5DZPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 90
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzpA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzpA02
5E5LA 4Z7AA 5DC2A 3TX4A 5DCCA 4HUCA 5DZPA 5DVPA 5E1IA 4JMNA 3U1QA 4QTFA 1Y7MA 4XVOA 5D7HA 5K69A 5DUJA 3VYNA 1ZATA 5LBGA 3VYOA 3ZGPA 4QRAA 3ZQDA 4A1IA 3TURA 4QR7A 4A1KA 4A52A 4ZFQA 4QRBA 5DZJA 4LPQA 4GSRA 3VYPA 4JMXA 3VAEA 4A1JA 5LB1A 3ZG4A 2MTZA 3U1PA 5E1GA 4GSQA 4HU2A 4LZHA 5DU7A 4GSUA 4K73A 5E51A 2HKLA
chains in the Genus database with same CATH superfamily
5I1LB 1D5IH 4I1RA 4Z0XA 5JIPA 5B39B 2X2YA 2FSEB 3DX3A 3QJUB 4WCYH 2X40A 2G5BA 3MA9L 5F44A 2BSED 2O72A 3EJSA 4S1RL 3OD3A 1FVCB 3X11A 3BZFA 3D4GA 5EF0A 3DVFA 2LLLA 3QCTL 4C4KT 4GLRH 4F2ME 1IC7H 2PCPA 1B3IA 2G3XA 4PJDE 4UT6L 3S8WA 3AY4A 4CJ1A 1NZRA 2VC2L 1IQDA 3L3GA 3BPCA 4G2AA 2ARJA 2AV7B 3IU3B 5DD6A 1F42A 43C9A 3GBNL 4J7RA 3QDGD 3H2QA 2YPVL 1L5GA 1UWGH 2XXCB 4YJZL 4OD2A 1JWUB 1DR9A 3TX4A 4LU5L 3DX0A 4PGZA 1H3PH 1ORSA 4ZXBA 1VKXB 3QAZB 4FMFA 2TRHA 3GPEA 4GNKB 4LKCA 4FS0A 5IQ9B 5C0RH 1OP9A 1HXYA 4W9FC 3VWKD 5AUMB 4M5TA 1AGCB 4WFGD 4F2MB 4PJDB 1ZT4A 1L6ZA 3NK3A 4XN1A 1MEXH 4EDXA 4OFIA 2YD3A 3P3YA 3P4NB 4NN6B 1IAKA 2H6PB 4GUPA 4ZNEA 1M9WA 2WNKA 4MDIB 5AAPA 1SEQL 5IV2B 2WLZA 3CHRA 2NQDA 4NQXB 4UILL 5C0BE 3ZE2F 2FX8H 3EIFA 1AQHA 4HGWA 3W0WA 3S98A 1G7HB 4NXKA 3FB8B 5F96L 4A55A 3MFGB 35C8H 4FLQA 4JQVA 5I19L 5DJ2B 4XNZC 5JORB 3TV3L 2Q7YA 3K6OA 4F2EA 2LVCA 2OR7A 4K3EL 5GS2H 2BY3A 4P9HC 2VRAA 2Y69B 4JDTL 3SOTA 1EERB 3P40A 1NKOA 4FZ8H 3TPUB 1U8HB 2VMDA 3RWGB 2LHAA 3DI2B 4WWNA 2BVTA 4YVNA 3C8DA 4CA4A 2YEVB 2VDOH 5DJCB 5KJ7E 5C0BB 1E8WA 4AK1A 4X6EA 1OALA 2ATPB 4R2GD 5GRJL 3HG3A 1T1XB 2Y2TA 2P46B 5FDWB 4JREB 4KK6C 3SKMB 5C71A 3TOPA 4X80L 5E1AB 4UYPA 2FR4B 1RUQH 3RUGA 2VM4A 2EKSB 4JFUA 1D5BA 2EIMB 1ET7A 3MLVH 4NQDE 2LT9A 2F8VA 4LCCB 1Z9NA 3W56A 5HGBA 1JGDA 4U7MA 1QATA 2DM7A 1ZLWH 1CI5A 3P54A 3A67H 1NIEA 5T5NF 2EE0A 2GTZB 1IBYA 5BV7C 1Q9OB 1WA0X 3LZFH 4POUB 4XWOD 4YHIA 1PQZA 3QP3A 1C5DA 3GSVB 4Y4KD 4XHJC 5EUKB 1GPOH 1Y7MA 1BFOA 5D5MB 3ZT5A 1IGML 1KCUH 1MFNA 4NQDB 5BJTA 4HKBB 1BZOA 2K1MA 4URTB 4JVUA 5J13C 4KK9C 1Q9KB 3PWPD 4J3XA 1M7UA 1WAAF 5IJBC 3QYCA 3U25A 4HA1A 4MZ3A 2BNRE 3OR7B 4LHQB 4APXA 3KPMB 5JOPE 3DPBA 1OGAB 5GS0D 4A1JA 3DHMA 3FH7A 2MTZA 1WA2X 1HINH 5F88A 5J12B 1SZNA 1PNCA 1A47A 4FNSA 3TXAA 4TQ8A 4XN5A 3U46A 1SYVA 1OAXH 4GQQA 1DP0A 4L8BA 1NLDL 4QRUB 4RMWA 4UIMA 3P4OA 2WXGA 3VWJC 4Z3IA 2VQ1B 4EZMA 2OXGB 5CEYB 1OTUC 1FGVL 3MA9H 5GZOC 4C47A 3S3DB 1P2CB 2KLRA 2VXVL 2VIRB 3ZDZB 4GMSL 3PL6C 4Q9RH 3VNYA 5KOMC 2BNRB 5TE7L 4H26A 1UG9A 4KQ0A 3RL2A 4LLMB 3VE0B 1BF8A 3OZ9L 1ZV9A 2VERA 4UT6H 3OGCB 5IMOA 5AYQA 1RIVH 3IDXH 4XI5C 3EFDL 1B0RA 1V7NH 1YNLL 3ZX1A 1N10A 3I9IA 5CJ8A 4M29A 4ISVA 2Q1EA 4A2DA 4OUOA 3CDFA 3AADB 4D0BB 4ADJA 2ZOLA 2BFGA 3GLAA 4KJWD 4LU5H 3FTWA 1BVZA 1KEML 4HC1L 3RWEA 4P23B 4P5MB 4LNRB 3RHWK 4YSUA 3IDJB 4W6YB 5GZOD 5ANME 1NBYA 4JDVA 3TGXA 2BC4B 1AZCA 3PL6D 5JPMA 2R7EA 4K0OA 4JFXB 5I76B 4ONHB 5JW4N 1DCLA 1FAIL 2CO7B 2P8LB 5I0WA 1UACH 2VR4A 1MH5A 3RZCC 2CJTA 3AAZB 1BD2A 3IKCB 4GKNB 4XI5D 3RKPA 4PTTB 2GSMB 3U4EB 2V5MA 3PJLA 2X88A 1P4IH 3B9KC 3L9RB 3CVBA 5I19H 3TBTA 1SOXA 4WW2A 1AANA 3ISRA 4AIZA 3ZUNC 3FFCA 5I8EB 4NO0A 3UBXG 5ANMB 1KGJA 4OLUH 3VJ6B 2HFFB 2WSDA 5FYKL 5TD4A 4JHAL 3BAYA 4RDBA 4AV0A 5AFAA 4DNLA 5IVXF 2PYEE 2J1XA 4YXKH 4L0YA 1IM9D 3LB6C 1UGNA 4Y16D 1TJHL 2A74C 2VLRB 4BGDA 1HKLH 2QHLA 3VDAA 3NA9H 2V2XA 5E9NA 1SDAB 5HHME 1BJMA 1AGEA 1EK3A 3B9KD 1P7BA 1DSYA 4JY4A 4X80H 3QJQB 2R2BB 1Z9SB 3RWHA 4BWUA 1K8IB 4JQIH 4HIHA 1ZIAA 3EYFB 4HKJB 4X42A 5DFAA 4K71B 2PYEB 5HHVL 1R3JA 2AERT 2VDLH 4JFFD 1WG3A 1DBML 1QLRA 4DP1X 4FQIH 4PV8A 3VO0A 3VRLE 1XIWB 1QHOA 1N64L 5HHMB 5HJ3B 5D6CA 4AC2A 4ZUSB 2VDRB 4MCYA 3W9DB 4O9HL 1W8EA 2EDYA 3LH2L 4G8AC 3MRKB 3E7JA 4JQIA 1ESOA 1WBYA 3IMSA 3MUY1 1IGMH 4TLTA 2OSWA 4EXKA 1RIUL 3C2AL 4H88H 3VD2A 2JCCF 2UUDH 1GGCL 4NZTL 4WU5A 4GO8A 3OJ2C 1A7NH 3OWEA 3NABH 4A2MA 3EJYC 1EMTH 5BVJB 3LEVL 3SY0A 3BVUA 4X9FA 2F61A 5DRZA 1J0KA 4HUKB 4LL1A 3U30B 1E27A 2AZUA 3GT6A 3C5ZC 4W9KC 8CGTA 1C8PA 1FNLA 3KGTA 3TS8A 1PFCA 5DJ6B 3NCJH 4URKA 5KYUB 1A02N 3QDJE 1W0VB 3WUWG 5KSVA 1JHTA 1FGVH 1JXGA 2BHZA 2ZE0A 1YPZF 2YC1B 4OCYL 4XAKE 5F1NB 4YBLC 4GBXC 2H45A 4PLNC 4GMSH 3KJ6L 3BX7C 2CG9X 2FNBA 4MSWA 5JR1L 5TE7H 5EU5A 2NX5E 3BW9A 3EJZC 5AD0A 2XN2A 1DTUA 1NIDA 1TEGA 4GXUM 1IGJA 3UJTL 5JDJA 3MNZA 1IT9L 3D0VA 4KHXL 1ZWIA 1XB8A 4M1DL 2H7WA 1KGIA 3C5ZD 4IGBA 5L2KE 1TO5A 2X4QB 3QDJB 5CD3B 4N6RA 4YZFF 1W0YT 3U4KA 3ZSTA 3NIGE 4F57L 4BSVB 3ATFA 2YS4A 4F9PC 3MNVB 4GBXD 2GJ6A 3VU2A 5LGKA 4GKOA 1WE5A 3MLZL 4RISL 2NX5B 3CAFA 4WI7A 1FN4A 2EKJA 4DPBX 2H32H 4MQXC 4JFYA 2I9LA 3DLQR 1GC1L 1MREL 1QA9B 4U1NA 3C6LD 3P4MA 4LHUA 4M3KB 2AK4E 5GGRY 2WBJB 1N19A 4FFZL 4FXKA 1BVKB 1RUMH 1HEZA 3F6IA 1DZ0A 1ZSHA 2DQCH 1EJOL 2A77L 2WQ8A 4TUOA 4YR6B 1DVXA 4NZUH 4G6JH 3NIGB 3SE8L 3WS6C 3S8GB 1AGFB 1E9QB 5L7XL 4A2HA 1FNGA 1OO2A 5DS1A 5FYKH 4JHAH 4KUCF 2IDCA 3E8VA 4QHNB 1JDAA 2PW1B 4ELKA 5J1TC 5EEWA 5M95B 1J87A 4R3SA 3VFUB 4GI9A 2A9NH 1AIFB 1WAEA 2VXSH 4LFHD 1ZVYA 1PKQE 4JM2B 1EXUA 2AK4B 5CP7B 5IESL 1SBBA 2QV2A 3FFDA 4NM4L 4V1DD 2ZKXA 5IOPB 5INCB 2PPEA 1X5JA 3UZVB 2FX9H 2QJDA 3AG2B 4TOYL 1GZHC 1HWGB 2BVUA 1QABA 1KN2L 3OL2A 4J3OG 4FLHA 1MUJA 1TR7A 1S9WA 4KROB 5GRVL 3WLBA 2GW5A 4P3DA 1WISA 1G6RB 2BLFA 3BI9X 3RKDD 5FWRA 5KSBA 2BZ7A 3T0AA 3OB0K 5F9WC 3RUGF 4ES9A 1J9QA 4A7UA 4B60A 1F11A 1OHZA 2AJSL 4QO1A 2CBOA 3BP7B 1MJUH 2HRPH 1PKQB 1DBMH 4KTYA 3VXME 4N2EA 1PY9A 1FVDB 3RWIA 4ZSOA 5IW6B 5ISZB 2N7SA 3NBNA 4O2CA 1R5VA 1BSIA 3PPEA 4U1LB 2AITA 2FYYA 2VDRL 3LH2H 1WP6A 2X1QA 5DJ0A 5HI3C 2MCMA 3UTSE 4KDWA 4P48A 1WEJH 5ABZA 3WELA 3IWUA 1WD9A 3ZKQD 3GSNH 1BWWA 1JZ7A 3WNNA 1L9RA 3ULUH 4K3GA 5FEBA 3H9ZA 2W8CA 3P2DA 3RDTA 2AEPL 4JHWL 3VXMB 4X5RA 3QEHA 2BCMA 3LEVH 1CPUA 3LMJH 5D71L 2RQEA 2H3NB 1LO3L 2I60L 3N85H 4QF1B 2L7QA 3M1CA 2IAMB 2ITCA 3UROR 1L6PA 1AKJD 3NQKA 4OJFH 1RHFA 3UTSB 4AM0B 1SJXA 3GSNA 3W81A 3MO1B 4NEHB 1KCVL 4XZUA 1DANU 2P5WD 1H8NA 1KCKA 2VL5A 3NAAL 5C0DA 4WKZA 1ROCA 1V8HA 2YAQA 2DD8H 3TO4A 4NJAL 1SM3L 2IANE 1X7TA 4FA7B 1NBZA 3ARZA 2F7RA 1X5LA 1XAKA 3UAEA 1KJMB 4P9ML 5I82A 4OGYL 1IT9H 5I1AA 2X42A 5BOPA 4FG2A 3ARUA 5T8IA 2PR4L 4AY0A 2AJXH 3NCXA 4RQQB 2EYTA 3QQ9C 5BMFL 4HEME 3SQOH 4GP4B 3ARGC 1P4LB 2XI9A 5AVXB 3EYSL 2OBGA 4KMTH 2VDKB 4TULL 1JPEA 2OYPA 1G4MA 2MWCA 1FV1A 1KGYE 4MHHG 4UOQA 4AQEB 1SN0A 2RFXB 4EF3A 4A6YH 3CLWA 4RISH 2IANB 3I6LE 3MRRA 5F6HI 1UD6A 4DVRL 5TF1H 2FBJL 3LRMA 3JYBA 4KY1L 5DRXA 4HZ1A 3UAJA 1KELL 2YUWA 3ATBA 1H15B 2YA2A 3GJFH 2IDUA 3L3IB 1URIA 1XGYH 3BH9A 2GI7A 5IEHA 4Z9KB 4WNQA 5DMGD 1A21A 3ZRFC 3MRQA 5KSUB 1EJOH 3JZYA 4OGZA 2O5XH 3VFSA 5F3BB 1G9HA 4U1KA 1HXMB 1CT8A 3ARGD 3O3AB 4WW2F 5DT1H 5AEAA 5KYWA 2NY7L 3L1OH 3W37A 1X9UA 2FB4L 3BIBX 2C4FU 5L7XH 5ESQA 4K7PX 4XWGH 3S35H 4TSBH 3ZTEA 3MJ9L 4XN4A 3WEAA 2O5ZL 3O9WB 3H3PH 4NT6B 1GJWA 4G11A 1NDMB 5ESVB 3ESPA 5FGCE 5DYOA 4C83B 5B38G 2QBWA 2QADB 3GJFA 5GSRB 4XVTL 4NCDA 5CWSB 1KFAL 1EVUA 4YAQA 5AG8A 4HPHA 5INDA 3HOGA 4N1HB 2OMTA 3LN4B 5IHLB 4TOYH 5CILH 3NSDA 1I7RB 1MNUL 3BUDA 4JUTA 2F5AL 3DGGB 1LK2B 3EFOA 1RZIA 4QPEA 1YA5A 3VCLB 4ZBJA 3TIDA 4QRSA 5D2NE 1UYWL 2IBGA 3L45A 3D2UD 3S36H 4NKOB 5AAWA 2AJSH 2BO0A 5D7LA 5FGCB 4G80A 4HIPA 3MOQA 4QGTA 4WY7L 5MEOA 4XMPL 2YR3A 5TH2A 4X7EC 4JY6B 1M71B 4H13C 3UC0L 1FSKC 1I3GH 1NAMB 1HH6A 4HHGA 1GCYA 5ID1A 3BVWA 4U05A 4XN9A 3T8VA 3VXRA 4GMTL 4YHYC 3A4AA 1B4RA 4LCWD 2Z65C 4PVMA 3BZ4B 3UO8B 1S9YB 3DX7A 2WZPA 3BCFA 5DWPA 3BE1H 3P11L 3MYJB 4HUUA 3QORA 5D2NB 3ULVE 4E9WA 5AW4B 3U9PH 3LKSB 4M61B 1UCBH 2AEPH 2Y1ZA 2AKRB 4JHWH 3MLTB 4LRNL 2Q10A 4MAUL 4LP5A 3O45B 3IS1X 4KI5D 1PCSA 4QOKA 1B0GA 3UDWA 1WITA 3VXUA 4Z23A 5C0AA 1LO5B 5HHXL 4QTFA 3WN5B 4RFOL 1UZ8B 1R24A 3MCLH 1NGPL 5I66A 3NUKA 5TE6L 1KCVH 1O7DC 5AVYB 2HG5A 2AEQH 4G1EB 3MYZA 2QVIA 4G71B 2XV3A 1E5BA 3ERXA 5C3TA 1J11A 3IEAA 2NQ3A 3GIZH 4JO1L 5D8JL 3QRFM 2OZ4L 1NGWA 2ID5A 3IFNH 4OI8A 4KKCC 4K9EL 4ZO8A 3WN6A 1CFSB 3PLYA 1UGKA 1SDDA 3UTPE 1JK8A 1IIKA 3NTCH 3O6FD 3OXRA 5BMFH 4JRXD 3RJDA 4KRPB 3D05A 3L4WA 4KKAC 3M7FB 4BHUI 3GK8H 4KKBC 4R96A 1KBGL 1N18A 2D7MA 1OB1B 1TG8A 2WXRA 3DHUA 1P84K 3HG1A 3KPTA 3KYKL 2QGDA 1MSPA 4HJJH 3IVKB 3BGFC 3EF7A 4BHUA 5JHBA 1EA9C 4AQ1B 5DC0A 1EO5A 1LGVA 2V2WB 4CU6A 1UURA 3O2DH 2B15A 4HK0B 1RZ8B 2Y3NA 4DVRH 2FBJH 5EDXA 3LRSB 4KY1H 4MS6A 1G7JB 1NCCH 1JN6B 1KELH 2OAAA 2ED6A 3C09C 4OJEH 2ZUYA 4QDGA 3MV8D 2Q5BA 2ZYHA 3SGJC 2OK0L 3ME0A 1D9KB 1MVYA 1OW0C 2IALA 5ADOH 2CO2A 4IBYA 1AD0B 3ZZQA 3M46A 4PBVC 5FKAA 4E9XA 1DN2A 3FB6A 3QHZL 1WZAA 3EO1B 5HHNA 1FJ1B 3O2DA 2O5ZH 4OCMC 1OTTC 1KPUA 2H3XC 1A6UL 4M3JA 3IXAA 5B1BB 1AJ7L 4NGHH 5BZDA 2G2RA 4LCYA 3WJMB 2Z64C 2CUMA 3L3JB 3KNBB 2PTUA 4YEEA 3NJLA 4EKJA 3EO9L 4PD4K 3WMSA 4RAHA 3SBWC 4UT7L 4MD0B 3SN6N 1QUNA 4D8OA 1HEJC 1KLGB 3R4RA 5IM7B 2CIIA 3K2UL 2O5NA 1QRND 5CN3A 4QTHA 3CVHL 1G0YR 5KSBF 2DQUL 5E6RB 3ABLB 1T80A 1S9KC 3TZVA 4JMXA 3X3FL 1NPNA 1OTTD 2CKNA 1MF2L 2Y23A 4GAAA 1ACXA 3MLUL 2ZWSA 1NBCA 4RESB 2LLNA 3NZ8B 3T65B 4EVNA 5C0EA 3MODH 5IFJB 3HUJF 2YQBA 4UANA 4GH7B 1XR8A 3MRGB 3QDGE 5HYFA 3TL5A 2AV1B 1I7TA 1WIOA 1Y18B 3Q06A 3S5LB 1CZ8H 3MRCB 4HGMA 2EO9A 2BSSA 3WKQA 2O6CA 2VUOA 1X6LA 3WHE1 2VXUL 1WD8A 2FWUA 4WFGE 3RFZB 4F7TA 4UOW0 2PUQT 4MZ2A 4Z78A 1QLEB 2DWSA 4C4UA 2DM4A 5T5FA 1GH7A 4CSZA 2CBTA 3U79A 2D7PA 3GI9L 2R15A 3EXJA 3QDGB 1HOCB 4KK8C 2EC9T 5LDSA 3N43B 3C5SB 3EOBB 3MJ6A 1DBAH 4H5SA 5C0CA 3QUMB 4IMLA 1H3TA 4N2HA 1K4CB 1OKEA 3A24A 4Q7DA 1N0XL 4M48H 1NGPH 4JHVA 5F7LB 1PDKA 1HJBC 3KH3A 2J8UF 2ZYSA 4TQIA 3FUEA 2C3VB 2BSRA 3BKYH 1ASPA 1II4E 3GWJA 4ALAC 3QIWA 3QRBA 2O6FA 2AW2A 4Y19E 2OXHB 4CVXB 1KIPB 3T6XA 5C7ZA 5I24A 2AS5M 1XF1A 1NL0H 4UV7L 3GM8A 4J3OH 1CDYA 3ZHNA 4HPYL 4G9DA 1KN4H 4HHAB 1I8MB 4RVBA 4N8PA 4HUXB 4KK8D 2WMPA 4HIJB 1R3HA 4ZFOA 1BAWA 5IK3B 3F6LA 5CSZA 1E2ZA 3RVWC 4H0HB 3L5HA 1GGUA 1N8ZA 2I5YL 2ZAGA 2XT1B 3VM5A 4RIRA 3GEWB 5D7KD 2CLRB 2DYPB 4FI7A 1FH2A 1WGVA 2XLLA 4Y19B 1PLAA 4XO4A 4R8WL 5IT2L 2UVFA 5FC9A 1KIQA 4IHOA 1M2VB 4F7EA 4R2GB 2MQGA 2QQKL 4Z7AA 3E9UA 3FQTA 4M93C 4ZUVB 5F7BA 1FRGH 4L2LA 3GBML 1FIGH 2CBPA 4XPAL 5FCUL 4ZFGH 1D6VL 3HC4L 4FHKA 2R56H 3DGDA 4XNZB 2JB6A 3T08A 1MFCH 3BFWA 3TA3C 3RVWD 4B53A 4XMVA 1WF5A 2GJRA 5ALBH 4MA3B 3CDZB 2FJGB 3D12B 3PWPE 2DBJA 5IW1A 1SYSA 4XOAA 3GRWH 2QV4A 4DO6A 4XMLL 4N87A 4LSSH 5PAZA 1YMME 4MTMA 3R4DA 3BUIA 3LXBA 3T4AC 1JNLL 1BW8A 2XKSA 1LE5B 4GI6A 3WJJC 1C5CH 3U9WA 4JEGB 3FU9A 1FFRA 3WDJA 1WVZA 1TPXB 3QYMA 4KZDH 4U3SA 2BM3A 3N91A 3BWUF 4KJQC 4K3JH 4Q89A 5AW5B 3TP4A 3TA3D 2R1XB 3LXUX 1JL8A 1S2EA 2Q8BH 3CVHH 2VABB 3GRWA 3PWPB 1MELA 2FIRT 4K94L 5GGTL 3BVVA 3IGUA 3X3FH 4Z0BH 3ARBA 3G08A 2MQCA 4EZKA 1I7ZA 2ROXA 3KPRD 5IFAL 2OMVA 5E1QA 4PTUB 2F0CA 3M86A 1AZZC 5DJYB 3OX8A 3KBEA 4PREA 2FEEL 3MRBA 5BV7B 2RIKA 4XBGA 5B4MD 3TT3H 2C34A 3ZDWA 3KHQA 4ETQB 2UWEF 2R2HB 3C8KB 4YC2C 1CBVL 3DTDA 3VXTB 1KB5B 4KJQD 5DK2B 3V5KB 1T0MB 3RPKA 1GGBH 3G5VB 5C0GB 2VLMD 1MJ7L 5D9SB 5BO1L 3EYVA 1HDMA 5J13B 1GMIA 4PMFA 3H2PA 2PPAA 3TN0D 2OA9A 2XN0A 3LEYH 2FZ3A 2A6IA 1X9RA 1M6OB 3W38A 2E46A 3D50A 3EO0B 1MJJB 5CP3H 4QRPA 5CJXC 1U8KB 4F8PA 2OW6A 1J9CT 3JV4B 3L7EA 4OQTL 1OAQL 1QLEL 3DO7A 1RZ7L 1JZ4A 1JXFA 4WENB 5KAQG 1R3LB 3E1ZA 1J1XL 2Y7OA 2YD9A 3AQYA 3I9AA 4IS6B 4KXAA 1V54B 3UTTA 2I24N 3K4AA 2V8MA 1KWGA 2G9HA 2CGZA 4FF9A 4I4WA 4LDCA 4Q9QH 4RAUA 5DHYB 4RGMC 1S3KL 3VWJB 4UMGA 1NGZA 1T5KA 4BWTA 3L08A 4QRAA 4PJIF 1KBKA 5A2BA 3H9YA 1JP5A 1M3JA 3NJNA 4LSDA 4NKMB 5I0XA 3PL6B 2VAJA 1A6VL 1NGYA 4PMEA 4QXGL 5CP3A 3RY6A 4JAMB 4N4YB 3CQPA 1FP5A 3BPNC 3NJHA 4MDJA 3BEWB 4GG8A 1Z6JT 2NY2C 1CFNA 2W91A 1HQRB 1ND0B 3OKNA 4JPKH 3LIUA 4QRFA 3WL9B 4HOWA 2MCG1 1KPRB 3HBGA 4B27A 1MJ8L 2A38A 2MPVA 4QWWC 4X98B 4IBUA 5L9DH 1U9KA 1X44A 2CO6A 2E8ZA 1WFUA 1UB6A 3GMMB 4ZDHA 4DK3A 5B38A 3QS3A 2F6AA 1INEL 1ZA6A 2HT3D 3GUTA 3QUXC 3FF8A 4L4TE 4JHBA 4RGOL 1IM9B 5BZZA 3R8QA 4Y16B 4JFFE 2X0UA 1A4BA 5IWLA 3P73B 1CXEA 2A99A 4X5WA 1XSIA 5E2WL 1LE9B 2KYIA 2LGNA 2PP8A 2KZKA 3V0IA 2NY2D 3QQDB 4P07A 5KUMA 3VVVA 5I8CB 4ODUA 4BH8A 1ITCA 3B9KB 3GBLA 5FDYA 3MOBL 1D6VH 1KLUA 5ANHA 4LVEA 1K5WA 3VTMA 1UD5A 4M03A 5L4MA 3CVDA 3UERA 5AW1B 3QWQB 1KC5L 3L3KA 3JTBA 3A21A 3KXFA 4N6QA 1JMXA 4L4TB 1VENA 2WZAA 4JFFB 4AYID 3IETB 4IRSC 1DEEA 1I1YB 5KG9B 2A74B 1QFWH 3U4BL 3ZMEA 4Y2LA 5IIEA 2GC7C 2PXYD 5A1AA 3WIAA 2ZJSL 4OZIB 1D2PA 1OP4A 5FM5M 2AQ2A 3CFKA 3MBEC 1E2WA 2WKGA 5AALA 4LARL 4D2NA 3WD5L 2EDFA 3FUFA 3ALPA 3L3HB 4K94H 4FEIA 3DYMA 1YNTB 3V6BR 1HHJA 2A7BA 4I8DA 4YSSA 1IGYA 4YH6A 4BZ2H 3O3EA 2IWEA 5HPMB 5IFAH 1XFPA 3BH8B 4OB5L 3WKPA 3WV0A 3O3UN 5GS0L 2H41A 3KLAB 5I9QB 3LTVA 4MMYB 4YXHL 4QYOA 1SRDA 2HAZA 4A2FA 3QNFA 3D69B 4BFRA 1DQLH 2YFOA 4IOSA 5FFGA 1P1ZA 5HBBA 3HNSL 4H2CA 3N1GC 1RZFL 1U6AH 4LFHG 3ARVA 5T1DH 4ZX6A 3C60D 3HFFA 5DUJA 5GGUA 5I75B 2WUCL 1CBVH 2D3LA 4MAYA 4ZOAA 3H3KA 2VLJD 3I75B 1KB5L 3O11A 5E99L 5GIRA 1MJ7H 3PHOB 1S7VA 4OVUA 5C8JB 4K8RD 4LGSB 4G6AD 2QVFB 2DBLH 2ZYIA 3ABGA 3GSXB 3LJ3A 2BP0B 3BP6A 4U1IA 2QPEB 2CGRH 5HDWA 3GMOB 4Z8FL 4FNLH 1OAQH 3BWAA 4EEEA 2UY7A 5J9PB 5SV4A 2ARWA 4RFNC 3C5ZB 4JO3H 5HDOA 1PPIA 3FCSA 5IVZB 1HCYA 1S3KH 3AXLA 2IWGA 3CIQA 2BHUA 4QEGA 5F7KC 3V8OA 1PS3A 2Q3AA 5EEYA 4YBLB 5EBMB 1QSEA 4GBXB 1JI1A 3GRBA 5DHVB 5IREA 4UMSA 3OAYK 2CRZA 2XWZA 4GSQA 4LEXH 2TSBA 4KOBA 3US0A 3P0VH 5EO0B 5HHOA 3C6LB 3U2JA 4V11A 1PVHA 1DSFH 3RI5K 1TYRA 3CDGB 4N28A 2BOLA 2P45B 4LB8A 4FQPA 4P2OC 4V1DE 3AQZA 2MCPH 3P69A 2EUZA 3IXTA 2EIEA 3MV7A 4PJ6A 2ATKA 4XO8A 4JZOB 2Z31D 1HI6A 1R1CA 3B9AA 5CCGE 2WIIA 1HZHL 4I87A 3A6CH 4NAMA 3JWOC 2OCJA 3HZVA 5E9DD 5CHNA 1MXGA 4KTDH 3MGTB 1JZIA 4LPVA 1G7PA 3CIAA 3PIQA 4I0PD 3ISYA 4XNQA 5HDBF 2K4WA 3RWDA 3EDFA 1F6FB 1NUFA 4JFPA 3MREB 3NCCB 5E2WH 3ZDYF 3B43A 1OANA 4V1DB 2VR6A 4C59B 3U7AA 3QXAA 2AXGB 3FCGA 4BDVB 5BZDB 4L8CB 3MOBH 4NWUH 4XTRD 2CA4A 4F7PA 4ELMA 3OPUA 3HE7C 4ZX5A 1ZLSL 4FXGA 3K80A 4GT0A 4NUJB 5TQ0L 2F5BH 3O3BB 1QFHA 1EGJA 3TWCL 4OV5A 4IBLT 3NA4A 4N0FB 4PRPA 1LK3L 4LCIH 3P77B 3QH3B 2D3VA 3JUYA 1FHNA 2XIDA 4JFOB 4GW4B 4LMQI 4WI3A 1G7QA 4QXUL 2YQ2A 2ILLA 2R1YA 4AL8C 1GZPA 4B96A 1YUHA 4BQ8A 5BVPH 1RFDL 3CZUB 3OVUB 4IOIB 4OY9A 3Q6FA 4XPGL 4O2FB 3ZUCA 5IMMA 3EDKA 4N0YL 2G2PA 5FM8A 3GIVB 1A6PA 2GIMA 2X7LB 3BGAA 4UV4L 3WD5H 5IKCB 4OFYD 1DBBL 2LTQC 4ZTPL 1CF8H 1TTGA 2E7DA 2WLHA 2ZXAA 1T1YA 2W07B 5E94A 2GHWB 1E3FA 1TZHB 1WZKA 2DLFL 2ZUSA 3E0GA 1UWEL 5KBPA 5G5DB 3R0NA 2HRLA 1PZBA 3BAKA 2GSGA 3QR0A 1QFUH 3H42L 3EGSB 1G5GA 4YXHH 3OKLA 3SDXE 3KCWA 3RNQB 1SHWA 1AHWC 4F7CA 2VMJA 3QUZC 3X14A 2BRRL 2EUXA 5FGBA 1EQWA 5A7BA 1OVZA 3DVGA 3KYOB 3VFNB 3VXSA 2R29H 3US1A 1GAFH 4XN2A 3QC6X 5AZEH 4H8WC 4YLBA 2DQHL 3D8MA 2CGYA 1V05A 5EEUA 4YWGL 1BM7A 5J6GB 2WTRA 2BZDA 1TVHB 1XCWA 1IAIH 3B2PA 1NCGA 3QEGH 4IKLA 3RGVC 5DU7A 1IGIH 2MPAL 2ZCLH 3IDNB 5E6YA 3SJVD 4Z8FH 1YEKL 1A1NB 1K5NA 3B3IB 3SDXB 3JV0A 3UZQB 2H5UA 4LEEA 2X4TA 5I1KL 3E8UL 2WBKA 3H9SE 3L3OA 4NZRH 4NIKB 3PDOA 4JPVL 3QUZD 1IO4C 1ZGLM 1XZWA 4AYBA 5ABDE 2R29A 4FKHA 4YDLC 3CVIL 2WLLA 3TFKD 3ZQDA 2H8PA 2EIBA 4RWYH 5K93A 2OMWA 1TQWA 4ZW5A 3OAZK 4DVBA 4QRRA 1UEMA 2CJSA 3UPAA 2DDQL 2FE0A 1BWMA 2LQRA 3T9WA 3WHXA 3RGVD 3BT2L 4JFEA 1IQWH 1BZDA 1C8QA 4WJKB 3QUKA 5A6IA 3IDIA 4X7FC 2O5YH 5C6TL 1NEZG 1T2JA 3H9SB 1I85C 1EUUA 3A3YB 4OZHA 1J0JA 2JFCA 1WWAX 2CR6A 4ZAKA 4S1QH 1O9ZA 3E3QC 2NPLX 3N1FC 3X3GL 1HZHH 3ARGB 3O8XA 3VH8G 4B9KC 2ALAA 4L37A 4JG0L 5A6MA 3CHQA 5FYKU 1JPSL 3O6KL 4HFUL 1DE4A 2GTWA 3GMQA 2X5PA 4UI2A 1AYRA 3BN3B 4FOMA 5EO1B 2SEBA 4ZYKA 3VFWA 1JPST 1HQ4B 3S36X 3ARED 1RK1B 1OOWA 1YEGH 7TAAA 5J1AB 5DURD 2PMZA 3U36B 1CICC 3EBGA 4CJ0A 1J18A 3KWTA 4Q9CA 2IBZX 1LP9E 1A6TB 4ABQA 1R9FA 5C0JB 1TVDA 3D0LB 3FUKA 3ZKSD 4YBHA 2IOOA 1M4KA 1WZ1H 4J8QA 5DSCA 1CO1A 3H54A 3PRZA 4CADA 2FO4B 3V0GA 1LK3H 3CFEB 3O2VL 5I1IH 2ZCKH 3KPOA 3H4HA 3T6QC 2WO2B 1NSNH 4G8GE 1SMAA 4Q6IA 4MCNA 2DLIA 2OTWB 4XPGH 1LP9B 1AKPA 1KENL 4MMXA 3IFPB 5FHAL 5E7FA 4N0YH 3TBBA 5MEND 4PJFE 1JF1B 1OAUH 2FWOB 4O02B 2P28B 4UV4H 5DJAA 2H1LM 4LL4A 3T3PF 3WCYA 5E6UB 1G0DA 4ZK8A 3GKWH 4AGQA 3NIFF 4KVNH 4W9CC 5GGSY 3V0WL 3QWOB 2X87A 1JV2A 2R2EA 1QVOB 1ZD6A 2XXGA 4YXLL 2FSDA 2HA1A 3H2WA 1XX9C 2B1AH 1D5MB 2UVEA 3K74B 2XCMC 4OLWH 1FSKB 4Y9BA 4WI0A 5LG6A 4XHQA 5CGYC 5EOTA 3V8CA 4YHYB 4RCAA 4JRXE 1PZAA 2HG0A 4PJFB 5CIPH 3FAWA 1J1OH 3S96A 2B39A 1J8HD 3S4SB 1A5FH 3IBOA 1DQQB 1CDUA 4JLRB 4KQ3H 3NFPA 4MXQC 3CZSA 1EEUA 1RUKH 2NUPA 2XWDA 2ZKHH 5H4YA 2IV8A 4OGAD 4JANB 2WXOA 1OAKL 3Q2CA 2MPAH 2P8MA 2OLDA 3V0DA 1U8MB 3H0TA 4FN0A 3TYGL 3HC3L 3T0EC 2MKLC 5DC2A 1INQB 5E1HB 4D9LL 5B3JF 1NFKA 4E41D 5IMKB 3WUZA 1T2QL 3O6FB 4JX0A 5F7FA 4JPVH 1S7TB 1UD2A 4JRXB 4G7QB 4GG6F 3ARDA 1B0IA 1ZCRA 4QHLA 1A7QL 1MQKL 4FKEA 1DSWA 4F9LA 3HI1B 1SXSA 1JTPA 5A16B 3FBKA 4LSRL 2DKMA 5EN2A 2C4XA 3CBRA 5E6IC 3U1PA 3LPGA 3F12B 3U0PB 1DBJL 1YECL 3BT2H 4HG4J 1U93B 4LLUA 5B8CA 1COBA 1IBFA 2EVIA 2Z6FA 1G0XA 3EJCA 5AZ2H 2R51A 4WGKA 3T0ED 2GFBA 2X3AA 2NOYA 3IRPX 5C6TH 3T2NL 1CIUA 5F1KC 1JZFA 3STZA 5I2IB 1EFQA 1AXTH 4KRMB 2PPDA 3CUPA 1RZKL 5C07D 4HMEA 4PH8A 4CU7A 4MJ5B 4E42A 5FUOL 1XGPA 4XMUA 4JG0H 1EH9A 1QRNE 1UD3A 3BGFB 2H9GB 3L4CA 1OWWA 1IU1A 3SKOA 5E6ID 3P3TA 5BS0D 2GPZA 5GS1C 5HYQA 1OPOA 1N5AA 3CK0L 4XNXH 4ZFFB 3PNWB 2JQMA 3DBXA 4BQ9A 4W6XB 3NSXA 3PJSA 2BFVH 1TETL 4PJ9D 4JB9L 2VQTA 4PGCB 3C09B 4DT2A 4PBXA 4Q2ZB 4IEFA 2B4CC 3APDA 3PXLA 4WJ5B 4L18A 4ANWA 1FNEB 2QGCA 4WEUD 4FMKA 4G43A 5BZWA 1QRNB 2DTML 3RL1A 2XWBB 1BQKA 1VADA 4GRMA 1F97A 1FCGA 4D0CA 5K1JA 4AQAB 4PY8I 3O2VH 4AH2A 4GKZA 1BZ9B 5DD0L 2DQDL 1HE7A 1NBVL 2WYTA 2E7CA 2WQUA 4AMWA 4YL9A 3JWNE 5I1CL 5ERWA 2P8PA 3EH4B 4OUUA 1QTYT 2XQ0A 4IRJD 2YPKB 1T89A 3Q13A 4UAHA 1KENH 2DLTA 3QA3A 5JDSB 2X12A 2P1YA 3K46A 3SDCC 4E5XB 2PO6D 1F1AA 3VXQA 5TTRA 1PG7H 1ZT7B 5A2FA 3D39A 4PG9B 1ZGLA 1T0PB 1JV5A 2HLEB 2O61B 3OZLA 3P9MB 2GIXA 4UUJA 4B5EA 1LILA 2ETWA 4F33B 2FJFB 2HTKC 4L1TA 5EO9B 4HXAH 5EU6A 1NDGB 3VFMA 5DJDA 1D5ZA 3TVMC 4Z3GA 4H8VA 4XOBA 2VQ4A 2CO4A 4X0NA 3SDCD 3DX8A 4LXFA 1DVUA 1MAML 4HF5L 1CE6B 1A3ZA 1XL4A 5AAMA 5KSAD 5E8PA 1B4LA 5F7UA 1AZNA 5D7KE 5JYLA 1OSPL 2XKNA 5CINL 2W95A 4M43H 3PGCB 4PJ8D 1MOEA 3SE6A 3RTQC 2RALA 2FECL 2W92A 5EBWA 1JHKL 4MWFB 3TBYA 2XG5B 3DX4A 3EJTA 1Q0YH 3TYGH 1KIRA 2A6KA 1S7XA 3V6OC 2YWZA 1J0HA 1FPTL 5J6HB 4WI6A 4IU2A 5CBEB 2FX7L 1F90L 3BKCH 1XT5A 1AZUA 2N4IA 3QEQA 4KRNA 1DFBL 4B3VA 4M7KL 2Y06L 1OCZB 2IDTA 3GBEA 3RPIB 3NSJA 4IOFC 4DP0X 2WSKA 4LSQL 4TKWA 4Q97A 3CZLA 5GPRA 4XP5H 1R5IB 5AOLA 4OGXL 5LB1A 1IM3D 1HL5A 1CGTA 1OARH 3Q43A 1AYOA 1I1CA 3OSVA 1WGOA 1DBJH 3RTQD 1FE8H 3PWJB 2FL5B 4H20L 5IG7B 1FFNA 1FZOA 1ZPLA 1A9BB 2ZZUT 3A47A 1VGEH 4ZJ9A 3EBAA 2ZYRA 3T2NH 4GO9A 1IZKA 1VCBC 2IBBA 3IB4A 1MCOL 1VFAA 1RZKH 3H4FA 4OZHF 3VMNA 5DMIL 1WBZA 4A1IA 1IGCL 4HSAC 1WC7A 3QHFL 5ITBL 3LOWA 3DX9A 4TUJB 1JG9A 3CFCL 1IKFL 1CFMA 2DQMA 4P2CG 3CH1B 1TO4A 2E3VA 3R1GL 1SJVA 1ZMYA 2HFEA 3S88L 3IJ8A 3KPRE 2QSCH 4GW1A 4MA1B 3I6GA 2IFFH 4JB9H 4WO4A 1I8IB 3L9EA 3A4FA 4M93B 4IDLA 5FPIA 1UATA 4UTBH 3WFCL 3OZKA 1IC4L 1TLKA 4FE9A 4QJ4B 3ZL1A 2EO1A 2LVEA 1RHHB 3V7AE 3TA3B 3ZKMD 4OLYH 1CXHA 2VW6A 2DTMH 1NOFA 3PHQB 2VLME 4FC3E 2ENJA 4YHNA 1ZOXA 1H8OA 5D7EA 4XE0A 2ZNXA 1A4KA 3FC8A 4IRZH 2ZWKA 1HSAB 3KPRB 4D3CH 1LEIB 1ORQB 2EIKB 3T4AB 4J3UA 3FO1B 1WPCA 1L0PA 2VZ3A 1TUPA 5DD5H 4S1DC 4BD4A 1VPOL 3CD4A 3QJHB 4UTBA 1SJMA 5I6MA 1CLZH 4YDKH 5K59E 3OKMB 3T2PA 3KL0A 2FSEA 2NY0C 1ZEAH 3G04B 2DMHA 4BSWB 2Z35A 1VFMA 1TQTA 5E8DL 1A3LH 1QBML 2F8XC 5HVWA 2V9UA 3RY4A 1FVCA 3EOTH 1O0VA 4N8VG 2I27N 2AGJH 3UMNA 1E6OL 2EDWA 4IRZA 2B14A 3EDJA 2VLKA 2Y9RT 4KMQA 3NH7L 3D34A 3IU3A 4JUSA 1QKZH 3DBSA 3I2CL 4PJXE 2FLRT 4NQED 1RD6A 1CE1H 4HC1A 4S1DD 1JWUA 4Y2OB 2Y4SA 1U8JA 2XA8L 2N1KA 4R5XA 1VKXA 4GB9A 4G7YL 5SX5K 4M56A 4YC2B 1T21A 2PWDA 1A8JH 4M6ML 5FXCH 2XZQH 3FOMA 4RMQA 4PJDA 1W0WA 1RJLB 4RSYA 4R0LC 2CDEA 1F13A 1OSPH 1YNKL 3IDYB 3JUZA 3P4NA 2YARA 2JELL 4ONGL 3S3BB 3U2SB 5AKSA 1JFQL 5IV2A 1JAEA 3JQOB 4HH9A 1NFDE 1YQ2A 1A6WL 1OF2B 4PJXB 5GGRA 4ATWA 1BDYA 1N9PA 4PB9L 1G7HA 3VH8A 3FB8A 3L3DB 3MRMB 1H3VA 5DJ2A 5JORA 1TJMA 3HS9A 3MUHL 2Y06H 3UZEA 4BZ1A 3BDYH 4LSQH 4RGMB 1OK8A 2NCMA 3B2VL 3RURA 2K9FB 1NM4A 3GSWB 3FONA 1U8HA 3RWGA 2YMOA 3WNKA 5F9JA 1KCSL 1MVFA 2CCWA 5LBGA 2GEEA 1NFDB 4N8CH 3BESR 3RA7L 2ATPA 4H20H 1TDQA 3BPNB 3AG1B 4NQSB 1T1WA 2HX7A 1F1DA 1G7IB 5HDQH 2NY2B 3PGDB 4EUPG 1CFTB 3WLWD 2WLJA 3BQUC 3F7VB 3R0MA 1YEIH 4PWKA 2YRZA 4Y5XC 3SKMA 3ZE0F 5FWQA 1LD9B 2NYZA 3BUPA 4TSCL 1VZIA 1T4WA 4ZPVA 5E1AA 4CKVX 2FR4A 3VRJA 1NKGA 1IBGH 3ET9F 4OF3A 1KLFB 3NZHL 3Q9QA 2YZ8A 3M1OA 3WNLA 5ITBH 4LCCA 2EIZB 4JRYD 1BBJB 5LNDA 3DNKA 4EI5C 4AJVA 3OMZA 4LLQA 4MAZA 1PW3A 1ZDQA 3ARRA 1FG9C 3QUXB 3BSHA 3LY6A 4KVCL 3TJPA 3FCTB 2GTZA 3S88H 2KZWA 2JB5H 3ELAT 2MFNA 1NCBL 5GGVY 1Q9OA 2I9TA 3PAZA 4OIIL 4JY5L 4Y2DC 4BXVA 4NOBA 2PXYB 4ZX4A 3DTXA 3EHBD 1ZHNB 3EBHA 3BQUD 4L9LC 5H2BB 4Z7VE 5HI5C 2E0PA 3FU3A 5E00B 2OTPA 1P7QA 1JGEB 3RB7A 4HFWA 4NQDA 1DQDL 4HKBA 1NMAH 4NHUA 3JTSA 3OLEA 2W81C 3ATEA 2VLJE 2GHZA 4N8UA 1QSFD 4AVHA 5HDRA 1KY6A 3KPMA 3MTXA 3LS4L 4JKMA 3CNKA 1VFBB 4JGNA 4WJG3 2XWRA 4KNSA 1MY7A 4G82A 1V7MH 3OAYH 3Q44A 5DLML 4IMKA 2VN3A 3ECQA 1XZ0B 3THMH 4LQFH 4QMEA 5FIEA 1IB5A 4Z7VB 4FNQA 3T3ME 2VERN 4NWTL 3C08H 3BYYA 4NYLB 5CEYA 3C60B 5EZJB 5HI5D 2ATAA 1P2CA 2VIRA 3VFOB 1A7OH 2VLJB 1AP2B 1BX2A 3MBEB 1KMGA 1G4RA 4FP8L 2JKLA 4APQD 2OYKA 3D7PA 2OMUA 5EFIA 5TPWL 2ED8A 2HWZL 3QQ4B 2JKRM 1ZXQA 3QJXA 3IAGC 4ODXB 1HE8A 5MEQA 3PCYA 4LLDA 2DI9A 4D0BA 4MYPA 1T83C 2Z1KA 1I7UB 3ILDA 3T3MB 3QJSB 4J3BA 5GSVB 3FTVA 1P69B 4KBPA 4P5MA 4GI8A 4LNRA 1AQDB 1GYCA 1XXDC 3ZOAA 3IDJA 4LOEA 5ELIA 1ILUA 3QI9D 4NP9A 1A2YB 3UAFA 2BC4A 4M6MH 2H2SD 2XN1A 4HQQL 5E9DE 1MFVA 5I76A 2NR6C 3HPLB 4JFXA 3JV5A 1XD1A 4KOCA 3LKQA 2Z8RA 3O0RL 2P8LA 3NCWA 4XBPB 4TL5A 2HZHA 3AAZA 4NUMA 3O3DA 4MB1A 4MZIA 4PTTA 1B9ZA 5EOQH 1FO0B 3RIFK 3U4EA 4Y5YA 2AJZA 2CK0H 4Z7IA 4AGNA 4PHZA 5C3LD 2W1NA 3AM8C 1U8NB 2YFNA 4Y4HC 2WXIA 1M7DB 4RFNB 5AW3B 2J1YA 2Z31B 3ABZA 4R7NA 5I8EA 1KEGL 3FAXA 4LSPL 3NPSC 2Y6TE 4DCQB 3LXAA 4KH2A 5E9DB 1BFVL 5C9JB 4L9DA 2EEBA 1I1AD 4QHMB 3EH5B 4I0PB 2MNUA 1INDL 5K9OB 3MRJA 4YEFA 3BD4A 4XAWH 5KZCD 1YUKB 1L7TH 4I18A 2FIKA 1FYTD 3BAWA 3RA7H 5HJBA 2QQQA 4JO2L 1ML0A 4KAQL 5BRQA 1QEWA 1IVTA 3KM1A 3EJPA 3HJ0A 4DAGL 1ONQA 3MUJA 4TF4A 2Q86A 5I1HH 4TSCH 1N2RB 2R2BA 1Z9SA 4YDMA 5DI8B 5BOJA 2GJJA 2V17H 4MYWB 1ZLDA 4HKJA 4N2KA 4DZ8B 2IH3B 4JJ5B 3VTAA 4M9OA 4ZQTA 3ARWA 3D9AL 1H9DA 1KTLA 4Q14A 4XMKH 2I32A 1JZ5A 1EBAA 3HMXH 1XIWA 1P9MA 2BINA 3CZFB 2QGEA 2Y72A 4U6VH 3FW6A 4YSEA 4WWPA 4B3EA 3K7UA 2BS8A 4HS3B 5L6YH 3MBWB 4ZUSA 2W88A 3W9DA 2QSQA 2NW2B 5F1IB 1AQMA 4TSAH 3ZIYA 2ALWA 3MRKA 1KTDB 4G8FB 1RKRA 3TURA 1O75A 2ZXGA 1RUPL 4MBOA 4PGJA 4UQ2A 3GPSA 3SHSA 1YJDC 4Y5VC 2XZZA 3QUYC 1Z3GL 5AZUA 3HMXA 1ZVSB 1XR9B 2OR8A 3X1NA 4RA0C 3OAZH 3C6EA 2VH5L 1IEBA 3SJVE 3QZWB 2FUQA 3U1QA 4FGMA 4HIQA 5EC2B 2F54D 4EN2A 4LHJB 2DIJA 4FYRA 4Y9GA 3DRQB 1X5KA 5ESAA 5DJ6A 2J6EA 3VYOA 4NWTH 3L4UA 1W0VA 3MXVL 2WO4A 5CCKH 3GMLB 1EHAA 2YC1A 4JRFA 5DQJB 3V4UL 4HDIB 1UWXH 2QGBA 2X4UB 2ZKYA 3Q8BA 2OYMA 4EDWH 4R97C 1URZA 1Z1WA 4J4PC 4ORZC 3Q1SL 4EBQH 3C9NB 2ADFL 3MCYA 3QUYD 1E4HA 2YOCA 3WIHL 1U0QA 1XGZA 4L4VD 4NKQB 2L4OA 4K8RL 4DGIH 1T7XA 3BT0A 3SJVB 3T5WA 3H8NA 1U33A 3HS0C 4TUKL 4NHCH 5D7IE 3CG8A 2BH0A 2B0SH 4LBEA 2O93L 2CXKA 1PLGL 1M6UA 5DJXB 3ZT7A 3QK0A 5EZOL 5JXAH 2X4QA 3QDJA 5CD3A 4UOZA 4N2GA 2QQNL 3QUZB 3N41B 5EU7C 1DJXA 2P9RA 4NPYB 1N7MH 4DUXA 4Q0XL 4YFEA 2NY3C 4MZRA 3IJHB 3WE6B 4J4PD 2P24B 2WP3T 3DGCR 2CKBB 5EEZA 1IKNA 4PJDF 3IJYB 5CU5A 4BFOA 1M05B 1QA9A 3RGVB 4H25B 4Z7UA 4C56D 3IDMB 5D7IB 2BIHA 2AXFA 3EYOB 4JGMA 5DK3A 1N5YL 2NNAB 2Z7UA 4YN3A 2VLLA 4O2EA 2X6MA 1FO0L 2LOEA 5L2KA 1KTCA 3MR9B 1G9MH 5FUCC 5TK4A 1KJ2L 4EN3C 3DYOA 1QYGH 2IGLA 4FFTA 4XNDA 3LIZL 1AGFA 1S5HB 2W59A 3E3QE 5EC1B 1BFVH 1OT4A 1WFJA 2L04A 2PW1A 2GK2A 3MACH 2DWEA 1C5BL 2NY3D 3PGFL 4JG1H 2V7NB 3VFUA 5JHDD 4HJ0C 3AUVA 5AB9A 1A14L 1AMYA 3FQRB 1QG3A 1T20B 2YUZA 4JM2A 3BP4A 1GIGL 2AK4A 1K8DB 3GXNA 4IKNA 4U1JB 4YX2L 3SGDH 4DESA 4FFYH 5IOPA 5DMKB 4OCSL 5D1ZC 3SO3C 1JZHA 3UZVA 2YKLL 3AREB 1PBYA 4DAGH 1OCRB 3DX6B 4G83A 4DKEL 4G7RB 1H3WM 2BDNH 3BO8B 4PJBE 5HI4C 3VSTA 2WC7A 4EN3D 3TBCA 1IBDA 1D7CA 1DEDA 1G6RA 1KGCD 3OKEA 1E3XA 4FZEL 4JN1L 5CZXC 3EAKA 4EQ3A 4F8OA 2GB2A 4M7ZC 5HTSA 5IB3B 3UJJL 2KBGA 1AOHA 4MA8L 3OGOE 3JWOL 1MFMA 4OKVB 3HG0A 3BP7A 1QFOA 1PKQA 3RU8L 4BFBD 1NINA 2DIAA 4FFYA 5FOBA 1FVDA 3GXIA 1WIPA 4YHML 3L4VA 5HY9B 1MCLA 2ADGB 4GAYB 2GUOB 1WHOA 3SCMC 1HZKA 3HVDA 3IM1A 4HPOL 2FNWA 4MJ4A 5D1ZD 4NUGL 5DHDA 1VHPA 4GP8B 4Z7WA 3D25A 1SNRA 4U1LA 4W70A 1QO3B 4N8VA 4PJBB 1CICB 4GJTB 2QTVA 4UT9L 5HI4D 5F7YC 1RUPH 2FT8A 3HLAB 4MJID 5FA3A 4DF9A 3WY3A 1J8HE 1IIIA 2FJUB 4QUOA 1Z3GH 2X10A 4NN7C 5IBTL 4WWKC 5C2UB 1KGWA 5B7EA 3T77B 1P5UC 2H3NA 4YHLL 3TO2B 2FQGA 4JZNB 3FTGB 2BS71 2IAMA 3SCMD 1J48A 4NX0A 3ML9A 1P7HL 3UTSA 1B0WA 4E41E 1PFOA 4AL8L 1UA7A 2WQWA 4UTAL 2XWEA 2KDYA 3II1A 1J8HB 1N3NB 1CLYH 2C9PA 2Z8SA 4U6XA 3WEXB 4U1GC 4JNXA 4MD5A 3K1DA 3FSWA 3RWCB 1MCEA 2OZ4A 1DO6A 2PWFA 1BQ5A 5FO7B 3BIKB 5I28A 4U2YA 2NXYC 4NNPL 5IB2B 1KJMA 1MCPH 4EUPH 3T2QA 3WTYA 1FVEB 1CURA 4TUKH 4FTVD 4GAGL 4PGDA 2Y7QB 3T0EE 4Z3TA 4E41B 5EZOH 3V6ZA 4GXVL 5ADPL 4G6KL 2QQNH 3M17A 2YN3A 2ARJQ 5KYXB 4UM9A 5EUOE 1ZE3C 4HXBL 1SEBB 1O6SA 4GAFB 2CNZA 1EHKB 3HZ3A 2H3KA 5DZLA 3EKCA 2RFXA 4UCFA 1EJ6A 5IBUG 3VXNB 4HV8B 2R69L 4EUPA 2GTQA 2OJ1A 4TNFA 2NXYD 4WEMB 4X8CA 4N3TA 1H15A 3L3IA 4XPTL 1CBJA 1F58H 1L7IH 1WK0A 3T0EB 2R1WA 1Q4NX 2VDPH 4HEMA 1OM9A 1JDDA 2KDGA 5ACZA 3HE6C 3LRHA 5F3BA 4K5PA 3MNWB 5IQ7L 4MCZA 1KJ2H 1HXMA 2IQAA 3WKML 4HLEA 2WVTA 5C07B 3I02B 1A6ZB 2EAEA 1NGXA 3BMVA 3U7WL 2X4RB 1E9OA 2VDQB 3KR3L 3CC5A 1OL0A 4JFDA 4JDZB 1IGFL 3PGFH 3PYCA 4NT6A 3ZL2A 4HWBH 5LO7A 1DL7L 1NDMA 5ESVA 1MFEH 2VAAA 3D07A 4FYQA 4C83A 5E6IB 1JPTH 1A14H 2IQ9L 3DRTB 5JHLL 5GSRA 1T03H 4YX2H 1THAA 4X99A 3NG5A 2DN7A 4L8SC 4UU9B 5CWSA 1EAPB 1I4FA 3EW3B 3N42B 4PJ9B 1P1VA 3B9VA 1NMBH 2XNAB 4KNQA 4DP9X 3DGGA 3OBAA 3BSZA 3SYPA 1JVKA 4LGPB 3GS4A 4YO0B 2XVKA 1UB5A 4GRWE 1CLCA 1N4XL 2I26N 2IF7A 4IBQA 5IROA 3UJJH 3KYAA 4HCFA 4NJ9L 5HGAB 3DVNB 1QR1B 1BREA 1MRDH 3QO1B 4OZ4B 4JR9H 2J20A 3MLRL 4EPSA 4GXUN 2K70A 3RU8H 4JY6A 3TYFB 5GS1B 5CR8A 1GW0A 1M71A 2ED9A 2UZYB 4HETA 4XNBA 1NAMA 1PG7X 3BJ91 3JXAA 3FT3B 3KCPB 2QPDB 1XF3B 4OCXH 3V0VB 5K9QG 1S8DB 2Q3ZA 3INOA 2DQ6A 1HX0A 3BZ4A 3FBQA 3SODB 4AYSA 3V4PL 3GSRA 1OZUA 1G43A 1JNNL 3MYJA 4I48B 4LLWA 5D2NA 4GRWB 1U58A 3OHXC 4DP5X 1YLBB 1I8KB 3U1SH 3FU6A 4OCLC 3LKSA 3M1BA 5JHAA 3KL3A 5IBTH 2AKRA 2Y5EA 4PR5B 1AI1L 1D6EB 3GGWB 3VRLF 3U0TA 3ILPB 3DSFH 4YHLH 2WN2A 4OGQC 3QIUA 1MI5D 2HPOA 4ZZKA 3ESUF 1OD7A 4HS6A 3REVB 5E95B 3ZQWA 2VM9A 1EIBA 1RJZB 5L88H 3WN5A 3RWJB 4P57B 1R33A 3DTUB 1Y0LA 4MDRA 2QMKA 5D7SH 4HK3J 2WB1A 4M7JH 1W9XA 5I0ZA 3SDCB 1GJUA 1S46A 3W0WD 4KKLC 5EF1A 2AI0L 1A4JB 2YIHA 2IXQA 2Y07L 1QRKA 1PG7W 4EKXA 3NFNB 3N5AA 4PJ8B 2JJSC 1DJIA 4NNPH 2V2TB 4IU3A 3MN8A 1GL4B 1YAZA 3MZGB 3DIVA 2EDBA 1MFBL 2HN7A 4OAWA 2P80A 5KANG 3V6OE 4ERSL 4L3FA 4F1ZA 2EACA 2ZXWB 1YN7B 1OB1A 3HI6L 1A4AA 2ESVD 4IK7A 4ZS6C 3CHSA 1Z0MA 1VF5C 2D7QA 2Y1VA 2N7BA 5B1CA 2FD6L 3O4OC 5A7EA 5EIIB 2OQJA 4U6YB 4CW1B 4KKLD 1IM3B 4XN8A 1ZHLB 2J8OA 3OQRA 4HK0A 5D4QA 4G6ML 5GS2D 1RZ8A 4QLWA 5ACLA 3K6SB 2F53E 3BAEH 1G7JA 1JN6A 3RTQB 4GP5B 1UM4H 3UC2A 1JI2A 4W9DC 3JV6B 1X5HA 4XPTH 5E1IA 3QDHA 4Z7UF 2HFGL 1WAPA 4JFHD 1KPVB 4LOFA 3TF7C 5GRYA 2Z92B 2R23B 5CUSH 2E47A 4WQOA 1D9KA 1H5BA 4ORGB 4EO5A 1CR9L 4X2UA 3SDAC 1HIMH 4GXFA 3NIGF 3HPJB 3E6HA 1CYGA 3ZRCC 4Z95H 3FOLB 3U7WH 1AGDB 1FJ1A 3KR3H 1X5AA 2BVOB 4ONFL 5EEVA 1FH5H 1E5YA 2VDQL 5ICXA 5KWYC 4V2BA 5GJTH 4LAQH 2F53B 2IQ9H 3NESA 1D5XB 2J43A 1T0NB 4JM2F 2V9RA 1WZMA 2WKOA 1WCBA 3REWB 2C7UB 1MHEB 3VYNA 5D1XC 5D70H 1OV8A 2BCKB 2HP4A 4MD0A 4X4XB 4P59L 5IUCA 2IDQA 1XXFC 3OC8A 3OJDB 3QZOA 5GHWL 1DVYA 5I18H 2KI6A 1B4JL 1OD9A 2A83B 2XKUA 3CPLB 2X4SB 5SX5H 3O2WH 3APNA 1UFUA 4NI3A 1E2VA 2FAUA 3LKPB 3VGDA 2ZOTA 1YEHL 3W82A 4G8EA 1BG9A 3NZ8A 4BIKA 4ELDA 3QG7H 2EZ0D 3DHPA 4NN5C 1F8TL 4XBEH 1CTNA 3WXVH 4M00A 5D2LA 3D4ZA 5CZKA 1CFBA 1DBKL 1DUYA 3V4VH 3PP4L 1Y18A 3FCUB 3FQXB 4MJ2A 3V4PH 4F58L 4OFQA 3TBVA 2BSEA 2B4CL 2WWKT 3S5LA 1FBIH 1PYWA 1JNNH 3ZXAC 2XFXA 1RZJH 4OTXL 3H6JA 4GEIA 1E5ZA 1U3ZA 2FJHB 1PZUB 2IPTH 4QRTB 3ZGHA 4LVOC 2CM5A 1F2QA 3NIDE 2E59A 3RFZA 1HNFA 3KGRA 4BE6A 2D3NA 2EH7L 2P26A 5DRNA 4HKZB 4TRPL 4OLZL 4OT1L 3S3SA 5ICYB 4DFHA 3UYRH 3HC0B 4BCXA 1C1EL 2H2PC 2JH2A 3C5SA 3PABA 4OCRL 3S48A 3V4VA 2V9TA 3CCHB 3QUMA 2NY0B 5BXFB 3NSCA 1JZGA 1BD2D 5GRUL 1TCRA 1ZS8A 2L7UA 5ENWB 1U95A 3ZL4L 5J7CC 5KJRL 4M6OH 4I2XE 1NAKH 1IBHA 3U6XA 2DIEA 3FMGL 1BEYH 3NIDB 5JYMA 2CHWA 4KZEL 2XBTA 4R7DA 3FFCD 2NY1C 4NO0D 3B2DC 5AQ0A 1KIPA 1LL1A 3PJNA 4F3FB 2YAOA 5E4IA 3KJ4C 4EIGB 5I16B 3FYIB 2CR3A 4HHAA 1I8MA 4K9JA 3O0LA 4HUXA 3HNTL 3WGVB 2H2PD 3S34H 3UXFA 5IK3A 4AG4H 5D4IA 3SE4C 1MW0A 2WAHA 4EJ1C 2R0WL 4TQEH 3W9EB 4I2XB 3G6JA 2FQFA 2FD6H 2NT0A 2DWDB 4R4BB 3WU1A 2WVVA 3N2JA 3BHBB 2DYPA 2ZF8A 4PJ7E 1J0IA 3Q6GL 4Y19A 1ED3B 5AOKA 1WBXB 3VFPB 3K71B 2NY1D 4ODTH 4PJHE 4QXWA 3HB3C 1A7RH 1M2VA 1XGQA 1AY1H 1SLXA 4ZUVA 2GQHA 2K3TA 3T4YA 3ES6B 4FHBD 4UQ3A 4YGAB 4NM8L 3WENA 4QHUB 4EI6B 1M1XB 4RX4D 2NYKA 3IJEA 4H40A 4YHKH 3FN0L 4MA3A 4N0CC 1X5GA 5EBLB 4AEFA 1J12A 4ONFH 4K7FB 4PJ7B 1QSFE 2YLKA 5D4HA 3X17A 2ENYA 1BFTA 1KJVB 3ARFA 4XX1E 4PJHB 4XMTA 2H4EA 2W9LA 4ZT1A 5EZIL 1U8LB 1VFOA 1LE5A 1C08B 1U21A 1T1ZB 3DX2A 4MVBD 3CPUA 4PWHA 1E67A 4HBQA 4YDZA 3WSQL 3O81A 5BV7H 5IJVB 3AWFA 3BQUB 4OQ1A 1DHKA 4W9ZA 3LQMA 1I9IH 2H0JA 4OZGE 3SGEI 2R1XA 4JVPA 1B4JH 2VABA 6CGTA 1G5AA 1YMHB 1RI8A 4XP1H 1QSFB 3U7YL 1XGRA 4ZMWA 1YMMA 3AITA 2ZCZA 1CL7H 1GSKA 1FORH 5DJYA 3GB7B 3MZTA 2WD0A 2HVBA 4WTZG 2WLYA 1PX8A 1AHKA 4MMZC 4XR8C 1R17A 4ECNA 1XBDA 2IEPA 2R2HA 3C8KA 4RZKA 1WTLA 4L9LB 1YZZA 5LNGA 3VXTA 1KB5A 5LGHH 5DK2A 4OZGB 4G3YL 4FXKC 3V5KA 3QG6A 5GZNA 3G5VA 4NAQA 1T0OA 2D7NA 1VACA 3HHSB 5D9SA 3EJUA 1FI8C 2BNQA 1CU4L 3ML8A 3VFTA 1B9KA 4M1CC 3MPCA 4RAVB 4APQB 3MLYL 1T2XA 2FEJA 1M6OA 3HEIB 1MJJA 4F37K 4JVWA 3JV4A 3PQYE 5F2FA 3MRPA 2D73A 2YHGA 3QCVL 4HZAA 4OLZH 3SD5A 4QT5A 6TAAA 2GJ6D 1R3LA 3FTYA 4K07A 1PY4A 3ZZ1A 4IS6A 2IOMA 1VFUA 3NEOA 5LAPA 1ECYA 5DHYA 3ZDXB 1MLBB 3VWJA 4LHUD 3MLPA 3UEQA 5H37A 5GRUH 5F8RC 3ZL4H 3QI9B 2EDOA 5TQ2L 1DJYA 4XC1L 3ZTNL 4ABWA 3ULVF 4J5VA 3ZVVA 1VZGA 3PL6A 1MCDA 1E8YA 4R7VA 5F0PB 4ZUTB 1TJIL 1ULVA 2CBMA 4DN4H 1ZHBA 1VRSA 2Z0UA 4KZEH 1KULA 5CJQH 1HHIB 4QKXB 3DO3A 1HILB 2QDWA 5FHBL 3BEWA 3QFDB 1FIEA 1TMCB 2W65B 4GQ9L 1HQRA 4OM1L 1ND0A 5CGTA 2QKSA 3WL9A 3GXFA 2AC0A 2B1HH 3HNTH 1BVNP 4MNHB 4GW5B 3VVWA 4AIOA 5EZLB 5DHMC 1ROWA 4P3CL 3GTNA 1CJYA 2NUTA 4N22A 1UT2A 3QCUL 4NNXB 3X12B 3GMMA 4WSJA 5B7FA 1B90A 4PP2A 2UYLB 2EDRA 4JREC 4X50A 4PCKA 3HKFA 4NRZB 2CLVB 1I1AB 2D03H 3RVVC 3Q01A 5HGDA 5EOCL 3Q3GB 4YLCA 4E0RB 4PCYA 1MWAB 1G84A 1NC2A 1FL5B 5KZCB 5SWSE 1LEKB 5IQLA 3RZCA 1DQJB 4FQHB 4AV4A 3T0WA 2ZX9A 1I3RA 1T3FB 4X5XB 2MHAB 1QI5A 1EZLA 1KXVC 3B9KA 4NM8H 1E8ZA 1FFQA 3BUBA 4Y4HB 2ENSA 2YPLD 3G5YA 4U1HB 4LF3B 4XNYH 1C16B 3NPSB 4WRLA 4BINA 5K9QI 1A9EA 2X28A 3L4YA 3VQ1C 4L4TA 3KWWB 3OKDA 1M2OA 2FDBP 3PV7A 4YDJB 3RVVD 1E5CA 3A6BH 1ECZA 3ULUC 5SWSB 2CRYA 1E3ZA 1OLLA 2A74A 2DQIL 3IMRA 5DS8B 4MXWL 4TTDC 1KYOK 3CZJA 3IK2A 3N9GH 4A1RA 2XN9D 4KGLA 5H94B 2WKOF 4JM0A 3RDTD 1H9VA 4I1NB 1HTYA 5T3XE 2F54E 4JKNA 2RCSH 4EQ2A 1Z5LB 1QPKA 1Q94B 4PJGA 5K9KB 1XF5B 1PLBA 3QJRB 1GTFA 4IBVA 4AGOA 5IJKC 1IC5L 2BHFA 3FFOA 1MFDL 3L3HA 3O6ML 4O58L 5F1OB 5LLIC 1GTNA 4AITA 3L54A 4NUQA 3QARA 1JCVA 4AMKL 2CQVA 5HPMA 4H2AA 3BH8A 2D0FA 4L4VE 3ULUD 1S7RB 1AS7A 1KJ3H 3EYQD 1UOWA 3D69A 1X4XA 4TTDD 4AW7A 5L4IA 2GYSA 1F6AB 2F54B 4HT1H 5ALCL 2V7HA 2APWA 5D2LF 1CFQB 3WTXA 3ATDA 3KVQA 3I75A 3LNDA 3L4XA 4Z7QE 4MQ7B 4Y5VB 3U0WL 4ANXA 3IFLL 3QUYB 4EOWL 4P23C 5SV3A 2X1WL 4KV5E 4L4VB 4WU7A 1XCQB 1S78C 3N1QC 2OI9B 4Y2NA 5J9PA 1KCBA 1PZCA 3TJHD 2AJYH 4JPQA 4P2QD 2YOAA 3C5ZA 5CJOL 3SZKC 5FUZH 5DGRA 2CSPA 2GG1A 1K4DB 4M5SA 1P6WA 5IVZA 3UAJD 1SJEB 5CD5C 5DHEA 1JYXA 1NC4B 1NCWL 5BO0D 1EUTA 4TMPA 5EU7E 5TQ2H 3ZTNH 4Z7QB 4GBXA 3U83A 4B97A 1VESA 5F9OL 1GKOA 5DHVA 4R97B 1FUNA 2R0KL 1JHLL 1JRHH 2G0LA 5JXEC 3S2CA 4ILDA 5KVFE 4RRPG 5JHDE 3VGEA 3WO3B 4AI7A 5HVHC 1ASOA 1YN6B 1CF1A 1K2DB 3F65A 3G9AB 5EO0A 1S78D 5EULV 4HCRH 1RJYB 4BKSC 4OM1H 4KQ4L 4Y7MA 1OGTB 4OSUL 1CDCA 4KKRA 2R59A 3TH2T 3HJEA 4MX7A 5FUCE 1ET8A 4N2LA 3OHMB 1Y07A 4Q8BA 1AR2A 4K3DH 1F4HA 4XRCB 2CDFB 4F9PA 1KGCE 2JTYA 3BD5A 1AC0A 3G6JF 2GEQA 2NY3B 1REIA 5JHDB 2ZTBA 4YQXH 2EEAA 2Z9TA 4UZUA 3CHPA 4MLIA 4CSSA 1AGBB 4S0SD 3FPXA 3MREA 1HC1A 3T6WA 4HCRA 1MWAL 4DKFL 4M3HA 1XQ4A 4HHWA 3IFOA 1RMFH 1T04A 5FW6A 4V1DA 1BMWA 4NERA 2I07A 4PQXA 4K71C 4Z18A 2C4FT 3TIEB 1UXWB 1LYQA 3DDGA 1TJGL 5D7LD 3BFQG 3QPXL 4BDVA 2X9ZA 4P3WA 1LXMA 5E2UH 3UJIH 4EN3B 4BRJA 3SYQA 4ZMLA 2BOCA 4YLQT 4N5UA 2AAVA 4U1SA 3G5ZB 8PAZA 4NUJA 2V3FA 3O3BA 2J6WA 2Y6SD 5D1QC 3VXRD 3T0DA 5CJ5A 2VR7A 1CIDA 3IS0X 2WZPD 4N0FA 2V33A 3P77A 5DTFA 2BRQA 5FA4B 4JFOA 1OCWL 4L8DA 2AQQA 4U4BA 1UXSB 4IOIA 5D1ZB 3SO3B 4DKAA 5FB8B 2MQ3A 1A1OB 4KFZC 5KBLA 5DR5L 1E28B 5CO1A 2DAVA 1MCQA 3GIVA 4QOKD 2X7LA 2FEDD 3VXUD 4DJMA 5C0AD 4UDTA 3FF7A 3FRPB 4QY8A 1MFDH 4J23A 5IUSA 2W07A 3QZLA 1DLFL 3ZO9A 5KBMA 4E9QA 5DGQA 5EDSA 3CFBB 1DQTA 2QR0B 2HJFB 4MB5A 3VFRB 4LDEB 4M8QB 5M7QA 1U8OB 3GBDA 4AXWB 2BP8B 4NAJA 1IL1A 3SCMB 2YA0A 5IVXE 5SWZA 2GAZA 4YBQD 4PG2C 1N8OE 3MKKA 2Z0BA 2DQTH 1FFOB 2H1PH 3ECUA 4WTXA 4G6FD 1PKOA 3HW7A 3F7YB 3KYOA 4D9QD 2XUWA 4IW4C 2WWOA 2QHRH 3K6NA 3QQ3A 1EEZB 4LZHA 3L7FB 1IV8A 2APVA 3U0WH 1B2WL 2EABA 3DWTA 3EGXB 1TVHA 1YJDL 2ADJB 2FT6A 4NN7B 1USZA 3IDNA 3HG1D 3II2A 3BFOA 2FATH 3NEXA 1A1NA 3B3IA 5BZXA 3SDXA 3UZQA 2E9GA 4PY7B 1P5UB 1HJCA 1EHLL 2AQNA 3MJ8B 1T7WA 4J8RB 4MASA 2HTLC 5IVXB 2MJWA 4HJGB 5B1JA 3M8OL 2HH0H 3RIFF 4Z3EA 3RIKA 2B77A 4MFHA 4QRBA 3TEXA 3KG5A 1RZGA 5CLYA 1ET5A 3L1EA 2VN5A 3IN2A 1GVIA 1CXKA 3N50A 4UQEA 4P46C 4C57C 3AZUA 4FX5A 3BN9C 2UXVA 2YLHA 5F9OH 2R0KH 2XZAL 3FQWB 2XOTA 3A4DA 3FQUA 3VQ2C 1KTBA 4FQ2L 4OLEA 5KVDE 1PZ2A 2NXYB 3VI3E 5HYJE 3NN8A 3H9SA 4XCNA 1T5XB 2HTLD 2O4EA 2SODB 5GGVL 5LBVA 2G5UA 3CX5K 3CC1A 2VJ0A 2XWJA 3ARGA 5J57B 3N3EA 3OAUH 3HCVB 2DJ4A 1ZPUA 3VG0H 3OXSB 5I6KA 3KGSA 4Z7OE 4Q74A 3QXTA 5HVFB 2JIXB 4WDIB 5I74B 3VI3B 5HYJB 2RA1A 5DQDH 5EWIH 3TH3T 5MI0C 3TZVD 4B0MB 2VT0A 3U36A 1TJGH 4IYKA 4A7TA 3QPXH 3IDGB 2CRMA 1A6TA 2VSDA 4XP4L 5C0JA 2JI3A 3UGUA 3ILEA 3HS8A 3D0LA 1L0QA 5SWQB 2ZXEB 4HU2A 4H0GA 3FO2A 4FLRA 4WTZA 4Z7OB 1FA4A 3D0AA 2FO4A 4QIRA 3CFEA 2G5BB 3DDFA 3LQZA 2X0VA 4PIRF 3FXIC 4K23L 3BZFB 4YDIL 4OI9A 4WIQA 5T1LA 4L8SB 4I3RL 4ICWA 1UH2A 2IG2L 4X8JB 5T33L 2E7LC 1MI5E 2O1AA 2YXMA 2OTWA 5KBKA 2ICEC 1AR1D 1QNZL 1OQXA 3UMTA 1AAJA 1UC6A 3IFPA 4KX8A 1ES0B 1IQDB 3BPCB 1FZKB 2ARJB 2X0WA 3CN2A 3WEOA 1JF1A 4O02A 2AJVH 1N6VA 1PSKH 43C9B 4PJGF 3INUL 3S8FB 2PABA 1LMKA 15C8L 3I6KB 3W0WE 5G2NA 1DUZA 5JMRA 4QXTB 3QWOA 5C0CD 1ORSB 1YNTF 1QVOA 4DTGH 4X6DE 1YYLH 1SOKA 4LKCB 4L3ED 2BX5A 1D5MA 3OLIA 4G8GA 4KJYA 4BQBA 4JHZA 1MI5B 1JGUH 3D18A 1H3GA 3OMAB 3QIWD 1ZT4B 4KXCA 5LCVL 1AD9B 3EUUA 4KXZI 3VRIA 1UHVA 4J3OC 1I53A 3AW5A 4R4FL 1ETZA 4AVJA 4D94A 1J8RA 1IAKB 2ICWJ 4M4RA 3CJJA 4PJFA 4IBZA 1QTSA 4MCMA 2ICCA 2FECI 4P04A 4U1MA 1OAZL 1RY7B 2ESVE 2J7LA 3C12A 5D7JA 3S4SA 3W0WB 1DQQA 3OHXB 1A9VA 1QZ1A 1W72H 1B2WH 4DETA 2ZXCA 4JANA 2VXQL 4X6DB 4AC4A 2IWFA 3QXDB 1J05A 3MX0A 1HCZA 3U2IA 1LO4L 1U8MA 2G60L 1OE2A 3MNDA 1INQA 3BAJA 1E7VA 1XDTT 5I1EL 1NCUA 2HLFD 4W9EC 5IMKA 3B4NA 5LGJB 5CU9A 1GRWA 2DF3A 4XCFL 5AVRB 4HOXA 2OP4H 4YHOL 2D7TL 4JRXA 3IYLW 3KEDA 4HCIA 2JXMB 4J3OD 4IKJA 3POHA 4X6EB 4BFNA 2ESVB 5CMAB 4ZW7A 3HI1A 1EVTC 4PJ5D 5ABAA 4OJYA 5A16A 4ZMPA 1W72A 4G7VL 3B83A 3WFDL 3IGAB 1JPFB 1Q8MA 3U0PA 3H56A 1U93A 2CWRA 5KVEL 2GY7B 2TAAA 1AZVA 1WA1X 3PP3K 4MRBA 1J5DA 2H0FA 4Y1AA 4N2CA 1ACYL 3ARBC 5E08L 1JGDB 1CVSC 2DEXX 1D3CA 2VDOB 3MTRA 2HT2C 5G55A 5E8EA 3HR5B 3AS1A 4R26H 4BH7A 4ENEC 5JIIA 3TTYA 4LOUC 2FQDA 3SYCA 4UNTA 3SZ6A 2H9GA 2R4RL 4V33A 2K9UA 4AGMA 4X6CE 1C5DB 1O5DT 3KPNB 4F8TA 1LM8V 4ZFFA 4J6RL 2YGPA 5FECA 4XVJH 2HJKA 3PNWA 3W5NA 2B9AA 2JJVA 5KVDL 1U41A 5DZNA 4ZZFA 4NC0B 4X5QA 3ARBD 3DPBB 4WJ5A 3QEUA 3NACH 3SGJA 1FNEA 4DOHE 2NLJA 5F88B 3P30H 5D1XE 1OW0A 3K5RA 3ASNB 4XP4H 4ENED 3PE9A 3NJVA 1QRNA 4LOUD 3FDWA 3QPQD 4KXBA 2XWBA 1RURH 3ESOA 1ANUA 1HN1A 2XY2A 4L5FH 4X5LA 2ZWLT 3GHEL 2YMTA 4JFZH 4F8LA 3LN9A 3UCRA 1PZDA 4H26B 4KXDA 4A68A 1BA9A 1WV7T 3EBIA 3ZKND 1BAFH 4DOHB 1AIZA 2F2HA 5D1XB 5IMOB 4Y7OC 4QRPD 5JDSA 4N68A 5J4MA 3SB3A 3CFDA 5FLUA 4I13B 1C7TA 2F58H 4E5XA 4X4YA 5BNXD 7FABH 4M62H 4TLSA 1ZT7A 15C8H 1A3RL 2WV3A 4KK5C 4NQCE 1D5IL 3UTTD 2ZOLB 4NP4H 3LRKA 5MP6H 3RTLA 3IKKA 3CDCA 4WCYL 3RWEB 4AIEA 2O61A 3DC0A 5KVGH 1NANH 3P9MA 5DUML 1NBYB 2DY2A 2FJFA 2WNWA 3E2HC 4JDVB 1DDHA 3NZUA 5IQNA 2R7EB 1IC0A 2C9RA 5EO9A 4NN5B 3RX9A 1IC7L 1M42A 2VC2B 5BRZE 4J27A 3CSGA 3K4ZA 3D2TA 2D4DA 2MRYA 5KN5B 3VD4A 4RRPA 5H35B 2MEJB 2ZUVA 3SDDC 1NA8A 1UWGL 4MXVE 4ZTOH 3IJSB 1H3PL 2AMGA 5AYTA 2VXQH 3EDDA 4NO0B 5LN4A 1H6FA 4OFVA 1ZV2A 1YQVL 4WFED 3CXDH 2YXWA 4E68A 3RJQB 3B9DA 3SDXF 5AW9B 2TSAA 1SLVA 2WANA 2X70A 5C0NC 5MHSD 1ZVNA 4BFIA 1MEXL 3PWVB 3FSOA 3RPIA 3FT0A 5IJDC 2FH6A 4UZGA 1HK6A 4E9LA 1BHGA 2FX8L 2V2XB 2VTFA 3FKUS 2WXLA 4MNQD 1R5IA 4KJPC 3ZO0A 3CHOA 4XZ4A 1Z9MA 4Y4FC 35C8L 4R83A 4Q52A 5AKTA 1E4XH 2CNYA 12E8L 4AEHH 2N1TE 1J9SA 2NY1B 1HCFX 3PWJA 1KCLA 1LQSR 2FL5A 4WUUA 4HIHB 3NCBB 2GITB 1A9BA 1NEUA 4KPHH 4FZ8L 3KJ4B 4YVUA 4JL2A 1M7XA 1TXKA 3Q2LA 1R3JB 4ZX3A 5C0ND 1QLRB 4FABL 3NCMA 2VDOL 3ECWA 4N5EC 4XPBH 4XPFH 4F27A 2R4RH 1UASA 4YHZL 4Y4FD 2IVFC 2DMGA 4MA7H 3EZ8A 1RUQL 3L4TA 4K94C 4A2EA 3HB3B 3MLVL 1JBJA 4ABVA 4LVNC 2CXGA 3HNVL 1MFUA 3LZLA 1EJ8A 1KACB 3PWUA 2VDLB 3KYMA 3OPZL 3W39A 1CYWA 3ILQC 1WRFA 3A67L 4MJHA 2JKSA 3SY0B 5DZVA 4TLUA 4PAZA 3TA3A 4N2BA 4M8VA 4IOSD 3LZFL 3ZHFA 1E27B 4JK0D 2XVLA 1LEIA 1GPOL 4FNPA 3HZMA 4LCUB 4MAYD 1JHTB 4BELD 5KSVB 5I5MA 1B6UA 4KVPA 4HUNB 3NSYA 3QJHA 3BC9A 3WJJA 2HUHA 4NZFA 2GJ6E 3OKMA 5EU5B 2KQMA 2VXTH 1ZLUK 1SFDA 2BVQA 3L9BA 4HX1A 2KHAA 1BLNB 4GKLA 2B20A 3WNJA 1IGJB 1HINL 1LP9F 4H8QA 1EHXA 3D0VB 3GRGA 1ZLVK 1ZWIB 4A04A 1A3RH 1U42A 1TSHA 5CCJA 1YEJL 1KZQA 4N6RB 1YPZA 1WICA 3FU7B 5DUMH 4K5NA 5FS5A 3Q2NA 5ECJE 3VWKC 1QSED 4Q9RL 1MHCB 2GJ6B 4HISA 1AACA 5LXVA 3MU3A 4Q6KA 1ITBB 1KIUB 2VUKA 4Y2OA 4LSVL 1FN4B 4XPHH 4JFYB 2I9LB 4MMZB 4N2FA 5B3NA 1RIVL 2HKFH 1UCTA 1EZUA 2X6UA 3IDXL 4Q56A 1IKOP 1V7NL 4JE0A 4LHUB 4GUQA 2K6WA 4FXKB 4PJFF 1HEZB 3U9UB 2IH1A 3MV7D 4YHPA 1YYCA 5EU3B 1TENA 2WSPA 5FYKE 1FNGB 5CJXA 1YQVH 4KX9A 1OF2A 3NJMA 1MG3C 3MRMA 2H32B 4X9BA 3AROA 4FAAB 4J3SA 1UACL 2HFTA 3AFLA 3AU1B 3W11D 2HX9A 4M4PA 4R2GC 1WLHA 3SBRA 3FFDB 4ZSOE 3QNXB 5MERA 2YPLE 5D93C 1PZ5B 4D0DA 1P4IL 5HP5A 2VDMH 5A2JH 5I15H 12E8H 1FL6A 3AT0A 2GI0A 3GD1C 5D6DC 4P3DB 1IE5A 4OLUL 4KDTC 1JTOA 4NQSA 4PPTA 5E7BA 2CMRH 3P3RA 2UY6B 1Q9WA 5CZRA 3UGEA 3PGDA 1CFTA 3VM7A 1F11B 3KS0H 4PCTA 1TFHA 2XN9E 5JIDA 3ZJAA 1D7DA 1LD9A 2CO3A 4YXKL 4FABH 2Q6WA 1AOZA 1HKLL 1KLFA 1NFIA 4ZSOB 3QULB 4FFWC 4GSDH 2YPLB 3NA9L 4KITB 4A7GA 4XWOC 1BBJA 4O2CB 1R5VB 3C5JB 1YC8A 5HD8C 3CSYA 1TPXC 4Y4KC 4YHZH 4WGVB 2FYYB 3VNZA 3QUXA 3FCTA 1UVQB 3MA7A 2CK2A 5D5ME 4JQIL 2LE9A 3V79C 3VACA 2HKAA 3ULUE 5TF0A 3HNVH 3ARYA 1P7KB 2KUTA 4PLKC 2XN9B 4LDLB 1ZHNA 2Z8WC 1UM5H 1X5FA 3CFNA 3OPZH 5GS0C 2VDLL 3B5TA 3S6CA 4CNIB 1OGAE 2JK5A 5CEXB 4FQIL 1JGEA 1G1OA 4HUVB 1CXIA 4OD1H 5DF0A 3AG3B 1UJ3C 4P99A 4FFWD 2JV6A 2HKHL 2ZXBA 4K2UH 2NY5L 4DN3H 4R90L 3EG9A 5CLZA 5F9DC 5HD8D 5A2LH 1ZJBA 1BQLH 3GSNB 4IRSA 5L8JB 3VXSD 2K3HA 4H88L 4XZUB 1MW2A 2VL5B 2NY4D 5SX4I 1BVNT 1XZ0A 3ZDZE 3WAJA 5KW9H 1AFVH 4WKZB 1A7NL 2XY1A 4PLKD 4ZQKB 4Z7VA 4P2QE 1J5OH 4NYLA 1NBZB 3NABL 5EZJA 5ES4B 1EMTL 5CXPA 3HZYB 4NKDB 2ZUUA 5E8OA 3MBEA 4HZLA 2YSTA 3WIHA 5DZOA 5DUBB 3VXOB 5BUPA 1A64A 2NSXA 2BWQA 4KJWC 5EA0H 1TITA 2DM3A 1JMZA 3NCJL 1YEJH 3MV9D 1Y1DA 2XACC 3FT1A 4YDVA 3NSFA 1FV1B 5I5RA 4KO5A 1QBBA 3D08A 4QRRD 5GQBA 3ESNA 4LSVH 3MRRB 4P2QB 3HG4A 3BPOB 4FI8A 43CAB 3MRHA 3MRFB 4UINL 3HAEG 5DRXB 5I1GL 3QT2A 1JPGA 2FUTA 5LDUA 3SQBB 2V5SA 3MRQB 4ZAKD 4XBPA 1GXEA 2QL1A 1CT8B 2ZKWA 3O8XD 3B1TA 1EAJA 1YSOA 5KYWB 1NDTA 3BUTA 1QQDB 5IB5B 5GGQH 1FO0A 5ESQB 1LTXA 4A6YB 1JCKA 4D9RD 1KCRL 1U8NA 1P4BH 4Y16C 3WY1A 4F2FA 1YRKA 4MJ6A 4DCQA 2VLRE 1ID5I 3I9GH 3NYKA 5E9DA 5ITFA 5C9JA 4YAQB 4ANUA 4DP7X 1RUML 4QHMA 3CLFL 1W15A 3EOAA