5DZKA

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
196
structure length
196
Chain Sequence
ILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
total genus 67
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F, G, a, b, c, d, e, f, g
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5dzkA00
1FC9A 4K29A 4JJTA 2NP9A 3QREA 3WG5A 1XNWA 3V5EA 3Q0JA 1YG6A 5FUSA 3DORA 5DUCA 1EF9A 1DUBA 4ZDEA 3V5IA 1RJMA 3H0QA 4HC8A 1HNOA 1N6DA 1O8UA 4K2NA 3P85A 3HP0A 4B3JA 4JCSA 3T88A 2DUBA 3NJDA 3GKBA 1PJHA 5C90A 5INFA 2J5GA 3HE2A 4IZDA 1UYSA 3H0UA 3FF6A 4QFEA 3SWXA 3KTIA 5E0NX 1WDMA 3STAA 2A7KA 3BEZA 3P2LA 1HZDA 3VIVA 4B3IA 3N6RB 2VSUF 3RSTA 5C9GA 2BZRA 3KTKA 2Q35A 4WCZA 3BPPA 3G64A 1J7XA 4YLHA 4FB8A 3H0SA 3H0JA 3SLLA 4ELWA 4OLQA 2F9IB 3OT6A 4JCRA 3KTGA 4EMMA 1W2XA 4FZWA 4I4ZA 2HW5A 2J5IA 2X24A 4KD6A 3TLFA 1K39A 4KPKA 3GMAA 1FCFA 1UYVA 3ZWBA 3T8BA 2F9IA 2J5II 1OD2A 2ZL0A 4Q1IA 5DTPA 3TT6A 4LK5A 4FZWC 2ZL3A 4RCNA 4NNQA 2ZL4A 4Z0MA 4OMRA 4KNPA 4GM2A 5INGA 4ASIA 5INIA 3R9QA 4U1AA 4JYLA 1OD4A 3H02A 4EMPA 3PZKA 4JVTA 3RRVA 3QMJA 1Y7OA 2C8TA 4F47A 4QIJA 3GF3A 3LAOA 1VRGA 5E0SA 4ZU2A 2WTBA 3K8XA 3QWDA 4L8KA 3R9SA 3M6NA 2VSUE 3QYRA 2UZFA 2X58A 4MI2A 4WYOB 2Q34A 4QIIA 2FW2A 3Q7HA 2PPYA 1WDLA 1TG6A 2QQ3A 2F6QA 5E0SH 4IZBA 4ELXA 1Q51A 3QXZA 1WZ8A 3IBBA 2J5SA 4K3WA 1K32A 3TVUA 2VSSA 3OMEA 3GLMA 3U9SB 4L6WA 3U9TB 3TRRA 3KTHA 3IB9A 4JSBA 5DU4A 3TDCA 1XX4A 3MYBA 5DKPA 3R9TA 2F6IA 2VSUA 3TVWA 3ZW8A 3ST9A 1ON3A 4Q0GA 1XNVA 4OG1A 4JFCA 4WZ8B 3R6HA 3Q1TA 3P5MA 2D3TA 5JBWA 1UYTA 4HNKA 3ZWAA 2VX2A 4RYFA 1MJ3A 2VREA 3NJBA 4ZDDA 1RJNA 3TV5A 2VSUC 4MXIA 1WDKA 4JOTA 1DCIA 3FDUA 1FC6A 1UIYA 2ZL2A 5G1SA 3DJAA 3TT7A 1Q52A 2IEXA 2J5GD 3K50A 5DZKH 3JU1A 3ZWCA 5DUFA 3PEAA 3H81A 3QKAA 1N6EA 3LKEA 2ZQQA 1XNYA 3QK8A 1ON9A 4U0GA 4JCQA 5DZKA 4B3HA 5CTBA 3BF0A 1X0UA 4KWBA 5G1RA 4RYFH 2Q2XA 3IAVA 1PIXA 3MFMA 2CBYA 5G1QA 4ZDFA 3ZW9A 3T3WA 3L3SA 5IKLB 2A81A 4IZCA 3MOYA 3R0OA 5DL1A 5CTCA 2VSSE 3HLN1 5KJPA 5DU6A 5KDRA 4JWVA 5DTWA 3MT6A 2F9YB 1EY3A 3GF7A 2W3PA 3T8AA 1JXZA 1UYRA 4ZDCA 2ZQRA 2FZSA 4DI1A 5DU8A 3T89A 1NZYB 5FIFA 4EMLA 4U19A 4ELSA 3HINA 4FN8A 3ISAA 1HNUA 4JYJA 2J5IB 4U0GH 4FNBA 1NZYA 3PE8A 4NEKA 4GHNA 1SZOA 3RSIA 3KTJA 3TZ3A 3KQFA 1XO6A 4JCTA 1YG8A 2F9YA 4MOUA 2PBPA 2A7SA 3I47A 4FJWD 5MGBA 1N6FA 1SG4A 2VSSF 4I52A 3QXIA 5JBXA 1FC7A 4I42A 5KDRB 3PGQA 3OC7A 3HRXA 1TYFA 4ZDBA 4U0HA 2EJ5A 4G2RA 4U18A 3M6MA 2PG8A 4FN7A 2FBMA 2CE3A 1EF8A 2GTRA 3Q0GA 3U9RB 4FNDA 2DEOA
chains in the Genus database with same CATH superfamily
5HUQA 1FC9A 4K29A 4JJTA 2NP9A 3QREA 3WG5A 1XNWA 3V5EA 3Q0JA 1YG6A 5FUSA 3DORA 5DUCA 1EF9A 1DUBA 4ZDEA 3V5IA 1RJMA 3H0QA 4HC8A 1HNOA 1N6DA 1O8UA 4K2NA 3P85A 3HP0A 4B3JA 4JCSA 3T88A 2DUBA 3NJDA 3GKBA 1PJHA 5C90A 5INFA 2J5GA 3HE2A 4IZDA 1UYSA 3H0UA 3FF6A 4QFEA 3SWXA 3KTIA 5E0NX 1WDMA 3STAA 2A7KA 3BEZA 3P2LA 1HZDA 3VIVA 4B3IA 3N6RB 2VSUF 3RSTA 5C9GA 2BZRA 3KTKA 2Q35A 4WCZA 3BPPA 3G64A 1J7XA 4YLHA 4FB8A 3H0SA 3H0JA 3SLLA 4ELWA 4OLQA 2F9IB 3OT6A 4JCRA 3KTGA 4EMMA 1W2XA 4FZWA 4I4ZA 2HW5A 2J5IA 2X24A 4KD6A 3TLFA 1K39A 4KPKA 3GMAA 1FCFA 1UYVA 3ZWBA 3T8BA 2F9IA 2J5II 1OD2A 2ZL0A 4Q1IA 5DTPA 3TT6A 4LK5A 4FZWC 2ZL3A 4RCNA 4NNQA 2ZL4A 4Z0MA 4OMRA 4KNPA 4GM2A 5INGA 4ASIA 5INIA 3R9QA 4U1AA 4JYLA 1OD4A 3H02A 4EMPA 3PZKA 4JVTA 3RRVA 3QMJA 1Y7OA 2C8TA 4F47A 4QIJA 3GF3A 3LAOA 1VRGA 5E0SA 4ZU2A 2WTBA 3K8XA 3QWDA 4L8KA 3R9SA 3M6NA 2VSUE 3QYRA 2UZFA 2X58A 4MI2A 4WYOB 2Q34A 4QIIA 2FW2A 3Q7HA 2PPYA 1WDLA 1TG6A 2QQ3A 2F6QA 5E0SH 4IZBA 4ELXA 1Q51A 3QXZA 1WZ8A 3IBBA 2J5SA 4K3WA 1K32A 3TVUA 2VSSA 3OMEA 3GLMA 3U9SB 4L6WA 3U9TB 3TRRA 3KTHA 3IB9A 4JSBA 5DU4A 3TDCA 1XX4A 3MYBA 5DKPA 3R9TA 2F6IA 2VSUA 3TVWA 2YJGA 3ZW8A 3ST9A 1ON3A 4Q0GA 1XNVA 4OG1A 4JFCA 4WZ8B 3R6HA 3Q1TA 3P5MA 2D3TA 5JBWA 1UYTA 4HNKA 3ZWAA 2VX2A 4RYFA 1MJ3A 2VREA 3NJBA 4ZDDA 1RJNA 3TV5A 2VSUC 4MXIA 1WDKA 4JOTA 1DCIA 3FDUA 1FC6A 1UIYA 2ZL2A 5G1SA 3DJAA 4J2UA 3TT7A 1Q52A 2IEXA 2J5GD 3K50A 5DZKH 3JU1A 3ZWCA 5DUFA 3PEAA 3H81A 3QKAA 1N6EA 3LKEA 2ZQQA 1XNYA 3QK8A 1ON9A 4U0GA 4JCQA 5DZKA 4B3HA 5CTBA 3BF0A 3BPTA 1X0UA 4KWBA 5G1RA 4RYFH 2Q2XA 3IAVA 1PIXA 3MFMA 2CBYA 5G1QA 4ZDFA 3ZW9A 3T3WA 3L3SA 5IKLB 2A81A 4IZCA 3MOYA 3R0OA 5DL1A 5CTCA 2VSSE 3HLN1 5KJPA 5DU6A 5KDRA 4JWVA 5DTWA 3MT6A 2F9YB 1EY3A 3GF7A 2W3PA 3T8AA 1JXZA 1UYRA 4ZDCA 2ZQRA 2FZSA 4HDTA 4DI1A 5DU8A 3T89A 1NZYB 5FIFA 4NARA 4EMLA 4U19A 4ELSA 3HINA 4FN8A 3ISAA 1HNUA 4JYJA 2J5IB 4U0GH 4FNBA 1NZYA 3PE8A 4NEKA 4GHNA 1SZOA 3RSIA 3KTJA 3TZ3A 3KQFA 1XO6A 4JCTA 1YG8A 2F9YA 4MOUA 2PBPA 2A7SA 3I47A 4FJWD 5MGBA 1N6FA 1SG4A 2VSSF 4I52A 3QXIA 5JBXA 1FC7A 4I42A 5KDRB 3PGQA 3OC7A 3HRXA 1TYFA 4ZDBA 4U0HA 2EJ5A 4G2RA 4U18A 3M6MA 2PG8A 4FN7A 2FBMA 2CE3A 1EF8A 2GTRA 3Q0GA 3U9RB 4FNDA 2DEOA
chains in the Genus database with same CATH topology
5HUQA 1FC9A 4K29A 4JJTA 2NP9A 3QREA 3WG5A 1XNWA 3V5EA 3Q0JA 1YG6A 5FUSA 3DORA 5DUCA 1EF9A 1DUBA 4ZDEA 3V5IA 1RJMA 3H0QA 4HC8A 1HNOA 1N6DA 1O8UA 4K2NA 3P85A 3HP0A 4B3JA 4JCSA 3T88A 2DUBA 3NJDA 3GKBA 1PJHA 5C90A 5INFA 2J5GA 3HE2A 4IZDA 1UYSA 3H0UA 3FF6A 4QFEA 3SWXA 3KTIA 5E0NX 1WDMA 3STAA 2A7KA 3BEZA 3P2LA 1HZDA 3VIVA 4B3IA 3N6RB 2VSUF 3RSTA 5C9GA 2BZRA 3KTKA 2Q35A 4WCZA 3BPPA 3G64A 1J7XA 4YLHA 4FB8A 3H0SA 3H0JA 3SLLA 4ELWA 4OLQA 2F9IB 3OT6A 4JCRA 3KTGA 4EMMA 1W2XA 4FZWA 4I4ZA 2HW5A 2J5IA 2X24A 4KD6A 3TLFA 1K39A 4KPKA 3GMAA 1FCFA 1UYVA 3ZWBA 3T8BA 2F9IA 2J5II 1OD2A 2ZL0A 4Q1IA 5DTPA 3TT6A 4LK5A 4FZWC 2ZL3A 4RCNA 4NNQA 2ZL4A 4Z0MA 4OMRA 4KNPA 4GM2A 5INGA 4ASIA 5INIA 3R9QA 4U1AA 4JYLA 1OD4A 3H02A 4EMPA 3PZKA 4JVTA 3RRVA 3QMJA 1Y7OA 2C8TA 4F47A 4QIJA 3GF3A 3LAOA 1VRGA 5E0SA 4ZU2A 2WTBA 3K8XA 3QWDA 4L8KA 3R9SA 3M6NA 2VSUE 3QYRA 2UZFA 2X58A 4MI2A 4WYOB 2Q34A 4QIIA 2FW2A 3Q7HA 2PPYA 1WDLA 1TG6A 2QQ3A 2F6QA 5E0SH 4IZBA 4ELXA 1Q51A 3QXZA 1WZ8A 3IBBA 2J5SA 4K3WA 1K32A 3TVUA 2VSSA 3OMEA 3GLMA 3U9SB 4L6WA 3U9TB 3TRRA 3KTHA 3IB9A 4JSBA 5DU4A 3TDCA 1XX4A 3MYBA 5DKPA 3R9TA 2F6IA 2VSUA 3TVWA 2YJGA 3ZW8A 3ST9A 1ON3A 4Q0GA 1XNVA 4OG1A 4JFCA 4WZ8B 3R6HA 3Q1TA 3P5MA 2D3TA 5JBWA 1UYTA 4HNKA 3ZWAA 2VX2A 4RYFA 1MJ3A 2VREA 3NJBA 4ZDDA 1RJNA 3TV5A 2VSUC 4MXIA 1WDKA 4JOTA 1DCIA 3FDUA 1FC6A 1UIYA 2ZL2A 5G1SA 3DJAA 4J2UA 3TT7A 1Q52A 2IEXA 2J5GD 3K50A 5DZKH 3JU1A 3ZWCA 5DUFA 3PEAA 3H81A 3QKAA 1N6EA 3LKEA 2ZQQA 1XNYA 3QK8A 1ON9A 4U0GA 4JCQA 5DZKA 4B3HA 5CTBA 3BF0A 3BPTA 1X0UA 4KWBA 5G1RA 4RYFH 2Q2XA 3IAVA 1PIXA 3MFMA 2CBYA 5G1QA 4ZDFA 3ZW9A 3T3WA 3L3SA 5IKLB 2A81A 4IZCA 3MOYA 3R0OA 5DL1A 5CTCA 2VSSE 3HLN1 5KJPA 5DU6A 5KDRA 4JWVA 5DTWA 3MT6A 2F9YB 1EY3A 3GF7A 2W3PA 3T8AA 1JXZA 1UYRA 4ZDCA 2ZQRA 2FZSA 4HDTA 4DI1A 5DU8A 3T89A 1NZYB 5FIFA 4NARA 4EMLA 4U19A 4ELSA 3HINA 4FN8A 3ISAA 1HNUA 4JYJA 2J5IB 4U0GH 4FNBA 1NZYA 3PE8A 4NEKA 4GHNA 1SZOA 3RSIA 3KTJA 3TZ3A 3KQFA 1XO6A 4JCTA 1YG8A 2F9YA 4MOUA 2PBPA 2A7SA 3I47A 4FJWD 5MGBA 1N6FA 1SG4A 2VSSF 4I52A 3QXIA 5JBXA 1FC7A 4I42A 5KDRB 3PGQA 3OC7A 3HRXA 1TYFA 4ZDBA 4U0HA 2EJ5A 4G2RA 4U18A 3M6MA 2PG8A 4FN7A 2FBMA 2CE3A 1EF8A 2GTRA 3Q0GA 3U9RB 4FNDA 2DEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC9 A;  4K29 A;  4JJT A;  2NP9 A;  3QRE A;  3WG5 A;  1XNW A;  3V5E A;  3Q0J A;  1YG6 A;  5FUS A;  3DOR A;  5DUC A;  1EF9 A;  1DUB A;  4ZDE A;  3V5I A;  1RJM A;  3H0Q A;  4HC8 A;  1HNO A;  1N6D A;  1O8U A;  4K2N A;  3P85 A;  3HP0 A;  4B3J A;  4JCS A;  3T88 A;  2DUB A;  3NJD A;  3GKB A;  1PJH A;  5C90 A;  5INF A;  2J5G A;  3HE2 A;  4IZD A;  1UYS A;  3H0U A;  3FF6 A;  4QFE A;  3SWX A;  3KTI A;  5E0N X;  1WDM A;  3STA A;  2A7K A;  3BEZ A;  3P2L A;  1HZD A;  3VIV A;  4B3I A;  3N6R B;  2VSU F;  3RST A;  5C9G A;  2BZR A;  3KTK A;  2Q35 A;  4WCZ A;  3BPP A;  3G64 A;  1J7X A;  4YLH A;  4FB8 A;  3H0S A;  3H0J A;  3SLL A;  4ELW A;  4OLQ A;  2F9I B;  3OT6 A;  4JCR A;  3KTG A;  4EMM A;  1W2X A;  4FZW A;  4I4Z A;  2HW5 A;  2J5I A;  2X24 A;  4KD6 A;  3TLF A;  1K39 A;  4KPK A;  3GMA A;  1FCF A;  1UYV A;  3ZWB A;  3T8B A;  2F9I A;  2J5I I;  1OD2 A;  2ZL0 A;  4Q1I A;  5DTP A;  3TT6 A;  4LK5 A;  4FZW C;  2ZL3 A;  4RCN A;  4NNQ A;  2ZL4 A;  4Z0M A;  4OMR A;  4KNP A;  4GM2 A;  5ING A;  4ASI A;  5INI A;  3R9Q A;  4U1A A;  4JYL A;  1OD4 A;  3H02 A;  4EMP A;  3PZK A;  4JVT A;  3RRV A;  3QMJ A;  1Y7O A;  2C8T A;  4F47 A;  4QIJ A;  3GF3 A;  3LAO A;  1VRG A;  5E0S A;  4ZU2 A;  2WTB A;  3K8X A;  3QWD A;  4L8K A;  3R9S A;  3M6N A;  2VSU E;  3QYR A;  2UZF A;  2X58 A;  4MI2 A;  4WYO B;  2Q34 A;  4QII A;  2FW2 A;  3Q7H A;  2PPY A;  1WDL A;  1TG6 A;  2QQ3 A;  2F6Q A;  5E0S H;  4IZB A;  4ELX A;  1Q51 A;  3QXZ A;  1WZ8 A;  3IBB A;  2J5S A;  4K3W A;  1K32 A;  3TVU A;  2VSS A;  3OME A;  3GLM A;  3U9S B;  4L6W A;  3U9T B;  3TRR A;  3KTH A;  3IB9 A;  4JSB A;  5DU4 A;  3TDC A;  1XX4 A;  3MYB A;  5DKP A;  3R9T A;  2F6I A;  2VSU A;  3TVW A;  3ZW8 A;  3ST9 A;  1ON3 A;  4Q0G A;  1XNV A;  4OG1 A;  4JFC A;  4WZ8 B;  3R6H A;  3Q1T A;  3P5M A;  2D3T A;  5JBW A;  1UYT A;  4HNK A;  3ZWA A;  2VX2 A;  4RYF A;  1MJ3 A;  2VRE A;  3NJB A;  4ZDD A;  1RJN A;  3TV5 A;  2VSU C;  4MXI A;  1WDK A;  4JOT A;  1DCI A;  3FDU A;  1FC6 A;  1UIY A;  2ZL2 A;  5G1S A;  3DJA A;  3TT7 A;  1Q52 A;  2IEX A;  2J5G D;  3K50 A;  5DZK H;  3JU1 A;  3ZWC A;  5DUF A;  3PEA A;  3H81 A;  3QKA A;  1N6E A;  3LKE A;  2ZQQ A;  1XNY A;  3QK8 A;  1ON9 A;  4U0G A;  4JCQ A;  5DZK A;  4B3H A;  5CTB A;  3BF0 A;  1X0U A;  4KWB A;  5G1R A;  4RYF H;  2Q2X A;  3IAV A;  1PIX A;  3MFM A;  2CBY A;  5G1Q A;  4ZDF A;  3ZW9 A;  3T3W A;  3L3S A;  5IKL B;  2A81 A;  4IZC A;  3MOY A;  3R0O A;  5DL1 A;  5CTC A;  2VSS E;  3HLN 1;  5KJP A;  5DU6 A;  5KDR A;  4JWV A;  5DTW A;  3MT6 A;  2F9Y B;  1EY3 A;  3GF7 A;  2W3P A;  3T8A A;  1JXZ A;  1UYR A;  4ZDC A;  2ZQR A;  2FZS A;  4DI1 A;  5DU8 A;  3T89 A;  1NZY B;  5FIF A;  4EML A;  4U19 A;  4ELS A;  3HIN A;  4FN8 A;  3ISA A;  1HNU A;  4JYJ A;  2J5I B;  4U0G H;  4FNB A;  1NZY A;  3PE8 A;  4NEK A;  4GHN A;  1SZO A;  3RSI A;  3KTJ A;  3TZ3 A;  3KQF A;  1XO6 A;  4JCT A;  1YG8 A;  2F9Y A;  4MOU A;  2PBP A;  2A7S A;  3I47 A;  4FJW D;  5MGB A;  1N6F A;  1SG4 A;  2VSS F;  4I52 A;  3QXI A;  5JBX A;  1FC7 A;  4I42 A;  5KDR B;  3PGQ A;  3OC7 A;  3HRX A;  1TYF A;  4ZDB A;  4U0H A;  2EJ5 A;  4G2R A;  4U18 A;  3M6M A;  2PG8 A;  4FN7 A;  2FBM A;  2CE3 A;  1EF8 A;  2GTR A;  3Q0G A;  3U9R B;  4FND A;  2DEO A; 
#chains in the Genus database with same CATH topology
 5HUQ A;  1FC9 A;  4K29 A;  4JJT A;  2NP9 A;  3QRE A;  3WG5 A;  1XNW A;  3V5E A;  3Q0J A;  1YG6 A;  5FUS A;  3DOR A;  5DUC A;  1EF9 A;  1DUB A;  4ZDE A;  3V5I A;  1RJM A;  3H0Q A;  4HC8 A;  1HNO A;  1N6D A;  1O8U A;  4K2N A;  3P85 A;  3HP0 A;  4B3J A;  4JCS A;  3T88 A;  2DUB A;  3NJD A;  3GKB A;  1PJH A;  5C90 A;  5INF A;  2J5G A;  3HE2 A;  4IZD A;  1UYS A;  3H0U A;  3FF6 A;  4QFE A;  3SWX A;  3KTI A;  5E0N X;  1WDM A;  3STA A;  2A7K A;  3BEZ A;  3P2L A;  1HZD A;  3VIV A;  4B3I A;  3N6R B;  2VSU F;  3RST A;  5C9G A;  2BZR A;  3KTK A;  2Q35 A;  4WCZ A;  3BPP A;  3G64 A;  1J7X A;  4YLH A;  4FB8 A;  3H0S A;  3H0J A;  3SLL A;  4ELW A;  4OLQ A;  2F9I B;  3OT6 A;  4JCR A;  3KTG A;  4EMM A;  1W2X A;  4FZW A;  4I4Z A;  2HW5 A;  2J5I A;  2X24 A;  4KD6 A;  3TLF A;  1K39 A;  4KPK A;  3GMA A;  1FCF A;  1UYV A;  3ZWB A;  3T8B A;  2F9I A;  2J5I I;  1OD2 A;  2ZL0 A;  4Q1I A;  5DTP A;  3TT6 A;  4LK5 A;  4FZW C;  2ZL3 A;  4RCN A;  4NNQ A;  2ZL4 A;  4Z0M A;  4OMR A;  4KNP A;  4GM2 A;  5ING A;  4ASI A;  5INI A;  3R9Q A;  4U1A A;  4JYL A;  1OD4 A;  3H02 A;  4EMP A;  3PZK A;  4JVT A;  3RRV A;  3QMJ A;  1Y7O A;  2C8T A;  4F47 A;  4QIJ A;  3GF3 A;  3LAO A;  1VRG A;  5E0S A;  4ZU2 A;  2WTB A;  3K8X A;  3QWD A;  4L8K A;  3R9S A;  3M6N A;  2VSU E;  3QYR A;  2UZF A;  2X58 A;  4MI2 A;  4WYO B;  2Q34 A;  4QII A;  2FW2 A;  3Q7H A;  2PPY A;  1WDL A;  1TG6 A;  2QQ3 A;  2F6Q A;  5E0S H;  4IZB A;  4ELX A;  1Q51 A;  3QXZ A;  1WZ8 A;  3IBB A;  2J5S A;  4K3W A;  1K32 A;  3TVU A;  2VSS A;  3OME A;  3GLM A;  3U9S B;  4L6W A;  3U9T B;  3TRR A;  3KTH A;  3IB9 A;  4JSB A;  5DU4 A;  3TDC A;  1XX4 A;  3MYB A;  5DKP A;  3R9T A;  2F6I A;  2VSU A;  3TVW A;  2YJG A;  3ZW8 A;  3ST9 A;  1ON3 A;  4Q0G A;  1XNV A;  4OG1 A;  4JFC A;  4WZ8 B;  3R6H A;  3Q1T A;  3P5M A;  2D3T A;  5JBW A;  1UYT A;  4HNK A;  3ZWA A;  2VX2 A;  4RYF A;  1MJ3 A;  2VRE A;  3NJB A;  4ZDD A;  1RJN A;  3TV5 A;  2VSU C;  4MXI A;  1WDK A;  4JOT A;  1DCI A;  3FDU A;  1FC6 A;  1UIY A;  2ZL2 A;  5G1S A;  3DJA A;  4J2U A;  3TT7 A;  1Q52 A;  2IEX A;  2J5G D;  3K50 A;  5DZK H;  3JU1 A;  3ZWC A;  5DUF A;  3PEA A;  3H81 A;  3QKA A;  1N6E A;  3LKE A;  2ZQQ A;  1XNY A;  3QK8 A;  1ON9 A;  4U0G A;  4JCQ A;  5DZK A;  4B3H A;  5CTB A;  3BF0 A;  3BPT A;  1X0U A;  4KWB A;  5G1R A;  4RYF H;  2Q2X A;  3IAV A;  1PIX A;  3MFM A;  2CBY A;  5G1Q A;  4ZDF A;  3ZW9 A;  3T3W A;  3L3S A;  5IKL B;  2A81 A;  4IZC A;  3MOY A;  3R0O A;  5DL1 A;  5CTC A;  2VSS E;  3HLN 1;  5KJP A;  5DU6 A;  5KDR A;  4JWV A;  5DTW A;  3MT6 A;  2F9Y B;  1EY3 A;  3GF7 A;  2W3P A;  3T8A A;  1JXZ A;  1UYR A;  4ZDC A;  2ZQR A;  2FZS A;  4HDT A;  4DI1 A;  5DU8 A;  3T89 A;  1NZY B;  5FIF A;  4NAR A;  4EML A;  4U19 A;  4ELS A;  3HIN A;  4FN8 A;  3ISA A;  1HNU A;  4JYJ A;  2J5I B;  4U0G H;  4FNB A;  1NZY A;  3PE8 A;  4NEK A;  4GHN A;  1SZO A;  3RSI A;  3KTJ A;  3TZ3 A;  3KQF A;  1XO6 A;  4JCT A;  1YG8 A;  2F9Y A;  4MOU A;  2PBP A;  2A7S A;  3I47 A;  4FJW D;  5MGB A;  1N6F A;  1SG4 A;  2VSS F;  4I52 A;  3QXI A;  5JBX A;  1FC7 A;  4I42 A;  5KDR B;  3PGQ A;  3OC7 A;  3HRX A;  1TYF A;  4ZDB A;  4U0H A;  2EJ5 A;  4G2R A;  4U18 A;  3M6M A;  2PG8 A;  4FN7 A;  2FBM A;  2CE3 A;  1EF8 A;  2GTR A;  3Q0G A;  3U9R B;  4FND A;  2DEO A; 
#chains in the Genus database with same CATH homology
 5HUQ A;  1FC9 A;  4K29 A;  4JJT A;  2NP9 A;  3QRE A;  3WG5 A;  1XNW A;  3V5E A;  3Q0J A;  1YG6 A;  5FUS A;  3DOR A;  5DUC A;  1EF9 A;  1DUB A;  4ZDE A;  3V5I A;  1RJM A;  3H0Q A;  4HC8 A;  1HNO A;  1N6D A;  1O8U A;  4K2N A;  3P85 A;  3HP0 A;  4B3J A;  4JCS A;  3T88 A;  2DUB A;  3NJD A;  3GKB A;  1PJH A;  5C90 A;  5INF A;  2J5G A;  3HE2 A;  4IZD A;  1UYS A;  3H0U A;  3FF6 A;  4QFE A;  3SWX A;  3KTI A;  5E0N X;  1WDM A;  3STA A;  2A7K A;  3BEZ A;  3P2L A;  1HZD A;  3VIV A;  4B3I A;  3N6R B;  2VSU F;  3RST A;  5C9G A;  2BZR A;  3KTK A;  2Q35 A;  4WCZ A;  3BPP A;  3G64 A;  1J7X A;  4YLH A;  4FB8 A;  3H0S A;  3H0J A;  3SLL A;  4ELW A;  4OLQ A;  2F9I B;  3OT6 A;  4JCR A;  3KTG A;  4EMM A;  1W2X A;  4FZW A;  4I4Z A;  2HW5 A;  2J5I A;  2X24 A;  4KD6 A;  3TLF A;  1K39 A;  4KPK A;  3GMA A;  1FCF A;  1UYV A;  3ZWB A;  3T8B A;  2F9I A;  2J5I I;  1OD2 A;  2ZL0 A;  4Q1I A;  5DTP A;  3TT6 A;  4LK5 A;  4FZW C;  2ZL3 A;  4RCN A;  4NNQ A;  2ZL4 A;  4Z0M A;  4OMR A;  4KNP A;  4GM2 A;  5ING A;  4ASI A;  5INI A;  3R9Q A;  4U1A A;  4JYL A;  1OD4 A;  3H02 A;  4EMP A;  3PZK A;  4JVT A;  3RRV A;  3QMJ A;  1Y7O A;  2C8T A;  4F47 A;  4QIJ A;  3GF3 A;  3LAO A;  1VRG A;  5E0S A;  4ZU2 A;  2WTB A;  3K8X A;  3QWD A;  4L8K A;  3R9S A;  3M6N A;  2VSU E;  3QYR A;  2UZF A;  2X58 A;  4MI2 A;  4WYO B;  2Q34 A;  4QII A;  2FW2 A;  3Q7H A;  2PPY A;  1WDL A;  1TG6 A;  2QQ3 A;  2F6Q A;  5E0S H;  4IZB A;  4ELX A;  1Q51 A;  3QXZ A;  1WZ8 A;  3IBB A;  2J5S A;  4K3W A;  1K32 A;  3TVU A;  2VSS A;  3OME A;  3GLM A;  3U9S B;  4L6W A;  3U9T B;  3TRR A;  3KTH A;  3IB9 A;  4JSB A;  5DU4 A;  3TDC A;  1XX4 A;  3MYB A;  5DKP A;  3R9T A;  2F6I A;  2VSU A;  3TVW A;  2YJG A;  3ZW8 A;  3ST9 A;  1ON3 A;  4Q0G A;  1XNV A;  4OG1 A;  4JFC A;  4WZ8 B;  3R6H A;  3Q1T A;  3P5M A;  2D3T A;  5JBW A;  1UYT A;  4HNK A;  3ZWA A;  2VX2 A;  4RYF A;  1MJ3 A;  2VRE A;  3NJB A;  4ZDD A;  1RJN A;  3TV5 A;  2VSU C;  4MXI A;  1WDK A;  4JOT A;  1DCI A;  3FDU A;  1FC6 A;  1UIY A;  2ZL2 A;  5G1S A;  3DJA A;  4J2U A;  3TT7 A;  1Q52 A;  2IEX A;  2J5G D;  3K50 A;  5DZK H;  3JU1 A;  3ZWC A;  5DUF A;  3PEA A;  3H81 A;  3QKA A;  1N6E A;  3LKE A;  2ZQQ A;  1XNY A;  3QK8 A;  1ON9 A;  4U0G A;  4JCQ A;  5DZK A;  4B3H A;  5CTB A;  3BF0 A;  3BPT A;  1X0U A;  4KWB A;  5G1R A;  4RYF H;  2Q2X A;  3IAV A;  1PIX A;  3MFM A;  2CBY A;  5G1Q A;  4ZDF A;  3ZW9 A;  3T3W A;  3L3S A;  5IKL B;  2A81 A;  4IZC A;  3MOY A;  3R0O A;  5DL1 A;  5CTC A;  2VSS E;  3HLN 1;  5KJP A;  5DU6 A;  5KDR A;  4JWV A;  5DTW A;  3MT6 A;  2F9Y B;  1EY3 A;  3GF7 A;  2W3P A;  3T8A A;  1JXZ A;  1UYR A;  4ZDC A;  2ZQR A;  2FZS A;  4HDT A;  4DI1 A;  5DU8 A;  3T89 A;  1NZY B;  5FIF A;  4NAR A;  4EML A;  4U19 A;  4ELS A;  3HIN A;  4FN8 A;  3ISA A;  1HNU A;  4JYJ A;  2J5I B;  4U0G H;  4FNB A;  1NZY A;  3PE8 A;  4NEK A;  4GHN A;  1SZO A;  3RSI A;  3KTJ A;  3TZ3 A;  3KQF A;  1XO6 A;  4JCT A;  1YG8 A;  2F9Y A;  4MOU A;  2PBP A;  2A7S A;  3I47 A;  4FJW D;  5MGB A;  1N6F A;  1SG4 A;  2VSS F;  4I52 A;  3QXI A;  5JBX A;  1FC7 A;  4I42 A;  5KDR B;  3PGQ A;  3OC7 A;  3HRX A;  1TYF A;  4ZDB A;  4U0H A;  2EJ5 A;  4G2R A;  4U18 A;  3M6M A;  2PG8 A;  4FN7 A;  2FBM A;  2CE3 A;  1EF8 A;  2GTR A;  3Q0G A;  3U9R B;  4FND A;  2DEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...