5DZKA

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
196
structure length
196
Chain Sequence
b'ILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
total genus 67
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F, G, a, b, c, d, e, f, g
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5dzkA00
3ZWCA 3T89A 3HLN1 3U9SB 1WDKA 4I4ZA 2F9YB 4QIIA 5FUSA 2DUBA 2EJ5A 4B3IA 4JWVA 1UYSA 2VSUE 5DZKH 3JU1A 2D3TA 4EMLA 2IEXA 1TG6A 1FC9A 3BF0A 4HNKA 4ASIA 5CTCA 1SG4A 3PEAA 3OT6A 2X58A 3RSTA 1MJ3A 2CE3A 2J5IB 1ON3A 3MT6A 2VSUA 5INGA 3GLMA 3LAOA 4YLHA 3M6MA 4JCTA 4U0HA 3TLFA 3Q1TA 4WYOB 3H0SA 1UYTA 1YG8A 2A7KA 1Q51A 3PZKA 1X0UA 1VRGA 3IB9A 4F47A 3FDUA 4MXIA 3R9TA 3KTKA 4MI2A 3TV5A 5JBXA 4Q0GA 3N6RB 1RJMA 1OD4A 2C8TA 2VSUF 4K29A 3HE2A 5DU4A 2F9IB 1K39A 2J5GA 4B3JA 1HNUA 1K32A 2F6IA 2F9YA 2ZQQA 4ELXA 4B3HA 1WDLA 3M6NA 4FN8A 4QFEA 3HRXA 3NJDA 3MYBA 4LK5A 5DL1A 4JCSA 4FN7A 1PIXA 4KWBA 4JYJA 5KDRA 2ZL0A 1SZOA 1XNVA 1N6DA 5IKLB 1WDMA 3T3WA 3GF7A 4EMPA 2J5SA 1OD2A 4IZCA 5G1RA 4Q1IA 2J5IA 2VX2A 3GMAA 3ZWBA 3T8BA 3G64A 3WG5A 4JSBA 4RYFH 3Q7HA 3ISAA 3TVWA 4IZDA 3K50A 5INFA 1HNOA 2FBMA 3ST9A 5DU8A 3TVUA 4ZU2A 2VSSA 5MGBA 3R0OA 4DI1A 5DU6A 4RCNA 4FNBA 1EY3A 1Y7OA 5DTWA 5DTPA 4U0GA 1J7XA 4ZDCA 3H0QA 2F9IA 3STAA 1TYFA 4JFCA 4OMRA 2HW5A 1N6EA 3L3SA 4FB8A 4JCQA 5CTBA 2J5II 4JOTA 2A7SA 5E0SA 4WCZA 4IZBA 4ZDFA 3OC7A 4U18A 1DUBA 2VSSF 2VSUC 2ZL2A 3DJAA 1EF9A 2Q34A 1YG6A 1UYVA 4KNPA 3NJBA 1HZDA 1PJHA 1RJNA 1NZYB 3QWDA 1JXZA 4I42A 3QXIA 3SLLA 1ON9A 4K3WA 4JVTA 3T8AA 4L8KA 2X24A 2WTBA 5E0NX 4OLQA 3ZW9A 3PGQA 4L6WA 3R6HA 1Q52A 4FZWC 3TT7A 3IAVA 3IBBA 3VIVA 5INIA 1WZ8A 3Q0JA 4WZ8B 4EMMA 3TT6A 4FJWD 4NNQA 3KTGA 3QKAA 3P2LA 4U19A 4U1AA 4FNDA 2CBYA 5DKPA 3QMJA 2NP9A 3DORA 2J5GD 3KTJA 3OMEA 3QXZA 1DCIA 4ELSA 2VSSE 5DUFA 1XO6A 2W3PA 4ZDDA 3LKEA 5DUCA 3K8XA 5C9GA 3KTIA 3GF3A 2UZFA 4G2RA 4ZDEA 2A81A 3V5EA 2QQ3A 3ZWAA 1EF8A 3V5IA 4KPKA 1FCFA 1UIYA 4I52A 3H0JA 4U0GH 4ZDBA 3KTHA 4ELWA 5FIFA 3P5MA 1N6FA 3H0UA 3H02A 2ZL4A 1NZYA 2FW2A 4QIJA 5E0SH 3FF6A 4RYFA 1XX4A 5G1SA 4JJTA 5KDRB 5JBWA 3I47A 1XNYA 5DZKA 1O8UA 3U9RB 5KJPA 3PE8A 4OG1A 2Q2XA 4JCRA 4HC8A 2GTRA 3P85A 2BZRA 4Z0MA 3GKBA 4K2NA 3QREA 3R9SA 4GM2A 1FC7A 3TZ3A 2PBPA 2Q35A 2F6QA 3TRRA 4NEKA 2ZL3A 3KQFA 3TDCA 3BPPA 2DEOA 3SWXA 3RSIA 1XNWA 4FZWA 5C90A 1W2XA 4JYLA 3ZW8A 1UYRA 2VREA 3Q0GA 3QK8A 4GHNA 1FC6A 2PPYA 2PG8A 3HINA 3BEZA 3MFMA 5G1QA 3HP0A 3T88A 3H81A 3MOYA 2FZSA 3R9QA 4MOUA 4KD6A 3QYRA 3RRVA 2ZQRA 3U9TB
chains in the Genus database with same CATH superfamily
3ZWCA 3T89A 3HLN1 3U9SB 1WDKA 4I4ZA 2F9YB 4QIIA 5FUSA 2DUBA 2EJ5A 4B3IA 4JWVA 1UYSA 2VSUE 5DZKH 3JU1A 2D3TA 4EMLA 2IEXA 1TG6A 1FC9A 3BF0A 4HNKA 4ASIA 5CTCA 1SG4A 3PEAA 4HDTA 3OT6A 2X58A 3RSTA 1MJ3A 2CE3A 2J5IB 1ON3A 3MT6A 2VSUA 5INGA 3GLMA 3LAOA 4YLHA 3M6MA 4JCTA 4U0HA 3TLFA 3Q1TA 4WYOB 3H0SA 1UYTA 1YG8A 2A7KA 1Q51A 3PZKA 1X0UA 1VRGA 3IB9A 4F47A 3FDUA 4MXIA 3R9TA 3KTKA 4MI2A 3TV5A 5JBXA 4Q0GA 3N6RB 1RJMA 1OD4A 2C8TA 2VSUF 4K29A 3HE2A 5DU4A 2F9IB 1K39A 2J5GA 4B3JA 1HNUA 1K32A 2F6IA 2F9YA 2ZQQA 4ELXA 4B3HA 1WDLA 3M6NA 4FN8A 4QFEA 3HRXA 3NJDA 3MYBA 4LK5A 5DL1A 4JCSA 4FN7A 1PIXA 4KWBA 4JYJA 5KDRA 2ZL0A 1SZOA 1XNVA 1N6DA 5IKLB 1WDMA 3T3WA 3GF7A 4EMPA 2J5SA 1OD2A 4IZCA 5G1RA 4Q1IA 2J5IA 2VX2A 3GMAA 4NARA 3ZWBA 3T8BA 3G64A 3WG5A 4JSBA 4RYFH 3Q7HA 3ISAA 3TVWA 4IZDA 3K50A 5INFA 1HNOA 2FBMA 3ST9A 5DU8A 3TVUA 4ZU2A 2VSSA 5MGBA 3R0OA 4DI1A 5DU6A 4RCNA 4FNBA 1EY3A 1Y7OA 5DTWA 5DTPA 4U0GA 1J7XA 4ZDCA 3H0QA 2F9IA 3STAA 1TYFA 4JFCA 4OMRA 2HW5A 1N6EA 3L3SA 4FB8A 4JCQA 5CTBA 2J5II 4JOTA 2A7SA 5E0SA 4WCZA 4IZBA 5HUQA 4ZDFA 3OC7A 4U18A 1DUBA 2VSSF 2VSUC 2ZL2A 3BPTA 3DJAA 1EF9A 2Q34A 1YG6A 1UYVA 4KNPA 3NJBA 1HZDA 1PJHA 1RJNA 1NZYB 3QWDA 1JXZA 4I42A 3QXIA 3SLLA 1ON9A 4K3WA 4JVTA 3T8AA 4L8KA 2X24A 2WTBA 5E0NX 4OLQA 3ZW9A 3PGQA 4L6WA 3R6HA 1Q52A 4FZWC 3TT7A 3IAVA 3IBBA 3VIVA 5INIA 1WZ8A 3Q0JA 4WZ8B 4EMMA 3TT6A 4FJWD 4NNQA 3KTGA 3QKAA 3P2LA 4U19A 4U1AA 4FNDA 2CBYA 5DKPA 3QMJA 2NP9A 3DORA 2J5GD 3KTJA 3OMEA 3QXZA 1DCIA 4ELSA 2VSSE 5DUFA 1XO6A 2W3PA 4ZDDA 3LKEA 5DUCA 3K8XA 5C9GA 3KTIA 3GF3A 2UZFA 4G2RA 4ZDEA 2A81A 2YJGA 3V5EA 2QQ3A 3ZWAA 1EF8A 3V5IA 4KPKA 1FCFA 1UIYA 4I52A 3H0JA 4U0GH 4ZDBA 3KTHA 4ELWA 5FIFA 3P5MA 1N6FA 3H0UA 3H02A 2ZL4A 1NZYA 2FW2A 4QIJA 5E0SH 3FF6A 4RYFA 1XX4A 5G1SA 4JJTA 5KDRB 5JBWA 3I47A 1XNYA 4J2UA 5DZKA 1O8UA 3U9RB 5KJPA 3PE8A 4OG1A 2Q2XA 4JCRA 4HC8A 2GTRA 3P85A 2BZRA 4Z0MA 3GKBA 4K2NA 3QREA 3R9SA 4GM2A 1FC7A 3TZ3A 2PBPA 2Q35A 2F6QA 3TRRA 4NEKA 2ZL3A 3KQFA 3TDCA 3BPPA 2DEOA 3SWXA 3RSIA 1XNWA 4FZWA 5C90A 1W2XA 4JYLA 3ZW8A 1UYRA 2VREA 3Q0GA 3QK8A 4GHNA 1FC6A 2PPYA 2PG8A 3HINA 3BEZA 3MFMA 5G1QA 3HP0A 3T88A 3H81A 3MOYA 2FZSA 3R9QA 4MOUA 4KD6A 3QYRA 3RRVA 2ZQRA 3U9TB
chains in the Genus database with same CATH topology
3ZWCA 3T89A 3HLN1 3U9SB 1WDKA 4I4ZA 2F9YB 4QIIA 5FUSA 2DUBA 2EJ5A 4B3IA 4JWVA 1UYSA 2VSUE 5DZKH 3JU1A 2D3TA 4EMLA 2IEXA 1TG6A 1FC9A 3BF0A 4HNKA 4ASIA 5CTCA 1SG4A 3PEAA 4HDTA 3OT6A 2X58A 3RSTA 1MJ3A 2CE3A 2J5IB 1ON3A 3MT6A 2VSUA 5INGA 3GLMA 3LAOA 4YLHA 3M6MA 4JCTA 4U0HA 3TLFA 3Q1TA 4WYOB 3H0SA 1UYTA 1YG8A 2A7KA 1Q51A 3PZKA 1X0UA 1VRGA 3IB9A 4F47A 3FDUA 4MXIA 3R9TA 3KTKA 4MI2A 3TV5A 5JBXA 4Q0GA 3N6RB 1RJMA 1OD4A 2C8TA 2VSUF 4K29A 3HE2A 5DU4A 2F9IB 1K39A 2J5GA 4B3JA 1HNUA 1K32A 2F6IA 2F9YA 2ZQQA 4ELXA 4B3HA 1WDLA 3M6NA 4FN8A 4QFEA 3HRXA 3NJDA 3MYBA 4LK5A 5DL1A 4JCSA 4FN7A 1PIXA 4KWBA 4JYJA 5KDRA 2ZL0A 1SZOA 1XNVA 1N6DA 5IKLB 1WDMA 3T3WA 3GF7A 4EMPA 2J5SA 1OD2A 4IZCA 5G1RA 4Q1IA 2J5IA 2VX2A 3GMAA 4NARA 3ZWBA 3T8BA 3G64A 3WG5A 4JSBA 4RYFH 3Q7HA 3ISAA 3TVWA 4IZDA 3K50A 5INFA 1HNOA 2FBMA 3ST9A 5DU8A 3TVUA 4ZU2A 2VSSA 5MGBA 3R0OA 4DI1A 5DU6A 4RCNA 4FNBA 1EY3A 1Y7OA 5DTWA 5DTPA 4U0GA 1J7XA 4ZDCA 3H0QA 2F9IA 3STAA 1TYFA 4JFCA 4OMRA 2HW5A 1N6EA 3L3SA 4FB8A 4JCQA 5CTBA 2J5II 4JOTA 2A7SA 5E0SA 4WCZA 4IZBA 5HUQA 4ZDFA 3OC7A 4U18A 1DUBA 2VSSF 2VSUC 2ZL2A 3BPTA 3DJAA 1EF9A 2Q34A 1YG6A 1UYVA 4KNPA 3NJBA 1HZDA 1PJHA 1RJNA 1NZYB 3QWDA 1JXZA 4I42A 3QXIA 3SLLA 1ON9A 4K3WA 4JVTA 3T8AA 4L8KA 2X24A 2WTBA 5E0NX 4OLQA 3ZW9A 3PGQA 4L6WA 3R6HA 1Q52A 4FZWC 3TT7A 3IAVA 3IBBA 3VIVA 5INIA 1WZ8A 3Q0JA 4WZ8B 4EMMA 3TT6A 4FJWD 4NNQA 3KTGA 3QKAA 3P2LA 4U19A 4U1AA 4FNDA 2CBYA 5DKPA 3QMJA 2NP9A 3DORA 2J5GD 3KTJA 3OMEA 3QXZA 1DCIA 4ELSA 2VSSE 5DUFA 1XO6A 2W3PA 4ZDDA 3LKEA 5DUCA 3K8XA 5C9GA 3KTIA 3GF3A 2UZFA 4G2RA 4ZDEA 2A81A 2YJGA 3V5EA 2QQ3A 3ZWAA 1EF8A 3V5IA 4KPKA 1FCFA 1UIYA 4I52A 3H0JA 4U0GH 4ZDBA 3KTHA 4ELWA 5FIFA 3P5MA 1N6FA 3H0UA 3H02A 2ZL4A 1NZYA 2FW2A 4QIJA 5E0SH 3FF6A 4RYFA 1XX4A 5G1SA 4JJTA 5KDRB 5JBWA 3I47A 1XNYA 4J2UA 5DZKA 1O8UA 3U9RB 5KJPA 3PE8A 4OG1A 2Q2XA 4JCRA 4HC8A 2GTRA 3P85A 2BZRA 4Z0MA 3GKBA 4K2NA 3QREA 3R9SA 4GM2A 1FC7A 3TZ3A 2PBPA 2Q35A 2F6QA 3TRRA 4NEKA 2ZL3A 3KQFA 3TDCA 3BPPA 2DEOA 3SWXA 3RSIA 1XNWA 4FZWA 5C90A 1W2XA 4JYLA 3ZW8A 1UYRA 2VREA 3Q0GA 3QK8A 4GHNA 1FC6A 2PPYA 2PG8A 3HINA 3BEZA 3MFMA 5G1QA 3HP0A 3T88A 3H81A 3MOYA 2FZSA 3R9QA 4MOUA 4KD6A 3QYRA 3RRVA 2ZQRA 3U9TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWC A;  3T89 A;  3HLN 1;  3U9S B;  1WDK A;  4I4Z A;  2F9Y B;  4QII A;  5FUS A;  2DUB A;  2EJ5 A;  4B3I A;  4JWV A;  1UYS A;  2VSU E;  5DZK H;  3JU1 A;  2D3T A;  4EML A;  2IEX A;  1TG6 A;  1FC9 A;  3BF0 A;  4HNK A;  4ASI A;  5CTC A;  1SG4 A;  3PEA A;  3OT6 A;  2X58 A;  3RST A;  1MJ3 A;  2CE3 A;  2J5I B;  1ON3 A;  3MT6 A;  2VSU A;  5ING A;  3GLM A;  3LAO A;  4YLH A;  3M6M A;  4JCT A;  4U0H A;  3TLF A;  3Q1T A;  4WYO B;  3H0S A;  1UYT A;  1YG8 A;  2A7K A;  1Q51 A;  3PZK A;  1X0U A;  1VRG A;  3IB9 A;  4F47 A;  3FDU A;  4MXI A;  3R9T A;  3KTK A;  4MI2 A;  3TV5 A;  5JBX A;  4Q0G A;  3N6R B;  1RJM A;  1OD4 A;  2C8T A;  2VSU F;  4K29 A;  3HE2 A;  5DU4 A;  2F9I B;  1K39 A;  2J5G A;  4B3J A;  1HNU A;  1K32 A;  2F6I A;  2F9Y A;  2ZQQ A;  4ELX A;  4B3H A;  1WDL A;  3M6N A;  4FN8 A;  4QFE A;  3HRX A;  3NJD A;  3MYB A;  4LK5 A;  5DL1 A;  4JCS A;  4FN7 A;  1PIX A;  4KWB A;  4JYJ A;  5KDR A;  2ZL0 A;  1SZO A;  1XNV A;  1N6D A;  5IKL B;  1WDM A;  3T3W A;  3GF7 A;  4EMP A;  2J5S A;  1OD2 A;  4IZC A;  5G1R A;  4Q1I A;  2J5I A;  2VX2 A;  3GMA A;  3ZWB A;  3T8B A;  3G64 A;  3WG5 A;  4JSB A;  4RYF H;  3Q7H A;  3ISA A;  3TVW A;  4IZD A;  3K50 A;  5INF A;  1HNO A;  2FBM A;  3ST9 A;  5DU8 A;  3TVU A;  4ZU2 A;  2VSS A;  5MGB A;  3R0O A;  4DI1 A;  5DU6 A;  4RCN A;  4FNB A;  1EY3 A;  1Y7O A;  5DTW A;  5DTP A;  4U0G A;  1J7X A;  4ZDC A;  3H0Q A;  2F9I A;  3STA A;  1TYF A;  4JFC A;  4OMR A;  2HW5 A;  1N6E A;  3L3S A;  4FB8 A;  4JCQ A;  5CTB A;  2J5I I;  4JOT A;  2A7S A;  5E0S A;  4WCZ A;  4IZB A;  4ZDF A;  3OC7 A;  4U18 A;  1DUB A;  2VSS F;  2VSU C;  2ZL2 A;  3DJA A;  1EF9 A;  2Q34 A;  1YG6 A;  1UYV A;  4KNP A;  3NJB A;  1HZD A;  1PJH A;  1RJN A;  1NZY B;  3QWD A;  1JXZ A;  4I42 A;  3QXI A;  3SLL A;  1ON9 A;  4K3W A;  4JVT A;  3T8A A;  4L8K A;  2X24 A;  2WTB A;  5E0N X;  4OLQ A;  3ZW9 A;  3PGQ A;  4L6W A;  3R6H A;  1Q52 A;  4FZW C;  3TT7 A;  3IAV A;  3IBB A;  3VIV A;  5INI A;  1WZ8 A;  3Q0J A;  4WZ8 B;  4EMM A;  3TT6 A;  4FJW D;  4NNQ A;  3KTG A;  3QKA A;  3P2L A;  4U19 A;  4U1A A;  4FND A;  2CBY A;  5DKP A;  3QMJ A;  2NP9 A;  3DOR A;  2J5G D;  3KTJ A;  3OME A;  3QXZ A;  1DCI A;  4ELS A;  2VSS E;  5DUF A;  1XO6 A;  2W3P A;  4ZDD A;  3LKE A;  5DUC A;  3K8X A;  5C9G A;  3KTI A;  3GF3 A;  2UZF A;  4G2R A;  4ZDE A;  2A81 A;  3V5E A;  2QQ3 A;  3ZWA A;  1EF8 A;  3V5I A;  4KPK A;  1FCF A;  1UIY A;  4I52 A;  3H0J A;  4U0G H;  4ZDB A;  3KTH A;  4ELW A;  5FIF A;  3P5M A;  1N6F A;  3H0U A;  3H02 A;  2ZL4 A;  1NZY A;  2FW2 A;  4QIJ A;  5E0S H;  3FF6 A;  4RYF A;  1XX4 A;  5G1S A;  4JJT A;  5KDR B;  5JBW A;  3I47 A;  1XNY A;  5DZK A;  1O8U A;  3U9R B;  5KJP A;  3PE8 A;  4OG1 A;  2Q2X A;  4JCR A;  4HC8 A;  2GTR A;  3P85 A;  2BZR A;  4Z0M A;  3GKB A;  4K2N A;  3QRE A;  3R9S A;  4GM2 A;  1FC7 A;  3TZ3 A;  2PBP A;  2Q35 A;  2F6Q A;  3TRR A;  4NEK A;  2ZL3 A;  3KQF A;  3TDC A;  3BPP A;  2DEO A;  3SWX A;  3RSI A;  1XNW A;  4FZW A;  5C90 A;  1W2X A;  4JYL A;  3ZW8 A;  1UYR A;  2VRE A;  3Q0G A;  3QK8 A;  4GHN A;  1FC6 A;  2PPY A;  2PG8 A;  3HIN A;  3BEZ A;  3MFM A;  5G1Q A;  3HP0 A;  3T88 A;  3H81 A;  3MOY A;  2FZS A;  3R9Q A;  4MOU A;  4KD6 A;  3QYR A;  3RRV A;  2ZQR A;  3U9T B; 
#chains in the Genus database with same CATH topology
 3ZWC A;  3T89 A;  3HLN 1;  3U9S B;  1WDK A;  4I4Z A;  2F9Y B;  4QII A;  5FUS A;  2DUB A;  2EJ5 A;  4B3I A;  4JWV A;  1UYS A;  2VSU E;  5DZK H;  3JU1 A;  2D3T A;  4EML A;  2IEX A;  1TG6 A;  1FC9 A;  3BF0 A;  4HNK A;  4ASI A;  5CTC A;  1SG4 A;  3PEA A;  4HDT A;  3OT6 A;  2X58 A;  3RST A;  1MJ3 A;  2CE3 A;  2J5I B;  1ON3 A;  3MT6 A;  2VSU A;  5ING A;  3GLM A;  3LAO A;  4YLH A;  3M6M A;  4JCT A;  4U0H A;  3TLF A;  3Q1T A;  4WYO B;  3H0S A;  1UYT A;  1YG8 A;  2A7K A;  1Q51 A;  3PZK A;  1X0U A;  1VRG A;  3IB9 A;  4F47 A;  3FDU A;  4MXI A;  3R9T A;  3KTK A;  4MI2 A;  3TV5 A;  5JBX A;  4Q0G A;  3N6R B;  1RJM A;  1OD4 A;  2C8T A;  2VSU F;  4K29 A;  3HE2 A;  5DU4 A;  2F9I B;  1K39 A;  2J5G A;  4B3J A;  1HNU A;  1K32 A;  2F6I A;  2F9Y A;  2ZQQ A;  4ELX A;  4B3H A;  1WDL A;  3M6N A;  4FN8 A;  4QFE A;  3HRX A;  3NJD A;  3MYB A;  4LK5 A;  5DL1 A;  4JCS A;  4FN7 A;  1PIX A;  4KWB A;  4JYJ A;  5KDR A;  2ZL0 A;  1SZO A;  1XNV A;  1N6D A;  5IKL B;  1WDM A;  3T3W A;  3GF7 A;  4EMP A;  2J5S A;  1OD2 A;  4IZC A;  5G1R A;  4Q1I A;  2J5I A;  2VX2 A;  3GMA A;  4NAR A;  3ZWB A;  3T8B A;  3G64 A;  3WG5 A;  4JSB A;  4RYF H;  3Q7H A;  3ISA A;  3TVW A;  4IZD A;  3K50 A;  5INF A;  1HNO A;  2FBM A;  3ST9 A;  5DU8 A;  3TVU A;  4ZU2 A;  2VSS A;  5MGB A;  3R0O A;  4DI1 A;  5DU6 A;  4RCN A;  4FNB A;  1EY3 A;  1Y7O A;  5DTW A;  5DTP A;  4U0G A;  1J7X A;  4ZDC A;  3H0Q A;  2F9I A;  3STA A;  1TYF A;  4JFC A;  4OMR A;  2HW5 A;  1N6E A;  3L3S A;  4FB8 A;  4JCQ A;  5CTB A;  2J5I I;  4JOT A;  2A7S A;  5E0S A;  4WCZ A;  4IZB A;  5HUQ A;  4ZDF A;  3OC7 A;  4U18 A;  1DUB A;  2VSS F;  2VSU C;  2ZL2 A;  3BPT A;  3DJA A;  1EF9 A;  2Q34 A;  1YG6 A;  1UYV A;  4KNP A;  3NJB A;  1HZD A;  1PJH A;  1RJN A;  1NZY B;  3QWD A;  1JXZ A;  4I42 A;  3QXI A;  3SLL A;  1ON9 A;  4K3W A;  4JVT A;  3T8A A;  4L8K A;  2X24 A;  2WTB A;  5E0N X;  4OLQ A;  3ZW9 A;  3PGQ A;  4L6W A;  3R6H A;  1Q52 A;  4FZW C;  3TT7 A;  3IAV A;  3IBB A;  3VIV A;  5INI A;  1WZ8 A;  3Q0J A;  4WZ8 B;  4EMM A;  3TT6 A;  4FJW D;  4NNQ A;  3KTG A;  3QKA A;  3P2L A;  4U19 A;  4U1A A;  4FND A;  2CBY A;  5DKP A;  3QMJ A;  2NP9 A;  3DOR A;  2J5G D;  3KTJ A;  3OME A;  3QXZ A;  1DCI A;  4ELS A;  2VSS E;  5DUF A;  1XO6 A;  2W3P A;  4ZDD A;  3LKE A;  5DUC A;  3K8X A;  5C9G A;  3KTI A;  3GF3 A;  2UZF A;  4G2R A;  4ZDE A;  2A81 A;  2YJG A;  3V5E A;  2QQ3 A;  3ZWA A;  1EF8 A;  3V5I A;  4KPK A;  1FCF A;  1UIY A;  4I52 A;  3H0J A;  4U0G H;  4ZDB A;  3KTH A;  4ELW A;  5FIF A;  3P5M A;  1N6F A;  3H0U A;  3H02 A;  2ZL4 A;  1NZY A;  2FW2 A;  4QIJ A;  5E0S H;  3FF6 A;  4RYF A;  1XX4 A;  5G1S A;  4JJT A;  5KDR B;  5JBW A;  3I47 A;  1XNY A;  4J2U A;  5DZK A;  1O8U A;  3U9R B;  5KJP A;  3PE8 A;  4OG1 A;  2Q2X A;  4JCR A;  4HC8 A;  2GTR A;  3P85 A;  2BZR A;  4Z0M A;  3GKB A;  4K2N A;  3QRE A;  3R9S A;  4GM2 A;  1FC7 A;  3TZ3 A;  2PBP A;  2Q35 A;  2F6Q A;  3TRR A;  4NEK A;  2ZL3 A;  3KQF A;  3TDC A;  3BPP A;  2DEO A;  3SWX A;  3RSI A;  1XNW A;  4FZW A;  5C90 A;  1W2X A;  4JYL A;  3ZW8 A;  1UYR A;  2VRE A;  3Q0G A;  3QK8 A;  4GHN A;  1FC6 A;  2PPY A;  2PG8 A;  3HIN A;  3BEZ A;  3MFM A;  5G1Q A;  3HP0 A;  3T88 A;  3H81 A;  3MOY A;  2FZS A;  3R9Q A;  4MOU A;  4KD6 A;  3QYR A;  3RRV A;  2ZQR A;  3U9T B; 
#chains in the Genus database with same CATH homology
 3ZWC A;  3T89 A;  3HLN 1;  3U9S B;  1WDK A;  4I4Z A;  2F9Y B;  4QII A;  5FUS A;  2DUB A;  2EJ5 A;  4B3I A;  4JWV A;  1UYS A;  2VSU E;  5DZK H;  3JU1 A;  2D3T A;  4EML A;  2IEX A;  1TG6 A;  1FC9 A;  3BF0 A;  4HNK A;  4ASI A;  5CTC A;  1SG4 A;  3PEA A;  4HDT A;  3OT6 A;  2X58 A;  3RST A;  1MJ3 A;  2CE3 A;  2J5I B;  1ON3 A;  3MT6 A;  2VSU A;  5ING A;  3GLM A;  3LAO A;  4YLH A;  3M6M A;  4JCT A;  4U0H A;  3TLF A;  3Q1T A;  4WYO B;  3H0S A;  1UYT A;  1YG8 A;  2A7K A;  1Q51 A;  3PZK A;  1X0U A;  1VRG A;  3IB9 A;  4F47 A;  3FDU A;  4MXI A;  3R9T A;  3KTK A;  4MI2 A;  3TV5 A;  5JBX A;  4Q0G A;  3N6R B;  1RJM A;  1OD4 A;  2C8T A;  2VSU F;  4K29 A;  3HE2 A;  5DU4 A;  2F9I B;  1K39 A;  2J5G A;  4B3J A;  1HNU A;  1K32 A;  2F6I A;  2F9Y A;  2ZQQ A;  4ELX A;  4B3H A;  1WDL A;  3M6N A;  4FN8 A;  4QFE A;  3HRX A;  3NJD A;  3MYB A;  4LK5 A;  5DL1 A;  4JCS A;  4FN7 A;  1PIX A;  4KWB A;  4JYJ A;  5KDR A;  2ZL0 A;  1SZO A;  1XNV A;  1N6D A;  5IKL B;  1WDM A;  3T3W A;  3GF7 A;  4EMP A;  2J5S A;  1OD2 A;  4IZC A;  5G1R A;  4Q1I A;  2J5I A;  2VX2 A;  3GMA A;  4NAR A;  3ZWB A;  3T8B A;  3G64 A;  3WG5 A;  4JSB A;  4RYF H;  3Q7H A;  3ISA A;  3TVW A;  4IZD A;  3K50 A;  5INF A;  1HNO A;  2FBM A;  3ST9 A;  5DU8 A;  3TVU A;  4ZU2 A;  2VSS A;  5MGB A;  3R0O A;  4DI1 A;  5DU6 A;  4RCN A;  4FNB A;  1EY3 A;  1Y7O A;  5DTW A;  5DTP A;  4U0G A;  1J7X A;  4ZDC A;  3H0Q A;  2F9I A;  3STA A;  1TYF A;  4JFC A;  4OMR A;  2HW5 A;  1N6E A;  3L3S A;  4FB8 A;  4JCQ A;  5CTB A;  2J5I I;  4JOT A;  2A7S A;  5E0S A;  4WCZ A;  4IZB A;  5HUQ A;  4ZDF A;  3OC7 A;  4U18 A;  1DUB A;  2VSS F;  2VSU C;  2ZL2 A;  3BPT A;  3DJA A;  1EF9 A;  2Q34 A;  1YG6 A;  1UYV A;  4KNP A;  3NJB A;  1HZD A;  1PJH A;  1RJN A;  1NZY B;  3QWD A;  1JXZ A;  4I42 A;  3QXI A;  3SLL A;  1ON9 A;  4K3W A;  4JVT A;  3T8A A;  4L8K A;  2X24 A;  2WTB A;  5E0N X;  4OLQ A;  3ZW9 A;  3PGQ A;  4L6W A;  3R6H A;  1Q52 A;  4FZW C;  3TT7 A;  3IAV A;  3IBB A;  3VIV A;  5INI A;  1WZ8 A;  3Q0J A;  4WZ8 B;  4EMM A;  3TT6 A;  4FJW D;  4NNQ A;  3KTG A;  3QKA A;  3P2L A;  4U19 A;  4U1A A;  4FND A;  2CBY A;  5DKP A;  3QMJ A;  2NP9 A;  3DOR A;  2J5G D;  3KTJ A;  3OME A;  3QXZ A;  1DCI A;  4ELS A;  2VSS E;  5DUF A;  1XO6 A;  2W3P A;  4ZDD A;  3LKE A;  5DUC A;  3K8X A;  5C9G A;  3KTI A;  3GF3 A;  2UZF A;  4G2R A;  4ZDE A;  2A81 A;  2YJG A;  3V5E A;  2QQ3 A;  3ZWA A;  1EF8 A;  3V5I A;  4KPK A;  1FCF A;  1UIY A;  4I52 A;  3H0J A;  4U0G H;  4ZDB A;  3KTH A;  4ELW A;  5FIF A;  3P5M A;  1N6F A;  3H0U A;  3H02 A;  2ZL4 A;  1NZY A;  2FW2 A;  4QIJ A;  5E0S H;  3FF6 A;  4RYF A;  1XX4 A;  5G1S A;  4JJT A;  5KDR B;  5JBW A;  3I47 A;  1XNY A;  4J2U A;  5DZK A;  1O8U A;  3U9R B;  5KJP A;  3PE8 A;  4OG1 A;  2Q2X A;  4JCR A;  4HC8 A;  2GTR A;  3P85 A;  2BZR A;  4Z0M A;  3GKB A;  4K2N A;  3QRE A;  3R9S A;  4GM2 A;  1FC7 A;  3TZ3 A;  2PBP A;  2Q35 A;  2F6Q A;  3TRR A;  4NEK A;  2ZL3 A;  3KQF A;  3TDC A;  3BPP A;  2DEO A;  3SWX A;  3RSI A;  1XNW A;  4FZW A;  5C90 A;  1W2X A;  4JYL A;  3ZW8 A;  1UYR A;  2VRE A;  3Q0G A;  3QK8 A;  4GHN A;  1FC6 A;  2PPY A;  2PG8 A;  3HIN A;  3BEZ A;  3MFM A;  5G1Q A;  3HP0 A;  3T88 A;  3H81 A;  3MOY A;  2FZS A;  3R9Q A;  4MOU A;  4KD6 A;  3QYR A;  3RRV A;  2ZQR A;  3U9T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...