5DZPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 90
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzpA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzpA02
5DC2A 3VYOA 5E1GA 4XVOA 2HKLA 3TURA 5DZJA 3ZGPA 4ZFQA 4LPQA 5DCCA 4QR7A 5K69A 4Z7AA 5LB1A 4QRAA 4A1JA 3U1PA 3TX4A 3ZQDA 3VAEA 4K73A 5DU7A 1ZATA 4QRBA 4HUCA 3VYPA 1Y7MA 4GSUA 5DUJA 5E5LA 5DZPA 5DVPA 3VYNA 4QTFA 5E51A 5LBGA 4A1KA 4HU2A 5D7HA 4A1IA 3ZG4A 4JMNA 2MTZA 5E1IA 4A52A 3U1QA 4GSRA 4GSQA 4JMXA 4LZHA
chains in the Genus database with same CATH superfamily
2HJLA 2OZ4A 2DIEA 2VABA 4WK4B 2A99A 5D2NA 1CURA 2GY7B 3FQRB 2AXFA 1Z2KA 3WFCL 2LTQC 4F7TB 5CBAA 1RP9A 4E5XG 4YFDB 3HVDA 5HHQA 1B0RB 2NY3B 3WSQL 5L4JA 2MCAA 3MUZ1 4UTBL 1BVNP 3LSOB 3MV9A 4IK7A 4QRRA 1W6WA 3O11B 3EYSH 3VGAB 5IWLC 4Y2DC 1T1ZB 4A1KA 7PAZA 4LHQB 4DN4H 1QTYT 5CM1A 2NZ1A 2EUZA 4PREA 3BQUD 4EAEA 4O5LL 5E1IA 1RLWA 2NW2A 1IGTA 5KG9A 1D5MB 1EDHA 1WIOA 5DFAA 4BRJA 3OKLA 1OSEA 3LKNA 1MRFL 2WB7A 4LIQL 2KLTA 5KYUA 4W1TA 3WIHL 3L4VA 3US0A 4Z7VA 1DLFL 4KKPA 1G9NL 1A3LH 4FQXB 1I9IH 2GK2A 3OAWA 3JT2A 5ICXB 4JKPH 1KB9J 3SE8H 1GRWA 1KBGL 2JKTM 1HHKA 3RPKA 4ENEC 1ODUA 4N90D 4L3CA 1PPIA 2ZUSA 2FQEA 2OSLB 3OPZH 4TQIA 4LASH 1BM3L 3NA4A 3RHWK 1XXFC 4NENA 4W4OC 4RCAA 1C08A 1XCTA 3IBOA 3NIDB 3QAQA 2W65B 3BSZA 3HRZC 2H26A 1BMGA 3P2DA 4NUJA 4DP0X 5I1EH 3O45B 4OD3L 4AH2B 3AABA 2AJ3B 5D5MF 3HG5A 3JUZA 2NOYA 1W0WB 4S1QH 1OSZA 1TCMA 2YPVA 3ULVL 3WJLA 4KBPA 3Q2WA 1TZGH 4AQ8C 4PGJA 2NPLX 1Y07A 3TIDA 1WT5C 3N43B 1HHHB 3HCVB 1RU9H 2A6JA 1YDPA 1HWGB 2M1KA 3WV0A 3CUPB 4YEFA 5AW0B 1AZNA 1GZQB 3QB7C 4I0KA 4PY8I 4WW2B 3UZQB 3W37A 1RK0A 5I5IA 3CXHJ 4IBLT 2NY3D 3L4XA 5DJZB 1WT5A 3FCTB 4YAQB 1WTGT 2K8MA 4LLVA 2HAZA 4H2CA 1PJWA 1AIFA 5LGHL 1JD7A 1OCWH 2EC9U 4MQ7A 3FT0A 3RL1A 2MH4A 5T1JA 1IBDA 2BP5M 3B7UX 4KY1L 4PJCF 1ZTMA 2H6OA 1SJXA 2P44B 1FNFA 4U1NA 4L8DA 3TJEL 1E42A 5FFOA 4QEGA 1EV2E 4X9YA 3KXFD 5EO0A 4W9KC 1LLAA 1MFDH 3CAFA 1J1XH 1S9XB 1W8OA 3LAFA 1E5AA 2YOCA 1N18A 3PP4H 4PRPD 1M7XA 2BSCA 3SDCC 1C08B 2X12A 3BKCH 1X5IA 5B1CA 2UZYA 3GSXB 3PHAA 3KBHE 1VZGA 4BK4A 3DSFH 2Z31D 2VGLM 3KPNB 5LNEA 3VUAA 4P5TA 3IDNB 2XIDA 4MAZA 4POZD 2JK5A 4JGUA 1VSCA 5GHWL 4M7LL 4C4BA 1ZCRA 2AQ1A 3V4VB 1MAKA 3OF6D 3NK3A 2ZXQA 3VX0A 4LSRH 1NKRA 1ZA3A 2XNAB 2E7CA 5G4OA 4W9IC 2IG2L 2Y3AA 3B8YA 4HUWA 3N42B 3BMVA 1BQHG 2NDGA 1QRNA 1JNNH 1I85C 4GIPD 2DH2A 3IJYB 1KWGA 3VXMD 3DBXB 4ALAL 4NBXB 3VNZA 4N2FA 4NQVA 5F3BB 1SMAA 4J2XA 1M1XB 3NSJA 3SKOB 1QACA 2WXFA 5IROC 3FCTA 4E41E 3C5ZB 3IGLA 2XXGA 1TO4A 1SY6H 3HUJA 1E8WA 4BA0A 4CN1A 4L3FA 32C2B 4G8GA 1A9BA 3EADA 5BZWB 3G5YA 4IOFD 3BH8B 3UAJC 1QSFD 2FZ3A 2ZF8A 3ZZSA 1WITA 4M6NH 4YHLH 1KZYA 1U8MB 3G6JB 4PRBA 2XKNA 4IKJA 3H9SD 1OOWA 1XEUA 3NDZE 3SPVB 5BW7C 2K6WA 3VU2A 3TEXA 2MOGA 2WXPA 4DTGL 3OJVC 5B7FA 1JG9A 4H13C 2FO4B 2FR4B 3N0PB 1CZ8L 4K8RL 2EVIA 1AKJD 2A77H 1EK3A 2WVUA 3BYTA 3A22A 5E6IC 1RHHA 3QYNA 4M7KL 2I07A 4X7TA 4ZYKB 4PD4K 4B95C 4EE2A 4UDUB 1A21A 4GFTB 3WTXA 3LN4A 1TYJA 4MKMA 2IDSA 4ZFFB 1SN0A 3SD5A 2FHFA 2BM3A 5DHYA 1YNKL 2IBGA 5EIIB 4GUPA 1MCOL 3WY2A 4HJ0C 4MXQD 1N0XH 2EDEA 2HN7A 2Q1EA 2AITA 4D0BA 5D7LB 1IFHL 4QRAA 2VZTA 1RURH 3GSRB 3AS0A 1KFAH 4IOSD 1RPUA 4Y2OB 1S8DB 2IH1B 3MRDA 4LO9A 3JWDC 3OKOA 2DM7A 4A1IA 4M6OL 3K8KA 3TO2B 4GG6F 4ZQKB 3FFDA 1CU4L 4LZHA 3QIWC 5F6IC 3V10A 1SJHB 1G9HA 1GY2A 2D7NA 4JRYB 4LLAA 2X4NB 1MIEH 5D1ZB 3BH8A 2HKFH 3V6BR 3MLTA 4H5SA 3V4LA 1MFUA 3EFOA 1PZ5A 4Y5YC 3MGOB 4GI9A 3VXUE 3GHEL 1MELA 1A7NL 3MOAL 3OB0H 4KPHH 5HDBB 2QEJA 3SPVA 1CGTA 5FF6A 1M3JA 5E1HB 4KAQH 3STBA 2FO4A 1OW0C 1CYWA 2VDOB 4RX4D 1IGCL 3ECUA 3QQ4A 4MJJA 1NFDE 4YHZL 4PY7A 2UXTA 4U3SB 4P3WA 4X7TB 1RUPL 4Y9GA 4ZYKA 2QADB 4S1DC 2W5PA 2EXYC 1ZVYA 3BUYB 3FB8B 3QFGA 5AYTA 1JV2A 3WIFB 2VWEC 3X3FL 4MMZA 4A39A 5L2JB 3FQUB 2ZSVA 4FTVE 5DEFB 1IGFL 1AKPA 5FKPB 4OV5A 1ADWA 2D73A 3U36A 3KVDD 3ROOA 3LHPL 4W9ZA 1J0JA 2NTFA 3HI6L 5C0CA 4JQXC 3K6DA 2OXGB 5F7YC 2FX9H 3DVNA 4LASL 4LVNC 3L8QA 4PJ8A 4E9XA 3GQFA 1LNUB 3J07A 1PD1A 3EBHA 3BZ5A 4B9CA 4PJEE 2EDHA 4XN2A 2Y06L 4P3CL 4QRBA 1H19A 1SJHA 3DIFB 1HILA 4GO6B 4N8UA 3L17A 4D8OA 1KYDA 3OAYH 4H8WC 2G5RA 4LEOA 3QG6A 3BHBA 1MCKA 4DP5X 4MBRA 3X1BA 4M7LH 1G0XA 2DYPB 1CWVA 1GYVA 3QW9A 4Z3GA 2OQJA 2GJ6D 1UB6A 4HC1L 3LPFA 3S5YA 4EI5A 3PY9A 4UTBA 1DE4A 5B38B 3EOAB 1FI8C 4AMXA 2GBVA 1A7BA 2O26U 3KPPA 5F7DB 1BJ1J 1NAMH 5IBTH 4NN6C 2MCG1 4P2OA 3LVEA 2WKOA 1NC2B 2B1AH 4NWTL 4TNVK 1BCIA 2YPVL 4YSTA 5EIVA 3L4WA 5ANHA 5FB8B 2EDLA 2COQA 4TL5A 5DJXA 2IWFA 4WI8A 2E75C 5C0BE 3GMOA 1KYAA 3W0WB 1JV2B 3WIFA 3C6EA 3LDBB 5KVDH 3IDXH 3M88A 4AOFA 4M43L 5CP3H 5DEFA 2Q3ZA 3DPBA 3V0GA 3SB3A 4ZMPA 2R8SH 2I9TA 4Z95H 1PZ3A 2DD8L 1GGBL 1R3HB 2RALA 4DAGL 1YYCA 3D09A 3NJIA 4KFZC 3OKNB 1J1PL 1YCSA 2R2HB 1ZK9A 4MZIA 4XO5A 5GQBA 4NM8H 2DBJA 2X41A 6CGTA 1NFDA 1PZCA 5DZNA 5KSUA 4Q74A 4LCUA 4LAQL 3TBSB 1VGKB 4QY8A 1A14H 2CUIA 4K8RH 1WQVT 1U58A 4LPCA 5DJ2A 1KZQA 1RJLA 4HX1B 3Q13A 3UTOA 1CDCA 1EHKB 2XWBB 1HILB 1N5AA 4B0MM 5C09A 2MQ3A 5J6HB 1QFWL 5GHWH 3EOTL 2AZUA 4YXLL 2ZCLL 1ZHNA 1BFVH 4TL4A 2YEZA 1X9QA 2WN3A 1HOEA 1KPRA 3QIUD 2YMTA 2CQVA 2DKUA 1I9EA 2ZYHA 4LSRL 5LBVA 5CLWA 2OP4L 2B4CL 3GMMB 1B9ZA 5CBEB 3ZKSD 5FM8A 1WGVA 5J13B 3U30C 2WOBA 3EBGA 3FU5A 2X2IA 1W2KT 3BQVA 1K5NB 1JPSL 2BZ7A 4S0TD 4LVOC 3EF4A 3TF4A 1TFHA 4QHNA 4P2OB 3SDAC 2EABA 5LNGA 3EBIA 3TJHC 3CFNA 2AGJL 1T89C 3P77B 2VISA 4XNQB 1CG9B 3EO9L 4QRPB 3TCXA 2EKJA 4ZD3H 1SY6L 4APQB 2F8OA 3F7KA 2D7MA 1XB3A 3QAZB 3ETBF 5FECA 4BGDA 5F96H 2A9BA 2HRPL 4W9HC 3VXQA 2PUQT 1AHWC 1G0DA 2HT2C 5KVEL 4UT9H 3I6LD 1W0VB 5L8KB 5CEZH 4OFYA 4B7IA 4AJ0A 4ZPVB 1AR1C 1F42A 2B1HL 4FMKA 1T5KA 3MZTA 2Z1PA 4BFGA 3QZNA 3CH1B 2XVKA 2YPLB 3T0EE 4AMKL 4AV5A 4A7SA 1GYUA 3PL6B 1QI4A 2R1YB 2JKRM 5DMGC 3QQ9C 3CFBB 5FCSH 4XAWL 4XTRD 1S3RA 2Z4TA 5FUCC 2HWZH 1XFPA 3GSWB 4I1PA 4MDIA 2PP8A 1CFVL 2J8UB 2NY6B 3I50H 4PJDF 3FKUS 5EWIL 3ZDZE 1UUNA 1QSEE 1YG9A 5F1SA 3UYPA 4XMPH 2ITFA 1G7JB 3FJTA 4FFVC 3ET9F 1GW0A 1E4XL 1E8ZA 2DI9A 2UX6A 3MCG1 3ZT7A 1KB5L 1HS6A 1X5LA 3CHSA 1DQQA 1WEJH 2GI0A 4XNXH 1W15A 3OR6B 3TF7C 3RA7H 1XH2A 1H3UA 1ZT7B 2D2OA 2JJVA 3BP7A 1X44A 4M1CD 1RJCA 2JWYA 3VFTA 3ZL4H 1TO5A 4YK4B 1MHEA 3ATBA 1D6VH 3BD5A 3F6JA 3K6FA 4ZSOA 3A6CH 2Y3NA 5AYUL 1ULVA 3QPKA 1ZHLA 3IXAB 1CBJA 2EYSA 5D1QE 3ZQWA 4GRWF 2JTYA 2ZJSH 4APQD 3VXQB 4HVBA 2FHBA 1BEXA 1MFVA 4J8RA 4HT1H 1ZLSH 4Y7MA 1A22B 3HJ0A 1JDAA 1HSAB 1JTTA 1TTBA 4PJHE 4OZGB 1MCSA 3SPGA 3C08H 2D9QB 3Q01A 1SLVA 2DWTA 3RVUD 4QLRA 5BV7L 5DQJB 3S34H 4U1KB 3MCLH 5J1TC 4WKZA 1A4KB 4WFHE 2C1PB 1DDHB 2Z92A 3FBQA 3BWAB 4MMYB 3TA3D 3ETSA 4JM2A 4HMDA 3FO9B 1ZY9A 4I3SH 3V4PA 3MLZH 4FNSA 5DRWA 2CWRA 5IFAL 4FJYA 4UT6L 3P9MA 4DSYA 5D1XC 4YSDA 1BZ9A 4L4VD 5SV3A 3SBWA 5ILTH 2X09A 1JF5A 4Y9FA 3G6JF 3QDMD 1G7PB 2VDKL 3HKFA 4HKXB 2PABA 3DXAE 5C0GA 3ZN6A 2R4SH 3U79A 1BAFL 4Z95L 1KJMA 3ZKQD 3BN3B 3QZLA 4N0CD 4Y1AE 3VXRB 4ELMB 1M1SA 4ODSL 4A7GA 3EDKA 1HU8A 1LWRA 2P52A 3GKZA 4GT7A 5EBWA 3T2OA 4EZMA 1BREA 3DX8B 4X5WA 3PPEA 4M4PA 3V0EA 3O6LH 4BCZA 4K9JA 2ZAGA 3MCKB 3VQMA 5TH2B 1IE5A 4U1GC 4FG2A 3WO4C 3NSCA 3VI3A 1BOGB 5CF3A 3VD4A 5J6GA 2WINA 1FG9C 2HG5B 2NY2B 2X6MA 2HLEB 5B4MC 5D8JH 3S48A 2B4CC 3TFKC 2UX7A 1PFCA 6PCYA 1KOAA 1OPOA 4LL9A 5TE7H 4UUJB 1I9RH 3V6OC 1RZIB 3WLBB 2EIJB 2P5EA 4PRIA 5DJ8B 4W9EC 4JRYE 1P1ZA 2ZX5A 5LGKA 3DA0A 4AV0A 3K80A 4FQCL 4HIQA 4JY6B 4J8RB 4MJIA 1BHGA 2E0PA 4OTXH 5KSBA 1HKLH 5L2KE 3HRZB 3JXAA 2DMKA 1S5IH 3VE0A 4GSUA 1DBJH 5AOZA 1SOQA 5GS0L 4PJEA 2L8AA 4QRRD 4MSWA 2HJKB 1FGVL 1X4XA 1XWVA 2WMPB 1J0HA 3C60D 4YDKL 4IQHA 5HHVL 4AH2A 5KUKA 5J3HC 4K3EL 1UQSB 3X3GH 2GITB 2ICEB 1FIGH 2HMIC 2JI3A 4YPGA 4XOAA 1QSEA 2F8IA 1AC0A 3K0YA 3TA3B 3L5WA 2A73B 1ZIBA 1A5FL 1NGZB 1RZGA 4PG2A 2VO5A 5EF2A 2AK4B 1KB5A 3N42F 3REWB 3QDJA 5JHBA 1IAOA 1ZMYA 4QXUL 2OR7A 3ILDA 1UVQB 2JELL 2VN7A 4I48A 4AGMA 3RZCD 2H3NB 4R2GB 1YYLL 3M86A 4FTVB 1M71B 2H0EA 4S1RL 2PTTB 3G7TA 5IKCB 3VFMA 3GTNA 2H1XA 4YAQA 1SN2A 1YRKA 3DGDA 1N0LA 3TBCA 1DVFB 3MNZA 1FDLL 2Y6SC 3HMXA 4TSAL 3CN2A 3SPHA 3MBXH 4TUOB 4NOFA 4YPJA 1E27B 5ABZA 2WP3T 1Y6KR 3AFLA 1HZHL 2WUBH 3UTSB 3WJJC 2NY2D 1GAFH 1PLGL 1SXCA 4WNJA 3R19A 4LARL 2PMZA 1R9FA 3Q7JA 3DOSB 4PB0H 3IRCA 3NQKA 1K2DA 4WHCA 5C92A 4XXCA 4I18C 2GSMB 4HSQA 1J0ZA 1CI5A 1KB5H 2IWGA 1XIWA 3JV6A 4FFWC 3IAGC 2WNXA 1IBYA 2CJ3A 2YAOA 1GJWA 2BHZA 2OCJA 3MV9B 2PR4H 1MWOA 1VPOL 4HEMA 2EIZA 4YO0A 4XNMB 2WHVA 3M07A 4P48A 4O2EA 1NM4A 4ILDA 4OUUB 4HU8A 4ENZA 4K2UL 4OVVA 5I75B 4UOW0 4HDIB 1AO7D 2H1PH 1UURA 1SJMA 4FZEH 3L1OL 3QUGA 2AK4A 2YPKB 4JL1A 4LSVH 4S0SD 1T2QH 3CXFA 1IAOB 5DRNB 5JOPD 4MRBA 4LNRA 1KGJA 5KAQG 3KXFA 4GYBA 1KXHA 5JMRA 3RY4A 2O6CA 2X89D 3BFWA 3BUIA 4XWOC 5JIPA 1IM3D 1E6JL 5CJXC 5ICXA 2BC4B 4Z5RB 5IKCA 2ERJC 4XCNB 5I71B 5E00B 2VDOL 1JWSB 2VW7A 1G43A 3FQXB 2G2PA 3BN9C 3LPOA 2X4RA 4JG5A 5F9DC 5IFJB 3NEOA 2A4EA 5B22A 4XMZA 3WNNA 1GR7A 3EH1A 3LCYA 4JO4H 3SGJC 2AVGA 2H45A 3NIDF 5HGDA 4WFFD 3FTVA 2VQTA 4PH8A 2FIRT 2V7NA 1MJJB 3O4LB 1TLMA 1CVRA 3O45A 1JHTB 3WXWH 1KY6A 5HYSG 2ZWYA 1P2CB 2KZ1B 5AVUB 2VDKB 1FGNL 3TO4C 1J10A 3QIUC 4EKXA 3MVSA 3HLAB 2J72A 1OB1A 4N2IA 4X6FA 5LG6A 1T0PB 3FHQA 4J1UA 3BZ4B 1XD0A 3QQXA 4IRSD 3CVHB 3OAUL 3K5SA 5T33L 3N9GH 3FQNA 3FZUC 4KVCL 4QNPF 4E5XB 3CDZB 2VE6B 3ZR5A 3CMGA 2I07B 4E9RA 5GS0D 1UFGA 2P42B 4PBXA 5FYKD 4JFFB 3RX8A 4EN3B 4NJAL 1RFDL 3V4UL 1B0GA 5CUSH 4M5YH 5FUOH 1G1OA 3TFBA 4PJ6A 4P2QE 2BW5A 1N3NB 2NCEA 1F3DH 3T2QA 3R06B 1UJ3C 3PU7A 4RBPK 3EDDA 3DX0A 4N2GA 4NI3A 4YX2L 2IFFL 1NGPH 4JN2A 2WGXA 1GPOL 1IEAB 3OC5A 3OKOB 5JOFB 2I85A 2LVEA 3EJPA 3T6ZA 5TD4A 3CX2A 2BC4A 2LOEA 4G7QB 3GXDA 1EEUA 4PRPB 5EO0B 1A6WL 4Z5RA 3W2DH 5DD0H 3M8OL 1AKJA 3EDJA 2OI9B 1SYSA 4AK2A 4AEIL 1UH4A 3KAAA 3ULVD 5D1ZA 5DFVC 3L16A 2J4WL 4K3EH 1U93B 5CGBA 2H0JA 3L45A 4NUGL 2P8LB 3MGOA 5MEOB 2A4CA 1MRCL 4GBXC 5J13C 1EX0A 1INQB 4PVMA 4UDTA 1D7BA 3S88L 4X6FB 4BH8B 4F7CA 5BMFH 1SLXA 3D69B 3EZJB 4J3TA 3NSYA 4MJHA 3SPCA 3ZDZB 5EF3A 4E5XA 3V4PL 2E46A 1QRNB 4PJBF 2ZUXA 3L6FB 1I1AD 3L3GB 2FATL 3PV6B 3S8GB 1ESOA 3BUYA 2WXQA 2XN9A 3OLIA 2WKLA 1BX2A 3SBPA 4XN1A 1B4TA 3L4ZA 1UADC 1W72A 2XWJA 1SN5A 4FXKC 4KKRA 5D8JL 3WMPA 4X5XA 1U91B 4U0QB 3QRLA 3ZMNA 3IMBA 1KXVC 4CADB 5LVEA 1A9BB 1ID2A 3MRCB 3AXLA 4ZMLA 4UBDD 4YJZL 4HS8H 1QBLH 1G5GA 1T7YA 4OLXL 1SLUA 1VEOA 3H9YA 4PIRF 4P46C 4PJ8B 1FSKC 4S1DD 2ZYSA 4NQUA 3TVMA 2BRRL 1BQHA 4PJ7B 3E8UH 3SQOL 2AQNA 2XYBA 5ES4B 4WVRA 4IS6A 3TV3H 4RSVA 1XZ0A 4FQ2H 4G1EA 2WCPA 2BNRB 1OAJA 1KCUH 1MPAH 2IV9A 3O8XC 2RCSH 2ED6A 3KL3A 2MFNA 4PJFB 5CINH 2Y7QA 5DS8A 5MEOA 3FMGH 5KUMA 1XBRA 3B9EA 4L1LA 3VQ1C 3MLSL 2WWKO 2FJUB 4JFDD 2VLRD 1UWGL 4ZFFA 3CVIL 3K6NA 5B1BB 5ICYB 4YNYA 3MO1B 2LLLA 4KJPD 4F8TA 3KPMA 3TZVA 4K23H 3QDJE 4N0CC 1N19A 3MCYA 1GYCA 2GBAA 1YYLH 4Y2OA 4ZX4A 5I1IL 4U1MA 1E8XA 1KCSL 2VLJD 4P4KC 2EEXA 2I32A 3E9TA 5FB8A 1OAQH 4HLEA 5D71L 1I9JL 4HW6A 2HX8A 3W0WA 4FNQA 4NT6A 4R8WH 4DESA 4NNYA 1ADQA 1CLCA 1H6UA 4TRPL 3MBED 2XWJB 3DPBB 3D7PA 1NCHA 1TG8A 1WFJA 1JK9A 3ARED 3RP1A 4MTMA 1FPTH 2D0GA 1VGEH 2X4NA 3EJYD 1CCZA 3VXSD 4BFKA 4AQ1B 4F2ME 3RRQA 2IPKB 3E1ZA 3LN5B 5FCUH 2BY1A 3DWTA 4HWBL 3UEZA 3SDDA 3P0YH 4UT7H 4D3CH 1P6FA 2IAND 3Q1SL 1RZPA 1P5UA 4PRHA 4PRNA 3VB9A 2DJMA 5AAMA 2NXYC 4APQC 5J6SA 2LU5A 4CNIB 1S9YA 3MRQA 3GZPA 3T3PE 4ZO6A 3FB7A 1N59A 4OF6A 3VI4A 1GJIA 4HIXL 4NJAH 1QFOA 1IVTA 2W9DL 1ZHNB 5FUOL 2LHAA 1U6AL 4LLWA 1MEXL 2F1AA 4NNPL 2G2NA 5D4QA 3V2AR 3BZEB 3A4FA 3QZWA 1U3HD 5DGRA 1M7IA 2JCCE 3QXDA 2ZT9C 2H1PL 1H3PH 3DGCR 1OKEA 4LSVL 3N5AA 1OP5K 3EOYG 4RDQG 5FYLL 4NAMA 3SJVD 2YBGA 1BXXA 4UTBH 2RAMA 4JG0L 1TJIL 3U36B 3HN3A 4HJSA 2FSDA 5D5MA 1S5HA 2J5LB 5DO2C 2NTFB 5C0CB 4JQVC 3UIZA 5DD0L 3NZ8A 4OD2B 2LR4A 3OLEA 4GQQA 1BBJA 3B6SB 4AUJA 4X9BA 3U0TA 1J9TA 4K5MA 2Q6WA 5F9JA 5C09D 2XHNA 5E2WL 5DVKA 3DIFA 2XBTA 3OKKB 1CE6A 3FQYA 1JYVA 5DWUH 4RAUA 4DP8X 2B7DT 1OIOA 5F88A 4AQ1A 5A6IA 2ZOWA 4R4NC 4RGND 4NRZA 3CGTA 3SE8L 4XMKL 1WZKA 3MJ7A 1YO4A 2PLTA 4Z7UA 5GRWA 4POZC 2R56L 2PCYA 4RISL 5T3XH 4BEIA 4NRXB 1BXUA 2Z31C 3FXIC 2C7UA 2J88H 5EUOB 5EU5B 4U6TA 1N5YL 1WAAA 3KYNA 3K7UA 2FEEL 4AG4H 1N59B 3LKQA 5HHNB 2A6KA 2A7BA 3CFBA 3IDYB 1MXDA 8CGTA 2EXWD 4R96B 1NIFA 2R29H 1RZKL 5JW4R 2EKSA 1OAZL 2H32A 2PCPB 5HY9A 4DO5A 1Y0LA 3FUMA 4IOIA 5J12C 2ALWA 1TZGL 2DQCH 3CVHH 3QXDB 3GSNA 1PG7L 3G9AB 3LEXB 5T5FA 4X6DE 4TKWA 3WSQH 3ZL2A 4QTIH 2I9TB 1QKZH 4U0RB 1ZT7A 5F44A 3LS5H 5EC2B 4PV9A 3LRMA 4JG1H 3QWOB 5BO1H 2CK0L 1S5HB 3SEPA 3MTXA 1LO5A 3CQPA 4WV1A 2F74B 3RG1C 3ZDYB 3EW3B 1A6VL 5AG9A 4QRTB 2DWSA 5EF0A 1OGTA 1QAWA 2CIKA 5A7BA 3M45A 2G4EA 2PPFA 4JHZA 4JHAL 5AW7B 4DKAA 2Y69B 1CBVH 3K6IA 3UJIL 1N8ZB 4CRPA 1E7VA 1DLFH 2Y1ZA 4NHCL 5C09B 4F8QA 4O9HH 3UTSE 5TJWK 5KTEH 3UBXI 3ARSA 3L1FA 3MRFB 2XY1A 2VR3A 2VN5A 3CN0A 3IKCB 4N2DA 5IMOB 3MRHA 5EF1A 3FO2A 5IY5B 4J3OG 3A67H 2C1PA 1AC6A 4GAGH 1G7LB 1F11B 4ES9A 1ILUA 2YXVA 3CHPA 4YHML 4HGWA 1EA9C 2JB5H 2DTML 1X9LA 2F19H 3VFOB 3HAEB 4KXCA 3GS4A 4FCHA 3NEEA 3P9MB 4RMRA 5HHNA 4ZTOH 4OJDH 2DLTA 4PJ5D 3I3BA 4OIIH 3ZU8A 4AYBA 1A3QA 1YECH 4S1QL 2H32B 4XNQA 1OXYA 1EXUA 1MNUL 1OT4A 2YR3A 3X1FA 4APQA 2DQ6A 3FUFA 2ISDA 2WBXA 2VSKB 3LNDA 9CGTA 4GB9A 1VGEL 1NC4A 2ICWA 1AXIB 3QEQA 1M7DA 3L4UA 4OT1L 5KSAB 4I0PB 4HWBH 2ZNWA 4P04A 1CLVA 1YLBB 2M2DA 4PJ9B 4NOBA 5IB2B 5JIMA 2ZG3A 4W81A 3PUUA 3U4AA 3NCCB 2N59A 4JFZH 3FOMA 2VR7A 4JM2D 1QPPA 2R23A 4J27A 1IJNA 5HBBA 1BMWA 4BDVB 1BZDA 3QBTB 1D5IH 2WO2B 1U36A 5EUKA 2ADJA 1LYQA 4JDTL 2ENYA 5PCYA 4V1DE 1FBIH 3AG3B 5SX4H 3NZSA 5DI8B 3WD5L 3BGFB 5J56B 1W80A 2X2JA 4ODWA 2IAMD 3VSUA 2ESVB 2OTUB 3D12B 5IMOA 3MYJA 1N6QH 4P9ML 2IOMA 3IE4A 3RVWD 3UYPB 4MA3A 1DVQA 5D7KE 3WS3A 1H5BA 1T03L 3QPQD 4PJ8C 3ROLA 1DQQB 1WSST 1L7IL 4AZ8B 3IN0A 1CFNB 1LMKA 4YDMA 3VFOA 5HYQA 3OR6A 3GIZL 1WFIA 1LDPL 4MS8D 4LCWB 4JRXE 3KYKH 1NGZA 3ES6B 1EPFA 2F1BA 3FO0L 1LO2L 5F9WB 4BK5C 5KS9E 1JNLH 2H6PA 5IEKB 4FQXD 4MGXA 2QADC 3KWXA 2Y36L 4KVPA 4LL4A 5AOLA 4XMWA 1M71A 2ICWB 3KD4A 4XE0A 2UXGA 3OR7B 4XC1L 3CLFL 1TLKA 3CSTA 4OZGA 3WNIA 1FHGA 2IMMA 4JFTA 4XVSH 5TTRA 5DMYA 4NQEA 1N9PA 2LV4A 1ZOXA 4PRPE 4WFGD 4Y1TA 1J8SA 5F7BA 3SKMB 5TGBA 2VUKA 3BWSA 3UMNA 1VFUA 3MJWA 1MIEL 3BWAA 1CUOA 4MMYA 3OHXC 3IJ7A 4ZPTA 2EDNA 2R27A 1UG9A 3GXFA 4AUYA 4Q97A 3QDJD 4NLHA 5ENWA 3ABZA 1UXMA 2OTUA 1WS8A 4UU9A 3ZE1F 2XTJE 3RZCA 3DVGB 2P28B 1NMBL 2R0ZL 1KTKE 2BP8B 3VFGH 3B9DA 4Q52A 1ES0B 2IAMB 2XWTB 2NNAA 3CU7A 1GS7A 1EZVY 1S7UA 5JQ6H 3ISWA 3OJDA 1MN4A 1W91A 3ZE2B 5HGHB 2PP9A 4AZ8A 4BH7B 3QRGL 5AZ2H 3TWCL 3WDJA 4XPBH 4HUVB 2ZP9A 2XUWA 1DCEA 1ZT4B 2O6DA 2AK1H 3VI3B 1ZSHA 4L1HA 3CIQA 4PRDB 2B16A 2K4WA 3DPDA 4OFQA 3VYPA 2IF7A 2ZQKA 3CSYB 1IFHH 1TJMA 1U8NB 4MS6A 5AOMA 3T4AA 5F71A 4JK0D 5IVZA 1XR9B 2HT4D 1Q0XL 3HNSL 5I1AA 5DJ8A 1IKNC 1SFDA 3S35X 1RUMH 3IJ9A 4KVNL 2XYCA 1YPZA 4ZFGH 1IGML 4NS0A 4KK9C 3FUHA 2BP0A 3NCJL 1XIWD 3ML9A 1WISA 4TLSA 5T3XL 3ZE2F 2XWDA 2W0PA 1OZTG 3RILA 4YHMH 5DJYA 1D7DA 1JE6A 3WUWA 2Y06H 2MHAB 3V8OA 1RULL 1WFOA 4R7DB 4ETQB 4I77L 2JXMA 1FRGL 4UB0H 3X12A 4WU5B 2XA8L 1FORL 1UD5A 2BS71 1EBAA 3B5GA 3DJZA 5HHOD 2Z6FA 5DHEA 1WRFA 1YVLA 1QSEB 4M1GL 4YPGB 3BO8A 2AK4D 4FQIL 1CXHA 3MOAH 5CN1A 1OP9A 3PAYA 4RDBA 5ENWB 2YC1B 3KVPA 4NZJA 1BGXH 3EFDL 4PJFE 4Z0XA 1FC1A 1MSPA 3RDJA 1DSYA 5EU4B 4YH6A 3B2VL 2V17L 2XICA 2VNCA 1ZLUK 1E67A 1EHAA 5DA4A 1IM3A 4DZBB 3RWFB 3WXVL 2R0LH 1CGUA 2C3VB 5AVQB 4QRPE 3NH7L 4AVKA 1MFAL 2CZNA 1JGVL 2UYLA 2BH0A 3PGDB 5HI5D 3LJ3A 2OXHB 4HUVA 4UNVA 1AI1H 1ZT4A 2XV6B 2P5WE 3C8KA 4FN0A 1EO8H 4RDQF 3D87B 5I75C 1KJ2L 4KO5A 1ROWA 4G83A 3K2KA 1XR9A 5DHVB 4CVZB 2ZOOA 4NGHL 5DD6A 1B90A 1MVUB 3KDMA 3ML8A 4DAGH 1LO4L 1KBKA 4Z3HA 3RFRA 5E9DD 3KYAA 4IRSA 3UYOD 4F15B 3GBNL 2BFVH 2VN3A 1U3JA 1BYPA 4QTHA 3DOSA 1F90H 3A4AA 2Z7YA 5I0WA 5MI0C 5DHXB 2Y1AA 4AKQA 1V3JA 4HEME 1IC0A 4ATWA 3BE1H 3WUWB 4GKOA 2H26B 3EXLA 1L7IH 5E95B 4GXUN 5BVJA 5LBSH 3JWOH 1TU2B 4KRNA 3OHMB 4JBSA 4LGRB 2FJGA 1INQA 5D7LD 4KDTA 3QUKB 1FN4B 4O2FA 2QFPA 1FYHB 4HIEB 5ALCL 4YSUA 3EDFA 4WNQA 2JJSC 5JXEC 3K6SA 3GJEB 2IGFL 2WWKT 2YPKA 4I18A 1ZTXL 3HG4A 1FNGA 2VL4A 1YY9D 5DJAA 4B3EA 1I7ZA 2JLPA 4W9DC 2G9HB 3UZQA 2AMGA 1NGWA 3Q2CA 1AS8A 5IG7A 1AANA 4C56E 4F9LA 3FT3B 3X14A 1BX2B 5EDXA 3FAXA 4BFEA 1A6AA 1V7NL 3KE0A 5D1ZD 5CJ5A 3N3EA 4OY9A 5IBUB 4P4KB 2X4RB 3MC0A 3Q2NA 2QLVB 2HKLA 5I1HH 4F27A 3HE6D 1EEQA 2ZOLB 1QNZH 3QUYC 4F24A 5C0JB 1JK8A 5D6CA 2D31B 4KTDL 1OCOB 1EEZA 4B9KC 3TIEA 5JW4N 1I3UA 1IGIH 4UT9L 4U1NB 2VZOA 1C5BH 1HQRA 3IETA 2FL5B 4XAKE 3R8BB 1J1PH 1MW1A 3U4KA 1N67A 3KH3A 4IRSB 2VDQB 4YBQC 4XP1L 2XBZA 3WFCH 3HLAA 3VMOA 4CMMA 4L5FE 4PJGE 2VZ3A 4YHKL 5EU7C 1XZ0B 3RWGB 4GKZB 1TXKA 3GLAA 3QJOA 4IKKA 5HJ3B 4M7ZB 2XN9D 2EIBA 4PJFA 3KPNA 3CHOA 4DK5A 5JPMC 3RIAF 5H4ZA 2JK5B 1BZ7B 3MUJA 4NN5B 1GHFH 2V3DA 4I2XB 5SWSE 3F65A 3FQ1A 4K73A 1FN4A 1K72A 2ZX9A 3J8F7 1OOAA 4PB9H 4D94A 3BEVB 4JFED 2WOYA 3KPMB 3LKPA 1JZ7A 2H6UA 4HUWB 2BVPA 1J18A 4OZIB 3PP3K 1ZEAH 2GTWA 2OTPA 3HZKB 3IPEA 5DJAB 2R59A 4F37F 1VFBA 2JF1A 5EOTA 1SDDB 2R4RL 4HIHA 3IMUA 1KN4H 2CUMA 4X9GA 4ZAKB 4XPHL 2HVJA 3X1GA 3GJFK 5KJ4A 5KJ7E 3R1GL 1ZGLM 2KUTA 2HVBA 3FT3A 3GPSA 4U1HB 3VFSA 4BKSC 3L2MA 1E5CA 4Z7QE 4HCFA 2CXGA 1KEGL 2A0LD 4KH2A 3F7QA 4R7LA 3X17A 3IDJB 1XF1A 5TDNB 1E9PA 2ZOLA 4MLSA 4P4KD 2FZ3B 4KK8D 2MKWA 4HUKB 1HE7A 3BVTA 3GUTA 2OMNA 2VLRA 4IGBD 1UD6A 5T1LA 2ZUQB 4XCEB 5DTFA 3FH5A 1HOCB 4KJPC 4HD9A 2CR6A 2H5UA 3NJXA 4FYRA 2CJUL 1GW6A 5HI3D 1HL9A 4UF7C 4DW2L 5D7KD 2BSDA 2CO3A 2ESVE 4F7CB 2AANA 5F1IA 5INDB 3QK0A 3FB7B 2VLJA 1XF2A 3L9YA 4GQPH 4ZFOA 2EE3A 1YZZA 1KWKA 4EUPH 1Y6NR 5HDWA 3RURA 3HBPA 5IQLA 1VERA 5F93C 3ASWA 3AREA 4F5CE 1MWAL 5F7FA 1ED3B 3RDTC 3VXSA 3VGGA 4Q7DA 4X80L 3VXTB 1UA6L 3W38A 2WLYA 5ELIA 1OWWA 3AXLB 1YAIA 3QNFA 5A40E 5DMKB 2BOLA 4LSSH 2FH8A 1VFBB 3AGVA 2Q76B 2O5XH 3MRDB 1RUQL 1TDQA 4OQTL 2YFNA 3M46A 4AYID 2E9WA 1YPZE 4HIJA 4U1HA 3LD8C 3T8MA 5AB1A 4AGOA 3BKCL 5K9KB 3FFDB 3JVFC 3NRFA 4XH2A 2CRIA 4YXHH 1CJYA 3K2UL 3NCXA 4KZ0A 3QPXH 1E9PB 1CLZH 3LQAC 4JPVL 1TCRB 4TN9A 1U3HA 2IOIA 2WXGA 4HKJB 5E2UL 2IH8A 2XQ0A 3EFOB 1BDYA 3FQ2A 4OF3A 4QLWA 1JERA 1DL7H 4Z3IA 2GJJA 3COOA 1H15B 3DX1A 4WTQA 3G5VB 3BUQA 1BGXL 3EFDH 1IQWL 4DKEL 2DQJL 4MBOA 4JZJA 4ZOEA 3J7HA 1HCZA 3X13B 2DQIH 3MO1A 2PCFB 2GYSA 1KIRB 3BDXA 1IAMA 3MACH 3MV9E 3RDTA 5HJGA 3ZTEA 4BBWA 2GUYA 1BQKA 4OSUL 3EHBC 3TBYA 3B9KD 1EZLA 4KX7A 4OCXH 4YE4H 4RQQB 4W9LC 2MTPA 43CAB 4U1MB 5FEBA 1AMXA 1I82A 2EKSB 4I5BB 3ZKXB 5HY9B 1QD0A 4Q9QH 4PRHE 2XSKA 1NPUA 1RLBA 2I7OA 2P8PB 1AI1L 3FB8A 2VUOA 4J3VA 4JDVB 4K94C 5CHNB 4WIQA 1EO8L 4YBLC 3RY6A 1I1YA 2NLJB 4P9HL 1FL5B 1T1XA 2GABA 2WJ7A 4M1DH 1X5FA 3WJMB 3LN5A 4NPYA 1F02I 1IL1B 3S9DB 1MF2H 3SIKA 1XB8A 1UASA 3PP4L 2VQ4A 2WXRA 5A6MA 1G7IA 2IALA 3DI3B 4HIJB 3ZT5A 1UOKA 1QUNA 1BQLL 3GUFA 2WSDA 1DR9A 3T3ME 1FG2B 2Z7ZA 2FJHB 1J8HB 2DOCA 3ZKMD 5FO2A 4DVBB 1Y18B 4LEOB 4PWFA 5IT2L 1HYSC 2OMXB 5DD5L 2NY4C 1E9OA 2WXLA 4XAKD 1EDQA 4G5ZH 3FO1B 3I6SA 1R6VA 3IDMA 5FWQA 4XCFL 2VAAA 1M7IB 2CM6A 4HPHA 1KMGA 1IBBA 5KVEE 4PJCE 5E4EC 3FB5B 4MD0A 4HS3A 2K9UA 1EZSA 1JNNL 1C7TA 4KUZL 4IBZA 1USZA 3L9EA 3D85B 5I8EA 2OCCB 5AYQA 4M48H 1YEDA 3I74A 3MV7B 3ZKND 1WGOA 1EANA 1LP9A 4RQQA 3P9LA 5I74C 4FRWA 2IGTA 4KXBA 4BSWA 4IMKA 4OD1H 4QYOA 2UUDK 4WNSA 3D25A 4Y8AA 3HRPA 3HPJB 1E3FA 4GIOA 4TUUA 1U8OA 3PWVA 1DQJA 2VRAA 1NC4B 4M93C 4ZK8A 1HQ4A 3QCTH 4NQCD 5F9JB 3TL5A 1UGNA 1I1YB 2NLJA 4MKTA 1ZD6A 4IRJB 1T1XB 4PSPA 1CTMA 2ZUTA 3JVGC 4G6ML 4DKDC 1HNYA 5E08L 3CFKA 4P46B 1MY7A 5GPRA 2IQ9H 3UFIA 5J9PB 2EUWA 1DQIA 1QLFA 2AF2A 3UTQA 5I8OH 3ZDWA 4DW2H 4N5EC 3TBSA 2LLGA 2IALB 3ARGB 2EE9A 3AT8A 4YVNA 43C9A 3WIIL 1A0QL 4QY8B 1MWAA 4G2AA 4Y5VB 2BNRE 5L0QB 1U58B 2HT3C 4FF9A 3TEUA 1B6UA 1FG2A 1D5BB 2I69A 3GB7B 2WXKA 3Q3GB 2O93L 4ANWA 3TP4A 3NCWA 8FABB 3HC3L 1S7XB 1RY7B 2FEDC 4OGYH 5M7QA 2VXQA 4P5MA 2Y5TA 1T22B 1LEGB 3EAKA 4PB9L 4AQAB 3GMMA 2RA1A 1PCSA 3QEQD 1DSFH 1Z5LB 4FFTA 3CFDB 3LEXA 4P49A 5I18H 4QXVA 5C0CE 3WGUB 3HFML 3PNWB 4O51B 4DKFL 3ZTJG 2IBBA 1NDGA 4HUMB 1BW8A 4YOKA 2GJZA 2RGSA 2NY4B 2Z8RA 1RZQA 1MAMH 2NT0A 5ALBH 3P77A 5BZXA 1XH1A 1UHVA 5I5MA 3UC2A 4HMCA 3HE7A 1NBZA 4YGVB 1CU4H 4A2LA 3G6DH 1E5ZA 2DYRB 4MZ3A 2O6FA 4YSCA 3D39E 1CLZL 1XF5A 4JPVH 2G5BA 4CBZA 1SBSL 2XQYA 1WBYA 4TNVF 5I5JA 1R5WA 1EUUA 4IRJA 3ATAA 1SVBA 2FQDA 2YRLA 5L8JB 5EEXA 3LD8B 4LK4A 3S36X 4N1CA 5EOQH 1KELH 3IKCA 4WI5A 4BQCA 2XA3A 2JIXB 4KMTH 4KHTH 3H55A 1RMFH 3FFCE 3ZTNH 4M4RA 3JWOC 2EEAA 1PY4A 3G6AA 1KTDA 3GPEA 4JS7A 4RRPA 1QBMH 3AAZB 1KCVL 5IHUL 1JXGA 1X5KA 3Q3GA 4U6XA 3TBVB 4Q9QL 5I73B 4MXWH 3U46A 3GXTA 4Y4FC 3W82A 1NLDL 3ZGPA 5D2LE 2VLKE 2Y5TB 3BT2H 4M7JL 1TQCC 2WLKA 4HWNA 1BA9A 1GGBH 3QJUB 1BFTA 1E5BA 2UV3A 2MCPL 3T0AA 5D7LE 2I5YL 4WI3A 2QQNH 2R1XB 12E8H 4FNTA 3SY0B 1QYGH 4KO7A 5E2VL 4YHPA 3TN0C 4EDWL 5BVPH 2ADYA 1NDGB 5D7IF 3QUXB 5FYKH 1A65A 2OM5A 4CU7A 1KTLB 1G9MH 1VZHA 4AK1A 4I1RA 1PFOA 4U3HA 2C8NA 3FOMB 1AVAA 1SQ2N 1H3TA 4XNZC 1G9EA 2WLZA 1XF5B 5T3ZH 2ZE0A 3HI1B 4WHTA 3KPSE 1CL7H 4B9JA 5IJVB 3T0XA 4KJQC 2ESVD 3EFFA 2YAFA 2XV0A 1DLHB 4XZ4A 2F18A 4XXDA 4WUUE 1FQ9C 3CBKB 3DKHA 1OF2A 3MTRA 5DJYB 4IK6A 3CSPA 4KUZH 2ZUVA 1CLYH 4H1LG 3KWUA 3LRLA 4F7EB 3FUIA 1CDJA 4OLZH 3X12B 2WLNA 2J12B 1H5BB 1KJ3L 4ONFH 4EZJA 4FP8H 4HHAB 5CINL 2CH8A 1YEGH 4GLRH 1A1NB 1WBZB 4LCWA 5C71A 3VFRA 5E4AA 5ITFB 1E4KA 4Y4KC 3CVIH 3QHZL 3RVUC 2YD4A 2JCCA 4KV5F 2H6PB 1NUGA 3INUH 2DD8H 2VXSH 3VXRA 3MRIA 2AJXL 2JMRA 2YD8A 2Q86B 5IJDC 3SOBL 1FL3A 1KGCE 2BK8A 5E9AA 4HHGA 1CTNA 2DLEA 2ITEA 3VWJC 2ZYRA 2EJ1A 3A5VA 5KSVA 4H8VA 3P30L 3KLSA 5I0ZA 5I2IA 3BRDA 1BIHA 1MH5A 2EEFA 5B8CA 1M9SA 4RAVB 4N85A 1E28A 1FJ1B 1CYXA 4JPSA 1P7QA 5SWSD 4LQ1A 5K1VA 2FUTA 3VWKC 4ZO7A 2BJML 4YXLH 1L9SA 2HWZL 4ZPTB 4XCFH 2HPTA 1VRSA 1LQBC 1SDAB 3C6LC 3RGBA 1XSIA 5EIQA 3CE1A 4KQ3L 1E50A 5EA0L 4EKJA 2BP8A 1OTTD 3IU3A 5BVJB 2G4GA 1MJ7H 4L1DA 5LWYL 1AR1B 4LOUD 4Y4HA 4M8VA 5FYJD 3NN8B 1UWEH 2ADGB 4KKBD 2VDNB 5F9AC 3RWEB 4POUB 5HGBA 2Z91A 3UJTH 2KPWA 2RCSL 3FYEB 4HHAA 2WAQA 3DURA 4JE4B 3V6ZA 2F1EA 2PO6B 3WY3A 4M7ZC 4QXGL 4JGNA 2PW1B 1WVZA 3PE9A 4WFEE 1NEZA 3CZGA 3MRBA 1JNJA 4K9EL 4LDOB 1FNGB 6FABL 4J6IA 3EXJA 1NTDA 4Z7QF 1I7ZB 4LLQB 4TQEL 5H8DA 2VH5H 3BDYH 4X8GA 3B3IB 4FTVA 1A7PL 4G6MH 2CM5A 4N8CH 2Q86A 4F37K 3H56A 1ZLDA 3EJUA 1FAIL 2ADFL 1I1CA 3LRSA 1FL3B 3NIDE 3MNMA 3UP6A 1QHQA 3QGVA 4CMHC 2LE9A 1BPVA 3QDHA 2IGLA 1ADQH 1DVFA 1MQ8A 4K71B 3DK0A 3TOPA 4I13B 5LBGA 3LIZL 4AYFA 1DEEA 4RAVA 5L7XL 1E27A 1ZHBB 1PSKL 4A52A 1UKSA 1KCVH 2Y2YA 1PU0A 4JY5L 4R4ND 4RGNC 5G55A 5IHUH 2QPEB 4WF7A 1HQRB 4AL8L 2UZXB 1I8LC 5MERA 3FN0L 5B39G 3GJFB 3PXJA 4JGMA 3ZJAA 4C4KT 2DZEA 3VFNA 1JOIA 3WELA 2YC1A 4Z0XB 1TZIA 5EZIH 3ARBC 1I1AB 5DFTA 4AQ8A 1L0PA 1XQ4A 1DVTA 5GSRB 4A38A 3OWRA 4LLMA 4RRPM 5E99H 1CGSH 2B1OA 3DTUB 5AB2A 4BKLB 3M1OA 5DSCA 3QUZD 5H94A 5GZOA 3PIQB 2VDPB 2EC9T 1JUFB 4Q89A 5F7EH 3FCUB 5HGBB 4JM0A 2Z91B 4LP4A 4N0YL 3BSZL 4PJAE 4XNMA 4OKVA 4JQVA 4KI5E 5IMKA 3OB8A 3G6DL 4Y9CA 2A2QT 2PW1A 4KJYA 1O6TA 4NXSA 3F6LA 3LB6D 1E6OH 1T5WB 4U6HA 4J23A 4LLUA 4QWWD 2Y22A 3F04A 3UYRL 4OZIA 2GTWB 3HZKA 5ID1A 3EOBB 4NHUB 5T3XD 1PKQE 3ARPA 1F4YH 1XH0A 4JG0H 2BHUA 4ACPA 4XBGB 5CN3A 1ND0A 1JCVA 1A6UL 4XVJL 2NMSA 3AMKA 5DYOA 3MODH 1RMFL 5GIRA 2BNRD 1CGWA 2XXMB 4MD4A 3QG7L 5F6HI 3RPIB 3T1FB 1IIIA 2X40A 3JBG7 5TDNA 1I3RB 3WGVB 4GUOA 5JLZB 1VB9A 5DURD 3WO4B 2H2PC 2ZXGA 5EO9A 1IGJB 1KBVA 2DQGL 4WV1C 2ZP8A 1JHTA 5E9NA 3RKPA 2J5LC 3IRZA 5FOBB 4O2CA 4OW6A 3CFEB 2FJGB 4NLAA 2ZSWA 5CU9A 4AV4A 3SDDC 1QFUL 2XXCB 3QHFH 1NCDH 4HIEA 3BZ4A 3DUUB 4HJ1A 5EIIG 5F1IB 4ZTEA 4WNQB 4OGAD 3MRKB 5AVYB 2CO6B 1PQZB 2F58H 1EH9A 4PJXE 4XPTH 1UXSB 4I4WB 2G3NA 4QF1A 2F19L 2AJUH 3FONB 4EDWH 4BFBD 5ICUA 2HTLD 1JV5B 1R3JB 2E7LA 4OAWA 3MBEB 3TCTA 4M02A 1RZKH 1U3NA 2VT0A 4HK3J 3AREB 2OYKA 2H47C 3GI9H 2YOAA 4JLRB 4H25A 4R3SB 5E9DE 4CSSA 3N44B 4OGQC 3MGTB 1N3NA 3QDGE 5CFAA 3LKRB 3RIKA 2ATKB 3D1MC 2V9TA 5JW4Q 5T1LD 2Z64C 4G43B 5ISZB 4Z76B 3GI8H 1EJOH 1NC2D 1SYVA 1WAAF 2IANB 2IDTA 3H9SB 3ZGIA 3WFBH 3TIEB 3DYOA 4LKCA 4L1SA 2AV1B 4FG6D 4CC1A 2OR8A 2FL5A 1T1YA 1T1WA 3U4BL 4Z3FA 3GMLB 3D18A 3HN8A 3HFFA 1LK2A 3NCYS 5KBKA 1QATA 2ZG1A 5F7UA 1D5IL 4JHAH 2D7QA 4KOCA 5D1QA 1U3HB 4HKJA 2E4FA 3MXVL 4PPTA 4UBDC 3OXSB 4OLUL 4RMUA 3KGTA 1CE1L 3FULA 3AUWB 2ZXCA 1ANUA 1EJFA 4QXGH 3G5VA 1LWJA 4JRLA 5GGRA 3PGFH 4YL9A 4I2XA 1ZE3C 4JZOA 3LKOA 5GGUB 2EEDA 2P9RA 3H0TB 3MLVH 2FBJL 3Q6FB 1G1YA 1MFCH 1UEMA 4QRQA 3TCLB 3VFUB 4EUPB 2BVPB 2PWFA 1I1AC 4I4WA 1CB4A 1FH2A 2X7LA 1WC7A 4WWKA 1GC1C 1E30A 3AS1A 3B7YA 4CGUB 5F2FA 3FSWA 3ULSB 3VI4E 5JHDB 1R3JA 5BUGA 1HINL 1SZNA 2X0UA 1FDLH 3QIWD 3EJCA 3ZE0F 5LN8A 2V2WA 4FTDA 1BBDH 1U4FA 2X53A 4X4XA 4TQPA 4ZMNA 4P5RA 4XNBA 3CG8A 5MHSE 5AAMC 5MP6L 2FJFA 3FU7B 5IB1A 2HX7A 2L7JA 1CLOL 1P5UC 4K7PX 3BKJL 4R5VA 3EGXA 4G8GE 4IBWA 1TQVA 1F6AA 15C8H 1DVZA 2A74A 2EQDA 2XU9A 3KEHA 1IL1A 2NXZB 4OT1H 2VYRE 4I9WD 4XC1H 3NSXA 5F97E 5BJTB 3GUTB 1E4HA 3STZA 1SFHA 3P0VH 4YHOH 4GBXA 3RDTD 3QIBA 3N9GL 1Z3GH 1R75A 1QVOA 4PS4H 5TFSL 1UZ6F 1LK2B 3GRWL 3FTGB 2EDQA 2YA0A 5DK0B 5C97A 2C9SA 3LNEA 3QNXA 4LDCA 2APSA 3WDIA 2HXAA 3CCHA 5C9KA 4FGMA 1BJ1H 3D0VB 3IDGA 3FO1A 4FNLH 1RZFH 3ABMB 4N2AA 1TEGA 5LNDA 3SJVE 2GTZB 2OA9A 4LCVA 4F7KA 3C6SA 4MD0B 1BVLA 2NX5A 3IEAA 3T6XA 3MLUL 1Q9KA 3WFDL 1SXSA 3D3VD 5DO8A 1U33A 3MV7A 4HJGA 4E42A 5TPWL 1I53A 3S2AA 3EYUH 5GS0C 3BP6A 4M61A 3CLEH 1E6JH 3RPBA 5EBMA 2RMNA 4MMXA 4OM1H 3UG4A 4QYOB 4UILL 3KZ8A 2XFGB 4OGXH 5IHZA 3UEQA 5JHDA 4TF4A 4GSQA 4X5PA 4XMTA 5EMYA 2YSTA 3EDEA 3NJHA 1R3IH 4HJJH 3PP3H 4NFDA 3QJFB 3CU1A 3CZFA 4OZFH 4G6JL 4PFEA 4X4XB 5C08D 5K9KA 1NCUA 1LM8V 5LAXB 1NDMA 1CICB 2YKKA 1T6WA 3TVMC 1JWMA 4N6QA 1E7UA 4NQDB 4P46A 1I1RA 1QLFB 4J3XA 2QR0A 4LHJB 5C0EB 4PJBE 3VD0A 1P4LA 4N5UA 3S98A 3ARDC 3OPZL 2UXFA 2CMRH 3L5XL 4OCLC 1BQRA 1DN0A 4IM8A 3IDUA 1L0YA 2Z7WA 2CU9A 2AEPH 3TN0B 4MAUH 4CNIA 5EULV 5DT1L 5IBLC 1KCRH 3BPOB 4HEPG 1INDL 5KBNC 2XA8H 43CAA 4LLWB 2BSRB 2YQBA 3GMQB 1PKOA 2V5RA 3L81A 1MHPL 3L3IA 1T22A 4NQCA 5LDUA 2WYHA 4Q4IA 4YN3A 1AG6A 3PHQA 4JCMA 1F56A 1R24A 3WTVA 1TT6A 4KKQA 4MVBC 1A6ZA 3MLRL 2NY1C 1GPOH 4C56B 3J27A 3UABA 5BV7C 1GZHA 4JO3H 2BIQA 3ZZ1A 4JZNA 4MMXB 5BRPA 4NPYB 1AXTH 1TTCA 5EHFA 4NPKA 3W56A 4NRYA 4KKAC 5IQNA 4OQTA 4QPEA 4KQ0A 1A1MA 2XC8A 1BBJB 1PMYA 3ZE1B 1I3VA 1ZA6A 1J8HD 3BI9X 5EO1A 5HHME 4OCWH 4AIXA 3ZVVA 4HYTB 3QJFA 4M8RA 3JQOB 3ARFB 1SRDA 1CE6B 2NY6C 2WQSA 1ETA1 3HZVA 3JZ7A 4RAUB 5IESH 1L7TL 1F13A 3A21A 4A67A 1AGCA 3UH8A 3NABL 3RB5A 1E9OB 3P3YA 3B83A 5JPNB 5AOJA 4GRLC 3H9HB 5JPNC 1FZMA 2VAAB 1Q9OB 3RKDC 4GQRA 3U2SA 5J11B 2AC0A 5CSGA 1OVZA 3QWQB 1JPEA 3AACA 3LX9A 2WXNA 1YEDB 1F4HA 3LKQB 1H9DA 1ET5A 3HE7D 4UB0L 4RGMC 3JWNG 3QORA 2Y5QA 3AGWA 5LLIC 1YEHH 3IU4L 4KMQA 3SGEH 5K9OA 3WFEH 2VC2L 3RFZB 5CR8A 2NSMA 5SWZD 4X0NA 7FABH 3LSOA 4QKTA 4M7KH 4UYQA 1XMWA 1FNSL 1MW2A 4IRJD 3NDYE 2BS9A 3C60B 1K4CA 1FIEA 1R24B 1DBBH 4FZ8L 4BUHA 2CDGA 4LPXA 5FYLE 3DJSA 3E6HA 5MENA 5F1NA 3WFBL 3BKYH 5DU7A 1MCIA 1F1AA 2CAKA 3MFFB 3OKLB 1LK3H 3BIKA 1NCOA 4OZHB 4U1LB 4B9IA 4PP2B 4LZKA 1DVSA 4JZNB 1QUPA 3Q1SH 5J9PA 3AXHA 3LMJH 2VZ1A 1QOKA 3F01A 3CDFA 3ARGA 4R9HA 1P6WA 3O3DB 1XF3B 2B8OT 4JPWL 4H8UA 3QNYB 3PWPE 5C0RH 5LGJB 4XC3L 2ZUUA 3MXVH 4Y2DD 5HJDA 3IXTB 3H6AA 3RUGA 3NFPB 5JDJA 1NCCH 4ELKB 3CDGA 4C55A 5H37G 2VLKD 2DBLL 1DLHA 4RWHA 1XCTB 5CFHA 2W38A 2P8MB 3SE3A 1S7XA 1H3XA 4BZ2H 1SPDA 3WAKA 7CGTA 2FECL 2B3IA 2BFVL 4EPSA 5F0MB 1KBPA 1P84K 1F18A 3QSKB 3B8SA 4P5MB 3VQ2C 3ZMRA 4AWJC 1UCTA 4F7EA 2CO4A 3IS1X 3WLWC 5GSVB 3AS3A 1WA0X 4U7MA 1MLBB 3BE1L 5E94B 3V6OA 1YJDH 3D52A 3DSFL 4WW2F 4ADGA 2IPTL 2DEWX 4Z0BL 3I84A 1RERA 4HIPA 1B2WL 1GHFL 1T4WA 1YDPB 2FIKB 2QBWA 4L3AA 3SO3B 4BSVB 5DFWH 5CKAA 5F8QC 1NFAA 1PX8A 3ARQA 3ILEA 4LSTH 1E0OB 2XTSA 3PL6C 4FLRA 4G6FD 2WQVA 4AQZA 5DWUL 4ZFZA 2X3CA 4MFHA 4Q9BA 5FIEA 3ZRFC 3MV9D 3MOBL 2K4AA 1OK8A 3ARUA 1AGDA 5DZLA 5FKAA 3B2UC 3AC0A 4HPYH 2QHRH 3P0YL 5E4IA 1IGFH 1PKQB 3QIBC 4Q8BA 4LBAA 4XPFL 1QQDB 4PP2A 5I2IB 4QMEA 3DHUA 3FUNA 4PBDA 2HLFC 5CD3A 4YDJA 3WJJA 2J1WA 3E0GA 5G4NA 4XGZB 2YLKA 4G71B 3LEYL 3PWUA 4QYAA 4EBQH 2AABH 1QFWI 1IKFH 1F4AA 1HKFA 3MZGB 5EUKB 1T7VA 2E27H 4KTDH 4YE0A 1CXIA 4A2EA 4ELKA 4WGVB 3RTQC 2APXA 2PP7A 4YSQA 1B2YA 2YLHA 3CN3A 5J57B 1W0YT 3ZE0B 3CVHL 3LRHA 4ODWB 2NY0C 5CGYC 4OB5H 1CF8H 2DF3A 3VXRD 3Q8AA 3WE6A 4M1CC 1OWRM 1M6UA 3RVTC 4Y4HB 3D6GA 3T04D 1L4IA 3T0DA 3US9A 2HH0H 4G42A 4Z8FL 2Y07L 4QHUA 2XNAA 1ZA3B 2CPUA 3CVCA 4A68A 5HYQB 3IJ8A 5K59E 2ZF9A 2AJVL 3S4SB 2VO8A 1U0QA 1Y7VA 1G7MB 3SBRA 2CK2A 5F0JB 1NEZB 2FIKA 3MLYL 3RI5F 1P7QD 2AFNA 4AEHH 4H8WL 2Y7LA 2OMUA 3LIUA 3H3BC 2AKRA 4ODTH 4DKTA 3O0RH 4MB1A 4PJHB 3TT3H 5E9DB 3CV5A 5HI4D 1DQVA 2FWOB 4ZFZB 1CDGA 5I6XC 4IIZA 1FO0A 4A6YA 4OQ1A 3KCPB 4FQLH 5CJQH 2CIIB 5A2IH 3WTYA 4G8GB 2LGNA 4PJ7F 3IFOB 2WQ8A 1Z9MA 2W0LA 3EH3B 3T3MB 1JI1A 1V8HA 4XGZA 3CDCA 4W9JC 5LAPA 3V9EA 2DLFH 2XKNB 2N1TE 2CCLA 3VYNA 1LO3L 1S46A 4GKNA 4ZTOL 3M7FB 5HYJE 4D2NA 4NO0B 3GZOA 2VXTL 1WJ3A 5AEAA 3UXFA 3V7AE 2X3BA 5IJBC 4G11A 4PJCB 4DWHA 1ITBB 5JNYA 2XETA 5ECGA 3OMNB 3MSPA 3VFRB 4D9QD 3TEYA 4LKXA 2HFFB 4Y7OC 5EBGA 2JCCB 3SQBB 2DQIL 3L3OC 1K6QL 1OANA 1HHGB 2G2RA 2H2SD 5TQ0H 1T0MA 3BOVA 5H94B 3PGCB 2I26N 3MRIB 4P5TD 2Z8SA 1RK7A 4L3EE 4C54A 2IQAB 5I15H 2AERT 2R1WB 2WZ0A 4H1LB 4R0LC 1JFQL 1A6VH 2V0AA 5SWQA 2EH7L 4WENB 3QQDB 2F8XC 4F33A 1FV1A 3T77B 4BZ2A 3U9UA 2HPOA 4WUKH 2LAAA 3V0WL 4PIBA 4NP4H 3FRPA 1QRND 5E8OB 5GRYA 4PJHA 4P9HH 1T0NB 1GH7A 1P7QB 4ZD3L 5AKVA 1Z9PA 4E9LA 1KXQE 2L0DA 2EYTA 3UO1L 3W57A 4FQ1H 2O5XL 3KCPA 2HT3D 4K3JL 5A6LA 3NJJA 1SEQH 3BWUC 4XP4H 3FTYA 5JIHA 1EERB 2Q8AL 3A4DA 3MLTB 2P24B 2AXGB 4TTDC 3C5JA 2X6VA 1PZ5B 4G8GD 3ELAT 2WZPA 5C7ZA 1C8PA 4U2YA 3ATDA 5JLZA 1BQ5A 3QUZA 5GZOD 4UT9A 1QSFA 3BP5B 4PBVC 4JNXA 1TF4A 2JKLA 2KLSA 2M26A 5DXWA 1J86A 3X11A 2J57A 3AY2A 5LGYA 2YAHA 3FU3A 2N4IA 3QFJD 1NWOA 2DKMA 5IZ7A 3BO8B 5FGRA 4X6DF 1IQWH 1X5XA 2X0WA 3OKYA 2NNFA 4UAHA 1UXSA 2WBJC 3BPOC 3CLWA 1UXWB 1J5IA 1X5GA 1HHGA 2D7OA 1AQ8A 3I50L 3PRZA 2BIOA 4MMZB 2C3VA 1UKQA 4XHJD 3IGAB 4Y16D 1AE6L 3EYOB 3DYMA 2QMJA 4E36A 4PJDA 3GZKA 5D70L 5E56A 5G5DA 5HYJA 3IGUA 4GSDH 3TYGH 1DANT 2OXHA 5CMAB 2UZIH 3MXWH 5IHHA 5SWQB 3PDDA 1K4DA 4QXTB 2CLVB 1IAIM 3TM6A 4MJ5B 3KS0H 1N6UA 3ZE1E 3FRPB 2UWEB 5E8OA 5EZJA 1DJHA 3ECVA 3HB3C 5GRUL 4GT0A 3T2NL 3NACH 4M3KB 1IBFA 2CA3A 4HPOL 5ETUB 2DJ4A 3WD5H 4DPRA 3S8WA 1AHKA 3ARBB 3RY5A 5AYUH 1VFOA 1QZNA 4YBHA 2FNBA 3AM8A 4A2GA 3GS7A 4LGSB 3CSFA 2BVEA 3GJFA 4G7VH 5KOMC 3BXNB 1KFGA 4GAYB 2J6EL 4ALAC 1U8PA 1DQTA 4KKNA 1GMIA 1DQDH 3Q8BA 5J4MA 5DK3A 3QUZB 1JP5A 4MCYB 3BPCB 1DDTA 3W9EB 1LDSA 1PDKB 5C0IB 1E5YA 3ILPA 3B43A 5D96B 3QFDA 1BQUA 2IWEA 5DSCB 4MB3A 3EOAA 1T20A 1RIHH 3FPXA 1JUFA 3BLBA 4PV1C 1I75A 4JANA 1NSNL 1LO2H 1WFUA 4Z7UF 2X05A 3DV4B 4Z7OB 4JHWL 1QFPA 5LO7A 4KJYB 1NC2A 1I4FB 2JCWA 4LT7A 4I18B 3APCA 3MRNB 4IEFB 5ILTL 1G9NH 4L0YA 2BCMA 2X4QB 5DJXB 4IU2B 2E56A 5E5RB 4KJWD 3DSNA 2F15A 4L4VE 3ZIMA 3OKDA 5IQ7H 3CC1A 4LF3A 5E5UB 1J11A 5DJCB 2VDMH 2AGJH 5LN4A 3S5LB 4HLZH 5DVNA 3HHSB 3QEUB 4PJDB 3RNQB 2A1WH 3QZBA 2IVFC 1IB5A 3BLPX 3BWUF 2WO4A 5GIRB 4BFFA 2XFXB 5AW2B 1ZT1A 2EADA 2B2XL 2R2HA 5DO2D 3ZHNA 1NFDB 2TRHA 3VD1A 5C6WH 3WMSA 1YC7A 2XBDA 1AQDB 2FBOJ 3I6GB 1EEZB 3U48A 1OAXL 4FXKA 1FZKB 1ZLSL 5C0CD 1X4YA 3BCFA 4OZFA 6PAZA 4JFYA 1FYTA 1IAII 4GBXB 5HHMD 3CFEA 1RJLB 4L8CB 4ZJ9A 3MJ9H 4GW4A 1J9CT 2V5YA 2Y2TA 3B2VH 3RVTD 3BXNA 4GAYA 4ZZKA 3DUUA 2FX7L 2L3BA 3DTXB 1FLTX 1A0QH 4HETA 4WWKD 2CO6A 5A3IC 1QBBA 3QI9D 4E41A 4JRYD 5F7HA 5IQ9A 4XXWC 1HDMA 2WLIB 4FI8A 4DNLA 2VR9A 4JPIA 4LVHC 4F8PA 2GB2A 4R5XA 1PDKA 5IJKC 4F9PA 5JQHC 1CPUA 2EICA 4EI5D 1FGVH 4B41A 4YIQB 2WWNA 2GIYA 4H8WH 7PCYA 4F8OA 3BPNB 3BT2L 1JRHL 2PYEB 3IJHB 5ISZD 2FEJA 5BZZA 2VDQH 3LKPB 1RHFA 1ZSDA 2OK0H 2WWOA 2ATKA 2QKIB 4IEFA 1NQBA 4G43A 2JTDA 1ETJA 4G8FB 5ANMA 4CN4A 3VFPA 12E8L 1RUML 1SDDA 3QIBD 4Z7NB 4GMTL 3EYVB 1CT8A 3PWJB 2IXQB 2JJWA 4Y4KB 5HDQH 5DJCA 4KDWA 1FSKB 3VX1A 4R7NA 3OM3B 3TONA 5DDHB 4X4YB 4DP4X 1MOEA 1FVCA 1R17A 3ENEA 3T8XB 2WTPA 1QLRA 1ZJAA 2D3JA 4H40A 3BVNA 4RGOH 5TF0A 1JWMB 4FFZL 4KK5C 1XHHA 4LCYB 3EJTA 3RWDA 2VLRB 1DZBA 4CVXA 3GSNL 3MREA 2X4SA 1Q0EA 3MNVB 4JFYB 3D85D 1XR8B 3VXSE 1J5HA 1KNOA 4HCGA 3MV7D 4U4IA 1MQKH 1T2XA 4PJGF 4WSJA 4A37A 1T6BX 3TN0A 3DTXA 1RQ5A 4KQ4L 2R0LL 1NMCC 4AGQA 4B9GA 3HNVH 3L3JA 1AR2A 3UO8B 1Z5HA 1RVFL 4YDKH 4Z23A 3NH7H 3L9RB 3S37L 4WI0A 1EO5A 2BSRA 5IFAH 4MCZB 4RMWA 3CSBA 1SXBA 1IRAY 5JMOC 4M9PA 3QIUA 5F0LB 4N6RB 2YZ8A 3HHMA 4H26B 1B4LA 3NCBB 3GRGA 4L23A 2YD2A 4N2CA 5AUMA 5BV7B 3OZKA 3P69A 2Q8BL 2X5PA 4EZLA 1I7UA 5LCVA 2OMTA 4HJEA 4P46D 4HMEA 1X6LA 4LPWA 3VRJB 3GBEA 2QKIA 1MCWW 4YDLC 4FZEL 4JMNA 1F6AB 1FE8H 4DF9A 4HJTA 3ISRA 4U31A 1CDHA 2ENPA 3IXAA 3NTCL 2VXUH 3ZIYA 1BWWA 5DD3H 4XVOA 5CJXA 3IDYC 2WYTA 1V7MH 4NZRH 2BVQB 5KS9A 3VXUA 1WK0A 2WLLB 3T8XA 3UP1A 4M93B 5KSAD 1BP3B 2CRMA 1TQUA 4XBPA 3VGFA 3RWDB 1N4XL 5JPNA 4R97C 4PJFF 4EZKA 4PMEA 1BV8A 3IFLL 2QQLH 4PJXA 3MFGB 3SPIA 2JJTA 2V2TB 2C9RA 3CX5K 1IMHC 1Z9LA 2VDPH 4G9FE 1Q9KB 3GC3A 3TTYA 2PCFA 2FD6H 4LOVA 3DV6A 3V4VH 1FFOB 3FH7A 1TEFA 4H8HA 1NGXB 4ALAH 5LWYH 3BDBA 5HHVH 3TBYB 4PJAB 1PTZA 2F54B 1FIGL 1XO8A 1YY9C 4M9OA 4JX0A 1S7TB 4FXGA 2Z0BA 1DBAH 3N1GC 4H26A 2O6PA 2DM4A 2DIBA 1K4CB 4IJ3C 5I28A 5FM4A 3RGVC 5HPOA 2DICA 2YD5A 2FYVA 5C0NC 4WHYH 3EYFB 1TZAA 1WAEA 3OMAB 2GW5A 4XI5C 3TT1H 3PS6A 1XF4A 5JW5A 3NZHH 1O9ZA 1UT9A 4B6ZA 3T3PB 4G80A 3TLRA 1RZIA 3P30H 2BXYA 1TJHH 1BZOA 4K3DL 3VW3L 2A77L 5FGCB 1DQKA 1OZUA 3HRZA 3QORD 4ODVL 1HL4A 4FHJA 2P5WD 2QZ5A 1AQKL 4DVBA 1NBVL 4LLDB 4OR1A 1Y1DA 3FCGA 1HIML 1FL6B 1FGNH 1WA1X 3LNFA 3LQAH 4N2NA 5AKTA 1NSNH 4X99A 3GSOA 1WZMA 2WMPA 4IMKC 4LAJH 1N0XL 4JB9H 3ZKXC 5F1KC 2QGDA 2PW2A 1I8MA 4M7LT 4Z7WF 3QUMB 2X4UA 1D9KC 4ZXBB 4DZ8A 5E94A 4FABH 2Q7AA 3TA3A 1MDTA 4IHOB 4FD0A 2E7MA 1RIVH 2FB4H 4B50A 3KPRE 1BYNA 5EC1A 3D08A 2KYIA 1KB5B 3REWA 4PEEA 2R2EA 1FP5A 3F58H 4L4VA 4BSWB 1BF5A 3GRWA 4OFKA 3R7QA 4U2ZA 4GEJA 4I48B 3LKSA 3QDMA 2N0KA 3HW7A 4XR8C 1KPVB 2B2XH 3I3EA 5EZLA 4EXKA 4LCIL 2PN5A 1HQ4B 3UPAA 4X6BA 5JIQA 3DHMA 2IDQA 2GUOA 4XB7A 4H0IA 1OAXH 3MNZB 4ODUA 4M8QB 1SUJA 1XGRB 4ONHB 4EQ2A 2ICEC 5JR1L 3K4AA 3RBGA 3SYOA 1J9RA 3HAEG 3LZFH 5D2NC 3UTQB 5BRZB 2DKSA 1XIWC 1YN6A 1FZMB 2EIDA 1VKXB 1B4JL 3O6FA 4PP1C 3VGHA 3HNVL 3F2LA 4R2GC 1LXMA 2P5ED 4PRID 5DR5H 2E7BA 2XKUA 3KPLA 2WLMA 5I1LB 4W6YB 2NUPB 4TLUA 5B3SB 2EYRA 4GG6B 4MJID 4X6DA 4MJ4A 4R5TA 1FL6A 3TX4A 2KLRA 2NNCA 3O6MH 3QORB 5GISL 4TNEA 5HVWA 4JJ5B 1NCAL 4LRNH 5MEPA 4ACTA 1JPFB 5IJCC 2Y4SA 2KC0A 1LEGA 4X80H 4QHMB 4MJ6B 3QXVA 3VFVB 4KHXL 4DZ8B 4JM4H 2TSAA 3C60A 2AI0H 5T3ZD 3RWCB 5B3JF 1TKWA 1U2YA 4HWEL 4L2YA 3BD4A 2AW2A 1MLCA 2HKAA 3L3DA 5F1NB 1MCQA 1QSED 3K71B 3MFFA 1A7RH 4X6CB 5JORB 4GI6A 2DJUA 3ZL1A 3I02A 4L4VB 5KYNA 1C1EH 4BFOA 1NCBL 4HG4K 5T8IA 1O6SA 4TVUA 3D5OF 4FEIA 4EDXB 4IHBA 1HE8A 3FTUA 3MRMA 1L9QA 5SX5H 3FSAA 3UC0H 1GGCH 4UQ3A 3UYRH 3HZMA 3HC2A 4X6BB 1L9OA 5FM5O 3ECBB 3FQXA 5IFJA 1L6XA 3NCYP 2ZKMX 1OM3L 3NFNB 2AEIT 3QUML 3N40F 5CJOH 1WP6A 4G3YL 3BAYA 4DGYH 4JCWA 1P9MA 5CILL 3UCRA 1TVHA 3PUCA 4IBTA 3E8UL 5DEJA 1MI5E 4J3OF 1YN6B 2FD6L 5GJTL 1VKXA 1EXGA 2OCFD 3TH2T 1MLBA 1GA2A 1T66D 1XGYH 5F7MC 3PHOA 5IB5B 1PW3A 5FO7B 2Y72A 4AVIA 3LY6A 1LE5B 1X9RA 3FQNB 3D05A 4NN5C 4X6DB 4I3GA 3U46B 4UIMA 3US1A 1YN7B 4CW1B 1AHWB 1TPXC 4MB5A 5EOCJ 1JPFA 4KKCD 5BMFL 1NMAH 1YUHB 2AV7A 2KHAA 4QHMA 3VH8G 2HRPH 5DVMA 1S9KC 2AJSL 2CRZA 4KTYA 4PUBH 3ZHFA 3VMNA 3TT1L 1D5ZA 3GD1C 4FC3E 4N8VA 1MLCB 3H42H 1AGDB 3QPQC 5EU6E 2AMUA 1ZLEA 5C6TH 1BD2E 5CLZA 3N1MC 4QGYA 1RK1A 1IC5H 4H20H 4WO4A 3T77A 4Z7VB 1IEAA 4RZKA 4HH9B 2G3MA 2J44A 3BLKA 2Y7OA 3HJEA 5C0AA 4KNUA 2EINB 3JV4A 2GEEA 2EYTB 3IWUA 1AZCA 4JKLA 3ECBA 3P3RA 1NOFA 2CE6A 2QVKA 4RZCB 1JGDA 4BQ9A 5CLTA 5I66B 1JZFA 3EIFA 3TPUA 3WFHA 5BQ7A 4XX5A 1AY1L 2A9NL 1UD4A 4WGKA 4YHOL 1A9EA 5D55A 4XMPL 4EI6B 4WK2B 5IV2B 2ZUQC 5FGBC 2ZIDA 4AVJA 5E6UB 3NEXA 4PN6A 4YSOA 4GS7B 1WUZA 4OFVA 4AC2A 2HFGL 2JNZA 4AYMC 4L9LB 4Q0XL 4TQ8A 4YSPA 1OSZB 1U6AH 2GI7A 5IGXL 2OJEA 2WBJB 5F7AA 1EWHA 3S4SA 5JXAH 3QYMA 5KVMC 4S1SL 3FB6B 1I8AA 1MCNA 2R29A 1UB5B 2VMCA 3P0GB 3FH8A 5HP5A 4HGMA 1PCXA 5IHLB 3BWZA 3QO0A 4B9YA 3LS4L 3C2AL 2V7HA 3ULUC 2NYKA 1KELL 3IF1A 1BAWA 5CEZD 1BFOB 3L7FB 4XPAL 3P40A 3AG4B 4WTWA 1IVLA 4DH2A 3A23A 2WIIB 3LXAA 2G60H 2XPGB 1E28B 2OW6A 2FGWL 1WA2X 1SMDA 5E8DH 1U8LB 4ZMXA 4YHYB 1CLOH 1ZLVH 4X4KA 1F0LA 4QJ4B 4GKNB 1BQHB 3QXTA 3WU1A 5D7JD 3LYRA 2ETWA 4YHNA 5T1DH 4UQCA 4N2MA 4RVBA 3BW9A 5CZVH 4UNUA 1FNLA 1U8PB 2XTJD 4EI6A 5EU6A 4D0CB 4X98A 1K5WA 2AI0L 1ERNA 3X2QB 3SQBA 1ORSB 5F0PB 5JTWA 4AG4L 2WGNB 3ILPB 5D4IA 3V4VA 1X5YA 1HH9A 4YNYB 5AW8B 4KI5D 2E4TA 2IQAA 4JKWA 1J05B 2R1WA 2VIRB 1D5XB 2NY1D 3TNNA 1S78C 2BNUB 5ID0A 1FVDA 3NIFB 1S7RB 2WXIA 1EJ8A 4MASA 1ZKAA 4XBMA 3MRNA 5L6YH 3OAZK 5T3ZE 5AAPA 5H37H 1ZS8A 3ZG4A 2G0LA 3UDWA 5F70A 3BD3A 1KC5L 2J20A 1BZQK 3WN6A 3CD4A 4OIAA 3MNDA 4RETB 1MG2C 5E6SB 3S3SA 2FX8H 1NBYB 1HXMB 3UBXB 2IPKA 5AOKA 4ZT1A 2BY3A 3KCWA 3C8DA 1L5GB 1AOHA 2CHNA 1FZKA 3P11L 3BAEH 3MV8E 1JHLH 3O81A 4O9HL 2H4EA 2VDRB 1SJEB 3ETTA 4LU5H 3WKPA 3X11B 1DO5A 3O2DL 4C58B 4XB3A 3L4TA 4WW2C 3TVMD 1U4EA 1ZVNA 2CGRH 4IDJL 4LRNL 2NR6A 1WWBX 2GBTA 3KWWA 4EJ1C 4JDZA 4JM4L 2EEBA 4X98B 4QHLB 3QXWA 3WKMH 5GSRA 3R0MA 3BJLA 3KPQB 3CFCL 4XP9L 1TR7A 1Q1JH 3VWKB 5IB3B 1INDH 2ITDB 4JCLA 1HEZA 1VEPA 3QARA 2FYYB 1SVCP 4F93B 3EYOA 5AD0B 1G9ML 3K81A 5EPMB 3C8HA 1XAUA 2JKJA 4JFDA 3VH8B 4MXVE 4Y5YA 4MX7B 1HYRC 3IJHA 3DBSA 5CMAA 1RJZA 2MTZA 5ERWB 4E9YA 1YHPA 1S8DA 2BVUA 2Q10A 4HWUA 5TE4L 2R69A 2VMEA 3LH2H 1YNLH 1Z7JA 3EOBA 1L6ZA 4JJOA 4EN2A 1QKZL 1ET8A 1MHHA 1JNLL 1IZJA 1CT8B 3PWJA 3CN4A 5ETUA 3OSKA 2Q6WB 1AD0B 3FK3A 2IPUK 4W68A 4PB0L 1OY3B 5CILH 5D7IB 5L8LB 2NXYD 1KJ2A 1CQYA 1HESA 4OLVH 3W0WD 3V6FA 5J5EA 4E41D 2NQCA 4JRYA 3VG9C 4WHDA 2CKNA 5AAWC 4H5SB 3QEHA 4UQAA 3W5MA 3V9CA 5CCKH 1CBVL 4CDHA 5KYXB 3V5KB 4EI5C 3MLPA 4BE5A 4FA7B 4CVXB 1OM9A 1AYOA 5KTEL 1S3KL 4I3RL 3QR0A 1HT6A 3K6OA 4MA8L 1KBBA 3CWGA 3KYNB 3UTPE 1KGCD 4P4RA 4PRHD 3UGUA 1U8KB 3QQ4B 3U9PH 3DV4A 3SO3C 1BEYH 4IU3B 4PY7B 2CHZA 1UACH 3BEWA 4N9OB 1GMEA 4R6UA 1SXNA 2AJXH 2FTAA 5C86A 4XMVA 2OX5A 1ZGLP 1JWUB 1EQWA 2CLRB 4Z7QB 1GJUA 3KHQA 1EIBA 1F2XK 3N55A 3DSNB 4XXWA 3Q5TA 4N6RA 1INEL 1F86A 3FF8A 4U7SA 1NUDA 3RJQB 5E1GA 3OZLA 5AD0A 1OAUH 1E43A 3NT0A 3FO0H 1U9KA 1NICA 4MX7A 1JPGB 4TUJA 2Y7NA 4PV9B 3SJVA 4AC4A 4CGTA 5HPMB 1YNTF 3RVXD 5J7CC 1VLXA 5HDBE 3CK0H 5D4JA 3RNKA 2OL3H 3MR9B 2MQ0A 3N41F 4UNTA 4GH7B 4QRTA 1MHHB 3S97C 4ORGB 1IBZA 1YMMD 4X5LA 1CD0A 5E6IB 5J1AA 3TN0D 1HI6B 4LRIC 4NI6A 3VGEA 4EF3A 1T5XA 2P80D 3S35L 4L8CA 3P4NB 2WVVB 4AM0A 5IM7A 3KLHC 4Z7IA 1OAYH 4AI7A 2CDFB 4RWYH 4KVNH 2BY0A 2NXYB 2WJ5A 3A6BH 1I85A 3BHBB 3N1FC 4BFRA 5C7XH 3DRQA 5IVXA 3MKGA 1WZAA 1HDMB 1M42A 5KYXA 2YHGA 2WSKA 4MNHB 2NZ9C 3NJMA 1RIUH 2BVYA 4ZMVA 2QGBA 5CP3A 4DGWC 1UZ8A 1UCBH 1XEDA 5GGRB 2CO2A 2PYED 3CXHK 5SV4A 3S4SG 4BZ2L 4TOYL 3L1OH 3AROA 4YIQA 1Q38A 4YZFE 2P43B 3QEGL 3Q6FA 4IRZA 1ETZB 1ZSDB 4R26L 4NPJA 2D7TH 5KANI 1CDBA 4GO9A 4PJAA 3IKKA 4OM0L 2A9CA 5A2FA 5IF0A 1QPXA 4KXAA 4CSPA 1T7ZA 5DCCA 4RMBA 3OMZA 1YMME 2C26A 3EO0A 5HHPA 3U1SH 2RQEA 5KSAA 1GC1H 3MMEA 3CPUA 1LO0H 5CZXC 1FVCB 5B7MA 2ICES 1LE9B 2DQGH 3FU7A 4YSAA 5IB1B 3BVVA 4NKOB 1DUZB 2K7QA 3QDME 3JV5A 3WMQA 4LLYA 1M7UA 3FU9A 2GEQA 2CPCA 4JVPA 4FHKA 2DH3A 1UWXH 2FK9A 4U1JA 5JW5B 3MUGB 4ZFGL 1MFBH 4HXBH 4PLOB 4BDVA 1HHJB 3ME0B 1T5XB 5C2UB 3H7LA 1FZJA 1PX3A 1IO4C 4NGHH 4JO2H 5D6DC 5LQBL 3F83A 1RD6A 2GIMA 2AABL 4AQEB 1IKFL 2EE6A 1IUZA 3RBSA 5C0BB 3PQYB 4DHLA 5GGSY 4BGLA 5E5LA 4X4ME 3WN5B 1I8IB 2ILLA 4BH8A 4QRSA 1E4WH 2QVTA 5D72H 4F7PB 5FK9A 4RIRB 4ATTA 4XVUD 4YSEA 4PW3A 5DHDA 3BRFA 2GTZA 2DQFA 1CFNA 1NMBH 2NX5B 2R0ZH 2NUTA 4AIZB 1MCPH 3LZRA 3WXVH 2GC7C 4I9XA 2PNDA 1MHCA 5EC1B 4JL2A 2HH0L 3ZQ9A 4W4OA 2GSIB 2DMBA 2WB1A 1R4XA 2UUDH 1GYAA 2Y6TE 3JTTA 3TYFB 3EYQD 3ZTDC 3UAJD 2WW8A 1BVNT 1MCCA 5I1GL 4KKLD 4ZX6A 1XVSA 4HXAH 1UZGA 1AOZA 3FL7A 1U92B 2UWEE 5K33A 1OALA 1TQSA 1PZBA 4BINA 2P5WA 1A7OL 3VXUB 3WG7B 2WNKA 4UM9B 4XP6H 2QV2A 2I9LB 6TAAA 3IGFA 3G5ZB 4ODBD 3KJ4C 3FMGL 4LLYB 1PIFA 5JW3L 2MJWA 4FERA 4LIQE 1FLRL 4XBPB 4J39A 5C0EA 4M6AA 1DBKL 1B3JA 1P4LB 1FNEA 1XXDC 2HKFL 3B7TA 3W39B 3DJ9A 5A16A 4N0FB 4L9LC 4L48A 1YQ2A 2X9YA 3ME0A 1J8KA 1VCAA 5E8EB 4PI0A 4X50A 3HG1E 2V2TA 3PG2A 4KXZI 3IAPA 4A55A 1FCCA 3OKEA 1NGXA 4NQSA 2WCSA 3L5HA 5C0BA 1ZHKA 4UU9B 4PG9B 1MDAA 1INEH 4PYGA 4YHKH 4AGNA 4HJIA 3B2PA 4Z18A 4N2LA 1XGUA 2IAMA 2V37A 3I2CL 5CP7B 4YFLF 4DCQA 4OZIE 4RIRA 4QRRB 1SOXA 2H3KA 2FWUA 5MP6H 1T1ZA 3TBTA 1OTSC 3VU1A 1BII