2W60B 4IOSA 2AK4B 3KPSB 3O3DB 4MS8D 4QRTA 4U1LB 2ENSA 1OAUH 1OT2A 3GSVB 4ZDHB 1EUUA 2YZ8A 2Z93B 4NM4L 4PWIA 2RCSL 2WZPD 1FGVL 2E4TA 4MAZA 3S36H 4IBLT 3N41B 2YFNA 4ONGL 4ORZC 5DQ9B 5DVOA 2GIYA 3ZU8A 1M1XA 4ZQKA 5HYSA 3R1GL 5EB9A 5KS9E 2GTQA 2QGEA 3F65A 5HDBF 5T8IA 4AQAA 4DO4A 1CG9B 1T5WB 4MJ6A 4KHXH 1KULA 2NYKA 1NFDF 1PEWA 4J27A 2A77L 3KHQA 4HCGA 4X6DE 3UMTA 4KNQA 4HX1B 1PG7H 4M61B 5AD0A 1P5UC 1TJGH 4KO6A 4LAJH 5JHAA 4M7LT 1OO2A 4A38A 1KFAL 4IDLA 1URIA 3QUYC 2BO0A 2OZ4H 2VSKB 3A6BH 4TSAH 5A3ID 1F13A 5CWSB 1EERB 3FN0L 3BP4B 3AREB 5FA4B 1DEEB 1RQ5A 1SBBA 4RA3A 4UQIM 1WP6A 3GNML 2Z7YA 1BMZA 5MENB 1P6AB 4TNWK 2PTVA 3FSVA 4PJBE 3GSRB 2P48B 2CBOA 1NCHA 4OZHE 4ZXBC 3QRGH 2HFTA 4G43A 5AW3B 3UTTD 2FX9L 4LRNH 5JHDD 2WMPB 2ZNWA 1BXUA 1QO3A 5KVGE 1R3HA 1ZPLA 3WKML 3ZKMC 4H40A 3BSZL 4JUTA 4E9RA 3UJTL 1T0NB 4Y4KD 5CD5D 4MX7A 12E8L 4LCCB 4JPVH 5FA3B 5GGVY 3D1MC 4OCWL 1QWNA 4JGMA 1F45A 4F2EA 2EE0A 2FWSA 4ZW6A 5ISZB 2X0UA 1GOGA 3WO3B 3N9GL 1BX2B 2L0DA 5FYJE 3S96A 5E9DB 1DBKH 3X2QB 1K8DB 1LK2B 3Q05A 2OMWA 2NXYC 1J0KA 3QIUC 2ITFA 3KM1A 4JFWA 4FNRA 3U7YH 1MW2A 4UUJA 4Y4FC 1XGYH 4ZTOH 1DVFD 4I48B 1JE6A 1KB5L 2G60L 2R2BA 1KIRB 4GUQA 5FUZH 5HDLA 4Y5VC 5I6NA 2ZKXA 1CD9B 4YC2C 3V4UH 2HB0A 1HSBA 1JWSB 1S7RA 3CFTA 1FNSL 4QO1B 4HA1A 1MFAH 3AY4C 3O3BB 4PV9B 5F89B 4WO4A 3EOTL 1IX2A 3E80A 1JYWA 1Y6MR 4BFRA 4WW2F 2OJZL 4O9HH 2CDGB 1XCQA 3PXHA 4QXUH 1S9VB 2D0HA 1A6AB 2X4PA 1KPVA 1R19A 2BRQA 4FE9A 2ZYRA 5AEAA 1A3LL 3OXRA 1CLOH 4G8GA 4HISA 4ONFL 1QATA 3HFFA 3QI9B 1P4IL 1MCSA 1A9EA 3DYOA 4I0PA 5PAZA 2WQXA 3B34A 4PWGA 2J72A 1BOGA 2YIHA 3TA3C 5ETUA 4JFYA 3TGXA 2K6YA 4PRPA 4KWUA 1XGQA 1ND0A 2XETA 4PRBB 4L8CB 1KJ2A 3JTSA 1IBHA 3ASWA 3CFEA 3DV4B 4KTGA 3S5ZA 1XD0A 3UGUA 1IC1A 1QNIA 3X3GH 1X9QA 5TE4L 3HKZA 4ZUTB 4KZDL 4JY5H 1MHPH 2FD6H 5L2KD 1XX9C 3IJEB 4RSYA 4P5TA 3TTYA 4OIBA 1KGWA 3DROA 3VXUB 1DBAL 3B3IB 2JK5A 1XBDA 4RNRB 4Y1SA 3A67H 3KLAB 5HYJD 1II4E 3UTSD 1TCRB 1TXKA 2J71A 1KJMA 2EKJA 1LEKB 1N19A 5F2FA 1BQUA 3TO4B 4B5ZA 4G6FD 1ZLUK 2OI9C 2AERT 1BVNT 4MVBD 1JPFA 4WI2A 1JZHA 4X6FB 4D7PA 1RJCA 3TWCL 4CN6A 5KBNC 3I9GH 5TE6L 4WUUB 4JKLA 4R8WL 2B8OT 4DO6A 1T1XA 2V7NA 1JF1A 2Q3ZA 3E8UL 4YHZH 2P8LB 4OLYL 3ZE2E 4WUUD 2YPVA 5E8DL 2Y3NA 2W0PA 1ROWA 3VRJB 1QRKA 1JXDA 5T5FH 2A6JB 2PMZA 3X11B 2BZDA 3VD2A 1RK0A 4NQCB 2FCBA 5KYXA 2X6VA 3SDYH 4DGUA 5IEKB 4XCYB 4NO0B 2W0FA 3ZKXB 5MERA 3U0WH 6CGTA 4N2GA 3QH3B 4RAUB 1EANA 3BVXA 3DX1A 4FTVE 4JHWL 4OZIF 5FHBL 1ESOA 4OCRH 4DEWA 4NQCD 1DQMH 4IBWA 3AS3A 1F18A 3MRHA 4HK0A 4NAQA 2LU4A 5IROA 1NFIA 2IAMB 4HGWA 3SKMB 4NZRH 4UIKL 5D1QB 3HMWH 1OVZA 4MCZA 3M1BB 3QJFB 5E1HB 3NYKA 3M07A 3D05A 3QEQB 3UTOA 1JRHL 5T3XL 4YBLB 1UWFA 4WJG3 1NIEA 4EDXA 2VR4A 3IFOB 3HG1B 3KL3A 4L4VA 5BVJA 4NN5C 5CR8A 1BGXH 5D1QD 3GMMB 3JWOC 2MCAA 3QPQD 1CFVL 2EH7L 3EJQA 1W16A 2ZTBA 5EPMA 5I1AA 3O8XA 3HG1D 4P57B 1RERA 2NQ3A 4P46D 3TONA 1I1FB 1HQRB 2JCCF 4P9ML 1MSPA 4DGYL 5CZVL 2BS71 3OR7B 3X12A 4BHUI 1BQLH 3ZY7A 1UH2A 1LWJA 2Q7YA 4Z7NB 4UQ9A 2OR8A 2ZUVA 1XIWC 3OKDA 3TFKD 1SXBA 1KG0B 4HPOL 1Z2KA 5I0WA 4FX5A 4X7CC 5DJCB 4ELMB 3U7WL 4G7VH 3EYVB 3PQYD 3PWLA 4M00A 1A7RH 2G75A 3BZFA 5IMOB 1RIHH 5I16B 2OSYA 3W57A 1HH9A 3DTXB 4L4TD 2Q7NA 5ENWB 1M3IA 4L9LA 3L3OC 2EECA 3KPMB 1JGVL 2YXVA 5DS8B 5AW0B 2HH0L 4AJ0A 4F8PA 1ZK9A 4G5ZL 4QYOB 1OAKL 4PTUA 1G9NC 1BZOA 1K72A 3SPHA 1BG1A 4L3ED 5IK3A 3SYCA 4RDBA 3D39D 4PS4H 4PSRA 4UQ3A 4OAWA 2OMTB 1HNGA 1CYXA 5LBGA 4PV8A 3UJJH 3CSBA 5CEYB 3NRPA 1RHFA 2PO6D 3FRPG 3VFVB 4JM2A 3BPLC 3A23A 3BP6B 1DLHA 2H8PA 3QZWB 4GW5A 2XFXA 1FLRH 1CQYA 4FQJL 4N0CD 1A6ZB 4XRCA 1SXZA 4I3GA 2QHRH 1B0GA 1A7QH 1NCUA 4Z5RB 1C08B 5KJRL 4QCIA 3A21A 1TU2A 5CHNA 4F27A 2K0RA 2BVOB 4S1SL 3D34A 5FCUL 3ARQA 1XGUA 3LN4A 1G7IA 2D03H 2A9MH 1I1RA 5J6SA 1QUNB 4GIPD 5T5NG 4PJIB 2AXJA 4HKJA 1QFWM 3FQWA 4QKTA 5F1OB 3GIVA 3RPBA 5JQ6H 4BA0A 3HMXL 4HH9B 4L05A 5T1KB 3OHXC 4OT1H 5D2LF 4M6ML 3V6OC 4XNUH 4UZSA 4HZ1A 2YEVB 1NSNH 3QAZB 1BQKA 4Z7UF 2AJXH 1XR8B 4BZYA 1T04B 3CFKB 2QTVA 3S37X 4AVJA 5GGUB 1OE1A 3ULUH 2F7OA 3GRBA 4HWEH 2AEPH 4K7PL 4XO5A 2FK9A 5KSAC 3JZ7A 3OXSB 1BBJA 3P9WB 5I9QB 1YDPB 1E5UI 2G30A 1YRKA 3SDXE 4KDWA 4APQA 5HHME 1XGRA 3DHMA 6PCYA 4QHLB 3VWJC 4G8EA 4YDJB 8FABB 3HE7B 1AKJD 3EYQC 2Y5TB 1EMTL 3PGDB 2EADA 4FLSA 3PREA 1AD0B 4ABVA 3AMKA 1TPXB 4O00A 1E6JH 1XCTB 3MXWL 1FIGH 1ZHKB 1Z5LB 2X4RA 5ES4B 4M4RA 4YAQB 3NCEB 4LSRL 4P3DA 3X3FL 43C9A 3GKWL 3LMJH 3VRIA 2ZXQA 4UU9A 4GRMB 4X99A 1CDYA 1JCKA 1I9RH 1FL5B 4P59H 5CU5A 4S2SB 1UOKA 5DTFA 1EHLH 1SJEA 1WTLA 4FHBD 4H88L 3RAJL 5AL0A 2F7PA 1CR9L 4I0KA 4PN6A 3U9WA 3HC2A 3L2NA 3SCMA 4HKBB 4PJAF 3EYOB 5IB4A 4JHVA 1GMEA 4MCNA 4LPUA 4YFLF 1UEMA 3TZVA 1CGUA 2ZWNA 2BS9A 3QFGA 1ACCA 1IKFL 2IFGA 5BUPA 1I3VA 3N0PB 3C12A 2YD7A 3DJSA 5CF3A 1UXWA 5DI8B 3ZIMA 5BS0E 1WAAF 3ESMA 1KLUA 2OK0H 4LSVH 3UTTE 5JHDE 1LO5B 3H54A 2FHBA 1HINL 5JQHC 5MEQA 4E41E 2BY3A 2NY6B 4LEOB 2YC1B 1SYVB 3CZSA 3BFQG 4DKFL 3ZOAA 3VFOB 2LU3A 4GKNA 2CDEA 4ENEC 4F15C 1ZJAA 4N0YL 5EBLB 5IOPB 3QUZD 1FZJA 4UTAL 1OGPA 2FLRT 2Y6SD 4M8UA 4GW4B 4J6RH 4OFYA 4TNVK 3D18A 3DRTA 4P2QB 2XWTA 5JOPE 1LXMA 4JO1H 4ODXA 1RJZA 4WI4A 5JDSB 2YGPA 3C5JB 3E6FA 4OTXL 3REVB 3Q7JA 2ZJSH 2H1XA 1NGQL 3LNIA 4FRWA 3U0TA 2AI0H 4ZAKA 3G3LA 1LP9F 5K9QG 3P11L 5CGMA 3W0WB 2HWZH 1T4KA 2NY5H 4QRPD 1I9EA 1G5GA 3M17B 3MV9E 1E8YA 5IB2B 1JHKH 4FCAA 2ZOKB 4XMVA 4GKZB 3MC0A 4BH8B 4J39A 5D96C 1M71A 3JVGC 2HFEA 4RA0C 3TS8A 1G9ML 5DD5L 1FZKA 2FDBP 4JCMA 1M57B 3FUKA 1MFUA 5JR1H 2OYMA 3EJYD 3NUKA 1N2RA 3SOTA 5CU9A 3UL4A 5L0QC 3BMWA 3RUGB 4OLXH 3U1SL 4WSKA 4F1SA 3P0VH 1TZ8A 3EOYG 4GNKB 1NBYA 5K9OA 1RK7A 4TQIA 4GQQA 3QYCA 5JPNB 5T33H 2B3RA 2B59A 4HETA 3RX8A 3VGAC 2ATPB 1IBDA 1N12A 3Q48A 4PRIA 1N67A 4N0UB 4QEGA 4F5CE 5AYUH 3MMEB 4X4ME 3S35H 1QR1A 4RGND 4ETQB 1D6EA 1RCYA 3CSTA 1OTUD 1ILSA 3HVDA 2C4FT 3NDYE 1ZV2A 4UANA 2FR4B 1AP2A 4NIYE 4PQXA 4IBVA 4U6YB 3QG6B 3ISRA 2D7OA 4N2CA 5F7LB 4G7YL 4GS7B 3QQ4A 4HCRL 1LO2L 4J8RB 3MRPB 4MA1B 4O2FA 3AADB 5L2KE 2BCKB 2YJLA 4PJ7E 3WELA 5I5IA 1KXTA 1I3GH 1QRND 1QEXA 3OMNB 2X1QA 4HWZB 3WNIA 1F4AA 2J73A 1UM5H 2QQKL 3N85L 5IFHH 3UZEC 5JHBA 1SN5A 4X8GA 4OD3H 3CE1A 1UUNA 2XT1B 1ANUA 3CXDL 3IU3A 3WS3A 5AW7B 4J1UA 4CBZA 3BVUA 4IRJD 4DOHB 3BIKB 3BAYA 1ZT1B 4GUPA 1FO0L 1H3VA 4MD0A 2C9XA 4XBPB 3H9HB 5HDBE 3MRIB 4UBDC 4QRRA 3KXFD 1OZTG 4TXVB 3B9AA 4W9DC 1NFDE 3QO0B 1FNGB 32C2B 5B39B 3T6WA 1F4WL 1G7QB 1YEFH 1IFHH 3NQKA 1XO8A 3T2NH 5D4HA 4KK6D 3SDCB 1N18A 5I17A 1VFUA 1CK0H 1KBPA 3REWA 4JPIA 3SYAA 3T65B 1OOWA 2XN9E 2P45B 5AOZA 2W59A 3IGAA 2OAAA 4TKWA 1MXGA 1HXYB 2EDOA 4GIOA 1CDCA 4G42A 3K4DA 3DIFB 5HD8C 1I7UA 2X7LA 3EOAB 2XV3A 3MCKA 4DN4H 1JV2A 1U8CB 3NFPA 5C0CA 3HVNA 3NA9H 5GGRY 1KIPB 3BCFA 5C9JA 3UZQA 1EJOL 4TQPA 2FATL 4YIQA 1ASQA 1WBZB 5C09E 1Q9WA 3BI9X 4J3XA 1F86A 4JN1L 4JFUA 3PIQB 4F9LA 3TL5A 4XNXH 1F11B 4Q58C 3VXQA 4DT2A 2I60H 5CGTA 3S5LB 2QR0B 4LLUA 3F6IA 4DETA 3BKYH 4G80B 1Z9NA 4Y9BA 5JLZB 2FH8A 1ZMYA 3AQXA 4UQCA 3RDJA 3PLYA 4IDJL 4M5YL 3T8XA 4QXTA 4D8OA 1P5UB 2ZCZA 2XG4A 2VSMB 1T4WA 1SJMA 2JJTC 3QUYB 4KO5A 2WNXA 1PD6A 1ZRUA 2QMKA 1KV7A 4L29B 3QQ9C 3S98A 2J6EA 5F7WC 3BGAA 4WJ5B 3B7YA 3HRPA 3ZXAC 1I7TB 4MNGA 1AC0A 2MCPH 4ZS6C 5LGJA 1CE1L 1HJBC 1FYTE 2QKIC 3AG4B 1KCSL 5ADOL 3T09A 2AQPA 2YSTA 3NH7L 4XPTL 5FGCE 3D51A 1D7CA 1Q0XL 4ZXBB 4BWUA 5GS0D 3KYOA 4KNTA 3EO1B 1IQWH 1X5FA 2VLLA 4G1EA 1MLCB 3QEHA 4LQFH 4U6HA 5B38B 4OV5B 1Y6NR 1JNHB 2BP8B 2EXTA 3CQPA 4NJ9H 3U4EA 4UOW1 5C0FB 5EFIB 4A67A 3HC4L 5C86A 4WHDA 3LRLA 1DJXA 1FE8H 1GGBH 4GAGL 2K3HA 4LMQE 4MSWB 4P4RA 3MV11 5I5MA 4L3CA 3O3EB 4MNQA 1RZKL 4OCXH 3DECA 2ICWB 5AVYB 1LO0L 2HRPH 2H45A 3QFJA 3UCQA 1C12B 1V8HA 2NXYB 5DF0A 3DXAE 4QLWA 4O2CB 5E2TH 2WVVB 2DQHL 4KX9A 1HHJB 2VLKA 1LDPL 1UWGH 4PBVC 5A6LA 3D39E 4Y4FB 3V5KA 1UA7A 5F44A 2V2XB 1DQLH 1FHGA 1WGOA 1AXSB 2C3XA 5JXAL 2VDLB 4PGBA 3QIUD 4R96B 1IB5A 4GXUN 2E47A 1EGJA 4NKIL 4Y5VB 3U4BL 1BSIA 1M9SA 1CXLA 4YC2B 2P9RA 4MB3A 3IRCA 5DCCA 3GMQB 1JGLL 1CFSB 4JRYE 3KVDD 2DLFL 2AEOA 3PWNB 3VX1A 1GOFA 1JN6A 4J12A 1A1MB 1LK3L 4DKEH 2MOVA 4HJGA 1CLYH 1F56A 5FFGA 2PTTB 3AC0A 1BMGA 3WD5H 4LASH 1BBDL 1D7BA 4WDIA 3R8QA 4DSYA 4H13C 2VNCA 3NJHA 1ZWIA 5LWYL 4F8NA 1ZLDA 4BZ2A 2EYRB 3C6LA 3SPIA 2FQGA 1U36A 3TA4D 4FERA 3QA3B 1AS6A 3RGVA 4RMQA 2X6UA 1I9IH 3TA3B 2BW4A 2BVUA 3GXNA 3MLUH 3SQOL 3MNWA 3G9VA 4BWWA 4PJDA 5KBPA 1UCBH 5DFTA 2YAOA 4HUKB 2NQCA 2IDCA 5C07D 1M6UA 4BZ1A 1B6UA 3D2TA 1ZS2A 2AZAA 4ZNEE 3G6DH 1H5BA 3GC3A 4LKCB 5H4ZA 3T6XA 4IU3A 2VXSH 4O58L 3ZUCA 5F1SA 1KEML 3VXNB 2C1OA 5FO8B 1H0DA 3H53A 3SD5A 1TYRA 1QYGL 2JNZA 2WCSA 1XL6A 2OYLA 2OI9B 4K3JH 5HJDA 1MHEA 2Q2EB 1G7JB 3BH4A 4JQIH 6TAAA 1X6LA 4NFBA 4AQEB 3PUCA 3SBRA 3MLVH 2VN3A 4JQVC 3IFPB 4P3CL 2WO3B 2BHYA 2EVJA 1DFXA 5IW1B 3W9DB 1GZQA 1DLFL 1BVLA 1PVHA 3F7VA 4PJ5B 2HTLD 3D4CA 1XB6A 4CDHA 4KJQD 1XDTT 2DYPA 1UD4A 3B5GA 5F96L 4H8HA 4OH2A 1AIFA 2XY1A 3H7LA 4NWTH 3SKOB 3IS1X 1G94A 2Q9OA 2VISA 3DOHA 1F3JB 3OAWA 4K07A 5AAMA 5HP5A 4G1MA 4G9FD 3UBXG 5D5MB 5E08H 3D7PA 4EDWL 3NCYP 3B9VA 4YEEA 4KZEL 2J8UF 4IKJA 5T3ZL 1ZPUA 1A14L 3LPPA 3RWGA 5TFSH 3CLEL 3V55A 2FWUA 3FSOA 1IGFL 1UENA 4Y0GA 3CUPB 5BRQA 3GLDA 4P49A 4TMPA 3KWWB 3MOAL 3M1OA 5I1CH 3KZ8A 1R46A 1SFDA 4IBZA 1SEQL 1LEGA 2WLJA 4TNWF 1I85C 4NN5B 5F9DC 2XA3A 2QGDA 3WMSA 4LRIA 1J1XL 3RWCB 4ODTH 5EU6D 2MJWA 4B3EA 1DYZA 1SY6H 2O6PA 4XN2A 5I76B 1BG9A 3MA9H 4JFFB 1Z9PA 1DJIA 1BQSA 4AEHL 1KBGH 2R7EB 3TJHC 1IQDB 1H15B 2BP3A 3GRGA 2NY3D 4KRNA 4DKAA 3QJTB 3FQNB 2E9BA 3MRFB 1XIWB 4JPWL 1NGPH 2WINA 2DEWX 2AXFB 3UP1A 5KYWA 3BZ5A 1NC4D 4EPSA 1N70A 5E2UL 3KPNA 3F7YB 2OQJA 4DP8X 1NIFA 2E8YA 5LBSH 3BGMB 3RBGA 1LE5A 1GPOH 4OF3A 5FHAL 5E6IC 3IETB 3OAYK 5IEHB 4CILA 5D2LE 2OV0A 2AK1H 3HR5B 3L3OB 1CICD 3WIFA 3BRFA 5BV7L 2KQNA 4Z7UE 1HOCB 1J1PH 5IVZB 1U91A 5AKSA 3FRPA 1NCCH 1AGDB 2BOCA 2IIJA 2WY3B 1V7MH 3MTXA 3QXVA 3CDYA 4J3WA 1ZA3A 3PWJA 4KO9A 3RYMA 4B7LA 4F93B 1QTYT 5IWLA 3HG0A 3WLBB 5KTEH 2J55A 4L1HA 3WDJA 1X7QA 2ZIDA 1AI1H 5B1JA 3WN5A 3BPLB 3BT0A 3LJ3A 4K71C 3OKNA 4RAVB 2DTSA 5DA4A 1QRNE 4ZUSB 4KKZA 3UYRL 1BFVL 3TT3H 4ZX4A 1ZDSA 4XCEB 5D2NE 2APSA 2O72A 2BMKB 2BWIA 1VKXA 1G1KA 3ZBMA 4AXWA 5IIEA 1U92B 2C34A 3JWNG 3J8F7 1W0VA 3L08A 2BC4A 1FN4A 2J1ZA 4N6RA 4GINA 2BCMA 3IT8D 5KVEL 4HALA 3CD4A 4X7FC 3IXAA 4NBZB 3MKGA 3WY3A 4QI3A 1G6RB 1BJ1H 3OHXB 4LNRA 1F4XL 3L7EA 3O2DA 3N40P 4RZCB 5F6HI 3ZO0A 2D3VA 4NDMA 1HIMH 4FZ8L 3B2UC 3BWAA 1BD2B 3QB7C 2E4FA 4PJAE 3JWOH 1BQRA 1KPUA 1N6QL 4U1MB 3PNWA 1W6WA 4ZMOA 3S4SG 5KSAB 4JY4B 2P5EE 3INUL 3WNOA 3VWJB 3BSGA 4XHJD 1NGZB 4EZLA 1CTMA 2I07B 5GGRA 2IDUA 2AEQH 1TVHA 3T6ZA 4E36A 3WAJA 5CMAB 3AGVA 1GXEA 4HKXB 5KSAD 1I1CA 3RNQB 3MACH 1MCNA 3Q9QA 1XH3A 4HSAC 5HHQA 4OJCA 3MYJA 1G0XA 3O2VL 2YSSB 4G6JH 2Y2YA 1Q90A 3P77A 2KQMA 1L0PA 4IU2A 4XB7A 3V4PB 4Z0BH 3K6FA 4HUVB 1KNOA 3QIBD 4NRYB 5H94B 2D7PA 4EZJA 1ZSHA 2E75C 2QADC 2R23A 1AAJA 5AUMA 4XB3A 4BEIA 2BNQA 4X6CB 3GJEA 4PJXF 3Q2NA 5KS9B 1KCVH 4Z7AA 1IGJA 1UVQB 1ZGLP 1FF5A 3QCVH 4OCYH 4HBCH 4QXWA 4TULL 3W2DL 1AOZA 2PPDA 1IVTA 2Y36L 3VM5A 2DKUA 4JG1L 3LB6C 3IU4H 1T80A 1IKNA 3MGOA 3DSFL 3MNZA 4XWOD 4Y88A 5D1ZC 4BE6A 3U0PB 3WSQH 3EGSA 2DQIL 1LNUA 3GRWA 1CD1A 3UC2A 3BD4A 4ODHL 5MEPB 1I8LA 2W9LA 2WANA 4FQHB 5DJAA 4MAYC 5C0GA 4PG2A 5I71C 4G8AC 3MRBA 2H3NA 5CP7B 1YNLL 4HCFA 4ZQTA 1FNFA 1FZOA 4PJBB 3SDDD 3SE9H 3SGKA 3DVNB 4XCNB 3TT1L 3NZ8A 4HHWA 4XGZB 3M1CA 4N24A 3SQRA 3U79A 5GS2H 4F15B 4WW2C 4UQ2A 2JJSA 4ZW8A 2G3MA 3ZKNC 1AGBA 1O9ZA 5L4FA 1BVNP 1YEIL 7FABH 2BJMH 3B9KD 4WGWB 3RFZA 2W07A 2W95A 3F7RA 3O6FB 3EJTA 2WK2A 3O6LL 3WDHA 3EYSL 1JZJA 1KXVA 4AQOA 3QC5X 2X4TB 1P5VA 1RZFL 1N10A 2NZ1A 3LRKA 3GSQA 4ELKA 4NQED 5IR1B 3C75A 3V0VA 3H0TB 1PDKA 1TNNA 4FI7A 5BRZA 3KPOA 1GVIA 4D0DA 4HV8B 1GHFL 2VZSA 4XNAA 4AC2A 2FVNA 4KY1H 1NGWB 1ITCA 1QQDB 3DX3A 2CJTA 3TN0A 4JL2A 1UB5B 4S1RH 5D96B 1QLEB 3VI4A 4RWHA 2JFCA 1AG0A 4I2XB 4IMLB 1OE2A 4G7QB 3OGCB 3HS9A 3KR3H 4X7EC 4XCCH 5AB1A 1E42A 5JIQA 5L0QB 1WHOA 1E3XA 3BVNA 4LLYA 1CFQA 4KQ3L 4XN5A 3X1FA 3BLPX 2DIJA 2VQUA 2ZUSA 5HGAA 3V4PH 2DQTH 1U95A 5AZEH 3ARUA 1PGRB 2LAAA 1O0VA 2Z4QB 4UB0L 3V5HB 5C0NC 3HCVB 3VGAB 4IQHA 3NIFF 3EHBC 4MJIA 4LPYA 3L3KB 4UINL 1KCRL 3N40F 3CTTA 3L5JA 4WFFD 1XR9A 3AGWA 4KKNA 5DK2B 5MHSD 3QQNA 1ZY9A 4JR9L 4L37B 3T0AA 3I85A 5DJZA 1PLAA 2DIEA 4HKZB 1XF2A 3GT6A 2CH8A 4ZX5A 1S5HA 5C71A 2A74C 4FQXC 3FTVA 4J5VA 4S0SD 1I3RB 4QAWA 2ZICA 2HX9A 3EUUA 2R0ZL 3QULA 4YXHH 3P0YH 4I1RA 3L3HB 4DEUA 4OF7A 3AAZB 3UERA 4HZLA 1QLRB 4XXDB 1MRFL 2HRGA 4YHYC 2QMJA 4OQTH 4W1TA 4Z8FH 1U3ZA 4ZUWA 4C57C 4W68A 4A6YB 4FHKA 3GS0A 2ICES 3TYGL 4GG6E 1TVBB 2B7DT 4I5BA 1XTMA 2A9NL 3VGEA 4KKLC 3RX7A 3SKNA 3HHRB 5EMYA 1SHWA 3ZE2B 4OSUH 4UOQA 2AJVH 2ESVE 4HJ0C 3QUKA 1ED3A 4FKKA 3B6SB 1G87A 5IMLB 1U6AH 2BK8A 2ZYSA 5GGQH 2EH8H 3GO1H 3PJSA 5CJXA 3LXCA 2XUWA 4S1DD 4Z3GA 4NUGL 1HWGB 4R0LA 4DO5A 2IH1B 1QLEH 3NDZE 1TETL 5IJCC 4HIJA 1H8LA 1T66D 2CA4A 1PY0A 5DRZB 4GSDL 1R5IB 4YSTA 2BLFA 5K59F 1TKWB 2J56A 4L4JA 1ETB1 3VCLB 2CDFA 1A65A 1DBJH 4LVOC 3ZRFC 1NAML 4WEUD 4CC0A 4M6OH 4JVPA 5FECA 1ZVSB 4PGCA 2VLJE 4H8WC 4KQ0A 2EE3A 5EWIH 3OAZK 1E67A 1HKLH 4LESA 5B1CA 2F2HA 4Z76A 4CSPA 1MRCH 4E42A 1RZ7L 2WQAA 3VDBA 1EEQA 1NH6A 1WWBX 4MZIA 2VJ8A 5J3HC 3QXDA 3EADA 1KYAA 3KDMB 2FE0A 4LLQA 1P4BL 4E0RA 4BFJA 1X5IA 4RBPK 1F1AA 2IBZX 4WFGE 4AL8C 4TNVF 4OVUA 4I13B 3VDCA 2BSCA 2WXQA 2QKIB 2HVJA 2XX1A 2WLMA 2B5IC 4OZGA 3V0GA 5DGQA 3QRFM 4K9JA 4DAGH 4LHUD 4NWUH 5K9KA 2NY2D 5E0FA 3VXTA 3QUXA 2Z31A 1HXKA 4MCMA 1PLCA 4F9PA 4I4WA 3BUYB 3DV6B 3PFQA 3MUJA 2IXQB 1DDHA 3FQRA 5JPMC 2X2YA 3GUTB 4OJFL 5I0XA 3ARGD 3D09A 3PL6D 5CR1A 4U1JB 4NI3A 5SWQB 3F64A 4A7SA 1UA6L 3G04A 4JJ5A 3VFSA 1VEMA 1ZANH 5SWSD 1OQXA 4A6YH 3LQZB 4XXWC 4YVNA 3GK8L 2SODB 3TM6A 4GI8A 2H2PC 1SBSH 4M8QA 4PJGE 1MNNA 4QWWD 3S2AA 1DQTA 1FORH 3ZX1A 1M56B 4WF7A 4LOEA 2H2SD 4D7BA 1KIUA 2DMBA 2EIZB 3ZVVA 1JD7A 1IM3D 1I9JH 4V2CB 4Y9EA 3MRQA 5GRYA 5AVZB 3CFIC 2FEJA 3ML8A 3RU8H 2DMHA 1YY8A 4YLCA 2DKSA 2HPOA 3BDBA 4OM1H 1KIQA 3EDKA 3EGXA 4ZMVA 1XBRA 1A1NB 1YHPA 3S3CB 5D2NC 1AO7D 5F1KC 4RMSA 2GUYA 2PWFA 3IMBA 4MB4A 3K6NA 4WI8A 3SPVA 5IW6B 2K9UA 3X14B 4PJEF 2XHNA 2EDRA 3KWUA 4HJIA 4O02A 4QRUB 5HGGS 1P9MC 4NQVA 1XTLA 3VH8B 2J6EL 4B53A 4U1IA 4FAAB 1NLDH 5H8DA 1A7NL 1V55B 3LHPL 1GGIL 1Q9KA 2GCYA 1KZQA 2UXFA 2F7RA 1QLFB 5T1LA 2BSED 5DJ0A 3SY6A 3AXLA 5AW6B 3RL1B 4FLHA 2D3NA 5ICYA 3VFRA 3QPXH 1TO5A 3U1QA 5GS3A 1KF9B 1WDAA 2IJ0C 4LARH 2DMGA 2RQ8A 1PG7X 4KO7A 4FFZH 4BHUA 4LNVA 4LP5A 1GZHA 3SDXB 1BP3B 4KGJA 4PJHB 1HWHB 5HHMB 1U58B 4OF5A 4LSSL 2CD0A 3EG9B 4HQQL 4PW4A 1PY9A 2A9CA 2J8UE 1X4ZA 2NX5E 2WXKA 3UEZA 1F4YH 4B9PA 3A0OA 3O41B 3DMMA 2CGRL 2YXWA 2QQNH 4TLKA 4P2OD 3RIAK 1IL1A 1WFOA 4BDVA 1E4XH 4IJ3C 5CUSL 3L3IA 4CU6A 1JPSH 3OM3B 2EQDA 3OGOE 1E50A 3BEWB 1MI5D 3VD9A 3VI3F 3FU7A 4KHTH 3EXJA 1WZMA 2CLRA 4QJ4B 2E9GA 1LQBC 2OJ1A 4MASA 1RZJL 2IGLA 1T0MA 1GCFA 1BFOB 2ZD0A 1GS8A 1WFNA 2GC4C 3CH1A 4HC1L 5BMFL 5HPMB 2GTZB 5CIPB 1FC1A 5GHWL 2YA2A 3KPRD 3MGTB 3UMNA 2MPVA 2PN5A 1OCWL 4OLWH 2IBZY 5F0JB 4DGIL 1E2WA 4F7MB 3THMH 4KAQL 2R2EB 3MJWA 2JELL 4LF3A 1OCOB 4GXUM 1EPFA 4ZW3A 1ONQB 4NQDA 1ZHLB 5IJVA 4Y1AD 4AEIH 4L3FA 1COBA 5JW5B 1CXEA 2WTOA 2BP0B 1A6TB 2NXZD 1W2KT 3HB3C 4OZ4B 5BS0B 5HHOD 2DLHA 5CP3H 1MWAB 5IY5B 4E41B 3AG1B 5I1IH 2QLYA 5EIQA 4CGTA 3EO9L 3RRQA 1EK3A 2IADA 3DJ9A 1EA9C 2MKLC 3W5NA 1NTDA 5C0JB 4FQ2H 3O6ML 4NP4H 1PF3A 1WGVA 5DEJA 3GHEL 4CJ1A 1WS7A 2I69A 5KSUB 1FG2A 5FB8B 2L7UA 2Y72A 3RTQC 5ITFA 3PS6A 2HG5B 4JM0A 1GKEA 1L4IA 1IM9D 1YMMA 4JANA 1S7QA 3CVHA 4UMGA 4Y2OB 4F37K 1W72B 4GUOA 4KROB 1HWWA 2XWXA 3QDMA 4GOSA 4XP9L 4TUJB 3OZKA 1MPAL 3P9MA 3U82B 4OGXH 3CCHB 2ZCHH 4MBOA 3L6FB 5EIIA 3UPRB 1WITA 4XVTH 3MV9B 1DQQB 3VMPA 5BW7A 1YEDA 5D7JA 4HS6B 2X89A 1LJMA 1J0HA 5T3XE 1KMGA 2X4SB 2WYIA 2WQ8A 4D9LL 3QXUA 1MW1A 4MMYA 5BJTB 4FA7B 4EXPX 3VA2C 3VXPA 1R3LB 4ISVA 3SJVE 3WTXA 3O3AB 4Z3JA 3W38A 1RP9A 3BQUA 5AZ2L 5E6IB 3MLZH 1OAXL 4GRLA 4Y16D 3CZFA 3T9WA 5AKTA 3C5ZC 4NZUH 3SKJL 3MRRB 1F3DJ 2O5YH 2DL2A 3EGDB 4QY8A 2ZX9A 3RJQB 3ZTJG 3QWOA 3FNKA 3MRLB 2K7QA 3VRLF 5CIPH 3CVBA 2XVLA 5HJGA 4YOKA 4DVBA 4ODSL 4XVSH 4K71B 5T1MA 1TZHA 1U8OB 3RA7L 3MAWA 4IHOA 5D71L 4PJ7B 4LVNC 5CEZD 3IDJA 3C8HA 1RURL 3VD4A 2ARJB 1TCMA 4PREA 4CW1B 2DH2A 4N9GB 3V2AR 3ILQD 2C7UB 1O6TA 4CC4A 5EBMB 4JDTH 1FH5H 3MUY1 3GSUB 1MWAH 3QDHA 2JIXB 1A3RH 1NLBL 2FYYB 1QSFA 5FWQA 4UNVA 2F8OA 3B83A 5IMKB 4G6AC 2ATKA 4NUJB 4PJXE 2W91A 1RUKH 3LNEA 2TAAA 2FO4B 5TDPA 3ZTCC 3DX8B 1AXTL 5HDBB 5KVFH 1OGSA 4ZD3L 1O6VA 2OCCB 5FUOL 2VXQH 3T1WA 3N50A 3SYQA 4ZO9A 2X6CA 3JWDH 1IILE 3MJ9A 1S7VB 2RIKA 3GSOB 5GSVA 1W72H 2XN9B 1A9BA 2VM9A 2ICWI 2N7BA 5HYQA 3CC5A 4CNIB 3D2UB 1AQDB 4D8PB 3DUSB 2ROXA 2XG5A 1RZQA 3CDGA 5I6OA 1DR9A 4X4KA 3GYRA 2P5WE 3I3DA 3R19A 5A43C 4JY6B 2R0KH 4XMPH 1E9PB 4LCIH 4JZOA 3MU3A 2HN7A 3S34L 3HS0A 3NCXA 1WAEA 2J8HA 4JK0D 2DTMH 4A2LA 1SDAB 1H3GA 3T0BA 2Y69B 5IHUL 1C16A 2VE6B 3MOQA 4JFZL 4KZ0A 2DEYX 3CFBB 5C09B 5D7KD 3B43A 1FNEA 5HJ3A 1P4UA 3NSYA 1OPOA 1VEPA 3X1EA 2EVIA 2QADB 5H35A 4P23A 1T22A 2NQDA 3HZYA 3LPWA 3CVIL 4E9WA 5DHVA 4NPJA 3FONA 3EXLA 5FYLL 3ZKSD 1MFBL 5IM7A 3HI5H 1YLBB 4AMKL 2BHFA 3BKCH 2B4CC 2Q86B 3FFCA 3OSKA 1HHGA 1K5NB 4FG2A 4J3SA 4U6XA 1NMBL 3P4NB 4GP8B 2XWEA 3F5WB 4F20A 5D1ZB 3N1GC 1EH9A 4KVNH 3RWIA 1GGCH 1SLXA 2BIQA 3KYMA 5DJ6A 1JYXA 1I82A 2GPZA 4FNLL 4HSCX 2FJHB 5FDWB 4MAYB 3K2UL 5I71B 3ERXA 5EA0H 1XGPB 5G5DB 4M8RA 1P4LB 3WUZA 1FYTB 1YC8A 2FQEA 1E5CA 2R29L 1ZA6A 4HYTB 5TE7H 4UT9H 1T21A 5FGCB 3RWDB 2ARWA 3AJ7A 3EF7A 4WK4B 3CLFH 5D6DA 3AS0A 3NCBB 5HGHA 1MFEL 4WW2B 3FQUA 2B08A 1T89A 4YBQC 4MXWL 4JZJA 1BCIA 4X4ZA 2E74C 5CBEA 4B6ZA 1MH5A 2WAQA 3MUGB 1VGKA 2WVUA 2XTLA 5DMKB 1S7UA 3NIFE 3HZKA 1K4CB 2A73A 4GKSA 2XWBA 4ZG1A 4ZMQA 5JW3H 2DDQL 3EFDH 1YJDL 4ZMTA 4HWBH 2UVFA 3KE0A 1JV5B 3ZL2A 2KHAA 2CHZA 3D6GA 1N4XH 1EVTC 3FYIB 3DXAB 2JJUA 4YXKH 3MV7E 4XAKE 3KCPB 2JV6A 4GXFA 2F5AL 1CZ8H 2CK2A 3I6SA 4EUPA 5JW4N 4AENA 4G8GD 5I8KL 4FXLA 3F12A 1UWYA 3KWTA 4I0PD 1ID2A 3JXAA 2WN3A 4R84A 5GSRB 1AMXA 2A6IB 5CJBA 2DWDA 4NKQB 5C2BH 4PRPD 3HNSL 4BELD 4DGVL 4F57H 5BZDB 1QFWL 2EVHA 4LLDB 2BFGA 2N1TE 1A22B 1FV1B 4D0CB 2H1LM 1LDSA 4JRYB 4PJ8A 1N68A 3K4AA 3TNMA 4BA8A 3V7AG 3AU0A 3STLA 3FN3A 1JHLH 3HE6A 2FBOJ 2Q8BH 1PYWB 1CLCA 4JM2F 1OTTC 4F8LA 2OMYB 2QVIA 3ZMRA 4WWKA 4OKVB 1Q0YH 4XVUC 5A2JH 1GL4B 1QSEA 4JEGB 1MF2H 2R1WA 2IANA 1Z9SB 3EHBB 3FSZA 5EEZA 2IWKA 3NAAL 4URTB 2FGZA 2NYYD 4NHUA 5LB1A 3NZSA 3UADA 3FT3A 4XN9A 1JIBA 2WKLA 2XA8H 3IMWA 3CPLA 5EU5B 1I8UA 1G43A 1ORSA 4BQ8A 1FAKT 4ZI8A 2DI9A 4V1DB 2PXYC 2R27A 2AQRA 3B9DA 4R90H 1NFKA 2VTFA 2KYIA 4GMTL 4RMRA 2A74B 3FZUC 2VDPB 5IKCB 1Q9LA 1TFPA 4FQXB 4POZC 3L9RB 1B2WL 4XBGA 4N0FA 4Q56A 4U1KB 1RHHA 5LXGH 4KMLB 2VZUA 3HI6H 5F7UA 1FFPA 5B3NA 2R1YA 5DMJB 1KTDA 1RUPL 5BQ7A 1TEFA 2WZ0A 4PWFA 3KVPA 4L3AA 4XMTA 1M6OA 2ADGB 5ITBL 2D9QB 1HSAB 4KFZC 3UDWC 2X87A 4YHYB 2MQCA 1OAZL 3O81A 1KCUL 3IMUA 3P4LA 1MI5E 5H37G 3RY5A 4FYTA 3W82A 1NDGB 2VKXA 1RU9L 4FQLH 4LPTA 3QNZB 3IDNB 1TJIL 2B1HL 4KVCH 5E1GA 4OB5L 1NPUA 2IFFL 1Q94B 2ZXDA 3PWPA 4XZUA 5DJYA 3T2OA 4BKLB 5IROD 3GSNB 2VMJA 1WC7A 1W91A 5AALA 1G4RA 3ARSA 4L8SA 3FB8B 5F3BA 5I1LA 1IUZA 4ODWB 3KGSA 2UX7A 5CKAA 3T8VA 5ANMA 1FZMB 4FNPA 3UYPA 1HCZA 4K2UL 2EIKB 1OW0C 5CBAA 3VXRD 1OT1A 2ZSWB 3KLQA 4L4VD 3UO8B 4G11A 2H3XC 1CDHA 3O2WL 1ES0B 1AC6A 4ZFZB 5HXMA 2XZAH 1ID5I 4XC3L 3QQ3B 5HHOE 3HPLB 1OGAE 1AE6H 2NNCA 1A0QH 2H6PA 4U3SB 3O8XD 4RRPG 2RFXA 2UXGA 4H4NA 3RIKA 3A47A 2GJ6E 3FT9A 1K8IA 1JGUH 2V5YA 4LVOB 1VFBA 2WQSA 1MAML 5DD1H 3MXVL 2QGCA 4L1LA 4LL9A 4M8VA 4YHKL 3L5WB 2K9FB 3IPBA 3AZUA 3VVWA 5I18L 1RJYA 5HPOA 1ZIAA 2V7HB 2VITA 2Y06H 2GJJA 3NABL 1WJ3A 3OPZL 5HHNA 2B2XL 4ZJ9A 4XP6L 1QTPA 5KBDA 3ZTEA 3GMNA 5KN5A 1LVEA 5DD6A 4PY8I 1M05B 2DWYA 3IDIA 4NM8H 1MCRA 2AQ2A 3NTCL 2VLRB 4M6NH 1KTLA 1IGCH 1HEZB 4HAFA 2DQUH 3B5HA 4JHAH 3S35X 7PAZA 4LCYB 4ZRGA 2TSAA 3PGCA 5HDOA 2B5IB 4L8BA 2VDPH 4NHCH 1G7MB 1WEJH 5CCKL 3FUEA 5I19H 2DM2A 2ZPKL 4UIMA 5EF0A 5IB3B 3TIEB 3DYPA 1OZUA 3FH8A 1BQHA 4IJTA 1S9YB 2DQGL 4KK8C 5INDB 4MDRA 2FWOA 2QPUA 5JPMB 3U9PL 1J05A 1CWVA 3L9BA 4YDKH 1AJ7L 1DSFH 1FJ1A 3BW9A 3TBTB 2P42B 4HS3B 4DFIA 2R56H 5D2LB 4MBRA 3I2CL 3B8SA 1CGSH 1A6VH 3PWVB 2OJEB 4Z7UB 1VGEH 1BMWA 1ZHNB 3G5VA 5C0AA 3PABA 5GZNA 4Y2DA 4UZGA 1EBPA 4KDTC 3IDGB 4KPHH 4H8VA 1MCPL 2ZG2A 3FOMB 4EVNB 3DSNB 3WJMA 1YO4A 2OZ4A 1YMHA 3MLWL 2J2ZA 4YHLH 2I7OA 3TCLA 4YQXL 1ZXQA 1BZ9B 3BH9B 5CEZE 2DQDL 3W11D 5JHMA 2HMIC 2OMZB 4JLRA 2BFVL 2GY7B 5ESVB 5D2NB 3C60C 1WWWX 2DBJA 2MNWA 1T1YB 4PR5B 3QE5A 2UZIL 1PKQE 3MKKA 3BPCB 4APQD 4DP0X 2F53D 1YUKB 4A7QA 5I1HH 1E28B 1DE4A 2DQCH 4JGJA 1W80A 3VI3E 1A7OH 1IC7L 4XNMA 1IVLA 1I1AC 2ALAA 2N56A 4OLZL 2V2WB 4D3CL 1SVCP 3DBXB 4JFQA 4J4PD 1H6TA 1YEEL 4OR1A 3TV3H 1L7TL 3PAUA 4H8WH 5TDNA 1UZ8A 3QWNA 4HLZH 1RUMH 4XPGL 2HFGH 2M1KA 1QG3A 4PJAB 3X13A 4XPHL 5AVVB 1MJ7H 2G0LA 1N64H 3T71A 1QW9A 1EZSA 3ZIYA 5JO5A 1HHKB 1CBJA 4PH8A 1DBMH 5K5YA 5KAQG 2P5EB 3UAJC 4Z3FA 1E6OH 5PCYA 1AFVL 1S7WA 1RZIA 2XXMB 2FO8A 4AL8H 1HK6A 1FPTL 2Z92B 4HMEA 2BZ7A 3Q6FB 4NZDA 5AWNH 2CHXA 2CNYA 4HFWB 4R97C 4HS8H 5FDYA 4IRSC 4RGOL 5I75C 4GBXC 1DJZA 4B9GA 4CSZA 2WZPA 1PQZB 1U93B 3CFJB 2PABA 4KRPD 4YPGA 2A7BA 2EDDA 4PWKA 3TZVD 3BDXA 4IJ3B 1MCWW 5EU4B 5FGBC 2W60A 5KANI 4RIRB 3TV8A 2Q76A 4LSTH 2QVTA 2V3EA 3KPSA 1JHTB 3KLKA 3O3DA 4U1LA 3GSVA 4U7SA 4F3FB 2VDLL 1UB6B 2F61A 3VTTA 4ZDHA 2Z93A 5D7SL 4PRHE 5DJ8B 1UOVA 5DQ9A 3IVKB 1EAQA 5GJTL 1S78C 3IXTA 2XJKA 4Z95H 1H8NA 3UO1H 5A6IA 4BQCA 4TNFA 5DHMC 2Y7NA 2YPLD 4MWFA 1EVUA 1S3RA 4FZEH 3GIZH 1KB9K 3IJSB 3BP7B 1P69B 3ABLB 4M61A 2B15A 3ECVA 4FG0A 2HT2D 3KYKL 3QHFL 2OMXB 2VR6A 5AZUA 1Z9MA 5LDSA 5CWSA 3BP4A 2ODHA 2BVYA 2XQYA 2Z7ZA 3HPJA 3AREA 5FA4A 1DEEA 2XOTA 3HB3B 4XNQB 4NAMA 3KWXA 3PFUA 4AYSA 4JRWA 3W5MA 2O5XL 2Y07H 1IT9L 2PF6A 1AHKA 3HUJB 4OLUH 3HG3A 3CG8A 2X0WA 2X6AA 3GSRA 3J27A 4HHAA 2JKTM 4QHNA 4UT6H 3TVMC 2BZCA 3EBAA 1JBJA 4LKXB 4JE0A 3S3JA 3STZB 2F58L 3U9UA 1DTUA 4AQ8A 4HIQA 3ZZLA 3QEUA 1IJNA 4B7IA 2YUVA 1T0NA 4JO4L 1U8PB 4HJTA 4NRZB 4LCCA 2Z91A 3GTTA 1HL8A 3KYAA 4K15A 5DSCA 4OIAA 5FA3A 3RTQB 1OEZW 2YEZB 3IS0X 3VRLE 1AOHA 2ZKHL 1BX2A 1DVFA 3IJ7A 3OLGA 1K8DA 5E9DA 3MV01 1LK2A 3CFCH 3OZ9H 4G8GE 1NEZG 2CLZA 5T3ZE 5T5FA 3WIHH 1F4HA 3RFRA 3VG0L 3I75B 2WWNA 2YA0A 4I48A 4XWGH 1BIHA 5IREA 2Z35B 3NEEA 4HJJH 1KIRA 4UQAA 1WUZA 2CPCA 2BOBB 5F0PB 4EI5C 2DLTA 2DBLL 2YMTA 4KNUA 1UJ3A 3GSWB 1RIUL 2BVQA 1L5GA 1YYCA 2WLHA 4TQEH 4Z23A 3ARRA 5F89A 1CT8A 4JFED 3DBSA 5EOCH 4KQ4L 3B37A 1A4JA 2ADJA 4B9JA 2CDGA 4IYKA 4AGQA 2N59A 3ASOB 3BZDA 3C5ZB 1S9VA 2MTPA 4K3EH 3KLSA 5IVOA 1PY4A 1WT5A 5F1IA 4FABL 1VZHA 4PJCA 4O5LL 5CM1A 1MIEH 5GRVK 3UOAB 4FLOA 3QI9A 4ZMYA 1WFMA 2HLEB 3BZ4B 3VXSD 1A7BA 2NUPB 4M1DH 2A6DA 2RTTA 4QGTA 3CZJA 4NSKB 3S6CA 2F54E 5CJ5A 2V9TA 2MRYA 4QRRD 3LIZH 3U1PA 3MVSA 3O4LE 4WFHD 1G9MC 4L8CA 2VDNB 4JFHD 2HKHL 1BHGA 4ZODA 3DLQR 3WXVL 4B60A 3LH2L 2GK0B 4H5SB 2VC2B 4GYBA 4LVNB 5IESL 1HKFA 4ZUTA 3UTSA 5IJKA 1GR7A 5DD3L 1KENL 3IAQA 3UBFA 4PJDF 3T4YA 3ABGA 5TQ0H 3MREA 1MDAA 5C6PB 2AP2A 4NENB 5DMGC 2AJZB 3VXUA 2F1AA 1DQJB 3CVHL 4AYFB 3KLAA 3L13A 5C0CD 1XWVA 5E5LA 1TCRA 3TO4A 2AAAA 1MNUL 4OD2B 2IGFH 2OSLA 5K93A 1E4XI 1D5MB 4Z3EA 4X6FA 2K8MA 1KJ3L 4NKOB 1MFCL 3L3DB 4GG6B 5TF0A 4AOFA 5ID0A 3BVVA 3D25B 5I1GH 3JV6B 4WUUA 1S7TB 3FUIA 4RDQF 5F6IC 5HHVH 4CVWA 4DPBX 4IOIB 1RL1A 3QORD 3A4AA 1INDL 1SRDA 4HXAH 1XGTA 3RIAF 1DUYB 2BX5A 4TVPD 1U30A 2KLTA 2P8LA 5EU3B 3ARZA 4JFDB 4MD4B 3ETBJ 5GRJH 2ESVB 3HNVL 4HBQA 4GRWF 4JFOB 3VRJA 3X11A 2NZ9D 2A6JA 4I9WE 4JRFA 1R3JA 2DL9A 2VDQL 3OB0H 5DZJA 2F6AA 4BH7B 3LAFA 4NQCA 2OTWB 2WAHA 5IEKA 2W65A 4XCYA 5CEXA 4NO0A 4R7DA 5BZWB 1NCWH 1F90H 2BRRL 4I3SH 1G9NL 3NZUA 3QH3A 2DYRB 1NCOA 3L81A 4RAUA 4IIZA 1HH6B 2XZQL 2Z8SA 2XKUA 3TWYA 4ONOA 1FC2D 3RKDD 2AJSL 3DPDA 1FYHB 2CG9X 3IE9A 1N6VA 2UXTA 4PYGA 4YE0A 2IAMA 1HZHH 4P06A 4PB0L 4GB9A 3ABMB 4PEEA 1A5FL 3SKMA 5D1QA 5IBTL 3DVIA 2FZ3B 3M1BA 1A2YB 1XAKA 3QEQA 4YO0B 1UWXH 4HT1H 2VLJB 5CLXA 2V4LA 3IFOA 3HG1A 3OC5A 5DDHB 2OMVB 1MCFA 3CXFA 2CJUL 2BNRD 3MRJB 25C8L 2XWJB 4E9YA 1U0QA 3WMQA 2C9VA 3TC9A 1YPZF 3AM8C 3LXBA 1USZA 4KY2A 4MNQD 3V52H 4YDVB 3VB8A 1ASOA 4P57A 1PNDA 1OQOA 3QFJD 3MRGA 5GZOD 3T5WA 2VDNH 3E8VA 3D85B 1I1FA 3IGLA 1G6RL 1HQRA 1UM6L 4BXSV 5J0BA 5CZXC 3BN9C 2VC2H 1NIDA 3AQDA 3OR7A 1WO2A 4JKWA 4F37F 2QZ5A 3LZNA 3LDBC 4Q6IC 4TUKL 4L4TA 5DUML 1WICA 1NC2B 1NJ9A 1KG0A 1IFRA 1TQBC 4ELMA 1J9RA 3N5AA 1E5BA 3MOBL 2JKRM 3DGDA 3C5XA 5F9OL 2XZZA 2C3VB 5IMOA 3SE8H 2OTUB 4MAUH 2EZ0C 4TTDC 5HGDB 3ZDYE 4E5XB 4KK9D 2JTDA 2WSDA 2HTKD 5ENWA 5E4AA 1HJCA 3TEZA 2I5YL 4TVPH 4PFEA 1ZHBB 1JGDB 4PJGB 2BY2A 3L3GB 3RB5A 2FB4H 5JIDA 3FS9A 2R0LH 2VN6A 1KUMA 1MW0A 4PBWD 2AQTA 4PP1C 5DUBA 5JIHA 3BE1H 3JSSA 4X5WA 3RGVD 5FOJA 4H0GA 5IBUG 3U46B 3ZO9A 3BP6A 3S3PA 1NANH 3U2SB 1FVDB 1SUJA 1YEJL 2KMWA 1ZCRA 4LU5H 4JQXC 1LTXA 1RZKC 2AW2A 4Z5RA 1C08A 5FIEA 5LNEA 3CQQA 5KZCB 1ZLVH 1R0AL 2DQJH 2YPKB 4AT6A 5EG6C 4GFTB 2XIIA 4LOUD 1KTJA 1E4WH 1NIAA 4HK3J 3VFUB 1QFUL 2HT3D 3OV6A 2FHFA 1JVOA 1AZRA 3ABZA 3ZE1F 1QUNA 1MIMH 4PJIA 1C5BH 1HHIA 1KV3A 1KB5B 5T5NF 2Q8AL 4YDLC 4HH9A 4I9XA 4M1CC 4YHNB 2F5BH 3DOIA 4KV5F 2Q10A 5F7HA 3RDTC 4OF8A 4LOFA 3UCRA 2BSDA 3QCUL 1XR8A 5KVGL 2PXYB 3GXIA 1T04A 5GGUA 5KBLA