5DZKA

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
196
structure length
196
Chain Sequence
ILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
total genus 67
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F, G, a, b, c, d, e, f, g
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5dzkA00
2NP9A 3T88A 2VSSF 2PG8A 3H81A 3TLFA 1K32A 2J5II 2FBMA 3MOYA 3TV5A 5KJPA 4U0GH 3MFMA 1RJNA 3H0QA 4JJTA 1PIXA 2J5IA 4KD6A 3OMEA 2PBPA 2HW5A 2DUBA 3G64A 1YG6A 4B3HA 1HNUA 4F47A 5INGA 4FN8A 4FNBA 4FB8A 3FDUA 5DUCA 4ELWA 4NNQA 2ZL0A 5DU4A 3VIVA 3NJDA 5INIA 1UYTA 4LK5A 2Q2XA 1FC7A 3IAVA 2ZL2A 1DUBA 2ZQRA 1UYVA 4QIIA 4L8KA 4ZDCA 1N6EA 3PE8A 2J5SA 3HINA 5JBWA 2Q34A 5E0NX 4MXIA 3H0SA 5DL1A 4U19A 4RCNA 4IZDA 4GHNA 5DU6A 2C8TA 2WTBA 3H0JA 5DTWA 3OC7A 3H0UA 5G1SA 1FCFA 2PPYA 4GM2A 3DORA 4WYOB 3RSTA 2A7SA 1OD2A 1O8UA 2X24A 3K8XA 1UYRA 4HNKA 1XNVA 1TG6A 1EF8A 1EF9A 4KNPA 3KTKA 2VSUC 4ZDDA 2VSUA 4JYLA 3HE2A 3L3SA 3P85A 3TZ3A 1ON3A 4Q0GA 3MT6A 3IB9A 5G1QA 1OD4A 3P2LA 1WDMA 1WDKA 3GF3A 3TT7A 4ZDEA 3FF6A 3TVWA 1Q52A 4JCTA 2A81A 4KWBA 1Y7OA 4G2RA 3U9RB 4Q1IA 3DJAA 4DI1A 3SLLA 4B3JA 3BEZA 1FC9A 4OG1A 4WZ8B 4K29A 3GMAA 1NZYB 3KQFA 1N6DA 1JXZA 4ELXA 5C90A 1XNWA 4JWVA 4OMRA 5DUFA 1W2XA 4MOUA 4EMLA 4FJWD 3PZKA 3ISAA 3H02A 3V5EA 3GLMA 4U0HA 4Z0MA 3T89A 4ZDBA 5FIFA 2CE3A 4ZDFA 3N6RB 4ZU2A 3R9TA 1XNYA 5E0SH 3QKAA 5CTCA 2EJ5A 1J7XA 3STAA 3SWXA 5JBXA 1PJHA 1ON9A 2F9YA 5DU8A 3WG5A 4JYJA 4K2NA 3RSIA 3QXIA 1VRGA 2ZL3A 2QQ3A 3JU1A 4JOTA 3ZW8A 4I52A 3QMJA 1XO6A 2FW2A 3ZWBA 4QIJA 5KDRA 4ASIA 3TT6A 2IEXA 2FZSA 3Q1TA 3HP0A 1NZYA 3PGQA 2UZFA 1HNOA 3ZWAA 2F9IA 4WCZA 3BF0A 3KTHA 1DCIA 3Q7HA 3M6MA 3QXZA 1Q51A 2VREA 3QYRA 3P5MA 2GTRA 3LAOA 4MI2A 3ST9A 3TRRA 3T8AA 2D3TA 2ZQQA 2F6QA 1WZ8A 3M6NA 3PEAA 3ZWCA 4RYFA 1X0UA 1TYFA 5INFA 2J5IB 3RRVA 3QWDA 3QREA 3Q0JA 2VSUF 3R0OA 5DKPA 1UIYA 4JVTA 3TDCA 4IZBA 2J5GD 5IKLB 3QK8A 4U0GA 4FZWC 3KTIA 2W3PA 4QFEA 2VSUE 1WDLA 1RJMA 2F9IB 3KTJA 4I4ZA 3V5IA 5E0SA 2VX2A 5DTPA 1N6FA 3TVUA 4RYFH 1YG8A 5G1RA 2F6IA 3T8BA 3U9SB 3HRXA 1FC6A 3OT6A 5DZKH 4EMMA 2J5GA 5CTBA 4JCQA 3NJBA 1UYSA 3T3WA 5FUSA 1SG4A 4U1AA 3KTGA 4FZWA 4YLHA 3Q0GA 5KDRB 4ELSA 4JCRA 4JFCA 3K50A 4KPKA 1MJ3A 4HC8A 4EMPA 4JSBA 2VSSE 3IBBA 3I47A 4B3IA 2F9YB 1XX4A 3MYBA 3BPPA 4OLQA 2Q35A 4I42A 3ZW9A 2A7KA 2X58A 5DZKA 2BZRA 2VSSA 2ZL4A 3GKBA 3R9SA 3HLN1 2CBYA 4JCSA 1HZDA 4FN7A 1EY3A 5C9GA 3LKEA 4NEKA 4FNDA 3GF7A 2DEOA 3U9TB 1SZOA 3R6HA 3R9QA 4IZCA 4U18A 5MGBA 4K3WA 4L6WA 1K39A
chains in the Genus database with same CATH superfamily
2NP9A 3T88A 2VSSF 2PG8A 3H81A 3TLFA 1K32A 2J5II 2FBMA 3MOYA 3TV5A 5KJPA 4U0GH 3MFMA 1RJNA 3H0QA 4JJTA 1PIXA 2J5IA 4KD6A 3OMEA 2PBPA 2HW5A 2DUBA 3G64A 1YG6A 4B3HA 1HNUA 4F47A 5INGA 4FN8A 4FNBA 4FB8A 3FDUA 5DUCA 4ELWA 4NNQA 2ZL0A 5DU4A 3VIVA 3NJDA 5INIA 1UYTA 4LK5A 2Q2XA 1FC7A 3IAVA 2ZL2A 1DUBA 2ZQRA 1UYVA 4QIIA 4L8KA 4ZDCA 1N6EA 3PE8A 2J5SA 3HINA 5JBWA 2Q34A 5E0NX 4MXIA 3H0SA 5DL1A 4U19A 4RCNA 4IZDA 4GHNA 5DU6A 2C8TA 2WTBA 3H0JA 5DTWA 3OC7A 3H0UA 5G1SA 1FCFA 2PPYA 4GM2A 3DORA 4WYOB 3RSTA 2A7SA 1OD2A 1O8UA 2X24A 3K8XA 1UYRA 4HNKA 1XNVA 1TG6A 1EF8A 1EF9A 4KNPA 3KTKA 2VSUC 4ZDDA 2VSUA 4JYLA 3HE2A 3L3SA 3P85A 3TZ3A 1ON3A 4Q0GA 3MT6A 3IB9A 5G1QA 1OD4A 3P2LA 1WDMA 1WDKA 3GF3A 3TT7A 4ZDEA 3FF6A 3TVWA 1Q52A 4JCTA 2A81A 4KWBA 1Y7OA 4G2RA 3U9RB 4Q1IA 3DJAA 4DI1A 3SLLA 4B3JA 3BEZA 1FC9A 4OG1A 4WZ8B 4K29A 3GMAA 1NZYB 3KQFA 1N6DA 1JXZA 4ELXA 5C90A 1XNWA 4JWVA 4OMRA 5DUFA 1W2XA 4MOUA 4EMLA 4FJWD 3PZKA 3ISAA 3H02A 3V5EA 3GLMA 4U0HA 4Z0MA 3T89A 4ZDBA 5FIFA 2CE3A 4ZDFA 3N6RB 4ZU2A 3R9TA 1XNYA 4NARA 5E0SH 3QKAA 5CTCA 2EJ5A 1J7XA 3STAA 3SWXA 5JBXA 1PJHA 1ON9A 2F9YA 5DU8A 3WG5A 4JYJA 4K2NA 3RSIA 3QXIA 1VRGA 2ZL3A 2QQ3A 3JU1A 5HUQA 4HDTA 4JOTA 3ZW8A 4I52A 3QMJA 1XO6A 2FW2A 3ZWBA 4QIJA 5KDRA 4ASIA 3TT6A 2IEXA 2FZSA 3Q1TA 3HP0A 1NZYA 3PGQA 2UZFA 1HNOA 3ZWAA 2F9IA 4WCZA 3BF0A 3KTHA 1DCIA 3Q7HA 3M6MA 3QXZA 1Q51A 2VREA 3QYRA 3P5MA 2GTRA 3LAOA 4MI2A 3ST9A 3TRRA 3T8AA 2D3TA 2ZQQA 2F6QA 1WZ8A 3M6NA 3PEAA 3ZWCA 4RYFA 1X0UA 1TYFA 5INFA 2J5IB 3RRVA 3QWDA 3QREA 3Q0JA 2VSUF 3R0OA 5DKPA 1UIYA 4JVTA 3TDCA 4IZBA 2J5GD 5IKLB 3QK8A 4U0GA 4FZWC 3KTIA 2W3PA 4QFEA 2VSUE 1WDLA 1RJMA 2F9IB 3KTJA 4I4ZA 3V5IA 5E0SA 2VX2A 5DTPA 1N6FA 3TVUA 2YJGA 4RYFH 1YG8A 5G1RA 2F6IA 3T8BA 3U9SB 3HRXA 1FC6A 3OT6A 5DZKH 4EMMA 2J5GA 5CTBA 4JCQA 3NJBA 1UYSA 3T3WA 5FUSA 1SG4A 4U1AA 3KTGA 4FZWA 4YLHA 3Q0GA 5KDRB 4ELSA 4JCRA 4JFCA 3K50A 4KPKA 1MJ3A 3BPTA 4J2UA 4HC8A 4EMPA 4JSBA 2VSSE 3IBBA 3I47A 4B3IA 2F9YB 1XX4A 3MYBA 3BPPA 4OLQA 2Q35A 4I42A 3ZW9A 2A7KA 2X58A 5DZKA 2BZRA 2VSSA 2ZL4A 3GKBA 3R9SA 3HLN1 2CBYA 4JCSA 1HZDA 4FN7A 1EY3A 5C9GA 3LKEA 4NEKA 4FNDA 3GF7A 2DEOA 3U9TB 1SZOA 3R6HA 3R9QA 4IZCA 4U18A 5MGBA 4K3WA 4L6WA 1K39A
chains in the Genus database with same CATH topology
2NP9A 3T88A 2VSSF 2PG8A 3H81A 3TLFA 1K32A 2J5II 2FBMA 3MOYA 3TV5A 5KJPA 4U0GH 3MFMA 1RJNA 3H0QA 4JJTA 1PIXA 2J5IA 4KD6A 3OMEA 2PBPA 2HW5A 2DUBA 3G64A 1YG6A 4B3HA 1HNUA 4F47A 5INGA 4FN8A 4FNBA 4FB8A 3FDUA 5DUCA 4ELWA 4NNQA 2ZL0A 5DU4A 3VIVA 3NJDA 5INIA 1UYTA 4LK5A 2Q2XA 1FC7A 3IAVA 2ZL2A 1DUBA 2ZQRA 1UYVA 4QIIA 4L8KA 4ZDCA 1N6EA 3PE8A 2J5SA 3HINA 5JBWA 2Q34A 5E0NX 4MXIA 3H0SA 5DL1A 4U19A 4RCNA 4IZDA 4GHNA 5DU6A 2C8TA 2WTBA 3H0JA 5DTWA 3OC7A 3H0UA 5G1SA 1FCFA 2PPYA 4GM2A 3DORA 4WYOB 3RSTA 2A7SA 1OD2A 1O8UA 2X24A 3K8XA 1UYRA 4HNKA 1XNVA 1TG6A 1EF8A 1EF9A 4KNPA 3KTKA 2VSUC 4ZDDA 2VSUA 4JYLA 3HE2A 3L3SA 3P85A 3TZ3A 1ON3A 4Q0GA 3MT6A 3IB9A 5G1QA 1OD4A 3P2LA 1WDMA 1WDKA 3GF3A 3TT7A 4ZDEA 3FF6A 3TVWA 1Q52A 4JCTA 2A81A 4KWBA 1Y7OA 4G2RA 3U9RB 4Q1IA 3DJAA 4DI1A 3SLLA 4B3JA 3BEZA 1FC9A 4OG1A 4WZ8B 4K29A 3GMAA 1NZYB 3KQFA 1N6DA 1JXZA 4ELXA 5C90A 1XNWA 4JWVA 4OMRA 5DUFA 1W2XA 4MOUA 4EMLA 4FJWD 3PZKA 3ISAA 3H02A 3V5EA 3GLMA 4U0HA 4Z0MA 3T89A 4ZDBA 5FIFA 2CE3A 4ZDFA 3N6RB 4ZU2A 3R9TA 1XNYA 4NARA 5E0SH 3QKAA 5CTCA 2EJ5A 1J7XA 3STAA 3SWXA 5JBXA 1PJHA 1ON9A 2F9YA 5DU8A 3WG5A 4JYJA 4K2NA 3RSIA 3QXIA 1VRGA 2ZL3A 2QQ3A 3JU1A 5HUQA 4HDTA 4JOTA 3ZW8A 4I52A 3QMJA 1XO6A 2FW2A 3ZWBA 4QIJA 5KDRA 4ASIA 3TT6A 2IEXA 2FZSA 3Q1TA 3HP0A 1NZYA 3PGQA 2UZFA 1HNOA 3ZWAA 2F9IA 4WCZA 3BF0A 3KTHA 1DCIA 3Q7HA 3M6MA 3QXZA 1Q51A 2VREA 3QYRA 3P5MA 2GTRA 3LAOA 4MI2A 3ST9A 3TRRA 3T8AA 2D3TA 2ZQQA 2F6QA 1WZ8A 3M6NA 3PEAA 3ZWCA 4RYFA 1X0UA 1TYFA 5INFA 2J5IB 3RRVA 3QWDA 3QREA 3Q0JA 2VSUF 3R0OA 5DKPA 1UIYA 4JVTA 3TDCA 4IZBA 2J5GD 5IKLB 3QK8A 4U0GA 4FZWC 3KTIA 2W3PA 4QFEA 2VSUE 1WDLA 1RJMA 2F9IB 3KTJA 4I4ZA 3V5IA 5E0SA 2VX2A 5DTPA 1N6FA 3TVUA 2YJGA 4RYFH 1YG8A 5G1RA 2F6IA 3T8BA 3U9SB 3HRXA 1FC6A 3OT6A 5DZKH 4EMMA 2J5GA 5CTBA 4JCQA 3NJBA 1UYSA 3T3WA 5FUSA 1SG4A 4U1AA 3KTGA 4FZWA 4YLHA 3Q0GA 5KDRB 4ELSA 4JCRA 4JFCA 3K50A 4KPKA 1MJ3A 3BPTA 4J2UA 4HC8A 4EMPA 4JSBA 2VSSE 3IBBA 3I47A 4B3IA 2F9YB 1XX4A 3MYBA 3BPPA 4OLQA 2Q35A 4I42A 3ZW9A 2A7KA 2X58A 5DZKA 2BZRA 2VSSA 2ZL4A 3GKBA 3R9SA 3HLN1 2CBYA 4JCSA 1HZDA 4FN7A 1EY3A 5C9GA 3LKEA 4NEKA 4FNDA 3GF7A 2DEOA 3U9TB 1SZOA 3R6HA 3R9QA 4IZCA 4U18A 5MGBA 4K3WA 4L6WA 1K39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NP9 A;  3T88 A;  2VSS F;  2PG8 A;  3H81 A;  3TLF A;  1K32 A;  2J5I I;  2FBM A;  3MOY A;  3TV5 A;  5KJP A;  4U0G H;  3MFM A;  1RJN A;  3H0Q A;  4JJT A;  1PIX A;  2J5I A;  4KD6 A;  3OME A;  2PBP A;  2HW5 A;  2DUB A;  3G64 A;  1YG6 A;  4B3H A;  1HNU A;  4F47 A;  5ING A;  4FN8 A;  4FNB A;  4FB8 A;  3FDU A;  5DUC A;  4ELW A;  4NNQ A;  2ZL0 A;  5DU4 A;  3VIV A;  3NJD A;  5INI A;  1UYT A;  4LK5 A;  2Q2X A;  1FC7 A;  3IAV A;  2ZL2 A;  1DUB A;  2ZQR A;  1UYV A;  4QII A;  4L8K A;  4ZDC A;  1N6E A;  3PE8 A;  2J5S A;  3HIN A;  5JBW A;  2Q34 A;  5E0N X;  4MXI A;  3H0S A;  5DL1 A;  4U19 A;  4RCN A;  4IZD A;  4GHN A;  5DU6 A;  2C8T A;  2WTB A;  3H0J A;  5DTW A;  3OC7 A;  3H0U A;  5G1S A;  1FCF A;  2PPY A;  4GM2 A;  3DOR A;  4WYO B;  3RST A;  2A7S A;  1OD2 A;  1O8U A;  2X24 A;  3K8X A;  1UYR A;  4HNK A;  1XNV A;  1TG6 A;  1EF8 A;  1EF9 A;  4KNP A;  3KTK A;  2VSU C;  4ZDD A;  2VSU A;  4JYL A;  3HE2 A;  3L3S A;  3P85 A;  3TZ3 A;  1ON3 A;  4Q0G A;  3MT6 A;  3IB9 A;  5G1Q A;  1OD4 A;  3P2L A;  1WDM A;  1WDK A;  3GF3 A;  3TT7 A;  4ZDE A;  3FF6 A;  3TVW A;  1Q52 A;  4JCT A;  2A81 A;  4KWB A;  1Y7O A;  4G2R A;  3U9R B;  4Q1I A;  3DJA A;  4DI1 A;  3SLL A;  4B3J A;  3BEZ A;  1FC9 A;  4OG1 A;  4WZ8 B;  4K29 A;  3GMA A;  1NZY B;  3KQF A;  1N6D A;  1JXZ A;  4ELX A;  5C90 A;  1XNW A;  4JWV A;  4OMR A;  5DUF A;  1W2X A;  4MOU A;  4EML A;  4FJW D;  3PZK A;  3ISA A;  3H02 A;  3V5E A;  3GLM A;  4U0H A;  4Z0M A;  3T89 A;  4ZDB A;  5FIF A;  2CE3 A;  4ZDF A;  3N6R B;  4ZU2 A;  3R9T A;  1XNY A;  5E0S H;  3QKA A;  5CTC A;  2EJ5 A;  1J7X A;  3STA A;  3SWX A;  5JBX A;  1PJH A;  1ON9 A;  2F9Y A;  5DU8 A;  3WG5 A;  4JYJ A;  4K2N A;  3RSI A;  3QXI A;  1VRG A;  2ZL3 A;  2QQ3 A;  3JU1 A;  4JOT A;  3ZW8 A;  4I52 A;  3QMJ A;  1XO6 A;  2FW2 A;  3ZWB A;  4QIJ A;  5KDR A;  4ASI A;  3TT6 A;  2IEX A;  2FZS A;  3Q1T A;  3HP0 A;  1NZY A;  3PGQ A;  2UZF A;  1HNO A;  3ZWA A;  2F9I A;  4WCZ A;  3BF0 A;  3KTH A;  1DCI A;  3Q7H A;  3M6M A;  3QXZ A;  1Q51 A;  2VRE A;  3QYR A;  3P5M A;  2GTR A;  3LAO A;  4MI2 A;  3ST9 A;  3TRR A;  3T8A A;  2D3T A;  2ZQQ A;  2F6Q A;  1WZ8 A;  3M6N A;  3PEA A;  3ZWC A;  4RYF A;  1X0U A;  1TYF A;  5INF A;  2J5I B;  3RRV A;  3QWD A;  3QRE A;  3Q0J A;  2VSU F;  3R0O A;  5DKP A;  1UIY A;  4JVT A;  3TDC A;  4IZB A;  2J5G D;  5IKL B;  3QK8 A;  4U0G A;  4FZW C;  3KTI A;  2W3P A;  4QFE A;  2VSU E;  1WDL A;  1RJM A;  2F9I B;  3KTJ A;  4I4Z A;  3V5I A;  5E0S A;  2VX2 A;  5DTP A;  1N6F A;  3TVU A;  4RYF H;  1YG8 A;  5G1R A;  2F6I A;  3T8B A;  3U9S B;  3HRX A;  1FC6 A;  3OT6 A;  5DZK H;  4EMM A;  2J5G A;  5CTB A;  4JCQ A;  3NJB A;  1UYS A;  3T3W A;  5FUS A;  1SG4 A;  4U1A A;  3KTG A;  4FZW A;  4YLH A;  3Q0G A;  5KDR B;  4ELS A;  4JCR A;  4JFC A;  3K50 A;  4KPK A;  1MJ3 A;  4HC8 A;  4EMP A;  4JSB A;  2VSS E;  3IBB A;  3I47 A;  4B3I A;  2F9Y B;  1XX4 A;  3MYB A;  3BPP A;  4OLQ A;  2Q35 A;  4I42 A;  3ZW9 A;  2A7K A;  2X58 A;  5DZK A;  2BZR A;  2VSS A;  2ZL4 A;  3GKB A;  3R9S A;  3HLN 1;  2CBY A;  4JCS A;  1HZD A;  4FN7 A;  1EY3 A;  5C9G A;  3LKE A;  4NEK A;  4FND A;  3GF7 A;  2DEO A;  3U9T B;  1SZO A;  3R6H A;  3R9Q A;  4IZC A;  4U18 A;  5MGB A;  4K3W A;  4L6W A;  1K39 A; 
#chains in the Genus database with same CATH topology
 2NP9 A;  3T88 A;  2VSS F;  2PG8 A;  3H81 A;  3TLF A;  1K32 A;  2J5I I;  2FBM A;  3MOY A;  3TV5 A;  5KJP A;  4U0G H;  3MFM A;  1RJN A;  3H0Q A;  4JJT A;  1PIX A;  2J5I A;  4KD6 A;  3OME A;  2PBP A;  2HW5 A;  2DUB A;  3G64 A;  1YG6 A;  4B3H A;  1HNU A;  4F47 A;  5ING A;  4FN8 A;  4FNB A;  4FB8 A;  3FDU A;  5DUC A;  4ELW A;  4NNQ A;  2ZL0 A;  5DU4 A;  3VIV A;  3NJD A;  5INI A;  1UYT A;  4LK5 A;  2Q2X A;  1FC7 A;  3IAV A;  2ZL2 A;  1DUB A;  2ZQR A;  1UYV A;  4QII A;  4L8K A;  4ZDC A;  1N6E A;  3PE8 A;  2J5S A;  3HIN A;  5JBW A;  2Q34 A;  5E0N X;  4MXI A;  3H0S A;  5DL1 A;  4U19 A;  4RCN A;  4IZD A;  4GHN A;  5DU6 A;  2C8T A;  2WTB A;  3H0J A;  5DTW A;  3OC7 A;  3H0U A;  5G1S A;  1FCF A;  2PPY A;  4GM2 A;  3DOR A;  4WYO B;  3RST A;  2A7S A;  1OD2 A;  1O8U A;  2X24 A;  3K8X A;  1UYR A;  4HNK A;  1XNV A;  1TG6 A;  1EF8 A;  1EF9 A;  4KNP A;  3KTK A;  2VSU C;  4ZDD A;  2VSU A;  4JYL A;  3HE2 A;  3L3S A;  3P85 A;  3TZ3 A;  1ON3 A;  4Q0G A;  3MT6 A;  3IB9 A;  5G1Q A;  1OD4 A;  3P2L A;  1WDM A;  1WDK A;  3GF3 A;  3TT7 A;  4ZDE A;  3FF6 A;  3TVW A;  1Q52 A;  4JCT A;  2A81 A;  4KWB A;  1Y7O A;  4G2R A;  3U9R B;  4Q1I A;  3DJA A;  4DI1 A;  3SLL A;  4B3J A;  3BEZ A;  1FC9 A;  4OG1 A;  4WZ8 B;  4K29 A;  3GMA A;  1NZY B;  3KQF A;  1N6D A;  1JXZ A;  4ELX A;  5C90 A;  1XNW A;  4JWV A;  4OMR A;  5DUF A;  1W2X A;  4MOU A;  4EML A;  4FJW D;  3PZK A;  3ISA A;  3H02 A;  3V5E A;  3GLM A;  4U0H A;  4Z0M A;  3T89 A;  4ZDB A;  5FIF A;  2CE3 A;  4ZDF A;  3N6R B;  4ZU2 A;  3R9T A;  1XNY A;  4NAR A;  5E0S H;  3QKA A;  5CTC A;  2EJ5 A;  1J7X A;  3STA A;  3SWX A;  5JBX A;  1PJH A;  1ON9 A;  2F9Y A;  5DU8 A;  3WG5 A;  4JYJ A;  4K2N A;  3RSI A;  3QXI A;  1VRG A;  2ZL3 A;  2QQ3 A;  3JU1 A;  5HUQ A;  4HDT A;  4JOT A;  3ZW8 A;  4I52 A;  3QMJ A;  1XO6 A;  2FW2 A;  3ZWB A;  4QIJ A;  5KDR A;  4ASI A;  3TT6 A;  2IEX A;  2FZS A;  3Q1T A;  3HP0 A;  1NZY A;  3PGQ A;  2UZF A;  1HNO A;  3ZWA A;  2F9I A;  4WCZ A;  3BF0 A;  3KTH A;  1DCI A;  3Q7H A;  3M6M A;  3QXZ A;  1Q51 A;  2VRE A;  3QYR A;  3P5M A;  2GTR A;  3LAO A;  4MI2 A;  3ST9 A;  3TRR A;  3T8A A;  2D3T A;  2ZQQ A;  2F6Q A;  1WZ8 A;  3M6N A;  3PEA A;  3ZWC A;  4RYF A;  1X0U A;  1TYF A;  5INF A;  2J5I B;  3RRV A;  3QWD A;  3QRE A;  3Q0J A;  2VSU F;  3R0O A;  5DKP A;  1UIY A;  4JVT A;  3TDC A;  4IZB A;  2J5G D;  5IKL B;  3QK8 A;  4U0G A;  4FZW C;  3KTI A;  2W3P A;  4QFE A;  2VSU E;  1WDL A;  1RJM A;  2F9I B;  3KTJ A;  4I4Z A;  3V5I A;  5E0S A;  2VX2 A;  5DTP A;  1N6F A;  3TVU A;  2YJG A;  4RYF H;  1YG8 A;  5G1R A;  2F6I A;  3T8B A;  3U9S B;  3HRX A;  1FC6 A;  3OT6 A;  5DZK H;  4EMM A;  2J5G A;  5CTB A;  4JCQ A;  3NJB A;  1UYS A;  3T3W A;  5FUS A;  1SG4 A;  4U1A A;  3KTG A;  4FZW A;  4YLH A;  3Q0G A;  5KDR B;  4ELS A;  4JCR A;  4JFC A;  3K50 A;  4KPK A;  1MJ3 A;  3BPT A;  4J2U A;  4HC8 A;  4EMP A;  4JSB A;  2VSS E;  3IBB A;  3I47 A;  4B3I A;  2F9Y B;  1XX4 A;  3MYB A;  3BPP A;  4OLQ A;  2Q35 A;  4I42 A;  3ZW9 A;  2A7K A;  2X58 A;  5DZK A;  2BZR A;  2VSS A;  2ZL4 A;  3GKB A;  3R9S A;  3HLN 1;  2CBY A;  4JCS A;  1HZD A;  4FN7 A;  1EY3 A;  5C9G A;  3LKE A;  4NEK A;  4FND A;  3GF7 A;  2DEO A;  3U9T B;  1SZO A;  3R6H A;  3R9Q A;  4IZC A;  4U18 A;  5MGB A;  4K3W A;  4L6W A;  1K39 A; 
#chains in the Genus database with same CATH homology
 2NP9 A;  3T88 A;  2VSS F;  2PG8 A;  3H81 A;  3TLF A;  1K32 A;  2J5I I;  2FBM A;  3MOY A;  3TV5 A;  5KJP A;  4U0G H;  3MFM A;  1RJN A;  3H0Q A;  4JJT A;  1PIX A;  2J5I A;  4KD6 A;  3OME A;  2PBP A;  2HW5 A;  2DUB A;  3G64 A;  1YG6 A;  4B3H A;  1HNU A;  4F47 A;  5ING A;  4FN8 A;  4FNB A;  4FB8 A;  3FDU A;  5DUC A;  4ELW A;  4NNQ A;  2ZL0 A;  5DU4 A;  3VIV A;  3NJD A;  5INI A;  1UYT A;  4LK5 A;  2Q2X A;  1FC7 A;  3IAV A;  2ZL2 A;  1DUB A;  2ZQR A;  1UYV A;  4QII A;  4L8K A;  4ZDC A;  1N6E A;  3PE8 A;  2J5S A;  3HIN A;  5JBW A;  2Q34 A;  5E0N X;  4MXI A;  3H0S A;  5DL1 A;  4U19 A;  4RCN A;  4IZD A;  4GHN A;  5DU6 A;  2C8T A;  2WTB A;  3H0J A;  5DTW A;  3OC7 A;  3H0U A;  5G1S A;  1FCF A;  2PPY A;  4GM2 A;  3DOR A;  4WYO B;  3RST A;  2A7S A;  1OD2 A;  1O8U A;  2X24 A;  3K8X A;  1UYR A;  4HNK A;  1XNV A;  1TG6 A;  1EF8 A;  1EF9 A;  4KNP A;  3KTK A;  2VSU C;  4ZDD A;  2VSU A;  4JYL A;  3HE2 A;  3L3S A;  3P85 A;  3TZ3 A;  1ON3 A;  4Q0G A;  3MT6 A;  3IB9 A;  5G1Q A;  1OD4 A;  3P2L A;  1WDM A;  1WDK A;  3GF3 A;  3TT7 A;  4ZDE A;  3FF6 A;  3TVW A;  1Q52 A;  4JCT A;  2A81 A;  4KWB A;  1Y7O A;  4G2R A;  3U9R B;  4Q1I A;  3DJA A;  4DI1 A;  3SLL A;  4B3J A;  3BEZ A;  1FC9 A;  4OG1 A;  4WZ8 B;  4K29 A;  3GMA A;  1NZY B;  3KQF A;  1N6D A;  1JXZ A;  4ELX A;  5C90 A;  1XNW A;  4JWV A;  4OMR A;  5DUF A;  1W2X A;  4MOU A;  4EML A;  4FJW D;  3PZK A;  3ISA A;  3H02 A;  3V5E A;  3GLM A;  4U0H A;  4Z0M A;  3T89 A;  4ZDB A;  5FIF A;  2CE3 A;  4ZDF A;  3N6R B;  4ZU2 A;  3R9T A;  1XNY A;  4NAR A;  5E0S H;  3QKA A;  5CTC A;  2EJ5 A;  1J7X A;  3STA A;  3SWX A;  5JBX A;  1PJH A;  1ON9 A;  2F9Y A;  5DU8 A;  3WG5 A;  4JYJ A;  4K2N A;  3RSI A;  3QXI A;  1VRG A;  2ZL3 A;  2QQ3 A;  3JU1 A;  5HUQ A;  4HDT A;  4JOT A;  3ZW8 A;  4I52 A;  3QMJ A;  1XO6 A;  2FW2 A;  3ZWB A;  4QIJ A;  5KDR A;  4ASI A;  3TT6 A;  2IEX A;  2FZS A;  3Q1T A;  3HP0 A;  1NZY A;  3PGQ A;  2UZF A;  1HNO A;  3ZWA A;  2F9I A;  4WCZ A;  3BF0 A;  3KTH A;  1DCI A;  3Q7H A;  3M6M A;  3QXZ A;  1Q51 A;  2VRE A;  3QYR A;  3P5M A;  2GTR A;  3LAO A;  4MI2 A;  3ST9 A;  3TRR A;  3T8A A;  2D3T A;  2ZQQ A;  2F6Q A;  1WZ8 A;  3M6N A;  3PEA A;  3ZWC A;  4RYF A;  1X0U A;  1TYF A;  5INF A;  2J5I B;  3RRV A;  3QWD A;  3QRE A;  3Q0J A;  2VSU F;  3R0O A;  5DKP A;  1UIY A;  4JVT A;  3TDC A;  4IZB A;  2J5G D;  5IKL B;  3QK8 A;  4U0G A;  4FZW C;  3KTI A;  2W3P A;  4QFE A;  2VSU E;  1WDL A;  1RJM A;  2F9I B;  3KTJ A;  4I4Z A;  3V5I A;  5E0S A;  2VX2 A;  5DTP A;  1N6F A;  3TVU A;  2YJG A;  4RYF H;  1YG8 A;  5G1R A;  2F6I A;  3T8B A;  3U9S B;  3HRX A;  1FC6 A;  3OT6 A;  5DZK H;  4EMM A;  2J5G A;  5CTB A;  4JCQ A;  3NJB A;  1UYS A;  3T3W A;  5FUS A;  1SG4 A;  4U1A A;  3KTG A;  4FZW A;  4YLH A;  3Q0G A;  5KDR B;  4ELS A;  4JCR A;  4JFC A;  3K50 A;  4KPK A;  1MJ3 A;  3BPT A;  4J2U A;  4HC8 A;  4EMP A;  4JSB A;  2VSS E;  3IBB A;  3I47 A;  4B3I A;  2F9Y B;  1XX4 A;  3MYB A;  3BPP A;  4OLQ A;  2Q35 A;  4I42 A;  3ZW9 A;  2A7K A;  2X58 A;  5DZK A;  2BZR A;  2VSS A;  2ZL4 A;  3GKB A;  3R9S A;  3HLN 1;  2CBY A;  4JCS A;  1HZD A;  4FN7 A;  1EY3 A;  5C9G A;  3LKE A;  4NEK A;  4FND A;  3GF7 A;  2DEO A;  3U9T B;  1SZO A;  3R6H A;  3R9Q A;  4IZC A;  4U18 A;  5MGB A;  4K3W A;  4L6W A;  1K39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...