5DZPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
351
structure length
351
Chain Sequence
b'LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 90
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzpA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzpA02
4GSQA 4ZFQA 3VYOA 5E51A 5DUJA 4A1JA 5K69A 4QRAA 5DU7A 4A1KA 5DZPA 4Z7AA 5E1IA 5E5LA 4JMXA 5LB1A 4A1IA 4LPQA 4QTFA 3ZGPA 5E1GA 3U1PA 3VAEA 3VYPA 4HUCA 3VYNA 1Y7MA 3TURA 5DVPA 4LZHA 5DC2A 4GSRA 3TX4A 4QRBA 4K73A 4QR7A 5LBGA 4HU2A 4GSUA 3ZG4A 2HKLA 5DCCA 5D7HA 1ZATA 4XVOA 4A52A 4JMNA 5DZJA 3ZQDA 3U1QA 2MTZA
chains in the Genus database with same CATH superfamily
4PB0H 3ROLB 1T1ZA 4P23D 1BXXA 2AXGA 4YDVA 3LXBA 3LIZA 4XCEA 1SFDA 4XBMA 1THCA 2V9TA 4MA7H 3TBTB 1U42A 2W95A 1QBMH 3JWDC 4FQHB 1SLXA 2ZXDA 1PAZA 3HRZB 3S96A 1XCQB 4TRPL 2WMPB 3LNGA 4G5ZH 2RFXB 4FI8A 4XPHL 1YDPA 4M48H 4NZDA 5EUKA 5BPPA 3ZUNC 3R0MA 5SWZA 2FNWA 4JQXA 5DJ2B 2AJVH 2JJTA 1VERA 1IM3A 3LRMA 2R56L 5BXFB 3QO0B 4M56A 4WO4D 2IPKB 3HS9A 5DZ9A 1YNLH 2WLIA 3BVNB 5FYLD 3FCSB 3VXUA 4LAQH 1BBJA 1NFKA 4GAFB 3BN3B 4X7FC 1A9BB 1CVSC 5TGBA 2X3BA 3PWUB 3GMQA 4NWTH 2ZWNA 3KPLB 2H47C 5KANG 4XE0A 4ZXBA 5DC4B 2CO3A 3ARDD 2PCFA 4P46D 3QORB 1YNTB 1LDPH 1NCOA 1M05A 4PJ7F 3LN5B 4KK8D 1GIGL 4GRWB 4YX2H 3MZTA 4JDEB 2VOTA 1TOXA 2ZOLA 3M86A 4HKZB 1XR9A 4AQ1A 4Y4KA 2CDFA 3JZ7A 1TJIH 3VRJB 3PP4L 3HNTH 1VGKA 3IB4A 3Q6FB 5CNHA 2YMXH 1G9NC 4ZUVA 1UZ8B 4PY8I 2F54E 4E9SA 3EJYD 3F7KA 1CTOA 4PFEA 5CN3A 5DMGC 5E1AA 4QRTA 3D4YA 1JV5B 3IJ8A 4JE0A 4Z7QF 3EG9A 3QC6X 3BKJH 1XX9C 2VXSH 4X5QA 3ZDXF 1WWAX 3LZLA 2XTJC 4GKZA 2FJHA 3TVMC 3VDCA 4PCSA 3VXME 4HIXH 5FYKH 4HGMA 1FVCB 2BMKA 4QHLB 3X13A 1D5RA 4JFDE 1MIML 3NSXA 1T83A 4HCFA 1BPVA 1D7BA 4JHWH 3QUGA 3MRIA 4QUOA 3K2MC 5BVJB 3S88H 3U1PA 3L3HB 3DRTA 4LO9A 2V9UA 4D3CL 1JYWA 4EBQL 5HY9A 3OKOA 1LO5A 2QADC 1D5ZB 4KO5A 4OLXH 3U30C 4DW2H 5C9KA 1A64A 1FC2D 5CBAA 1HCYA 3FHEA 2HMID 4OCXH 4NNPH 3WO4B 1MAML 3MLRL 1BD2A 1RUQL 1ZLWH 6FABH 2AEWA 1F1DA 2RACA 3CK0L 2DH3A 5FCUL 5T5NG 4ZW3A 4RGOH 3PE9A 2Z92B 4G80B 5BW7A 3HE6A 3I6KB 2BNRB 3PWLB 3WAKA 4UDTA 5GS3A 2I60L 1RK7A 3FN9A 3C6LA 2B2XH 2OBGA 3VXSA 3CDCA 4L29A 5ECJE 3ZYJA 3WEAA 5MEPB 1ZT4A 3ISRA 1HK6A 1B2WH 5D9SA 5FGRA 3RWFA 2WLZA 4HULB 2JELH 4JJ5A 2ED6A 1GW6A 3VWJD 5DGQA 1A3ZA 3LPOA 4JM2B 3SB3A 2QSCH 3SKOA 3SZ6A 4WWID 3TO4A 3W2DL 4F8QA 5IB5A 4NP4L 1I7UB 2KI6A 1D5BA 4Y7MA 5IV2A 1E8XA 4Z0BL 5FS5A 1LE9A 5KS9A 3KS0J 4U6TA 3QIUA 5F70A 2ESVA 2NY4C 5I1LA 5F1IB 2AJYL 4MJ5A 3SDAC 3QUMB 5I1DA 4O2FA 5EOCL 2F58L 4DESA 2O5XH 5F96H 2JCWA 4R3SA 1IEBB 5HGDA 4HS8H 5D7LB 4P57B 3S36L 4HJJH 4NSKA 2O61A 3V0DA 1KBGL 2C4FT 3BWZA 3APMA 5AW7B 2JI2A 3QUYA 5EUOB 1A66A 2CQVA 3QI9D 4PN6A 5CSBA 4E0RA 4U1NB 4XNAA 5D1ZB 3RAJL 4HH9A 5AW5B 1NLDH 1WF5A 3GJFK 1UXLA 4X4XB 5GGTA 5F71A 2ZYHA 2J8UE 3P9WB 4N4YB 1KXTB 4LRNL 2NY7H 3BSGA 4JZOB 3PUUA 4FN0A 4I18B 4EI0A 2UUDK 3IRCA 4XC3H 4Y5XA 2OSXA 3IDJA 2X2HA 1S7XA 1OK8A 4ALAL 3BP6A 3JSSA 1CL7L 4IEFB 1U8LA 1TJHH 5JIHA 3WUWB 4JL2A 5C0AB 2UZXA 1XSIA 1N8ZB 3DHMA 4PV8B 3MO1A 3IKCB 1J9CT 2FUQA 3BQUD 4KTYA 2OX5A 2VR7A 4IRJC 4OZGB 1SDDB 3W9EA 1H3GA 1TO4A 4URTB 3V4PA 5C0ND 3AWGA 5TQ2H 3T4AB 3OX8A 4YN3A 4LHUA 2Z91A 5E2UH 1RPUA 1SNRA 1E9QA 3V5DA 3HBGA 2LT9A 3SY0A 4OCYH 4UQ2A 1HWGB 1I75A 3JWNE 1JNNL 2C9QA 1S7TB 3DSFL 3JVGC 3MBWB 4N0CC 4YUEL 4C54A 3M17B 4XR8C 1MHHB 1DJGA 1EFXA 1CE1H 4RX4A 5JHDA 1X4YA 2NW3A 2WC7A 1SJXA 2OSLA 3NCXA 1MHPH 3QPQD 3LKOB 1JERA 5HYSG 3D69B 2XWTA 4RDQF 4K7PL 2VO8A 3LEXB 4HBCL 4B9KC 3KYKH 2NXYB 2GJRA 2R27A 3X1NA 2A6IB 2L3BA 3S6CA 2AANA 2BHYA 1A6VH 2LOEA 1KEMH 1NC2A 2E59A 3OG6B 4ZYKA 1JXKA 2MQCA 1ZHNA 5TF0A 4YSCA 4HEMA 1F6AA 3BD3A 1ZXKA 3K72B 3VGAB 2JVUA 4AGLA 5FECB 1T2QH 5DT1L 1T0MA 3UCRA 3Q05A 4WFHD 1Q9WB 4JN1L 2ENYA 2FJUB 2HX7A 2YPLD 3IGAB 4WFFE 5IB2A 4EN3B 3FU9A 5DO2D 4FULA 2R0WL 4GXVL 3RU8L 4DVRH 1KJVB 5IW3A 3SBWA 1ZLUH 2V7NA 3JV0A 3QORD 3U6RB 2V9QA 3BKMH 1E9PA 4ZT1A 3RB5A 1QLRB 4QEGA 3RBGA 4ZNCD 4FQIH 4FYQA 2P8MA 4KMQA 2ZZUT 4CBZA 2ZP9A 1OD7A 1FV1B 1M2VA 3UZQB 4JDVA 5SWSE 5L8JB 4ODTL 4GQ9L 3BRDA 3MRFB 3SGKA 4WEUD 1FCGA 1EVUA 4YHNA 4G7YH 2XN1A 1BJ8A 5GRJL 3REVA 3BQVA 1FRGL 4N2BA 5DEJA 3ROLA 1BFSA 1DE4A 1IL1A 3U1SL 1N5YH 5F0PB 3V0HA 3WDIA 2D3JA 2EDOA 5DQJA 3MMEA 3LPWA 2ZWYA 4OZIB 1CZ8L 3CZEA 4LEXH 4YE0A 4WV1C 4YE4L 4AUJA 1IM9A 2XN9D 3QIWB 4GMTH 2X6UA 2YQ3A 3IJHA 4WI6A 3TA3C 1QFPA 1SVCP 2I07A 1H0DB 2HN7B 2Y7OA 4ONHB 3ZDYE 4I48A 5I2IB 1OP4A 3QBTB 1W72A 1IGIL 2IANE 2X41A 5JORB 4HVBA 5L4FA 5CGTA 4JFOB 3W82A 2NMSA 1BYOA 3P02A 4LLWA 3DECA 4AZ8B 3ELQA 3SN6N 3ZSSA 3Q43A 1A3QA 2J73A 3MYJB 3KLQA 2VC2B 1I8MA 3EO9H 3PPEA 4F7TA 4XNMB 3C5JB 4ZTPH 3RWGB 4UTBA 4LBAA 4LCYB 3L3GB 2AEIT 3FQTA 3QEQD 4JANA 4BWTA 3ARBB 2HKAA 3Q8AA 4Z7OB 4MWFA 1JE6A 4U7SA 4L8SA 3GB7B 1ID2A 1MHEB 3H0TA 2EVIA 3I75B 3N06B 4Y2LA 3RL2B 4G83A 2QJDA 3GF8A 3TEWA 5IW1B 1OAXH 4DEPB 1S4IA 3NZ8A 4JKPL 4YDKH 5IF0A 1BIHA 4Y8AA 1SN2A 2BFVL 4TPRH 1QEWA 1EV2E 3P0GB 4KXBA 4U1IA 1I7TA 2BS8A 3L3JB 3GXUB 4JB9L 1XQ4A 1PX4A 2CZNA 5MERA 5F7NC 4ZUWA 4YXHH 1AR1C 1T1WA 5TQ0L 2W0FA 1U8CB 4PGJA 2A38A 1NEZA 2IH3A 3KPSE 1N64H 2OA9A 1JYVA 1KCVH 3WIIH 3SDCB 1BQUA 1OSPH 4AVIA 4QXUL 5KANI 1H15A 1EGJA 2GSIA 2PKDA 4OJAA 5DZVA 1XV8A 1DHKA 2LU4A 4OU3A 4UM9A 4W4OC 5DRWB 2YD1A 1OZUA 3QP3A 1F4HA 2H8PB 4WVRA 2WP3O 2CPUA 4FS0A 4RGNE 1L5GA 3DXAB 1MF2H 2YIHA 2UYLB 4O02A 2MOVA 4JFEA 2QPEB 2MPVA 1USQA 3QULA 3FXIC 3UL4A 2CBQA 1ZSDB 2NQ3A 1WWCA 2R9HC 4ONGH 4EDXB 3OMZA 2W0PA 3NFSL 3PNWB 4K9EL 2Q5BA 4GH7B 4LVNB 1PX8A 1ND0A 4K7FB 5DMYA 1JZ5A 2NQCA 1KDIA 2X87A 2G75B 1U3YA 2UXTA 2AJUL 4JY5H 3LQAH 3BKYL 3INUL 2RQ8A 2G5BA 1JNHA 1EDYA 2DQEL 4L4VB 3B6SA 1PAMA 3L7FB 3AAZA 2Q8AH 1UFGA 1KJMA 5I8KH 3S5LG 3W11C 5CCGE 3ABGA 1FYTE 2DMGA 5AQ0A 1VENA 3X11A 1BM7A 4IBQA 4GW5A 3DARA 4N9GA 5G5DB 1EHAA 4J3TA 3HLKA 4FTVB 4ZUSB 4APQA 1YEFH 4MXWH 2D4DA 5F7WC 2DQ6A 4HV8A 3EYQD 3UAJC 3I02B 1T5WB 3TYFB 4OFIA 3NCYP 3DSNA 4M93C 3RKPA 1YQVH 1HILB 1HHJA 2P4AB 5D6CA 3SODB 2ZOUA 4KY1H 1ZVNA 3MODH 4PJ8A 4ENEC 4JX0A 3TEUA 5HJ3B 1OEZW 3WIAA 5DD5H 1QNZH 4U3SB 1SGKA 1YYCA 4OFQA 5FYJE 4DJMA 5BMFL 3H53A 2KERA 2VE6A 1O7DE 4MJ2A 3S37H 4LPWA 5IFJA 5J89A 4CDGC 2NX5D 2VLLB 3VD5A 4O4YL 5AYUH 4XRCB 4V2CB 4HC1L 1PCSA 1R17A 3LRGA 4KXZI 2XN0A 3CLWA 5EZPA 4XCFH 3EAKA 1LNUB 4KKPA 4Q2ZA 5C3TA 2OP4H 3T3PE 1DQDH 1B6DA 2H5UA 3SBRA 1KN2L 3QDJE 1BVNT 3RNKB 3HNSH 1T20A 2IFGA 4K3GA 4Y16C 1DQML 4NYLA 1ORSA 4GW1B 4NIKB 5ENWB 1KJ2L 4B27A 2WGXA 4FFZL 4HK0A 2N7SA 5I9QC 2VWEE 4QLRA 3RX5A 2VN3A 1KY6A 3MNVB 4MDJB 4YSSA 4P04A 5SX4I 1B3JA 2NUTB 1RU9H 4FXLA 1IJNA 1HZLA 1HL5A 2P26A 2QTEA 4Y2DA 1JHLL 1HIMH 3NIDB 4OFDA 1KBVA 4AXWB 4GBXC 5EZIH 4A2LA 1E6JH 1OW0A 3SBPA 2GUYA 1Q9LA 5AW9B 1NMBH 2I27N 4ERSL 2PTVA 4X9FA 5CEXA 4AQAA 2EDWA 4CADB 2FX9H 2F54D 1W0WB 4QHKI 1Y18B 2AXWA 2ADFL 2VDKL 1CD1A 3KR3H 4OLZL 3V0VA 5DSCA 1TDQA 4KITB 2V5MA 5LN4A 1RZKL 1AGCB 2J3SA 4KAQH 5DLML 1TEYA 3GMNB 1YECH 2E9JA 2P52A 3QWRD 1Z3GH 5ANMB 4OGAC 4M3HA 3VXMD 3QH3B 3QJHB 4N90E 4Y9GA 4Y19B 1WC7A 4N8CH 4KI5C 1J10A 2EEFA 1GOFA 1QBLH 5GS0L 1KBPA 3GPSA 2CALA 3MNZB 4JPIB 3ILDA 3UCQA 4P5SA 4QLWA 1MFMA 3GJFH 1G94A 1PNCA 5HHNA 4JLRB 1NGXB 1KELH 5TF1H 3EOAA 5IGXL 3LKSA 1F58L 5EZLB 5C0IB 3SGJA 4PGDB 1BEYL 4APXA 1KCBA 1QFUH 4QXGL 1NMAL 1T7XA 2UUDH 5G2NA 3GSNB 5F1KC 5FFOA 1QSVA 2J25A 2AV7B 2UWEA 4JY4A 3RBSA 4JM4L 3UYPA 4Z7VB 3O9WA 3Q1SL 1MUJB 1KPUB 1YEIH 3ELAT 3VG9C 4BK5A 5CF3A 2WUCL 5GHWH 5B1JC 4DKEL 1S9WB 4R4BA 1IGFH 3ERXA 3OKDB 5T3ZH 4JFHE 4F7MA 5FLUA 3ARBD 1I8UA 4U3XA 1W0VA 4OF3A 3FFDA 3W0WA 1MAJA 3NK3A 4HIHA 2Z9TA 4N8VB 4K5OA 4UT6L 4PRHE 2YGVA 1ET7A 1W0YT 3PF2A 3KLKA 4R7VA 5IFAH 3OMNB 4JFFA 4YAQB 3RY5A 3NUKA 3WS6C 2XBTA 3UJJL 3LH9A 3HG5A 4G2AA 5HD8C 2VLKA 3GINA 1P84J 1WZAA 1NKGA 4CU6A 2EJ1A 3MKGA 2VH5L 2WVVB 3TNNB 4AQEB 5KW9L 5IVOA 4PUBL 1X5HA 2E6QA 3T0EE 3Q48A 3U9WA 2P43B 3KPOA 1JK9A 4GMSH 2G30A 1TPXB 4TTDC 2GB2A 2E74C 1BA9A 4E41A 3S34H 3OGOE 3TV3H 1BZ7B 2CA4A 4E9QA 1P4BH 4WWKC 3KJ6L 3OZKA 2BSCA 4OAWA 4YSQA 43C9B 1PNDA 2NCEA 2H32H 1Q9OB 4M3JA 4UBDC 1OAZL 5IEHB 2DMKA 4M4RB 3EGSB 3DXAD 5CJXA 2N7AA 1L4IA 4PJ9A 3UOAB 3ZKNC 4HS6A 5EA0H 4KJYA 4KQ0A 3BP4A 4NQEB 3L4CA 3MBEB 2IXQB 3BLKA 5D2NC 4PTTA 2Y36H 4FQLL 3FQWA 4PW9A 3VD3A 4GIOA 1ZDQA 2Y4SA 3ABMB 2VGLM 4KMTL 1Z5HA 3CX5J 1QSEB 1D9KA 2WYIA 5BOZG 3V6FA 4N0UA 2MEJB 5F44A 1GS8A 4K15A 3OSKA 1MI5E 3PGDB 1AANA 4PJXE 4QTIH 3EJTA 3ES6A 3EJUA 4V1DE 5IHBA 5HI4C 1BM3H 2PYEE 1N70A 4ICXA 1K8IB 4ZRGA 5I8CA 2ZNXA 3HG1D 3IN2A 1NIEA 1SXNA 2G3MA 5FO8A 4NNYB 3OKKA 3RIAK 4HAKA 4HJIA 1TKWA 5B8CA 4UOJA 3BRFA 4NERA 4FTVD 4CAGA 3FQ1A 3GO1L 3GRBA 3BMVA 4P8QA 1EERB 1IEAB 5C0EB 5A2AA 3EF7A 4FNUA 1M53A 5L88L 1NBCA 3GXFA 4CC4C 4H20L 1HXKA 3EFFA 3LS4L 5CINH 3PXLA 5HHXL 4RZCA 2EDDA 3BESR 4XODA 4WI3A 3WEBA 1CFQA 2P5EB 4XNZC 5KVGH 1J9QA 4M7KL 3SCMD 4XMPL 4BRJA 3PWNB 3L16A 1IU1A 4IRSC 3ZQDA 4JRYE 4JUTA 3IWVA 1K5NA 2G2RB 3AB0B 5CZRA 3OVUB 5E99L 4QWWC 1ZHKB 2F19L 1UXSB 1CG9A 4OM1H 1NAKH 3EYUL 2EYSA 5ESAA 2Z4QB 1LWJA 3IJSB 4H5SB 3VI4B 3WI9A 4MNHB 1OCOB 2IWKA 1PY4A 3FU7B 4U2YA 2B3RA 5FUZH 4Z95L 1NDTA 4U1JA 5DRZA 5EEXA 5HYIA 2VZOA 3PU7A 3PDOB 1XR8B 3DO7B 1PD6A 1HHIB 2A7BA 3MJGX 1FWXA 4K9JA 5EZJB 4JRLA 3PL6B 4GG6B 3DV4A 3QQ9D 4N2GA 4Q6IA 1NWOA 5L4IA 3ZE0F 3BJ91 4NQXB 4W1TA 2YXFA 3MV9B 5K69A 1AKJA 2EVFA 5C0CB 4HPOL 2P46B 1R4XA 5A40E 3S8GB 3EJCA 4WFFD 2OMXB 5I30H 5JPNC 3H3PH 5I1KL 5B1KA 2XWBA 1Z0MA 1LVEA 1L9NA 3J27A 5ILTH 4MNQD 4BSVB 3P73A 5BZDA 1T0NB 4P5TB 1M7DB 1NCTA 4KROC 4CN4A 1ZV2A 3BAWA 4N2MA 5E8EA 4DTGL 2EDTA 1FO0H 4U1LB 3SGEI 1FH2A 3K4DA 5KSBB 3CCHB 1ETZB 5DK3A 1KTBA 3UYOD 4Z77B 1ML0A 1D3CA 1K8DA 3TO2B 3D52A 4GB9A 2XTLA 1OLLA 3ARGB 1KFAL 4IJ3C 1RURH 1WEJH 2LE9A 5CILL 1EK3A 1RY7B 3DX7B 5IMKB 4UIKL 3D87B 3V4VH 2FUTA 3WHE0 5IOPA 2VSKB 3E9UA 1YEKL 1HXMA 2BOBA 4TVUA 3UJTL 4A2HA 4QRPE 5AAPA 1R3LB 4BH8B 5I1GH 2EDQA 3CXFA 1SY6L 3SZKC 4DVBB 2YWYA 3WDJA 5DURB 1T6BX 4NPYB 2DD8L 1X5MA 4OLUL 4M6OL 3OF6D 2QSVA 3MRPA 1H8LA 1CGXA 4NO0A 5LNDA 2WK2A 2LQRA 2JB5H 3RY4A 3U2SB 3OXSA 1A25A 1TQCB 3CIAA 4X6BB 2ZUQB 5I17A 3OGCB 5KVFH 1RL1A 4JGNA 3FQ2A 1IO4C 1F90L 2VUYA 4LGSB 4ALAC 5AZEL 3TURA 2AJSH 4P2OC 4H26A 4ZS6C 2IPTH 3IU4L 5B3JE 4TVSa 3I3DA 4PJAE 3FU6A 2F8IA 3IDXL 4ABWA 4CVZA 5IJKA 1ZVHA 2J88L 4AUUA 3FCUB 3FSOA 3BGAA 4HWEL 2A74B 4XO8A 2QZQA 4Q0XH 3IFOA 4Y9CA 3VTTA 4L5FE 5MI0B 3N42B 3Q13A 5F7FA 4OD2A 2W59A 2YGNA 1XGYL 2X4NB 3D25B 2H6UA 1DBMH 5DMIL 1ZY9A 2X89D 1GGUA 2PETA 2R0KL 3U4BL 2X28A 2VJ0A 1V5JA 2A9NH 1J7VR 1S7UA 4IBSA 4O2EA 5D7KD 1TVBA 3QWOB 2PPDA 2CO7B 5FA3B 1E3FA 4BYHA 4JFPB 4FG6C 2WW8A 4FQQB 5E5MB 3G5YB 3QNFA 4NJ9H 4NIYE 1NSNL 2DWYA 2MTZA 2VMJA 2PWEA 3KL5A 3KPSD 1PMYA 1OAKL 1HKFA 3N2JA 1RZJL 1NGQH 1T7ZA 1ZANH 2CSPA 4L9LC 2AAAA 1QACA 1H3PH 4MHHG 4RFNB 5DC9B 4PRNB 4TNGA 5E94A 4GSDL 1L9QA 1XEUA 4HT1H 4B96A 1ZV5A 2O6EA 1PIFA 5IMOA 1YMMA 1T2XA 5IJVB 4JY6A 4UTAL 2BSTB 4WI8A 2R59A 4RGND 1M42A 4GT0A 2OZ4H 1M1SA 2QL1A 2BWQA 4YNYB 1E3XA 4N5EC 3QJVB 5EIIB 2WXMA 3SGDI 5K9KA 4HP5A 3Q9PA 1EAOA 2NZ9D 4Z7UF 4LSUL 3F85A 5F9WC 1RULL 3D85B 1JRHL 4ZPTB 2OL3B 3FSWA 3LH2H 3RZCB 3RIAF 1KC5L 25C8L 1QRNB 1RK1A 3IDNB 2VQ1B 1DVFC 4J4PC 1RCYA 1DBAH 3OR6B 3RGVB 1MWOA 5FM4A 1D6VL 2ATKB 2PNDA 2EIZA 1QSED 1NUDA 4B3EA 5AVYB 1GYCA 5DD1H 3CC1A 3RUGB 4OIIH 4F7PA 1T03H 4OH2A 4I0PB 1PFCA 5CWSB 5GGTH 3KWXA 4AOFA 4OIBA 1OGPA 5C09B 5D7JA 4G7RB 4XXDA 3K2UH 3VFWB 2IMNA 1KCSH 1UYWH 2KQMA 1U8HB 2B1AL 2V6HA 3U0TB 3BT2H 1DJHA 3IXTB 4FEIA 4X6FB 5CU5A 2WXGA 3VFVB 1UZ6E 2NYKA 4NFBA 4TQIA 3TPKA 5M94B 4OM0H 4H0HB 5HI3D 5CMAB 1VHPA 4RMSA 1NL0L 2EIKB 4L0ZA 3L17A 4ETQB 1NPNA 4HUVB 1A3LL 1DEEA 3EYVB 2ENJA 3JTBA 1GY1A 1OTSC 1YPZE 5FYJD 1FFNA 2P5ED 3RX8A 3V4PH 3HI5H 2B3IA 3S8WA 1FPTL 2XVKA 3FO1A 4KI5F 1WWWX 4Z76A 1VFOA 4ZAKB 5AOZA 1ZSHA 4ZSOA 3C5ZB 4ATTA 1F56A 3B34A 3MBXL 1JG9A 4J28A 2V7HB 4OLEA 2DWXA 1O9WA 2DMHA 1LWHA 1HL8A 3ILQC 1S5IL 4KI1A 4KVCH 1DN0B 1LD9A 4WNSA 3G6AA 3KPPA 2WHVA 4WLCA 5FDYA 3D1MC 1YN6B 5I28A 4MMYA 5E7BA 1WISA 4HPYH 1U8IB 2NY5L 2OMVB 3TJPA 4JMNA 1Y1DA 2C3VB 4MX7A 4UNUA 4LEOB 1FJ1B 3GMOB 1QVOA 3GZQA 1EZLA 1EBAA 1N0LB 1S7QA 2B1HH 3QRBA 3FT1A 4YPGB 5DVMA 4IHOA 3F7YA 5CSZA 3MV9D 3QWNA 4OJYA 1J8RA 4OZHE 4A2EA 1HH9B 1YEWA 2RTTA 3NQIA 4LPQA 1X9UA 1N12A 1CGSH 3HI6H 4JZNA 1QA9A 4NKOA 4OQTL 1ZLSH 4PWEA 4EVNB 3PJSB 3QVAA 3NJLA 1F8TL 2MTAA 4DQOL 1GYVA 5T5FL 5L2KE 4EQ3A 1F86A 1VFAB 3PLYA 2X2IA 4WW2C 1MCQA 5H8DA 2GTQA 4AC2A 2GIYA 3KLAA 3WKPA 4KUZH 1FLRH 2B15A 4EZKA 4AUYA 1TR7A 3H42L 1K9TA 4RAVB 4J2QA 2A83B 1NCBH 1QR4A 3BFQG 4WWPA 1BOGB 2PWDA 1MWAA 1CDJA 4F33B 1A4KA 4M3KB 2Y6TE 1LHZA 1T1YA 3BAEH 2XT1B 1R46A 2CKBA 2EH8H 3P40A 4K9EC 4NBZB 3RWJA 3SYQA 4BSJA 1O7DC 3ZUCA 3MLVL 4ANXA 4F9LC 4OD3L 2WZ6A 3BZDA 3KYMA 1U91A 4MD0A 2J56A 2YGPA 4LK4A 5DQ9A 3UTPD 5BS0A 4PP2A 1EHLL 5KVDE 4V11A 1NCWL 1TMCB 4L8DB 2B16A 2ZX6A 3QJSB 3BVDB 4GLRH 3RKDD 1XH0A 2EDEA 5GRYA 4AM0A 3PQYB 3VNZA 3NCWA 3RE0A 4P2RA 1C5BH 2KZ1B 1WAAF 4LSPL 4X7SL 3SE4C 3EJJX 5E1HB 4G7VL 5ICXB 2JCCE 1U8KA 3EZ8A 2Q87A 3C9NB 4XPBH 4MLSA 4EUPA 3LIUA 1S3RA 1XCTA 2XY2A 1DO5A 2DI9A 1CLZH 5FGBC 3WKML 4KJQD 2E7BA 1BMZA 2WBJC 2FB4L 4AIZB 4CA4A 5JHMA 3KYOA 4I4WB 1YEDA 4IKLA 4TLSA 4OBRA 4ZQKA 1NCNA 3QIBD 4N0YH 4NFCA 4B7LA 4F3FB 2CHZA 3STLB 3VFTA 1GGCH 3SQBB 1HTYA 3GXNA 3FO2B 3FO0H 4UTBH 2J4WH 1M2OA 3GDBA 3WUWG 5IT2H 1OAQL 5F93C 1EZSA 1PL3A 2V4LA 1L9MA 3C87A 4YHZL 2CG9X 2NY0D 4PB9H 2HT3C 4KU1A 2Q7AA 3VWKC 4AVJA 2R1XB 3GBLA 1B4RA 3AXLA 2Z93A 3WTXA 4PJ5B 1FORL 1E5UI 3V5KB 3B2DC 5HTSA 2WXRA 3AC0A 1EX0A 1U3NA 4XMKH 2PO6B 2ICWA 4JO4L 3D39A 5EBLB 2XFXA 4KKAC 5FPIA 3L9BA 1NGWA 4B95C 2Q0ZX 1RZGB 4NRZB 1I53A 2OCFD 4X6CF 1U6AH 1JHKH 3ILEA 3MRHA 2W5PA 5J4MA 2BVYA 3L4UA 4MQ7A 4HOZA 1EGJH 4XO3A 4WEBL 4TF4A 1X5LA 2V5YA 4YHPB 2WKLA 1KIPB 4FLSA 3DI3B 1KWGA 3U1QA 2K7QA 5JQ6L 2K9FB 4PRIA 2BPBA 2QVTA 2PCYA 4C4BA 1NOAA 2H45A 4V33A 2WZ0A 2A99A 3QUML 3MLZL 4PR5B 3RZCD 1MN4A 5GJSL 1JPGB 1FNGB 3PWJA 4LSRL 4UQCA 3RGVD 4N2AA 1MI5D 3FCGA 1K5WA 1BDYA 1VRSA 4RH4A 4V1DD 3EYFB 1SZNA 3H9ZA 4WHTB 2PYED 2CO2A 2DDQL 1RZKC 2Y1AA 2AQPA 3GLZA 4ZFZA 3TH2T 4ZMPA 3ZG4A 2RR3A 2WB1A 3ZSTA 4H0GA 1K4CA 1OP9A 4WCYH 5INCB 1UJTA 4MCYB 4WFEE 4NO5A 2BNRE 1DJWA 2BY3A 4Y1AA 1MNNA 1DDHB 5ISZA 1B6UA 3R8QA 2J2ZA 3GLAA 3HKFA 1ZHLA 3MRRA 3N1QC 1INEL 4LLYA 2ZICA 5C7ZA 3REWB 1SJHA 1S7RB 5GS0C 3MGOA 4Y9FA 4J1UA 2ZPKL 4J39A 1FH5L 4WK2B 2E27L 3CUPA 5C2BL 3TVMA 3D3VA 1HKLL 3VD9A 5DEFA 1TZIB 4LCUB 5HYEA 5ES4B 5AKRA 2VR9A 2AV1A 1YN7B 3T0EC 4R2GC 3ARFB 5C9JB 3BGFB 1HVXA 4QHNB 4OCMC 2VJXA 2W94A 4MS6A 1IIKA 5DUPL 5HHVL 3MOBL 3VI3A 4YWGL 3R1GH 3KM2A 3O6KH 4U1SA 1AGEB 4QXTB 3HC3L 3U7AA 3CVHA 1A4AA 4OLVL 1PQZB 1C1EH 4L4TA 3VXRB 4L18A 4IGBC 4PYGA 3TJEH 2Z7WA 3PS6A 4KUCD 1G0DA 4QI3A 4OSUH 1SYVA 3MUGA 5I8OH 1NCUA 5A2JH 2ITDA 5AVZB 4N8UA 5E08L 5EUOE 2PYFA 4L3EB 1EH9A 3F65A 2YR3A 2ZSWA 4LP5A 5FA4B 5BO0D 2Y7QB 3IE4A 1CO1A 4C8XA 2YEQA 2I25N 1F00I 1G6RH 1J0JA 1IGCH 1MFBH 1Z9SA 2FO4A 3LDBC 4XOCA 5EWIL 5B7MA 1O5DT 4AY0A 2IFFL 5T5NF 3G6DL 4JRXE 4Y89A 3HBPA 3BP5A 1RJYA 1FZOA 2ADIB 3G9VA 2F61A 3VMOA 5JPMC 1P53A 1YY8A 1QLEH 5EZOL 1LO4L 5MENE 4FZ8L 5E0QA 4TL5A 3D9AL 1WZKA 1OM9A 1YYMH 4NZUL 2GI7A 4WKZA 3GWJA 1N8OE 1CXLA 3SE9L 1YEHL 2P8PA 4YFEA 1RHHB 3MX0B 5DXWA 5SWQB 1T22B 1MCOH 4L05A 4X6DF 1OGTA 3EH3B 2R2HA 4OZGE 1NCDH 1IFGA 1RJCA 4Y2NA 3L1OH 1GGIH 2D7QA 4JCMA 5C7XL 2EYRA 3WFCL 3SDAA 1V54B 4Z7AA 1ADQL 2Z0UA 4EI5D 4OF6A 1OAJA 1FGVL 1A7PH 3X12A 5AVRB 4LLUB 3BE1L 3IU3B 2TSBA 3DJSA 1VA9A 1Q0YL 2MSPA 3GBNH 4PJ7B 3CBJB 1A8ZA 3T0WA 1PY0A 3C08L 3HJEA 1TSHA 2ARJB 3KXFD 4W9KC 2IPUK 3ZKQD 3SQOH 4YLQT 4CVWA 5DRNA 1NTDA 4Q9QL 1CYGA 1HHKA 3FNKA 5J5EA 4ODHH 1OALA 4BDVA 4MJIB 2QQKL 1XGRB 4F2EA 1PZSA 4DGIH 1HHHB 3VFUB 5IK3B 3KBHE 3VD4A 3LSOB 1E27B 1O9ZA 3CC5B 2OI9B 2X09A 1MHCA 4JVWA 4U1HA 4AJYV 2RCSH 5AW8B 2FBJL 3BD5A 4PW3A 4AMKH 2ITFA 5FKPB 1YEJH 4HJUA 2WWMC 1P2CA 4FQ2L 4AEFA 4EN2A 1JWMB 3BH9A 3ZE2F 5I8EA 3B2VH 4N1EA 1UT9A 3OPUA 2V5RA 1CICD 5AW2B 1FFRA 4JKKA 4XC1L 2XVLA 2L8AA 1BQHG 4IRJA 3TJHC 4KO7A 3N0AA 3ETTA 2PPFA 4ANVA 1I3RA 5F3HB 2AEOA 3UC2A 2CJSA 1AZNA 2X6CA 5LKNA 2W8CA 1JGDB 1D6EA 3GPEA 3KPMA 3SDYL 3H4FA 4N25A 4HCRA 4X4YB 2NXZB 2VC2L 2FGWL 1CQYA 4UQIM 5ACLA 3AG2B 1S78C 3LXAA 1TTFA 4CU8A 3HR5A 3JVGA 4YXKL 2WXNA 2XQYG 3H7BA 2ZIDA 4MMXB 3SPVA 1AIFB 3FO9B 5I66A 3EO1B 3NSYA 4P23C 4CVUA 4LQFH 1G4RA 5AVXB 5EEUA 4U0RC 1RLWA 4JUSA 2FEDD 2FT7A 1ZVYA 3ZHNA 1DO6A 4YDZA 1GCFA 5BO1H 2W07A 2YAHA 3P9LA 4UWQB 2PO6D 1R5WA 2VMCA 3HPLB 4R0LB 2A3TA 4OZIE 1R1CA 1IGYA 1R5IA 5CP7B 4GAAA 5KZCB 5E23A 4F1ZA 1PKQA 1DUYB 2J12B 1HYSD 2ZD0A 1CDCA 3E6FB 5FX3A 2D7TL 3DI2B 5DK2A 2PR4L 4X7TA 5GS1B 5GGQH 1BXAA 1NFDB 1UB5B 2F5BL 3MGTA 4NGHL 1BAFH 2KHAA 4NAQA 1AQDA 4H4NA 1XGTB 3TPUB 1W8EA 2WCGA 4ADGA 3MR9B 1MCDA 1TZAA 5LB1A 4AKPA 1JPFA 4IOIB 1LP9F 5ESVA 1WV7T 3KL3A 5DZLA 5FYKD 3VA2C 4E68A 4H44C 1Z32X 3WD5H 1U36A 3TT3H 3VXPA 1UWYA 2KLTA 1N3NB 2HZHA 2NSXA 2NDFA 5EC1B 2A5UA 5DEZA 3W5MA 2JQZA 4KK8C 2K70A 3H85A 3F6IA 4QRUA 1V7NH 5D72H 3CZFA 4KXZH 2C7UA 2D7MA 3W39B 1HQRA 3DVNA 1H5BB 3CJJA 1EXUB 2O6CA 2BHZA 2ZJSH 1BJMA 3G7TA 4F2MA 3FQRB 5JXED 3H55A 1KB5A 2F0CA 3J7HA 4XXCC 1JGVL 2BW5A 2VMEA 2HJLB 4UAHA 2CHNA 5HGBA 2CRMA 3D30A 2IAMC 4TOYH 1EEUA 1LMIA 5BZXA 1AI1H 3O4LA 3PXHA 1J9SA 2YLKA 4GJTB 3ZE1E 3O8XB 2FWOB 3MLYH 3HPJB 1QFWL 3P0YL 4LASL 4WV1A 1KTLB 4H40A 4KBPA 5D7HA 3B3BA 4LNRB 4X9BA 3TA3A 5J0BA 1ZGLA 2VTFA 4MD5B 4F1SA 1GJIA 1H8NA 3QHFL 1TYEB 4KK9C 1UASA 4XE5B 2WINB 4AVKA 1R19A 2OQJA 2OTUA 2QQNL 1P7KA 2R4RH 2E5EA 4GAYA 4M61B 4FNPA 3ULUL 3BAXA 4LPCA 5AOKA 5AW6B 3SKNA 4JPSA 3NGBB 5MEOA 2HMIC 2WWKO 3FT2B 2X88A 5LAXB 4FJYA 1KCWA 3LN4B 2BVEA 3K46A 3TBCA 1WFOA 4FKKA 3U46A 1EUUA 3QUKB 1N18A 3LKQB 4NM4H 1OT1A 4ATWA 3MJ9L 4CMHC 1JZ7A 4GUQA 1JV2B 3MV8A 5AAWC 1JGUH 4CMMB 1LGVA 1QX1A 4PV9B 5D1QB 3AWFA 4LP4A 3R4RA 4LLAA 1RZJC 3APFA 3HCVA 1XF5A 3II1A 3LZPA 1BW8A 4G6AC 2A6DA 4BFIB 1NUFA 2C26A 1XZ0A 3LV3A 4KKRA 2WIIB 1E8YA 2W0KA 3F04A 1OE3A 4ZMWA 2PW2B 4PP1D 1R24B 1B2YA 3MACL 3HHRB 2P24B 3SHSA 1UD4A 3T0XA 2VABA 3RIFK 2IALA 2YAQA 5IB4A 4PCKA 3PCYA 4NQCE 1CLOH 2RGSA 2WXPA 2XFGB 3N3EA 2LTQB 4ZDHA 2B7DT 2DQDH 4JO1H 2F15A 1CDYA 2J72A 2JLLA 4W4OA 3H9SD 4NQSB 2IBZX 4HUCA 2E4TA 3O6FD 5IB1A 4AK1A 5ICYA 3MCLH 2HJKA 3K6IA 5KYYA 2UXFA 2RIKA 4Q52A 3B9EA 3C09B 5F1NB 1RUKH 3QZWB 1QPXA 3LCYA 4N2FA 3ZQ9A 3QEGL 3UBFA 3NJGA 1NKOA 1MPAL 1XIWC 3FDWA 3O0RH 5CO1A 2DLFL 4DO5A 3BUYB 2WTPA 3CIQA 2FBRA 4HXBH 1BFVH 2A9DA 2XA8L 1XTLA 4NLAA 4NUGL 4P3CL 3MU3A 4I8DA 1AD0B 1DVZA 1EEZA 1I9IL 2JXMA 2CD0A 4NKMA 4WW1B 3VFPB 3ZYOA 4OQ1A 2NOYA 1KZYA 3UXFA 3RVWD 5D96C 3PWVA 1MJJA 5CZVH 3NTCH 1IMHC 5I74B 4R7DB 3NCJL 4NXKA 3MUUA 2FQGA 4NT6A 1P6FA 3DNKA 1ESOA 1CLCA 2YBRA 1RVFL 7FABH 3DLQR 3IFNL 3ET9F 3K5SA 5C6PB 3VDAA 4E9YA 5TDOB 3L3OB 3NIDE 1UA6L 4GOSA 2EDXA 1JI1A 2XPYA 3DX0A 3UAJA 1VADB 3NQKA 3N43F 3GSNL 3E38A 2OMZA 3O3DA 5JHLL 5HPMB 3CX2A 2WXHA 3N41F 3OKEB 1OF2B 3F12A 3ZU8A 1TZ8A 1MRFH 1MCWM 2VMDA 1KBBA 5HYQA 4ISVB 3EGXA 3TIDB 4BM7A 4Y5VC 1XF1A 5SWZE 3NFPB 5ADOH 1JCKA 2PP9A 3ZKSD 4I0CC 1ILSA 3LEYH 5I6XC 3K6SA 4QRSB 1KZQA 3Q2LA 1AGDA 4LDEB 2XXMB 5EOQL 4D9RE 4FYSA 1U2HA 3Q3GB 5I6KA 5ANME 1UOWA 2YEZB 2IH1B 4M29A 3VXUE 1UQSB 2IMMA 3MA9L 3RFZB 5DHYA 4LPXA 3EFOA 3GXPA 2NY5C 4F57L 4Y19E 2H1XA 1KIUB 4FCAA 2H0FA 3QPQC 3FQXA 3QXAA 3HRZC 1JWUA 1J11A 4Y16A 4ZX4A 3WJMA 2EEBA 2VLRA 3PPSA 4Z7UA 2QKIB 2FQEA 2K8MA 3BSZL 3CFEA 3LHPH 2YPKB 4BFRA 3MYZA 5B38A 1A1NA 1MIEH 2QPSA 3D6GA 5T1MB 5KZCD 3TS8A 4DN3L 1V05A 3CQQA 2GJ6B 2Y1YA 3QDGD 4H2AA 3VFOB 3JYCA 1J5HA 4KZDH 1N19A 3H6AA 1MH5B 4GAJL 4Q56A 5A2BA 5F9OH 2Y1ZA 1PG7X 4IOSD 3SPIA 4CL7A 2VO5A 2D3NA 5MEQB 1E67A 4Z7VE 1WE5A 3GMMB 3O45B 4GBXA 3FRUB 3QG7H 4ZOEA 3EFDH 5I5JA 1QSFA 3RWCA 3RG1C 1L7TL 3GJFB 4JKNA 3FRPG 2PW1B 5DO2C 4PSRA 2I69A 4DZ8B 4ZUTB 2ZF8A 1FNSL 3GSWB 2LLNA 3OHMB 5KYWA 4WFED 3QORC 2N0KA 3NAAL 4BKLA 3A21A 4B50A 3E0GA 4FLQA 1DQKA 3MRQA 3EOTL 3G5VB 2EC9T 4L4JA 3U2IA 1IC7L 3EXLA 2GTWB 4GFXA 1NIDA 3QFGA 1J0ZA 3F7VB 4OGYH 4B0MM 4PIBA 3QZNA 5ID0B 2YXVA 5A2CA 5ESQB 1WFMA 3ARTA 1G7QA 4PS8A 1A3RL 4URKA 3KEHA 3UPRB 2WTRB 4LPVA 4HWBA 5ITFB 2YK1L 4WFGD 3QR2A 4NZFA 3ULVH 1WICA 2FHFA 3VSQA 5HHME 1WVZA 1C7SA 1T5XA 1BD2E 2Y06L 3O8XD 5GRZA 4FADA 1ZPUA 4PJGB 2X70B 2J7LA 2UY7A 4A2FA 5IVXB 1JZJA 1KXVA 5DZJA 4ELMF 4PD4K 4KJWD 4XNUL 4JG1L 3GZOA 2B08A 1D5XB 1LMKA 3OPZH 4TSAH 4Y4HB 4L8CA 1G84A 2EDNA 1NCIA 2D03H 1UM5H 1B0GA 3WUZA 1AIZA 1C9SA 3SGEH 1URLA 4PS4H 1OP3K 3WY2A 5B1JA 3HE7B 3N0PB 3ZGHA 4ABUA 2ZCZA 4PJIF 4RRPG 3F7PC 5JOFB 1MG3C 2VCOA 5FB8A 3WO4C 2XV0A 1VF5C 4EOWH 1N10A 3VFRB 4G9FA 1XMEB 4PG9A 2DLHA 4M62H 3AT0A 5D93B 3L1FA 3U7WH 3QFJB 4XH2A 3HB3B 4E5XA 1KOAA 5KS9E 2H32B 1NAMH 3QCVH 2IDFA 2OXHA 1WZMA 1EXGA 4ORZC 4UUJB 4DKTA 5C8JA 2JKJA 1MVUB 3OB0H 1UGKA 1ZLDA 2GPZA 4Q9BA 2HH0H 4R90L 3NK4A 5DFTA 8FABA 5HGAB 3NIGF 2DPKA 4M43H 2B0SH 3CH8A 1LEIA 4HIEB 3ZYZA 5CGYD 5B4MD 3ZL4H 4FFYL 2R8SH 5L6YH 2YMOA 5I18H 1BFOB 1HSBB 5AKVA 1MJUH 4S1RL 5EPMB 5I5MA 4JM2C 3CAFA 3TH4T 5C0GA 1OTTC 2WBXA 5B1CA 1JOIA 5SV4A 2P5WE 1ZVSA 4JFDA 4WWKA 3CZSA 1OANA 4C56A 2LGNA 3D2UB 3LMJH 2FVNA 2Q8BH 3ZTNL 1KB3A 5CJOL 3WTSA 1HWHB 3ARRA 1WAEA 3C8KA 3O3UN 2ZXWB 2Q2LA 1N59B 3P0VH 4LB8A 1FAIH 1FNEB 5GRUH 3U9PL 4A7UA 4PVMA 4PJDB 4YHOL 4OJCA 3VI4E 3O3BB 1RMFL 4YSOA 2B9BA 2GYSA 5D2NA 3H9HB 3P4NB 3I3EA 5I1AB 2ED9A 1X5AA 3DYOA 3ZOAA 3GIVA 2HLAB 4HALA 5EIIG 5B39B 3T2NH 6PAZA 3PP3K 4AKQA 1EO8H 2JF1A 2XWZA 5K33A 2D73A 3UEZA 1HT6A 3BZEA 4GG6E 5D1ZC 4G1MA 3VYNA 5J6GB 2BSRA 1MRDH 1ROCA 3LQZA 4PHZA 5IROC 4CNIB 5GIRB 2BXYA 2XVGA 3NBNA 3GK8L 5AL0A 2DWTA 3MCKB 4YDVB 4ZFGL 3A47A 4O00A 1SEBB 3J2PA 1WPCA 4GKSA 1R3IH 2VDPB 4I18C 4HZAA 2DM2A 1JPEA 3S96B 3JT2A 3QG6A 5FEBA 5J56B 1YDPB 3FFCB 2C9SA 4FQCL 4A7SA 1TNNA 1A0QL 3NDZE 5EUKB 5JHDE 5H37H 4M9OA 2OW7A 4CC4A 4NPJA 2DQTH 3D09A 3EYQC 1R6VA 4S0HA 4PRDB 1B4LA 1WZ1L 4AGOA 1F1AA 1JVLA 1RUML 3KW8A 4HYTB 4NDMB 3ETBF 4NQDB 4IRSA 3QRGL 3T4AC 2QTVA 35C8H 1I7RA 2WNKA 3BKCL 3DMMB 2AERT 2CBPA 2X5PA 4HF5H 4HMCA 4RGMB 4UZGA 4NN7B 1BBJB 4FA6A 3ISWA 5I6NA 2LVEA 4X6CA 1BZ9A 3BEVA 4HEME 1BPLB 2DRUA 4KX9A 5KEZA 4DK3A 1HEHC 1BJ1H 1FO0B 3OKNA 1ASOA 3EBIA 1WITA 3JWDH 5G4NA 5A6IA 3DGGA 5J1AB 2FWLB 3SDXF 1FZJB 2WOBA 3ABLB 4XGZB 2ZOLB 3HC2A 2VIRA 1G43A 3PAZA 2DYRB 1WFNA 2ZKHL 2HLFC 1A14H 3UJIH 3V8OA 2Z8WC 2NXYC 1REIA 1BX2A 1PZAA 2E46A 2F74B 5T3XH 3V4VB 3CZLA 1R3JB 4GKNB 4NQTA 5D4JA 1NCAL 4U6VH 3KW7A 1HDMA 3GLDA 1QPKA 5JPNA 4DSYA 2GKIA 2Y5TA 5CCJA 1PFOA 2BP3A 3TTYA 3VGAC 4YGVB 4OCWL 1I8AA 2ENQA 4JPWL 3UBXB 1GAFL 2YPVH 5BJTA 2DJSA 1HCFX 1L0XA 4MJ6A 3B9VA 4JJOA 1WLHA 3NMEA 1CD9B 4EN3C 1X6LA 3DX6A 4QMEA 1F4AA 2BMKB 3D0VB 3BDYL 4XNQA 3EDKA 1AFVL 1HCVA 1AD9A 2MRYA 1IBGH 3GXDA 5LAPA 1JUFA 3P2DA 3AS2A 4CVXB 3KGRA 4Z3FA 1HQ4B 2OL3L 4B9JA 1CR9H 4KHXH 5C08A 3SDDB 4M5YL 5L8LB 2G5RA 2YD3A 2WJ7A 1BAWA 4UIMA 5D2LF 3LTVA 4LOVA 1E4JA 1TJGL 3KBFA 3LZFH 4JQIH 1O7SA 2Y0SA 2X4OB 3UTZA 1KIRA 3PAYA 4X80H 3DROA 5I0YA 1KTDA 4HJGB 5E4IA 3G6JB 4Y2OB 3TBYB 1HE8A 5K9OB 2PTTB 5T3ZD 2NTFB 2ZXEB 5GGVH 3CDGA 2VRKA 5D1XB 5EU6A 1D5MB 4XN8A 1PJ9A 5TJWK 4L2LA 1WIPA 1HZHH 3TEYA 1KUMA 1Q72H 2Y7NA 3CLEH 5C70A 5IFHH 3ALWA 4HS3A 4R8WL 4OVUA 4NBXB 2CJUH 5AD0B 5JOPE 2GCYB 5JUEH 4TQ8A 2XX0A 4HIIA 2OMTA 3QIWC 1OAUL 4OZFA 3AREB 4MAYB 4P2OA 4X6EB 1M7IA 3QCTH 3C6LB 5IMMB 1WFIA 4DFHA 4EDWH 4Y4HD 5C07B 5D9SB 2IIJA 3IRZA 2EKSB 5TE7H 2FDBP 4LZHA 1YLBB 2DMBA 1WO2A 2NR6C 3C6SB 3K74B 4HWZA 4NKQB 1K4DB 4P9ML 5IB5B 1COBA 3MNWA 3VGGA 1TTRA 5DJ0B 1C8QA 1CF8H 3U7YL 1QHQA 5IBLD 5LJYH 3JTTA 5CM1A 1MCPH 3T3MF 2F18A 4NHUA 3HNVL 3T65A 1AH1A 1TZHA 1MQ8A 2ICCA 2VM4A 2W60A 3CSGA 3QDHA 4MJ5B 2Q6WA 2P47B 2B4CH 5FCSH 3RUGE 5C0DB 3ARBC 3BZ4A 3GMLA 4XB3A 3OLIA 1Q38A 2XZCL 4AT6B 5SWSA 2XRAL 4XN9A 4OJEH 3QUZB 4X6DA 4YBLB 5HDLA 2MPAL 2WQWA 5C09E 2PR9A 2VXQL 4PG2C 4DEPC 5KG9A 5EF1A 4UV4L 2W80C 5DUML 3RTQB 2IBBA 1I9EA 3WMSA 1W80A 5EBGA 4WDIA 5F88A 2IC2A 4NQCD 4L9LA 4NXSA 2MOQA 3ARPA 1OE2A 1T1XB 4JFEE 1ZS2A 4C55A 4E0RB 4WZ9A 2OAAA 5CP3A 1EJ8A 5I0WA 1B4TA 2WLMA 3ILPA 5INDA 4Y4FD 4XVSH 3W81A 3VB9A 1M4KA 2PXYD 2XTSA 3O2DL 5H4YA 3ARWA 5CJQH 3FN0L 4TVPE 5DZPA 2CUMA 3SDCC 1FE8H 1PG7L 5DWUH 2YFNA 4S2SA 5IQ9B 2WZPD 3D2UD 4LCWA 3IDJB 3MLSH 1S7XB 1SJEA 2GUOA 2ZXCA 4O58H 4DK5A 1U4EA 1CTMA 1HNFA 1G7IA 5J1TC 2IWGA 1A9VA 4RAUA 4U1KA 3EJPA 1A7QH 1DVFA 4J4PA 2PUQT 2Q7NA 3P9MA 1NC4B 1TJXA 2BK8A 4PJHB 2HT4C 3EOBB 2IEPA 3OX8B 2FCBA 4LVNC 4MAUH 4C58B 3CG8A 4G6MH 4YO0B 1LK2B 1PGRB 3SY0B 4UQ2B 3TF4A 3LYRA 3CFBA 2AXHA 3U82B 2YSSB 4W9EC 4OCSL 4P2QA 1MFUA 4YR6A 3WHXA 4KOBA 5LWYL 4F7KA 1YNTF 4I77L 4KVNH 3TBWA 4GRWF 5E2VH 1WBYB 2EXYC 2BP8B 4JK0D 2MH4A 3FFCD 3IETB 3TP4A 5E8OA 3VU2A 2ICEB 1QBML 4WUKH 2JB6B 4J6RH 2CCVA 4C59B 1RXLA 4PRPB 3GSXB 3ROOA 4G5ZL 1ZGLM 1PCXA 1YEGH 3FOMB 3MJ7B 1SOKA 4LT7A 4EIBA 1NCJA 1IM3D 1ZHNB 1X7TA 4M48L 2V8MA 1O7VA 3CLFH 4D9RD 3WN6A 3FTGA 4HCRH 3WLWC 2AJVL 3L9RA 3UX9B 3QO1B 3ULUC 3VXUD 1JFHA 3HC4H 4NKIL 4PHXA 4ZUUA 3WTWA 5DJYA 3X1GA 3ZTJG 1KLUA 2UZYA 3ARYA 1T0MB 5F7EH 5HYSA 3FKUS 2CM5A 3RWIA 4ZFFA 4CBPA 4LAQL 4ZXBD 1OP3H 3TLRA 2Q86A 1M7XA 3FJTA 4H25B 3HZ3A 5EOTA 1GYWA 4NWTL 1AQKH 3DBXB 4FQJH 4HH8A 2BIIA 3VE0B 5F7KC 4YSRA 1BIIB 5C92A 4X7EC 5DFVD 1CTNA 2NY1B 1OD9A 2IF7A 3HC0B 3OAUH 4Y4KD 5LGJB 1LDPL 2X4RA 5EC2A 1LP9A 3ZPDA 5KWYC 3MRLA 3CFIC 2EO9A 3QQ9C 4YX2L 3UDWC 1E8WA 1PZUB 1ZIAA 4HFWA 5FK9B 4X99A 1J1PL 1MZZA 3AG4B 4JFXB 5JR1H 1TJIL 1F4WH 5KJ7E 4AV0A 2MNWA 3LJ3A 3REVB 3WS3B 3X3GL 1N0XH 2C1PA 2WD0A 4F27A 2YMXL 1JZ3A 3CHXA 1KTRL 2NNFA 2CGZA 3BD4A 3C2AH 4Y8DC 5CLZA 4BGLA 5M95B 4AW7A 3EZJB 5FOBB 1XGPA 4LLMB 4F8TA 3WL9B 1FP5A 3RI5K 2BOCB 4F37K 4WW2A 3DX3A 5J6HB 3QXDB 1YJDH 3HOGA 1MCJA 3MRDB 3HFFA 4RMRA 3T1WA 2WIMA 3CFNA 3RGBA 2VXSL 1OIOA 2DYPB 4XB8A 4LPYA 3OHXB 4X42A 3P1VA 3CZJA 3VH8A 2WM0A 2X9YA 3UZVB 3VSTA 4HIXL 4I1RA 1XGUA 5CUSH 2HKHH 2RMNA 3GQFA 4XP5H 2UZIH 1IC4H 2BJML 4ZFQA 1CBVH 4JHWL 1UWGL 4FE9A 2E75C 4JM2F 3K71A 1RIUH 2BW4A 1DANU 4Y88A 3TYGH 3BGMB 1M7UA 4FQXB 3WFHA 2YOCA 3WXWH 4F9LA 3S88L 1F1GA 3HIZA 4PJ5E 1MJ7L 3SEPA 3ZDWA 5HHMD 3BAIA 3VXNA 3CVBA 1KB5H 2UWEE 4XZUA 4HZLB 4DW2L 1FFTB 1XMWA 5D1XD 2JJWA 4KJPC 3S37X 1QASA 3VX1A 4JS7A 1OZTG 4OCXL 2NY2B 2ZUTA 3SPHA 3PP3H 4NNPL 2HKLA 3QDJA 5CAYB 2XWXA 3QYNA 3SE4A 1CXFA 3HZMB 4UT7L 3A4EA 4I2XA 4QRRA 4U6HB 1MCHA 4OW6A 4RGOL 4TN9A 4E9LA 3ESPA 3W0WE 3TFKD 3VXSD 3C6LD 4OR1A 5T1LA 4U1IB 3MUHL 4YDNA 5KBPA 3O2WL 1I7TB 5IBTL 3BRGC 3VGHA 1FFQA 3A3YB 2WBJA 3KDMA 4JFFE 5C0BE 5FUCC 2B2XL 3QQDA 1U8MB 4NZ8A 3TO4D 2CU9A 4XX1E 2V3FA 2VLKE 4WUUA 5AZ2H 3TC9A 5HHPA 3VXTB 1B2WL 2AMGA 3CU7A 1BWMA 2AK4A 2JH2A 2JELL 2YD0A 3SE8H 4OIAA 3E1F1 4Q6KA 5DD6B 2KUTA 3F58H 2ESVD 2GSIB 5F9AC 3LH8A 3W9DA 1DQQA 4KV5E 4NFDA 1IQDA 1X7QA 2W65A 1K3IA 2GQHA 4HC1A 3B37A 2H3NA 4MDIB 4R7NA 3VWKA 1RZIB 1NIBA 1L5GB 1AZCA 3LX9A 1JGLH 1E2ZA 1F0LA 2EH7H 3HS0B 2O5XL 3Q9QA 4F24A 5F96L 5F0LB 3SJVA 2BS71 4P9HH 2BOLA 1KJ2A 1NBZB 1GZQB 3B4NA 4FFZA 3OLGA 4HS8L 3D0AA 4D7BA 3NCYS 3WNOA 2NYYD 4HJJL 2ATPA 3QUYD 4Z78B 5L0QB 3VCLB 3CBRA 1NDGA 3UBHA 4Z7WE 2KPWA 2G5UA 3DRQA 3DURA 4YFLF 5AB2A 3CMOH 1G7PB 5C0RH 1TPXC 3ARUA 1VACB 4DCQA 1IC0A 1NLDL 1L6PA 4K3EL 4N0UE 3W5NA 5D71L 5HYJB 3H1ZA 5E03A 4ZMNA 3E1ZA 2DW5A 2NY7L 5A6MA 3KPRB 4L9DA 4APQB 4LLQB 5EU4A 4XTRD 1GKEA 2FX8L 5D70H 5AW1B 1OK0A 3DJRA 4KTEH 1BECA 2WBWB 3L9EA 4GINA 4X4ZA 3UG4A 3UAAA 5KSUB 1TJHL 4LU5H 4W9CC 2H1PH 5DJXA 3UROR 3G04B 4S1DD 3MBEC 2FT8A 5F21B 4BK4A 4WI9A 3GMRB 4PTUA 2GBAA 4UQEA 2BZDA 5F8QC 4PJ8B 1X7SA 4UAOB 4LHUD 5IM7A 1WBXB 4U1GB 4DPRA 2B77A 2WQSA 3AY4C 3CSYA 1P1ZB 2JKXA 4PRBB 4PRHA 4XX5A 1OKEA 1KTKE 4RX4D 1EFXD 4L0YA 3AZUA 1EDQA 5JHDD 3FB5A 1RFDH 3HZKA 4M5ZH 4X9IA 4MB1A 4YQXL 5BUGA 1E9OA 4R26H 4NOFA 1SHWA 3O3AB 4AYFB 5E9DB 2OMYA 2XVBA 3L13A 5C0FA 2BH0A 4N2EA 1G6RB 5KVEH 1Q4NX 2A6KB 2EQDA 4NYLB 1WG3A 2GJZB 4NQVA 4PY8J 3T0EA 2DB8A 2IDSA 1MHPL 2OTWA 5ACZA 3R7RA 4A37A 4PLNC 4ZMYA 3IGFA 3UO8B 3KG5A 2OMUB 4BZ2H 1CUOA 3E6HA 1BQRA 1BQKA 3M8OH 2ENSA 4LZKA 5FYJU 3SKMB 3KZ8A 4G70B 3KYKL 2PWGA 4UU9A 1J8HB 4FHKA 1KEML 1XF4B 3DUSA 3OQ3B 4UT9L 4TYUA 1QATA 1VSCA 3EO0B 4BWUA 4IGBA 4PJ7E 4ODUA 1W9XA 3KVPA 4P5KA 3AB0C 1IC1A 4FERA 1PSKL 4KK6D 4AV5A 4G8GB 4K8RL 5JYLA 1JMXA 1L3NA 1WYJA 4GIPD 1BLNA 4U6XA 2CLVA 2XQ0A 4IRZH 5B21A 3RL1A 3TH3T 4CKVX 4PY7A 3S9DB 4UT6A 2F53A 3MOAH 4AQAB 4DVRL 5AAMC 2D7PA 4CUCA 4LRIC 1YHPA 3RWHA 4ENZA 1L9RA 3BKML 1OWWA 3F5WB 3PL6C 1MVYA 3NN8B 4EF3A 4Z7QE 4FQIL 3PUCA 4AYID 1G7HA 5JPMA 1ADWA 4E9VA 4G7SB 5CU9A 3ZDXE 1A6AA 1R75A 4OIFA 4BUGA 4JE4B 5I1CL 1INQB 1R33A 3QC5X 4G7YL 1PEWA 4Z7OF 1KCUH 4KQ3H 3BWAA 4GUOA 5EH1A 2VLJB 1M71B 3OKMA 4X0KA 4P5TC 2E7MA 1GXEA 4KY2A 2QBWA 1N5YL 3MSPA 1IM9D 4UDUA 1J5IA 2GK0A 2DYPD 4P49A 3LRSB 2OR9H 3FUNA 2ROYA 5DHDA 4APXB 1SYSB 4LEXL 1IAOA 4PS7A 4DKDC 3HTLX 1ED3A 4GMTL 4YDJB 1GZPA 4XVTH 1EPFA 2VKWA 3ARGC 4GRLB 3VB8A 1DLHA 4O2CA 4FQXD 3QJFB 5F89B 1M9WA 3QRLA 4ELMA 5KN5A 4ZPVA 1HESA 4HWBH 2DIAA 5CEZE 32C2A 4ZOCA 5JOPD 4J8RA 4NWUL 5AENA 5D5MB 1KDJA 1HHGB 1KTJA 1T21B 3QZWG 4XN4A 3RIKA 3HRPA 3RKDC 4ZTPL 4MB4A 4HIHB 1TQCC 1CT8A 4JFUA 2ZUQC 4PJIA 4LL4A 1ZA6B 5FWQA 2OXGB 3DGDA 3P4OB 2R2BB 2DBJA 1ITBB 3NJFA 1A6ZA 4XPGH 1T7WA 2QVIA 2HG5A 4JFQB 4Z23A 4AYBA 4YDKL 1ZGLP 2BC4A 3DOHA 3IDGA 3PGFH 5FUOL 4TPRL 3U79A 3FQUA 3IGLA 2D3VA 1YC7A 1UB6A 4WI0A 2WZAA 1LLAA 4F58L 3K6OA 1JK9B 4HG4K 2A74C 4WK0B 1DCEA 4H13C 2DEXX 2JKRM 4I5BA 5B7EA 5ID1B 5MI0C 2BZ7A 4NLHA 5JIIA 2VQ4A 1JPTH 4JQVC 4L23A 4BZ1L 2AJZA 1P0SE 3BAKA 3PREA 2VL5B 4IKNA 3ZIYA 1UWXK 4ANUA 4UM9D 3WIIL 3V0EA 1UA3A 1OSPL 4IDJH 1AGFB 1AO7B 4RISH 1ZWIA 5FW7A 2G0KA 3P11H 2Z7UA 4NENA 2F1BA 4PJ9B 4J27A 4P23A 4HIPA 4B7IA 3JYBA 4QRPA 1OARL 4NAMA 1J5CA 4RMBA 2BNQB 2VZ3A 2GT9A 5K9QI 4QO1A 4UQ3B 1JHTA 2VXVH 4XI5C 3IDMA 4UB0H 2QPUA 1HH6B 3ULUF 1JGEA 4TVPD 3I6GB 4YHIA 5G4OA 3BUPA 4LHQB 3V6FB 3TGXA 2OJEA 1DUZB 2R56H 4ONGL 4PRAB 1KYUA 4WU5B 3RB7A 4Z3HA 1QI3A 4RFNC 2GIMA 3S4SG 3MGAA 4PCTA 1H6UA 2Q9OA 3GRGA 5JA9A 4EAEA 6CGTA 4JY5L 3FU5A 4P99A 5FO8B 3HZYA 5HYJD 4X5PA 2APXA 4FKEA 1P4LB 3WYRA 1YA5A 2Q8AL 5EDSA 2EDLA 5I8KL 4APQD 4DOHB 2ZOKA 1IFHL 4X4MA 1NFIA 4CC1A 5CEYA 3GHEH 2L0DA 2HJFA 1GIGH 2NY6D 5BRPA 5FR3A 2H9GB 3BUBA 1G9ML 3AUVA 1I82A 3RZCC 1YEFL 4G3YH 3IMBA 4RZCB 4XNXL 3RGVC 4D8PB 4WHYH 4PJ8D 4X8JA 1A1MA 2JFCA 1NBYB 4N1CA 5HHOA 4ZD3H 1KGYE 3GSRA 3FAXA 4NRXA 2BIMA 4KO6A 1YQVL 1WQVT 4N6RA 1SY6A 3K4AA 4KY1L 4GEIA 3MODL 3WIHA 4I0PC 1NUGA 5D1QE 3GEWB 5D7IB 3CXHK 5E24E 5T1KB 4XXCA 3X1FA 1QNZL 1BYNA 3B9KB 1KYOK 1R0AH 2D31A 4PBWD 1OCWH 2IAMA 4ZSOE 1DQVA 2Y23A 4E42B 4FAAB 5GGUA 4M6NH 4YHMH 1MIMH 5HGHA 5HJGA 3QB7C 1EEYA 4XCFL 3IJYA 1R47A 2Y7MA 5IR1B 2OP4L 2X42A 2BY2A 4HKBA 5FDWB 1DQDL 4N85A 3TZVB 1N4XL 1CE6A 3BUDA 4D3CH 3RX9A 3HNSL 5DYOB 4G7QB 2DWDA 2W9DL 3SDXA 4XBGB 3BH8A 2BDNH 2Y6SC 1OB1B 1JP5A 2UZPA 4V2BA 4RA0C 3L6FA 1E4KC 3DBSA 1QOKA 3LRKA 4ZAKC 2E0PA 4Y2DD 1RUQH 1I3VA 4JGMA 3C5ZC 1Q0EA 1OSZA 3RDTB 1JTOA 1ZXQA 4J3OC 3IMUA 5CN2A 4PJEB 3H9YA 4OCNC 3NIFB 2CUIA 4NCC1 3FSVA 3DETC 5EZIL 2NSMA 1E6JL 1I9RH 2SEBB 3KWWA 4MJJA 2A6JA 4DPAX 4FJ6A 1IGJB 3A6CH 4IW4C 4GQRA 3D51A 5E5RB 5AAWA 1UUNA 4NO2A 3IN0A 4MNGB 5I76A 3LXUX 3PFQA 2FX9L 2XA3A 2HVBA 4K23H 3GSVB 2X44D 2ETWA 3UTTA 4MA3A 1SMOA 3KR3L 4Y7OC 3LZOA 3NESA 4MD4B 1WWBX 3JTSA 4LPUA 4CJ1A 3Q8EA 1YECL 1JSYA 1U8JB 4HWNA 4Z0BH 5IHZA 4AEIH 1CBJA 4MS8D 4UTAA 5D2LA 5EO9B 3L2NA 5CBEB 3AWEA 2VLJD 1DSWA 5BS0E 1RSFA 1CDUA 1PZ5A 2D7OA 3F3HA 3FUIA 4N8CL 4KK5D 1C16A 1A4JA 5EOCH 5C3IA 2F58H 1YPZA 4WY7H 1IZKA 2ZUYA 3EUUA 4E9RA 4G43A 3P30H 4P2RE 5TF1L 3TWCH 1KELL 3GJEA 3APDA 3A6BH 4DZBB 3JWNH 3CN4A 1QFUL 3H3BC 3O9WD 3TNMA 1CXIA 1XIWA 3BZFA 4ZO8A 4FQPA 2H3XC 2LR4A 1JXJA 4OD2B 3WJJC 4BV1A 2X4TA 3U36A 4YHLH 1C12B 3EHBB 1YEIL 4KKQA 5JXAH 3VRLF 4JPVH 5GHWL 2J6EH 3Q06A 3WLBA 4ELKA 3QA3B 5H2BA 5I73B 2I7OA 5IUSA 5T3ZL 2Z65C 4UINL 3AUWB 2DMCA 2XG5B 3VXOA 5E00B 2AW2A 1CL7H 3UO1H 4JDZB 4G1EA 4JFFD 1JK8B 4OZFH 5D4HA 3M88A 3V6ZB 1X5FA 5AOLA 4RMWA 1YNKH 2I7SA 4QY8B 3EDJA 4JN2A 5DJDB 1IARB 4OTXH 5C0JB 3CPUA 2DKUA 4PJBB 2FYYA 3JV4A 1E3ZA 1I1AB 2MCPL 3TN0B 3UACA 5IW6A 4MQXD 4FG4A 1G7JA 5I6OA 5L2KA 3QXUA 3Q2WA 3WFEH 1AJ7H 1K2DA 3D39E 4G42A 3I50H 3GSQA 4E41D 4WJ5B 3VFSA 3DVGB 1JNNH 2QQLL 4HUXB 4GMSL 4LVHB 3SYOA 2Z8SA 1K3ZA 3S34L 4Z7NB 5T1DL 3IXAB 4HJ0D 1PEZA 1TU2B 4AI7A 1G7LA 1CI5A 2X4SB 1JFQH 2ZOTA 3O4OB 2ZX8A 2X9XA 3MFGB 1M1XB 2XV6B 4PJ9D 4Y5YB 4ABQA 3DTXA 3QFDB 1KGCE 3QDMB 2RHEA 5GSVA 4HKJB 2F8XC 2Z31B 3TBTA 1CPUA 4AENB 3FSZA 2J55A 4XHJD 1XBRA 2FEDC 3HRZA 1RUAH 2WMPA 3WNJA 2YUXA 2RFXA 1U8QB 1KBWA 2PO6C 1D9KD 5GZOA 4I1PA 2EINB 2Y36L 3CFKB 5CP3H 3B7UX 3N5AA 3VYPA 5DJ2A 3QDAA 2ZCKH 3R18A 1A9EB 2FH8A 2HFGL 5D7JB 3CFJB 3QO0A 5DT1H 5BXFA 2IPKA 1KWKA 3WTVA 5IJBC 5IHUL 2KKQA 1QKZH 1Y1UA 3BPOB 3JV6B 3BVNA 3KH4A 4MXQC 5T5FA 1BM3L 5ISZE 5H35B 3FCSA 3IM1A 2I5YH 3OTTA 3RU8H 1X4ZA 4HUNB 1FL5A 1A9BA 3PWUA 4XWOC 4CGTA 2HFEB 1J18A 3KPLA 4FL4B 4CU7A 1DN2A 5FYKU 3V55A 4DP6X 3V0FA 5HXMA 5JO5B 1WUZA 3QORA 3RURA 4JHUA 3D3VE 3LN5A 5FC9A 2DIJA 2IG2H 4J23A 4GQ9H 4N5UA 1J0IA 2WQAA 3C12A 1IEHA 4HKZA 4ANKA 5CINL 2JLPA 4UANA 4EPSA 2WQRA 3VRJA 5I71B 3WNKA 3MTRA 1FBIH 1Q94B 3Q6FA 4U3CA 1AZRA 1XSKA 2NDGA 2CXKA 2AZAA 1UZ8A 3MLTB 3ZR6A 5KSBF 2JJVA 1YY9D 3D4ZA 4QHKJ 1A7OH 2FHBA 4OM1L 1JV5A 3CV5A 3HUJF 4MA8L 2ZWSA 4E9XA 1DL7H 4Z7IA 5K39B 2A0LC 1HAWA 2VDPL 2X1QA 2VB5A 1NAMB 2VQTA 4O51B 5FUZL 3PV6B 1FVCA 1UATA 4QHLA 1E7VA 2G3ZA 1OGAB 4G82A 3ARFC 5F7DB 3S5LB 1AKJD 4XP4H 3BGFC 2DQGL 3M6DA 1DYZA 3VM7A 3FB6B 4UNIA 3L3HA 5E6IB 3NEXA 2YD6A 3GUTA 1D5ZA 1NM4A 3N41B 4GYBA 2GAZB 2WQUA 3PIQB 5I30L 2Y2WA 3H3PL 3QR0A 1A6WH 4JM0A 4R4FL 4W9ZA 1VJSA 1I8IB 2X9WA 5ILTL 3BYYA 2P7TB 3N1MC 3FU0A 3FULA 3MJ8B 1FIGH 2R0LH 5AB9A 1T4WA 4X5LA 5EO1B 3ZDZB 4KNTA 1FO0L 3MRKB 4Z1PA 2FO8A 1UWXH 2DYSB 4G80A 4OLWH 1SXSA 3UABA 4X5WB 4ZOAA 4B0MB 4RSYA 2N3JA 5SX5K 2Y69B 2BNRA 3I6KA 3PWLA 4JB9H 1PIGA 5F7YC 2FJGB 1F4XH 1H9VA 2NY3B 5EIVA 3N42F 1RURL 1WEJL 3KYMB 4DFIA 1FA4A 2AS5M 3BUTA 4FFWD 4MD0B 1YMHB 3V4VL 3SE3A 5MEPA 1BBDH 3ATFA 4XP6L 5FM8A 2WXOA 2Y3NA 4MCNA 4KKBC 3RWDA 3LPPA 1AS7A 1KXHA 3P77B 4JM2A 4NO0D 3ML8A 3MV7E 1I7UA 5A2LH 2L7QA 4NM8H 4EJ1C 2I9TB 4K7PY 1M6OB 4ADJA 1V55B 3I6LD 5AVVB 5EU3B 3QJZA 4ZJ9A 1U8KB 2CGRL 3IBOA 3UBGA 5TDPB 4NAJA 5KVFL 3JZYA 3M1BB 2X0VA 2VZTA 2WSPA 4D0DB 4MLIA 1TVHB 3QUXB 4XPFL 3SSGA 1IEBA 5FYJH 5CEZD 2AJSL 4K9EH 1XEDA 4NHCH 1ACZA 5D7LA 2IPTL 2OTPA 4NN5B 1NLBH 5F7BA 1JWSB 3VTMA 4JCLA 3WN5B 5I23A 4KC3B 4BKSC 4F7EB 2OFQA 3BKYH 4ZNEA 4HIQA 4M8UA 5EUOA 4QOKE 4HMEA 4U1NA 1QZ1A 4LMQE 4NBYB 2HP4A 5D1ZA 5TFSH 4YLCA 1VCAA 1BSIA 4X4XA 5IROA 1DBML 1E5AA 4DN4H 1TTAA 4FG2A 3RVWC 4ZI8A 5JHBA 1IKNC 4JZOA 4L3FA 2OI9C 2A9NL 4LHUG 4I18A 1D7CA 2CLRB 1XSOA 3D18B 4G8IB 2FD6H 1JZ2A 1JIBA 4IEFA 5DI8B 1IX2A 1MCKA 2X2YA 3WUWA 5C0AA 4NJ9L 1MKFA 1VGEL 2UVFA 5BRZB 2VSCA 1N8ZA 4LCVA 4PV8A 1ZANL 2A9MH 2F08A 2F7IA 1YMMD 3QJXA 1QO3B 1MCBA 2EIBA 1SDDA 4OZGA 4UNVA 4NC1C 3T4AA 4RNRB 1SJVA 3EKCA 1HYRC 4HT1L 2VZUA 3BVUA 4O4YH 1PKQE 3L4VA 2NXZC 1Y7MA 4K8RC 2A1WL 3TIEB 1NBQA 1S7TA 3EJZD 2OZ4L 2CRYA 3MBWA 4G8AC 3M17A 4MMXC 2N1TE 1S7SB 4KRMB 4AEEA 2NT1A 3LKOA 4N1HB 1ZE3H 3T8VA 4F93B 3LH2L 1S9XB 5EN2B 3D69A 1ET5A 4IMKC 3LEXA 2E7CA 4R0LC 3B2UD 4TUKH 2XKNA 3R06B 4QRFA 4ZW8A 3QYMA 2A6IA 2XNAB 1TETH 3A24A 1UGNA 1HN1A 3U4AA 4NZRH 4J3OF 1ONQB 1TCRA 1WD8A 1XB3A 3BVTA 4KUCF 5DD1L 5IJCC 3EXJA 3CPLB 4OIIL 5D7JD 5E2WH 1T03L 2YKLL 2YD5A 3UTSB 5GGTL 3K72A 2DQIH 4BFGA 4QKXB 4GQQA 5FECA 5IESH 4WI4A 3ULVD 1MCCA 5GS1C 3FU8A 3K2UL 1Q9WA 2XTJB 1KCSL 1UYWL 5IF0B 5I82A 4M1DH 4X8XA 3IGAA 3BT2L 2KC0A 4EN3A 4N0RA 3B1TA 3IGUA 1ADQA 1ECZA 1JF6A 3NEOA 4P4RB 2ADFH 4GIAA 1V10A 3CHOA 3FUKA 2YRZA 1AY1H 3OKLB 3U6RA 4OM0L 1F11B 3O4LE 5EORH 2Q20A 2AZUA 4AQZA 1QLRA 2X6MA 2VDMH 4U1SB 4LGRB 2ICES 2F8VA 3PWPE 1FVEB 1H3XA 5IB3B 1FV1A 3UZQA 5EBMB 3ETSA 1F4YH 3HI5L 3TU6A 3RPIB 3CHQA 5K59F 3MRFA 4WO4B 3WSQH 3FT9A 3ZQXA 1QUNB 1H5BC 1MCIA 1CGWA 2DQHH 4UQ9A 4NUMA 1SYVB 5GS0H 4LKCA 2OJ1A 4OD1H 3ZE0E 2ITDB 4QHMB 3A0OA 3MRJB 1G1YA 5JLZB 1LE5B 3MHZA 4IOFD 3NRFA 5IZ7A 3GSOB 2FL5B 4KRPD 4JDTH 3ARDB 1BF2A 4P46B 4OZIA 3O8XC 5HDBB 1NMAH 3NJJA 3BC9A 2WNWA 2X1OA 3QIWA 1KIQA 5I19L 1A7NL 1K85A 3UG3A 1H0DA 4JM4H 2HN7A 4ONHA 3VD7A 3P2BA 4B9ZA 2HTLC 4ETYA 4KMLB 1DZ0A 3I9AA 4FXGB 3CVIH 2IO5A 2B1HL 1LO2H 2DQUH 2EE9A 3MV8E 3NP3A 5ABAA 5JORA 2G4GA 2WUCH 3RNQA 2NR6A 2P3YA 4JFOA 4IJTA 3ZX1A 4AZUA 5EO0B 1RH8A 1MJ8H 3GRWH 4AZ8A 3HI6L 3IK2A 3MYJA 5LBVA 3CFDA 2X6VA 3NGBC 2WV3A 1OGTB 1KJ3H 3C5JA 4XNMA 3SYAA 1YSOA 3LEVL 4LCYA 4LXFA 3L3GA 4QR7A 3I84A 4R5VA 2EYRB 3ARBA 3WMPA 5KYNA 3GB7A 1L3WA 1MHEA 3PHOB 3LKNB 4HA1A 3I75A 3BH4A 1FLRL 3RL2A 1AZBA 1QTPA 2BVQB 3FOLB 3V7AE 1DJIA 5IW1A 4PG2A 1NCBL 1IFRA 1EAPB 2L04A 1X5GA 2VH5H 3W3BA 1BWWA 2NY3D 2O6PA 5D1QC 1F42A 5KW9H 1W6LA 2P8LB 5A2IH 3FQYA 5BS0D 2PPCA 3BAEL 3ARSA 2GW5A 3L3JA 1E28B 3MRNB 3V0WH 2EH8L 1NH6A 1UKTA 5HVHB 2VDRB 2CKNA 4FCHA 2P45B 4LARH 2AQSA 3O6LH 5E4EB 3ASOB 1IBYA 1U8CA 2WXJA 3KJ6H 1IQWH 2X9ZA 4P2RD 3T5WA 1DVXA 3DHJA 3SDCA 1DFBL 2J5LB 3KL0A 4U1HB 2AJ3B 3ZGIA 1OM3H 3HAEH 1SF3A 2EE6A 5DRWA 3WG7B 1OPOA 3QHZH 2DM4A 4DGUA 2A9CA 3TASA 1G9MC 2AQQA 2H8PA 1ZS8B 5PCYA 2ERJB 2YARA 1J5DA 2UYLA 3C09C 2FO1A 1BCIA 2DLEA 3D08A 3TBBA 1CLZL 1ZSDA 2Y25A 3G5ZB 3VFNB 4EDXA 1JJUA 4HAFA 4RA3A 1I3RB 3PNWA 3VWJB 2JTYA 3LZQA 4K7FA 1YRKA 4YC2B 4XVUD 5DFWH 4XPTH 2G75A 1OCCB 1GGCL 1HX0A 2HFTA 3TBVA 2J4WL 3ESMA 1UKSA 4L4VA 2VXUL 3AU0A 2EUZA 2Y07H 5IT2L 3L7FA 5I74C 2WVSA 3NJVA 4MSWB 1BJ1J 1U2YA 4ZFOA 2XIIA 1CMOA 4L8BB 4L37B 5DJ8B 3KGUA 5G5DA 3S35H 5JW4Q 2H6PB 4ZUSA 4OF0A 3IS1X 3D39D 4O9HH 5HHXH 5AFAA 5FGCE 4R96B 3L3OC 3G5XB 4DH2A 1GC1L 3D0LB 5T3XD 3I02A 1T5WA 1NCCH 3TYFA 1EZVX 1HILA 2XQYA 5L2JA 5K1NA 5CCKH 3QI9B 4HMDA 2CIKB 2D2OA 4Z7UE 4A63A 4X9GA 2F19H 4PIRF 1JHKL 2W9EH 1T80A 3QAZB 5HJ3A 3EYUH 3EF4A 2EO7A 1KGXA 1ZLVH 2VITB 2WANA 3CN2A 1MFDH 4PRID 1A1OB 1VKXA 3ECBB 2VLLA 2K4AA 4FP8H 2CPCA 2XZAH 2ZAGA 4XRCA 4A7GF 4YHYB 2R2EB 3QCUH 1LNUA 3WFBL 3RFZC 3ZT5A 2VR8A 5ALCH 1U3HC 3GHBL 1ES0B 2K6WA 1BZEA 3RNKA 4ZO9A 4RMTA 2HFFB 4DQAA 4GW1A 3K0YA 4QRUB 5ENWA 3BQUB 3UDWA 1UG9A 2QKIC 2BRRH 2YJQA 4FXKB 1FL3B 4Y1AD 3KPQB 3MNVA 4MDJA 5SX5H 2IQ9H 4WCYL 2DWEB 5DMGD 3UTSD 2NUTA 3AW5A 3FT0A 5HGBB 3N04A 2HVKB 1YO4A 3B7TA 2EABA 1RSYA 2XTJD 4DUWA 3TVMD 3D3VD 1PZ2A 4AXWA 5FHAL 1V7MH 1CXEA 2D0HA 3BOVA 4KI5E 3MRCB 3RVVC 5FHBH 1N68A 4L5FH 1ZGLB 4UNTA 2P28B 5EN3A 1DVYA 4MXVF 4H8WL 1PZ3A 4HIJB 4DGYH 3KLHC 3RVXD 4CADA 3FMGH 1W0WA 2QFRA 5CJ8A 1LTXA 4Y1SA 5A7EA 4KH2A 2F2HA 1B3IA 2OQJB 2QADD 3G3LA 3RX7A 1DQTA 4AMXA 4L4TD 3SD5A 3WIHH 3GZPA 2BSBA 2HPTA 1AGCA 3UZEC 1GTNA 1ZAGA 3GMNA 3O6KL 3R1GL 4XAKD 3DTUB 4OLUH 1B4JH 4NJAH 2WSDA 5JNYA 5ANMA 5AUMB 1JYNA 1LILA 1C1EL 2VISB 3IFPB 4G5AA 3QH3A 3QJHA 4YBQC 4Y19A 3DHPA 2YPLB 2BNUB 3T8XB 5I8OL 1TIUA 1J1OH 3MNZA 4JPIA 4KKLC 4L1DA 4FABH 1RK0A 4N24A 3UPAA 4G9FE 2VERN 1NGXA 1CFVH 4JLRA 5AB1A 2CXGA 1G6RL 5C0IA 1IGCL 5EZLA 3VQLA 3IDXH 4AEHL 1QFOA 4PGDA 3RGHA 3SY6A 3ZO0A 5JIPA 2A73A 4A66A 5L7XH 4PVNA 1CF1A 3GSNA 3S98A 5C71A 5KJRH 5L8KB 1PY9A 2AV7A 4Y4HC 3P2TA 2MHAA 4Z7VA 1UCBH 1X5IA 1XGYH 1JZGA 2R15A 4EXPX 4F8NA 2ZE0A 1MUJA 4P4KB 1FFPA 1KPUA 3ETBJ 3HE7C 3KH3A 5AKSA 3WNIA 3R19A 5E6UB 4NC2B 4TNWF 1S9WA 1YZZA 2NY4D 3AS1A 4LCIL 4H2CA 1DBBL 4JVPA 1O75A 2R7EB 3JWOH 1SHXA 3SDAD 1MCOL 1K72A 4DHLA 2XYBA 1VLXA 1NCDL 5D93C 5FO9B 1GGIL 2XN9B 4XMLH 4MCMA 3HB3C 4BEIA 4N8VA 2IWFA 3M7OA 4C56E 2B39A 3NA9H 3FC8A 4DP8X 4JMXA 1RZJH 4YAQA 1A7PL 1QD0A 5E1GA 3DVFA 3BSZA 3GNMH 2FAUA 5SV3A 3FHAA 3GBNL 5I75B 1WAAE 3FL7A 4JKLA 5E8DL 4DP2X 1OL0A 2WVVA 1Y0LB 1Z5LB 4GSDH 3TNNA 4JZJB 5D2NE 4P5MA 4CN6A 5EU7C 2E7HA 1P4IL 2V37A 3TCLA 4S1SH 3FZUC 1MJJB 3I2CL 1TFPA 1DR9A 3QEQB 2YD7A 5GRVL 4ODHL 1K6QH 2KZBA 2OYPA 1BZ7A 5IG7A 5TE6L 1G7MB 2WLLB 3DIDA 1WFUA 4DGIL 4KFMA 2XXFA 1XH3B 3V52L 3K6NA 1JRHH 3U9UB 43C9A 3MUY1 1RIHL 4GLRI 4N28A 3ZTJH 1KC5H 1FC1A 2RCSL 4JFSA 4NUPA 4ODXB 5DHVH 5IEHA 4ZW6A 4M4RA 1A2YB 4IBWA 1CI3M 3QW9A 4FYTA 2BVOB 4E9WA 4AMKL 4G8GE 4S1QH 1YEJL 1WD9A 3TWYA 4NQEA 5I1IH 3MBEA 2IXQA 4IRJD 5L9DH 5ADPH 3BFOA 3B2VL 4H0IA 5CGMA 1CDIA 4NI3A 5IJDC 1QSEA 1H3UA 3MRBB 4PD4J 3T6XA 1NFDF 3AY4A 2FEJA 3PGDA 2B1AH 5HJDA 7PCYA 4N0CD 3D8MA 4AX3A 2ZTBA 2BVTA 2YQBA 4IU3B 4ZS7L 2PWHA 4TNVF 1K8IA 1PF3A 3Q8BA 1PBYA 3WOVA 1QQDB 4NNYA 3EFOB 1QP1A 4X6CE 2Z1PA 3IMVA 3QNYB 1A3LH 5HBBA 4X5XB 5TPWH 3QXAB 4HUWB 4OUUB 4LQFL 3CVDA 1IEAA 5C0EA 3DJ9A 2VLRB 4U4BA 5HHQB 4BELD 2QLVB 1FPTH 3BN9C 1UD5A 3L1GA 1UVQB 4FI7A 2OYKA 2P5WA 2P5EA 2EXWC 3IPEA 4XCCH 3PWNA 4WWOA 4PLKC 5B3SB 3V9FA 3DMMC 2G2RA 4RGMC 1UJ3A 4NN7C 2K78A 4ZO7A 3EJQA 2FLBT 1QSFB 3RWCB 3VI4A 3IJSA 4H5SA