5E0HA

1.95 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (18-mer) inhibitor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
166
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Norovirus 3C-like protease
total genus 39
structure length 166
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0hA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0hA01
3A7VA 5A0BA 1A2CH 2Z7FE 3C27B 4NA7A 3U9AH 1P09A 1DWEH 4I8JA 1OOKB 3M3VA 1HGTH 1SGDE 3A7WA 4X1SU 1SI5H 4AYYB 1GBJA 1EPTC 4NWLA 4ABDA 5LPRA 1OXGA 1CA8B 3GY6A 1GHWH 3ZZBA 4FXGH 2AGIX 4IN2A 3MH6A 2XBXA 3ODFA 3RXGA 2XC4A 1EAUA 2LNCA 1MAXA 1W12U 2ZGHA 5JBCS 3RXJA 1AZ8A 4TPIZ 1LHEH 3SJ9A 2QV1A 2SGDE 1W0ZU 3BG8A 1FXYA 1JRSA 2H5CA 3SOSA 1W3CA 2F9UA 4INHA 4LK4A 1ELEE 3T62A 3AW1A 1TOCB 1EAIA 1VZQH 3BTHE 3PLKA 3FVFB 2OBOA 1GI2A 3HATH 3BEFB 2B7DH 1CGJE 1N8OB 1C2KA 1LHCH 1P0SH 5ESTE 3FZDA 2ODQA 2ZHEH 3H5CB 3DFJA 3AAVA 2XWAA 1DE7H 2AIQA 4ISOA 1AVXA 2RDLA 1FNIA 1GJ7B 3LH3A 3VB5A 4XDEA 3ZZ8A 3SUGA 1ZGVA 2P3FH 1EXFA 1C5OH 1RRKA 3UIRA 4AG1A 3TU7H 2EEKA 1QJ7B 5F6MA 3NK8A 1SHYA 4Y76A 1WQSA 1GMDF 1O0DH 1NFUA 2ZA5A 1C5XB 3BTEE 3OSYA 3KQCA 1DVAH 3PO1C 5F8TA 3SJKA 1K22H 5B6OA 1C5VA 1FIWA 1QFKH 1O2VA 5HM2A 1SC8U 1TQ7B 2BD5A 1BCUH 3STJA 1O3NA 4ISIH 1M9UA 4I32A 3CENA 2PUQH 3ZZ4A 1JIRA 3P8FA 4LOYH 1EZUC 2ESTE 1WAYB 1EKBB 3RLWH 5EXNA 4ZMAH 2ZFSA 3D49H 1P3CA 3LIWA 1TONA 2G4UA 1ZHPA 1O2TA 1W13U 2GX4A 5T6FA 1HB0B 1TMUH 2J94A 4I33A 4YM9A 1C2EA 3VFEA 3A80A 1W14U 1MKXH 3S7KB 1B5GH 1BRAA 1GBFA 1ZPCA 5AF9H 1XX9A 1GMHF 1Z7KA 1H1BA 3BEIB 4CRGA 1GBDA 1C2HA 1P06A 4OS5A 1LHFH 1VJ9U 4DOQA 4X8VH 1P01A 3HKJB 1ZPZA 2AGGX 2FTLE 1PQ8A 1FMGA 2Z3DA 1C1PA 5GXPA 4I8HA 1G37A 2NU1E 2GVFA 1CHOG 3UWIA 2FI3E 2ZDNA 2R0LA 1O2UA 2CF8H 1WQVH 3M7TA 1AFQB 2VWLA 1O2GH 1S85A 1V2TT 1O5CB 5E0JA 8GCHG 1GMCF 1W7GH 2F9NA 4UFEH 3UNQA 1FZZA 1QCPA 3PLPA 4WJG2 3ZVAA 3AW0A 3D62A 1G9IE 1YPKH 2A4GA 4I7YH 1NM6A 3QUMP 1ZLRA 4R0IA 1PPFE 1TRYA 1MZAA 2A7CA 1MUEB 4YT7H 2BY5X 1UTQA 1AUTC 4ESTE 1TNKA 1BITA 3TNSA 2A45B 1YBWA 1AE8H 1TMTH 2C8ZB 2J34A 3RXMA 1G3CA 1XXDA 3LGVA 2W3KA 2BY8X 1NN6A 1V2MT 3MU8A 1DS2E 2ZHWH 4O3UA 2CMYA 5FBIA 1C4U2 1KTSB 2B9LA 2C8WB 4ABIA 4LZ4B 1GI4A 2UWLA 4K1SA 2BXTH 2GT7A 2QXGA 4X2WA 5EODA 1SFQB 2HRVA 3MNCA 4BTIB 1FY5A 1A5HA 2R2MB 3T28A 1CT2E 1DFPA 2C90B 1YKTA 1GJBB 2HALA 2OXSA 2B0FA 3GY5A 3SUEA 2SGFE 1V2WT 3LGUA 2QF0A 2ZTXA 3ESTA 3IWMA 2BD8A 5A0AE 3UOUA 5LGOA 2IPHA 4DURA 1B0EA 5C1XA 4MQAA 3S0NA 7GCHF 2XW9A 1Z6JH 2VVVA 2AIPA 1DLEA 7ESTE 3A8BA 1FAXA 1G3DA 1A3EH 1SR5C 1UVOA 1PQAA 1BBRH 3A84A 1SGRE 3MOCA 1ETRH 3RXAA 1AB9B 1KXAA 1T4UH 1MAYA 1V2ST 1V3XA 4JCNA 1ZJDA 1LMWB 2GZ7A 4AN7A 1O2HA 1SOTA 4NZLA 3T26A 3Q00A 2C4FH 1T8LA 3AVZA 2WPMS 1C5YB 3SUFA 2ZCHP 3ZVDA 3IG6B 3WY8A 2OC8A 5C5OA 2ZHQH 3ZZ5A 1BTHH 3E8LA 1BMAA 1BTWA 1CBWC 4JMYA 1FDPA 1BUIA 1BB0B 1MQ6A 3RXCA 1SVPA 2A7HA 2VINA 1PQ7A 2XBVA 1PPCE 4ZH8A 1HAGE 2VNTA 1V2KT 1HNEE 1BMMH 2G4TA 1K21H 4Y8YA 3LGTA 1HAOH 1ZSJA 5FCKA 1VCWA 1WBGB 2G5NA 3SNAA 1UCYK 2BY9X 3PWCA 4IC6A 1C5ZB 2VGCB 4ABJA 1XMNB 1PYTC 3UR9A 1C2LA 1A3BH 2BQWB 1LDTT 4ZXXH 3OYPA 1S83A 5FCRA 1C5PA 1V2OT 3U8RH 1HJ8A 2WUBA 1QQ4A 3OTJE 4R8TB 5A2MH 1KTTB 3M35A 1GJ5H 1AN1E 1Z1JA 4AG2A 1CQQA 3Q77A 1FPHH 1Q3XA 3SW2B 5DP3A 1TPOA 4LXBH 1Z8GA 3ITIA 4BAOB 3ZV9A 3JZ2B 1C2FA 1LO6A 1Y3UA 4GCHF 3S7HB 1LPZB 1Y5AT 2P94A 2HLCA 1HAZB 1ANCA 1EP6A 1VCQA 1FV9A 1O5EH 4NFEA 3RP2A 2VJ1A 3SU5A 4CHAC 5A8XA 5EQSA 1XVMA 4AGJA 3ZZ7A 2RG3A 5G4BA 1ESTA 3SUDA 1IQLA 5I25A 5GCHF 3E6PH 1HAPH 1C2DA 4OGYA 2CN0H 4WMEA 4DT7B 3FZZA 1OS8A 4RN6A 3RXUA 4BAHB 2BZAA 4BAKB 3B23B 1SLVB 3PYHA 1DXWA 2R0KA 4ABEA 3F9FA 3GY3A 4MNXA 4BNRA 4JZEH 1K1OA 3JZ1B 1ORFA 3TJOA 1Z71A 4AFSA 9ESTA 1OKXA 5EXLA 5AVDA 1C2GA 4GPGA 1SB1H 1KXBA 1MQ5A 1TGNA 2ZPSA 3PTBA 2O8UA 3URDA 2RCEA 3BV9B 5FAHA 2HNTE 4SGAE 3BTQE 1MMJN 2BQ6B 3SZNA 2C8XB 5C67A 1W2KH 3TH3H 4WWYA 5JB9S 3ZZ9A 5L2ZH 1YP9A 1YM0A 1BZXE 4OS4A 1EASA 4ABGA 1W0YH 1OWEA 3SI4H 4B2AA 3VGCC 3AASA 2BD4A 4NGAH 1TBRH 1GI6A 1MCTA 2CJIA 1ZR0A 4JZDH 4DIIH 2A4OA 1BTPA 1MZDA 2C93B 1KYNA 1NY22 1ZHMA 1TOMH 3BF6H 3RMNH 4A1TA 1O2JA 3UUZA 1T7CA 3M5OA 3ZZ6A 1CGHA 1D4PB 3QK1A 1A0LA 5BRRE 1SLXB 2WPJS 4MNYA 3U1JB 3MU4A 1ELBA 4X2YA 4CH8B 3QLPH 1GI5A 4AB8A 1ZYOA 3QGJA 1DOJA 2WPKS 1Y59T 2BX4A 2Y80A 1DT2A 1O2MA 5JBTA 1RGQA 1LPKB 1FY3A 2BOHB 1TAWA 4FUCA 2ASUB 4AB9A 1DSUA 4QT8C 3TPIZ 1EPTA 4MPUA 1CVWH 1BJVA 1SGFA 3RXSA 3OX7U 2XNIA 4GHTA 3TK6A 2G52A 3RUOA 1O5GH 2Q6GA 4B2CA 4FVBA 3BG4B 1C1OA 2ZGBH 1G32B 4JZFH 4K2YA 3GCTG 5EW1H 3K2UA 1UVPA 3DA9B 3KEEA 1DSTA 2W5EA 1ELVA 4Y8ZA 1H4WA 1V2LT 2PWXA 1TX7A 1F0TA 1FPCH 2GD4B 1VJAU 3M7QA 1QRWA 1QL7A 1DICA 1KY9A 1TYNA 1AFEH 1LCYA 4BXSA 3E91A 1ID5H 4CBNA 2GT8A 5GIBA 1L1JA 2FX4A 3VGCB 4Y71A 4XBBA 1TFXA 4TWWA 3CP7A 2SFAA 4CHAB 1ZGIA 6GCHF 2XXLA 4SGBE 3KIDU 5GJ4B 4KELA 2BTCE 5TJXA 1TPSA 1QBVH 5C2ZA 8ESTE 3RXTA 1LVBA 4NG9H 3HGPA 1WV7H 1TMBH 3SV6A 3NUMA 4Q7XA 1UVSH 4TWYA 3SJ8A 1B7XB 1MKWH 3RXDA 2VH6A 4UFFH 2F83A 1BIOA 1PJPA 2W26A 4YTAA 4AOQA 1O2ZA 2AEIH 3TITA 3DT0H 1J17T 3M5NA 1IAUA 5HYOA 2ZHDA 5EW2H 1GDNA 1AY6H 1N8OC 3PMBB 5CMXH 1ANBA 1AZZA 2P8OB 1TWXB 1Q2WA 1P2MA 1BDAA 3GDUA 2C3SA 2VVUA 5H4IB 2BDAA 3ZZDA 1O2WA 1THRH 1A5GH 1V2NT 4NSYA 3HK6B 5EG4A 1TGCA 1GHZA 3RLYH 3SV2H 4E7RG 1NROH 1O3FA 3TJNA 4JZIA 2QYIA 1HBTH 4H6TA 3UWJH 3MU5A 3LT3A 2BLVA 1AVGH 1DITH 4K3JA 3RXOA 4D9RA 2ZCLP 4UFDH 1N6YA 1Z8JB 2O8WA 4AORA 1FY8E 2QN5T 4D9QA 5JYIA 1ELTA 1UHBA 1H9HE 4BANB 3MMGA 4UONA 1J8AA 1ANDA 3PV4A 2J2UA 4YO9A 3ATKA 3UY9A 1KXFA 4YT6H 1IOEA 1X7AC 2SGQE 3C1KA 2RA0A 9LPRA 1NU9A 5A8YA 1P04A 1H8IH 1C5UA 1C5LH 2RA3A 1L1GA 1GBCA 3VXEH 1LPGB 2G5VA 4XOJA 1WOFA 1SLUB 4BTUB 1DXPA 3KQEA 4MLFB 3TGJE 1NRPH 1LTOA 1GBTA 2P93A 1FONA 1TGBA 3KQDA 4J2YB 2BX3A 1LHDH 3ATIA 1O31A 1SGQE 1ZMJA 1IQJA 3GCOA 3FANA 3NPSA 4MPWA 3DD2H 5L6NH 1S0RA 3P8GA 1QTFA 1QR3E 3QZRA 2Z9IA 3I29A 3RMOH 2CHAC 1O32A 4UD9H 1SOZA 2KAIA 1VITF 2BLOA 3QTOH 2QGRA 2R3UA 3ZVFA 1S81A 1NZQH 4GSOA 3LKWA 1KXEA 1ZSKA 1K2I1 4Y8XA 1AKSB 1SQAA 1YLDA 2Q6DA 4Y7BA 2ZDLA 2A4QA 2FX6A 2P3TB 3RXBA 3KN2A 2A32A 3HKIB 4GUXA 1JRTA 2FS8A 3KHVA 4K69A 1TB6H 2CF9H 6LPRA 1YLCA 5I46H 4MPXA 3RXKA 1UK4A 4IMQA 2BQ7B 3M3TA 1LVYA 5E2OA 2HPPH 2BDYA 1T31A 3TH4H 1O30A 3SN8A 3P70B 5EQQA 3T29A 3MH5A 3S9CA 3LOXA 1FLEE 4DIHH 3GY2A 1N1LA 7GCHG 1L4DA 3VPKA 2JKHA 5ABWA 3LJJA 2JETB 2ZQ2A 1TIOA 1LHGH 1MU8B 2Y81A 1IQIA 2BVXH 4UEHH 4NCYA 1EZXC 3SV9A 1IQMA 3F9EA 1QBOA 2H9EH 3LGWA 2DE8A 4RKJB 4GAWA 1S82A 3RXRA 1FI8A 3SQEE 2QXJA 1P12E 1OWHA 1VGCB 1LVOA 1WSSH 1Z6EA 2UUKB 2W7SA 5F8ZA 1K1LA 2UWOA 1G2LA 2H6MA 2UUJB 4NZQA 2OC0A 4WVPE 2Z9GA 3SGBE 2F9VA 1DY8A 1OP2A 3SJOA 1K1JA 1MKWK 1JIMA 2XCFA 3BG4C 4CBOA 3V3MA 3SGQE 2PGBB 3A87A 4B74A 4X8TH 5JBBS 1P03A 3VB6A 1C4Y2 1A7SA 4A1VA 5TCAA 1RTFB 4NWKA 2JH5D 1MTVA 1AI8H 1O2LA 2VWOA 1GJCB 3SHCH 4IMZA 1D3PB 2F9OA 3PB1E 1GHXH 2F91A 2WPHS 4IW4E 4I8GA 3GISB 2GZ9A 1FY4A 4ZAEA 5DG6A 4Q2KA 1O3BA 4I8LA 2V0BA 3A7YA 2A31A 4DCDA 1IQNA 2FXRA 1E35B 1V2RT 1UCYE 4YOGA 1AWHB 3A7XA 3EQ0H 2WPIS 3O8CA 4GHQA 3UR6A 1OSSA 3I77A 1KDQA 5E0HA 3EA9A 1XKBC 3EA7A 2FYRA 4U01A 2EI8A 2ZG0H 1NS3A 3P6ZB 1NU7B 4WXVA 1GHAF 1GBHA 2PW8H 1CHOF 3E16B 2G81E 3NXPA 4ZROA 1C4V2 2OQ5A 1QBNA 2QF3A 3QZQA 1C5QA 1UK3A 2SGAA 1TRMA 4ASHA 1O3OA 8GCHF 4ABBA 1IQKA 1QY6A 1BT7A 2FOCA 3MH4A 3RC4A 1GBMA 1E37B 3ZVCA 1GJ4H 1NFWA 1HAIH 5DP4A 3RMMH 1T8MA 2OD3B 1K28D 1O5DH 4B76A 2PKAB 1YF4A 1HFDA 1TBQH 2VWMA 3E1XB 1UVUH 2VIPA 3T2NA 4O3TA 1VITH 1UTKA 1P11E 1AQ7A 1RXPA 4JYUH 3TK5A 1GVZA 3SU0A 5EGMA 2AYWA 4JYTA 1KXCA 1K1NA 3MI4A 8LPRA 1IQFA 5CHAC 3RMLH 1EJNA 2WV5A 2GCHG 2AGEX 4YOJA 1GMCG 3FP8E 4NA8A 1AB9C 4Q80A 1SGPE 1CA0C 5GPIB 1HAVA 4U30A 4ZKOU 1KLTA 4TY6A 1C5NH 2EA3A 2CGAA 3ATMA 3F9GA 2QY0B 1S6HA 1F2SE 1L0ZA 2B8OH 1XUFA 2VIDA 4Y11E 1GBEA 1ZRKA 2ZKSA 3GDSA 1O35A 4XBDA 1GBIA 2NU0E 1NTPA 3NCLA 5GDSH 2OCVB 2G8TA 1TNHA 3A8DA 2H1UA 2A1DB 2R3YA 1YGCH 5T3HA 1F7ZA 3Q3KA 4NFFA 1P2QA 1WU1A 1GHBF 5EU8A 4CRCA 1AWFH 1MTWA 1YYY1 3HGNA 4B71A 1J15A 1GGDB 1SGFG 1JXPA 1HRTH 3ZYEA 4Y10E 3FP7E 1C1MA 2PSXA 1DX5M 2LPRA 4A6LA 5L30H 1V6DA 4ABAA 2GV6A 3BIVH 4JK6A 3R0FA 2FOFA 3E0NB 4K8BA 2ODPA 4AYVB 2A2XH 2WUCA 4Y79A 4ZHLU 1GI1A 2HGTH 2Z3CA 3UTUH 1JBUH 4E06H 3UQVA 1CT0E 1HYLA 2BB4A 3KF2A 3LC5A 1NRQH 5E2PA 1K9OE 1GCTC 2OBQA 3SNEA 1OYTH 3TGKE 1HJAB 3M61U 4K60A 5JB8S 4CRAA 1CBWB 2Y5FA 3QDZB 1RIWB 4OS1A 1UVTH 1ZRBA 3P8OA 3SU3A 1AHTH 1NT1A 2AERH 2AFQB 1A1RA 2BD2A 4DGJA 4F4OC 4FUGA 1UCYH 1GMDG 3TJVA 3A89A 2GMTB 2CV3A 2CXVA 3NWUA 4JK5A 1C2IA 1QQUA 4HFPB 5TCCA 4Y0YE 4DY7B 1Y5BT 2V35A 3ZYDA 1DDJA 1RD3B 3PMJA 1PYTD 1HIAB 1L4ZA 2GDEH 1Y3VA 2A7JA 5HM9A 1O3IA 4FU8A 2IJOB 2V6NA 1F0RA 4X6MA 1YPLH 1GBAA 3MHWU 3ZV8A 3V7TA 3A8CA 3S69A 1B0FA 3GCHC 1O2QA 1YPEH 3BSQA 5FPTA 1YCPK 3ODDA 2ZU3A 1ARCA 3RC6A 1O3HA 2FOGA 2I6QA 1LQDB 2ZQ1A 2PFEA 4ZXYH 2TGPZ 1OWDA 1RFNA 1TX6A 4ZKRU 1NO9H 1ELFA 1ZTLA 1P05A 3LDXH 3MO9A 1BHXF 2FWWA 3D23A 3BTDE 4TY7A 1CA0B 4IGDA 4J1YA 3UNRA 3K6ZA 2HPQH 2ZFFH 3H7OA 2FMJA 5ESBA 4B75A 3RXFA 1MKXK 5CHAB 2ZF0H 3MWIU 2FOHA 1KLJH 2K1QA 2Y7XA 3EGKH 4GCHG 2HNTF 3GY7A 3MO3A 4BAMB 5EQRA 1GHYH 1YC0A 1YCPH 2FS9A 2Z9KA 2QXHA 2FM2A 3PWBA 4NIWA 5ETXA 4I8KA 1NPMA 1T8OA 5T6GA 1RJXB 1CU1A 3GCNA 4VGCB 2PV9B 3EE0B 1AE5A 1W7XH 1C1VH 2GV7A 1XUGA 4I31A 4AX9H 1BOQA 1G30B 4A1XA 3UPEA 5EXMA 4DG4A 1ANEA 1ARBA 1O3CA 3FFGA 4HTCH 4H42U 2QIQA 3P8NA 4A92A 3K9XB 2WV4A 2F3CE 4FUHA 1DY9A 2H9TH 3O8DA 6ESTA 1YCPM 1XKAC 3SJIA 3ZVBA 4X0WU 1UTPA 1F5RA 1MD8A 4RSPA 1YPJH 2SNVA 3F6UH 1O2KA 2JH6D 1D6WA 1SQTA 2D1JA 3BN9A 1QA7A 1Y5UT 1NESE 1C1NA 1XUIA 1G36A 2BDIA 4WH6A 1HJ9A 5DP8A 2ZC9H 5K0HA 1QJ1B 1TPPA 2FYQA 3KGPA 4U2WA 1C9PA 2VH0A 4JYVH 5SGAE 4RKOB 1GBLA 1GCTB 5BPEA 4MTBA 3T25A 4XFQA 4XBCA 1NRSH 2QXIA 2VWNA 3KL6A 1P2JA 1J9CH 1C5SA 3TK9A 2J92A 3V13A 2ZECA 4Z6AH 1C5TA 2OTVA 1EB1H 2FEQH 4OS2A 4MVNA 2PGQB 4DVAU 4FVDA 2ZFRH 1BBRK 3U8TH 3M36A 1GI9B 1V2VT 4X6OA 3QN7A 3TVJB 3ELAH 1YPMH 4YESB 1K1IA 3QTVH 2UUFB 1TBZH 3ENSB 2PTCE 3KCGH 2BMGB 1SGYE 1C1QA 4IN1A 3U98H 4DW2U 1T8NA 4X2XA 1O3GA 1Z8RA 1L2EA 3SU4A 2Y6TA 1A46H 4X1PU 1DWBH 3GYMA 1RTKA 2FPZA 1TPAE 1FUJA 2ULLA 1EAXA 1MTNC 3LGYA 2BLQA 1Y3YA 4WF8A 3T27A 1IQEA 2F9BH 5EPNA 2HVXA 2Y5HA 3VB7A 1PFXC 1MTUA 2D8WA 3QWCH 1GHVH 5IYTA 1TRNA 1KXDA 1P57B 3W94A 1FN8A 4FU7A 2G00A 3O8BA 2O8LA 1KIGH 1HIAA 1O2YA 3TH2H 1A0JA 5J4QA 3ZZCA 1SMFE 2BXUH 5HMAA 1THSH 2W3IA 4MDSA 1FQ3A 1MU6B 4AFZA 1YPGH 2UWPA 4KTCA 1F92A 1GL0E 3N7OA 3DFLA 2P59A 3M7UA 2BD7A 3SI3H 1CGIE 1ACBE 2NU3E 2ZGJA 2OP9A 8KME2 1NC6A 1P8VC 3RU4E 2BVSH 1WTGH 5DJ7A 2VB0A 3SO3A 2WYGA 1O2RA 2NU4E 4GLYA 6GCHG 3RXQA 3GICB 3MH7A 4HZHA 1V2PT 2TGDA 1ABIH 1H9IE 1G3BA 3L3TA 2DE9A 2YNAA 1GDQA 3MU1A 2QA9E 1GI0A 5AFZH 1OX1A 4NIVA 1A0HB 1IQGA 1ZTJA 4U32A 1QURH 4O97A 3A7ZA 4MNVA 1P2OA 2ZU4A 4KP0A 5C20A 1BQYA 2FDAA 4GVUA 2BD3A 5GWZA 2TIOA 3RU4D 2ODYB 1DPOA 2ZI2H 3EYDA 3TLOA 1DUAA 2B5TB 1SG8B 3W95A 1BRUP 1GHAG 4E05H 1C2MA 1YPHE 1C1RA 2CHAB 3OY5U 4K5ZA 4Z0KA 1EUFA 1EAWA 2FESH 3Q3YA 2Z9JA 1GJ6A 4UE7H 1DANH 1MBMA 1P3EA 4D7GA 1O2OA 2J95A 2XC0A 1GJ9B 4PROA 2NU2E 2ALVA 3RM0H 2ZPQA 3UFAA 3B8JA 3GOVB 4WMFA 1AU8A 1D3TB 4NSVA 1D3DB 2AH4X 1TNIA 1BJUA 1LKAA 2VIVA 1GWAA 1O3AA 1WTHD 3RU4T 3H7TA 3U8OH 4X2VA 1BTZA 1GPZA 1UTOA 2BD9A 5K7RA 4CR9A 1GVLA 1QB6A 3GY4A 1E34B 4VGCC 1GG6C 2O8TA 1F5KU 3MU0A 2HOBA 3URCA 1OPHB 3BEUA 3RXVA 1HDTH 2OUAA 2ZPRA 3IITA 2A5KA 1HAVB 4BXWA 1UK2A 1AO5A 1O3JA 2P16A 2FOAA 2ZFQH 2SNWA 4AZ2B 1O33A 4OS6A 5JPMH 4AFUA 6CHAC 3EAJA 2ZCKP 3DUXH 1ABJH 2STAE 1P2IA 3RXPA 4WXIA 1CHGA 3L33A 2J38A 3K65B 2FZZA 2A0QB 1HPGA 4KTUA 3RDZA 1HUTH 1W8BH 1O37A 3TIUA 1J14A 1YPHC 1SGNE 1EB2A 4OS7A 3STIA 2I6SA 3ZVEA 1S6FA 2FO9A 2PKAA 4CREA 2GCTC 2XYAA 4X1QU 1PPHE 4NA9H 1LQEA 2D2DA 1H9LB 2PSYA 3PLBA 5E8EH 3SNBA 4LZ1H 1S84A 3BTGE 3E90B 1O3MA 2PTNA 4CRDA 3PO1B 1FAKH 2BY6X 1TA2A 3F1SB 1UO6A 3PTNA 2THFB 3A8AA 3SQHE 1OP0A 2WYJA 5DGJA 2ALPA 2ZDMA 1SGCA 1C1WH 3SU2A 1SPJA 3MNBA 3UOPA 1NFYA 2TRMA 1QRXA 1SLWB 2ZIQH 4B2BA 1XVOA 2HNTC 1WYKA 3SU6A 3M3SA 4YLUA 3HPTB 7LPRA 3A81A 3RXHA 1KDQB 1MD7A 1AGJA 1BTUA 2YOLA 2BDBA 1EATA 1ESBA 1K1MA 3R3GB 2ZO3H 1ZZZA 3RXIA 2XCNA 1SBWA 1BRCE 3LGIA 2SGEE 1F0SA 3GCHB 4B73A 3V12A 5IDKA 4HI3A 2TGAA 4UDWH 1O3EA 2ZP0H 2J4IA 3UQOA 5AFYH 3GDVA 1O39A 2TPIZ 4YOIA 4FUIA 2FTMA 2AMQA 1DUEA 2A4RA 3MNSA 4X1RU 2BZ6H 2EI7A 2QCYA 4Q7ZA 1UTLM 2UUYA 4WY3A 2BDCA 5LPFA 1EQ9A 2V3HH 1K1PA 2VGCC 3MTYA 3RC5A 5HGGA 1QB1A 1QHRB 3L6PA 1BA8B 1RIWC 4HGCA 3KNXA 3Q3XA 2PLXA 2ZU2A 1V2QT 3VEQB 4H6SB 3SORA 2BOKA 1UJ1A 2G51A 1RTLA 1AVWA 4MNWA 1C5RA 1F0UA 4MPVA 2D26C 3PROA 4FUBA 4ZUHA 1DWDH 2BDHA 2ZDAH 4CR5A 2H9HA 2A5AA 1SGEE 2XRCA 1GL1A 2Z6BD 3B9FH 1MTNB 5C1UA 1EJAA 1MCVA 1QL9A 2GCTB 1QA0A 4FUJA 4ISHH 4YZUA 4AGKA 1E0FD 1INCA 1A61H 2FLBH 3UNSA 2Z9LA 1GJAB 1LKBA 4A7IB 2AS9A 5F03A 1JMOH 3GCTF 4O03A 2GZ8A 2XBWA 3A83A 3LPRA 7KMEH 5DP9A 1O36A 3E3TA 1ETTH 1BTYA 5FX6A 2ANYA 1EZSC 5FPSA 6CHAB 4YLQH 2IN2A 1XM1A 4KKDA 1AKSA 3OU0A 1XUHA 1ZTKA 1QL8A 1OP8A 2ANKH 1EX3A 1C5MD 2KAIB 4D76A 3ZZAA 5DO4H 1F5LA 1OWKA 2ZU5A 1GI7B 1G3EA 1SQOA 2H5DA 1BRBE 4ISLA 1EP5A 3MO6A 2ZU1A 1PPGE 3BTTE 3BTWE 5DP5A 5DP7A 4ABHA 4NIYA 1O5BB 1V2JT 2A2QH 3FP6E 1XUKA 5FXLA 5JBAS 3O8RA 1V2UT 1O5AB 1Y3XA 3QO6A 5FX5A 1O3PB 5E0GA 2ZTYA 4CRBA 3A88A 2Z94A 2STBE 3AAUA 2BHGA 1Y3WA 1ZPBA 3BIUH 5EPYA 4BTTB 1TX8A 1VGCC 1JOUB 1UHBB 1ESAA 2OC1A 4B1TA 5C5NA 2BDGA 4A5TS 1QRZA 3Q76A 4ZKNU 2XBYA 2OLGA 1EOJA 1E38B 1PPEE 1HAYB 2IOTA 1VCPA 5C3NA 5T6DA 1FY1A 2FP7B 3ZZ3A 2P3UB 1HLTH 5A09A 3DHKH 1ZHRA 3S9BA 3SGAE 3VXFH 2FI4E 2O9QA 1CE5A 3V0XA 3HK3B 5DKMA 1A5IA 3CS7A 1C1SA 1O5FH 4IBLH 2JH0D 1HV7A 2WPLS 1GHBG 5A0CA 2GKVE 1C1UH 3LONA 1GCDA 2P8OC 5FBEA 3QX5H 3PM3A 3VB4A 3M37A 2R2WU 2ANMH 1P9SA 3D65E 1MH0A 1OWIA 1EOLA 4ISNA 1OYQA 1AIXH 1O3KA 2PHBA 2FLRH 1T4VH 5FPYA 1GBKA 1P2NA 3SU1A 2XC5A 3A7TA 3SBKA 2ILNA 1EJMA 1JWTA 1HAXB 1P10A 3T5FH 4IC5A 1TALA 2PKSB 2GTBA 1GDUA 1W11U 1S5SA 1BTXA 1LVMA 2BLWA 5J4SA 1TE0A 4BOHA 2GMTC 2GP9B 2ZTZA 2NWNA 2OINA 2BY7X 3ATWA 4MG3A 4NIXA 3OY6U 5A8ZA 1FJSA 4Y6DA 3S9AA 4ZHAA 1PPBH 1EZQA 3U1IB 1THPB 2VIWA 3P17H 3SV8A 1GBBA 3M5MA 1IHSH 4K1TA 2OQUA 1SL3A 5DPAA 3TGIE 3BTME 5FHTA 2ZGCA 1QJ6B 1SGTA 1TGSZ 2VIQA 1O3LA 1J16A 2XTTB 4H4FA 2ZDVH 1O3DA 4WH8A 1ZOMA 4D7FA 3GYLB 3RXEA 3A86A 4THNH 1HXFH 3ATLA 1HXEH 1TA6A 1FIZA 1HAHH 2XWBI 1G2MA 3KQBA 2GDDA 1BHXB 1HCGA 3BTKE 1IHTH 1D3QB 1FN6A 3MNXA 3SHAH 5EOKA 5HXFA 4X8UH 3LC3A 1O2SA 1AMHA 1S0QA 1TLDA 4INLA 4KGAA 3M5LA 3P92A 1TABE 2FOMB 2V3OH 1PQ5A 2SGPE 2ZWLH 3RM2H 2QC2A 4O9VA 2FOEA 1EPTB 2BYAX 1Y8TA 1O34A 3E0PB 1SHHB 1MTSA 1ELGA 1GG6B 1GGDC 3NKKA 4X6PA 2ZZUH 3F9HA 4K1EA 2ZEBA 2Q1JA 1TNGA 2VVCA 1AFQC 1C2JA 2ZFPH 3I78A 1E36B 4BAQB 1O2PA 2H2ZA 1KSNA 1Q31A 2J9NA 5LH8A 4ZKSU 2M5TA 2JETC 4TPYA 4Y7AA 1UMAH 2ZDKA 4FUEA 1TGTA 2FODA 3K6YA 1ZJKA 1SSXA 2Y5GA 3RXLA 2WINI 3SNDA 3VB3A 1Z8IB 1P9UA 1C9TA 2EC9H 2PUXB 4OGXA 2C8YB 2GCHF 3FAOA 1QIXB 1ELCA 2FIRH 1GMHG 1ZSLA 2AMDA 2EI6A 1GI8B 1L1NA 2YNBA 1ZMLA 2Z3EA 3SV7A 1GI3A 1ETSH 1IQHA 1UTNA 1SGIB 3SNCA 1O38A 3P95A 3U69H 4AFQA 2A5IA 2HWLB 1DWCH 1UTJA 5LPEA 4Q7YA 1O2XA 1WCZA 1SFIA 3F68H 2QAAA 5C1YA 4ABFA 4CH2B 1W10U 5DP6A 1P2KA 4KTSA 1P02A 4E7NA 3CS0A 3TNTA 1VR1H 4JZ1A 4FU9A 3NZIA 3LJOA 1A4WH 1NRRH 4ZHMU 2PKSC 2PR3A 2F9PA 4WMDA 2Y82A 3A85A 1OWJA 3PMHB 1O2IA 5GCHG 1XXFA 5F8XA 5L2YH 1H8DH 4XE4A 3MYWA 2BM2A 3LU9B 3EA8A 1AD8H 1CO7E 1CT4E 5PTPA 2ZNKH 1PPZA 2W7UA 2VIOA 2BVRH 3PMAB 2ZHFH 3QGNB 1XUJA 5DK1A 5CE1A 4DJZB 1HJAC 2FI5E 2O8MA 2OC7A 4X1NU 1N6XA 4M7GA 1TNJA 3G01A 1NRNH 4TYDA 4Y0ZE 4F49A 2R9PA 2FOBA 2DUCA 4XSKU 3ZVGA 4FUDA 1DM4B 1UTMA 1BBRE 1GJ8B 1ELDE 2AMPA 1O2NA 1QB9A 1GJDB 1Z1IA 2G55A 4X6NA 2VU8E 1BMNH 1DLKB 1TNLA 4FUFA 3UREA 1AUJA 1QGFA 3TJUA 3GY8A 2TGTA 1T32A 3BTFE 2Q6FA 4K8YA 4CRFA 2GGVB 4INKA 1BMLA 1ELAA 1VITG 1ZMNA 1GVKB 3LH1A 4D8NA 2ZFTA 1QNJA 4UFGH 3EDXB 1CSOE 5AHGH 2ANWA 4IS5A 2ZGXH 5JDUB 1U6QA 1WUNH 4X8SH 1RS0A 1KLIH 2P95A 1C5WB 2Y7ZA 1NFXA 1D9IA 1D6RA 2TBSA 1MBQA 3A82A 1TQ0B 1C1TA 3MFJA
chains in the Genus database with same CATH superfamily
3ZIAD 3A7VA 5A0BA 1A2CH 2Z7FE 3C27B 4NA7A 3U9AH 1P09A 1DWEH 4I8JA 1OOKB 3M3VA 1HGTH 1SGDE 3A7WA 4X1SU 1SI5H 4AYYB 1GBJA 1EPTC 4NWLA 4ABDA 5LPRA 1OXGA 1CA8B 3GY6A 4Z1MD 1GHWH 3ZZBA 4FXGH 2AGIX 4IN2A 3MH6A 2XBXA 3N99A 3ODFA 3RXGA 2XC4A 1EAUA 2LNCA 1MAXA 1W12U 2ZGHA 3H09A 4TSFD 3RXJA 5JBCS 1AZ8A 4TPIZ 1LHEH 3SJ9A 2QV1A 1E1QD 5IK2D 2SGDE 1W0ZU 3BG8A 1FXYA 1JRSA 2H5CA 3SOSA 1W3CA 2J5UA 2F9UA 4INHA 4LK4A 1ELEE 3T62A 3AW1A 1TOCB 1EAIA 1VZQH 2JDID 3BTHE 3PLKA 3FVFB 2OBOA 1GI2A 3HATH 3BEFB 2B7DH 1CGJE 2YMSD 1N8OB 1C2KA 1LHCH 1P0SH 5ESTE 3FZDA 2ODQA 2ZHEH 3H5CB 3DFJA 3AAVA 2XWAA 1DE7H 2AIQA 4ISOA 1AVXA 2RDLA 1FNIA 1GJ7B 2KCYA 3LH3A 3VB5A 4XDEA 3ZZ8A 3SUGA 1ZGVA 2P3FH 1EXFA 1C5OH 1RRKA 3UIRA 4AG1A 3TU7H 3PV5A 2EEKA 1QJ7B 5F6MA 3NK8A 1SHYA 4Y76A 1WQSA 2KZ4A 1GMDF 1O0DH 1NFUA 2ZA5A 1C5XB 3BTEE 3OSYA 3KQCA 1DVAH 3PO1C 5F8TA 3SJKA 1K22H 5B6OA 1C5VA 1FIWA 1QFKH 1O2VA 5HM2A 3KYFA 1SC8U 1TQ7B 2BD5A 1BCUH 3STJA 1O3NA 4ISIH 1M9UA 4I32A 3CENA 2PUQH 3ZZ4A 2WPDD 1JIRA 3P8FA 4LOYH 1EZUC 2JJ2D 2ESTE 1WAYB 1EKBB 3RLWH 5EXNA 4ZMAH 2ZFSA 3D49H 1P3CA 3LIWA 1TONA 2G4UA 1ZHPA 1O2TA 1W13U 2GX4A 5T6FA 1HB0B 1TMUH 2J94A 4I33A 4YM9A 1C2EA 3VFEA 3A80A 1W14U 1MKXH 3S7KB 1B5GH 1BRAA 1GBFA 1ZPCA 5AF9H 1XX9A 1GMHF 1Z7KA 1H1BA 3BEIB 4CRGA 1GBDA 1C2HA 1P06A 4OS5A 5CDFE 1LHFH 1VJ9U 4DOQA 4X8VH 4F48B 1P01A 3HKJB 1ZPZA 2AGGX 2FTLE 1PQ8A 1FMGA 2Z3DA 1C1PA 5GXPA 4I8HA 1G37A 2NU1E 2GVFA 1CHOG 3UWIA 1COWD 2FI3E 2ZDNA 2R0LA 1O2UA 2CF8H 1WQVH 3M7TA 1AFQB 2VWLA 1O2GH 1S85A 1V2TT 1O5CB 5E0JA 8GCHG 1GMCF 1W7GH 2F9NA 4UFEH 4F55A 3UNQA 1FZZA 1QCPA 3PLPA 4WJG2 3ZVAA 3AW0A 3D62A 5DN6D 1G9IE 1YPKH 2A4GA 4I7YH 1NM6A 3QUMP 1ZLRA 4R0IA 1PPFE 1TRYA 1MZAA 2A7CA 1MUEB 4YT7H 2BY5X 1UTQA 1AUTC 4ESTE 1TNKA 1BITA 3TNSA 2A45B 1YBWA 1AE8H 1TMTH 2C8ZB 2J34A 3RXMA 1G3CA 1XXDA 3LGVA 2W3KA 2BY8X 1NN6A 1V2MT 3MU8A 1DS2E 2ZHWH 4O3UA 2CMYA 1H8ED 5FBIA 1C4U2 1KTSB 2B9LA 2C8WB 4ABIA 4LZ4B 1GI4A 2UWLA 4K1SA 2BXTH 2GT7A 2QXGA 4X2WA 5EODA 1SFQB 2HRVA 3MNCA 4BTIB 1FY5A 1A5HA 2R2MB 3T28A 1CT2E 1DFPA 2C90B 1YKTA 1GJBB 2HALA 2OXSA 3PV2A 2B0FA 3GY5A 3SUEA 2SGFE 1V2WT 3LGUA 2QF0A 2ZTXA 3ESTA 3IWMA 2BD8A 5A0AE 3UOUA 5LGOA 2IPHA 4DURA 1B0EA 5C1XA 4MQAA 3S0NA 7GCHF 2XW9A 1Z6JH 2VVVA 2AIPA 1DLEA 7ESTE 3A8BA 1FAXA 1G3DA 1A3EH 1SR5C 1UVOA 1PQAA 1BBRH 2K8IA 3A84A 1SGRE 3MOCA 1ETRH 3RXAA 1AB9B 1KXAA 1EFRD 1T4UH 1MAYA 1V2ST 1V3XA 4JCNA 1ZJDA 1LMWB 2GZ7A 4AN7A 1O2HA 1SOTA 4NZLA 3T26A 3Q00A 2C4FH 1T8LA 3AVZA 2WPMS 1C5YB 3SUFA 2ZCHP 3ZVDA 3IG6B 3WY8A 2OC8A 5C5OA 3F2HA 2ZHQH 3ZZ5A 1BTHH 3E8LA 1BMAA 1BTWA 1CBWC 3DSGA 4JMYA 1FDPA 1BUIA 1BB0B 1MQ6A 3RXCA 1SVPA 2A7HA 2VINA 1PQ7A 1E1RD 2XBVA 1PPCE 4ZH8A 1HAGE 2VNTA 1V2KT 1HNEE 1BMMH 1OHHD 2G4TA 1K21H 4Y8YA 3LGTA 1HAOH 1ZSJA 5FCKA 1VCWA 1WBGB 2G5NA 3SNAA 1UCYK 2BY9X 3PWCA 4IC6A 1C5ZB 2VGCB 4ABJA 1XMNB 1PYTC 3UR9A 1C2LA 1A3BH 2BQWB 1LDTT 4ZXXH 3OYPA 1S83A 5FCRA 1C5PA 1V2OT 3U8RH 1HJ8A 2WUBA 1QQ4A 4P02A 3OTJE 4R8TB 5A2MH 5KECA 1KTTB 3M35A 1GJ5H 1AN1E 1Z1JA 4AG2A 1CQQA 3Q77A 1FPHH 1Q3XA 3SW2B 5DP3A 1TPOA 4LXBH 1Z8GA 3ITIA 4BAOB 2KCOA 3ZV9A 3JZ2B 1C2FA 1LO6A 1Y3UA 4GCHF 3S7HB 1LPZB 1Y5AT 2P94A 2HLCA 1HAZB 1ANCA 1EP6A 1VCQA 1FV9A 1O5EH 4NFEA 3RP2A 2VJ1A 3F2GA 3SU5A 4CHAC 5A8XA 5EQSA 1XVMA 4AGJA 3ZZ7A 2RG3A 5G4BA 1ESTA 3SUDA 1IQLA 5I25A 5GCHF 1YLNA 3E6PH 1HAPH 1C2DA 4OGYA 2CN0H 4WMEA 4OM9A 4DT7B 3FZZA 1OS8A 4RN6A 3RXUA 4BAHB 2BZAA 4BAKB 3B23B 1SLVB 3PYHA 3WWBA 1DXWA 2KM0A 2R0KA 4ABEA 3F9FA 3GY3A 4MNXA 4BNRA 4JZEH 1K1OA 3JZ1B 1ORFA 3WWFA 3TJOA 1Z71A 4AFSA 9ESTA 1OKXA 5EXLA 5AVDA 1C2GA 4GPGA 1SB1H 1KXBA 1MQ5A 1TGNA 2ZPSA 3N7DA 2O8UA 3PTBA 3URDA 2RCEA 3BV9B 5FAHA 2HNTE 4SGAE 3BTQE 1MMJN 2BQ6B 3SZNA 2C8XB 5C67A 1W2KH 3TH3H 4WWYA 5JB9S 3ZZ9A 5L2ZH 1YP9A 1YM0A 1BZXE 4OS4A 1EASA 4ABGA 1W0YH 1OWEA 3SI4H 4B2AA 3VGCC 3AASA 2F43B 2BD4A 4NGAH 1TBRH 1GI6A 1MCTA 2CJIA 1ZR0A 4JZDH 5C0UA 4DIIH 2A4OA 1BTPA 1MZDA 2C93B 1KYNA 1NY22 1ZHMA 1TOMH 3BF6H 3RMNH 4A1TA 1O2JA 3UUZA 1T7CA 3M5OA 3ZZ6A 1CGHA 1D4PB 3QK1A 1A0LA 5BRRE 1SLXB 2WPJS 4MNYA 3U1JB 1WDIA 3MU4A 1ELBA 5EJLA 4X2YA 4CH8B 3PRBA 3QLPH 1GI5A 4AB8A 1ZYOA 3QGJA 3GS9A 1DOJA 2WPKS 1Y59T 2BX4A 2Y80A 1DT2A 1O2MA 5JBTA 1RGQA 1LPKB 1FY3A 2BOHB 1TAWA 4FUCA 2ASUB 4AB9A 1DSUA 4QT8C 3TPIZ 1EPTA 4MPUA 1CVWH 1BJVA 1SGFA 3RXSA 3OX7U 2XNIA 4GHTA 3TK6A 2G52A 3RUOA 1O5GH 2Q6GA 4B2CA 4FVBA 4I86A 3BG4B 1C1OA 2ZGBH 1G32B 4JZFH 4K2YA 3GCTG 5EW1H 3K2UA 1UVPA 3DA9B 3KEEA 1DSTA 2W5EA 1ELVA 4Y8ZA 1H4WA 1V2LT 2PWXA 1TX7A 1F0TA 1FPCH 2GD4B 1VJAU 3M7QA 1QRWA 1QL7A 1DICA 1KY9A 1TYNA 1AFEH 1LCYA 4BXSA 3UAIC 3E91A 1ID5H 4CBNA 2GT8A 5GIBA 1L1JA 2FX4A 3VGCB 4Y71A 4XBBA 1TFXA 4TWWA 3CP7A 2SFAA 4CHAB 5HIYA 1ZGIA 6GCHF 2XXLA 4SGBE 3KIDU 5GJ4B 4KELA 2BTCE 5TJXA 1TPSA 1QBVH 5C2ZA 8ESTE 3RXTA 1LVBA 4NG9H 2CK3D 3HGPA 1WV7H 1TMBH 3SV6A 3NUMA 4Q7XA 1UVSH 4RI0A 4TWYA 3SJ8A 1B7XB 1MKWH 3RXDA 2VH6A 4UFFH 2F83A 1BIOA 1PJPA 3UB0A 2W26A 4YTAA 4AOQA 1O2ZA 2AEIH 3TITA 3DT0H 1J17T 3M5NA 1IAUA 1WXRA 5HYOA 2ZHDA 5EW2H 1GDNA 1AY6H 1N8OC 3KQ5A 3PMBB 5CMXH 1ANBA 1AZZA 2P8OB 1TWXB 1Q2WA 1P2MA 1BDAA 3GDUA 2C3SA 2VVUA 5H4IB 1YY3A 2BDAA 3ZZDA 1O2WA 1THRH 1A5GH 1V2NT 4NSYA 2J97A 4FETA 3HK6B 5EG4A 1TGCA 1GHZA 3RLYH 3SV2H 4E7RG 1NROH 1O3FA 3TJNA 4JZIA 2QYIA 1HBTH 4H6TA 3UWJH 3MU5A 3LT3A 2BLVA 1AVGH 1DITH 4K3JA 3RXOA 4D9RA 2ZCLP 4UFDH 1N6YA 1Z8JB 2O8WA 4AORA 1FY8E 2QN5T 1H8HD 4D9QA 5JYIA 1ELTA 1UHBA 1H9HE 4BANB 3MMGA 4UONA 1J8AA 1ANDA 3PV4A 2J2UA 4YO9A 3ATKA 3UY9A 1KXFA 4YT6H 1IOEA 1X7AC 2SGQE 3C1KA 2RA0A 9LPRA 1NU9A 5A8YA 5B6LA 1P04A 1H8IH 1C5UA 1C5LH 2RA3A 1L1GA 3OE7D 1GBCA 3VXEH 1LPGB 2G5VA 4XOJA 1WOFA 1SLUB 3N7EA 1DXPA 4BTUB 3KQEA 5EJ1A 4MLFB 3TGJE 1NRPH 1LTOA 1GBTA 2P93A 1FONA 1TGBA 3KQDA 5KEDA 4J2YB 2BX3A 1LHDH 3ATIA 1O31A 1SGQE 1ZMJA 1IQJA 3GCOA 3FANA 3NPSA 4MPWA 3DD2H 5L6NH 1S0RA 3P8GA 1QTFA 1QR3E 3QZRA 2Z9IA 3I29A 3RMOH 2CHAC 1O32A 4UD9H 1SOZA 2KAIA 1VITF 2BLOA 3QTOH 2QGRA 2R3UA 3ZVFA 1S81A 1NZQH 4GSOA 3SZEA 3LKWA 1KXEA 1ZSKA 1K2I1 4Y8XA 1AKSB 1SQAA 1YLDA 2Q6DA 4Y7BA 3W1EA 2ZDLA 2A4QA 2FX6A 2P3TB 3RXBA 3KN2A 2A32A 3HKIB 4GUXA 1JRTA 2FS8A 1E79D 3KHVA 4K69A 3U28C 1TB6H 5DSFA 2CF9H 6LPRA 1YLCA 5I46H 4MPXA 3RXKA 1UK4A 4IMQA 2BQ7B 3M3TA 2PP6A 1LVYA 5E2OA 2HPPH 2BDYA 1T31A 3TH4H 1O30A 1SQRA 3SN8A 3P70B 5EQQA 3T29A 3MH5A 3S9CA 3LOXA 1FLEE 4DIHH 3GY2A 1N1LA 7GCHG 1L4DA 3VPKA 2JKHA 5ABWA 3LJJA 2JETB 2ZQ2A 1TIOA 1LHGH 1MU8B 2Y81A 1IQIA 2BVXH 4UEHH 4NCYA 1EZXC 3SV9A 1IQMA 3F9EA 1QBOA 2H9EH 3LGWA 2DE8A 4RKJB 4GAWA 1S82A 3RXRA 1FI8A 3SQEE 2QXJA 1P12E 1OWHA 1VGCB 1LVOA 1WSSH 1Z6EA 2UUKB 2W7SA 5F8ZA 1K1LA 2UWOA 1G2LA 2H6MA 2UUJB 4NZQA 2OC0A 4WVPE 2Z9GA 2RDEA 3SGBE 2F9VA 1DY8A 1OP2A 3SJOA 1K1JA 1MKWK 1JIMA 2XCFA 3BG4C 4CBOA 4DT4A 5GNDA 3V3MA 3SGQE 2PGBB 3A87A 2EY4C 4B74A 4X8TH 5JBBS 1P03A 3VB6A 1NBMD 1C4Y2 1A7SA 4A1VA 4HG6A 5TCAA 1RTFB 4NWKA 2JH5D 1S6LA 1MTVA 1AI8H 1O2LA 2VWOA 1GJCB 3SHCH 4IMZA 1D3PB 2F9OA 3PB1E 1GHXH 2F91A 2WPHS 4IW4E 4I8GA 3GISB 2GZ9A 1FY4A 4ZAEA 5DG6A 4Q2KA 1O3BA 4I8LA 2V0BA 3A7YA 2A31A 4DCDA 1IQNA 2FXRA 1E35B 1V2RT 1UCYE 4YOGA 1AWHB 3A7XA 4M9FA 3EQ0H 2WPIS 3O8CA 4GHQA 3UR6A 1OSSA 3I77A 1KDQA 5E0HA 3EA9A 1XKBC 3EA7A 2FYRA 4U01A 2EI8A 2ZG0H 1NS3A 3P6ZB 1NU7B 4WXVA 1GHAF 1GBHA 2PW8H 1CHOF 3E16B 2G81E 3NXPA 4ZROA 1C4V2 2OQ5A 1QBNA 2QF3A 3QZQA 1C5QA 1UK3A 2SGAA 1TRMA 4ASHA 1O3OA 8GCHF 4ABBA 1IQKA 1QY6A 1BT7A 2FOCA 3MH4A 3RC4A 1GBMA 1E37B 2L6OA 1YWUA 3ZVCA 1GJ4H 1NFWA 1HAIH 5DP4A 3RMMH 1T8MA 1FX0B 2OD3B 1K28D 1O5DH 4B76A 2PKAB 1YF4A 1HFDA 1TBQH 2VWMA 3E1XB 1UVUH 2VIPA 3T2NA 4O3TA 1VITH 5HIZA 1UTKA 1P11E 1AQ7A 1RXPA 4JYUH 3TK5A 1GVZA 3SU0A 5EGMA 2AYWA 3EE7A 4JYTA 1KXCA 1K1NA 3MI4A 8LPRA 1IQFA 5CHAC 3RMLH 1EJNA 2WV5A 4RT1A 2GCHG 2AGEX 4YOJA 1GMCG 3FP8E 4NA8A 1AB9C 4Q80A 1SGPE 1CA0C 5GPIB 1HAVA 4U30A 4ZKOU 1KLTA 4TY6A 1C5NH 2EA3A 2CGAA 3ATMA 3F9GA 2QY0B 1S6HA 1F2SE 1L0ZA 2B8OH 1XUFA 2VIDA 4Y11E 1GBEA 1ZRKA 2ZKSA 3GDSA 1O35A 2WHXA 4XBDA 1GBIA 2NU0E 1NTPA 3NCLA 5GDSH 2OCVB 2G8TA 1TNHA 3A8DA 2H1UA 2A1DB 2R3YA 1YGCH 5T3HA 1F7ZA 3Q3KA 4NFFA 1P2QA 1WU1A 1GHBF 5EU8A 4CRCA 1AWFH 1MTWA 1YYY1 3HGNA 4B71A 1J15A 1GGDB 1SGFG 1JXPA 5CHBA 1HRTH 3ZYEA 4Y10E 3FP7E 1C1MA 2PSXA 1DX5M 2LPRA 4A6LA 5L30H 2J98B 1V6DA 4ABAA 2GV6A 3BIVH 4JK6A 3R0FA 2FOFA 3E0NB 4K8BA 2ODPA 4AYVB 2A2XH 2WUCA 5C17A 4Y79A 4ZHLU 3OAAD 1GI1A 2HGTH 2Z3CA 3UTUH 1JBUH 4E06H 3UQVA 2HVYB 1CT0E 1HYLA 2BB4A 3KF2A 3LC5A 1NRQH 5E2PA 1K9OE 1GCTC 2OBQA 3SNEA 1OYTH 3TGKE 1HJAB 3M61U 4K60A 5JB8S 4CRAA 1CBWB 2Y5FA 1VKYA 3QDZB 1RIWB 4OS1A 1UVTH 1ZRBA 3P8OA 3SU3A 1AHTH 1NT1A 2AERH 1NBME 2AFQB 1A1RA 5C0TA 2BD2A 4DGJA 4F4OC 4FUGA 1UCYH 1W0JD 1GMDG 3TJVA 3A89A 2GMTB 2CV3A 2CXVA 3NWUA 4JK5A 1C2IA 1QQUA 4HFPB 5TCCA 4Y0YE 4DY7B 1Y5BT 2V35A 3ZYDA 1DDJA 1RD3B 3PMJA 1PYTD 1HIAB 1L4ZA 2GDEH 1Y3VA 2A7JA 5HM9A 1O3IA 4FU8A 2IJOB 2V6NA 1F0RA 4X6MA 1YPLH 1GBAA 3MHWU 3ZV8A 3V7TA 3A8CA 3S69A 1B0FA 3GCHC 1O2QA 1YPEH 3BSQA 5FPTA 2GJGA 1YCPK 3ODDA 2ZU3A 1ARCA 3RC6A 1O3HA 2FOGA 2I6QA 1LQDB 2ZQ1A 2PFEA 4ZXYH 2TGPZ 4Q4LA 1OWDA 1RFNA 1TX6A 4ZKRU 1NO9H 3SYJA 1ELFA 1ZTLA 1P05A 3LDXH 3MO9A 3MQKC 1BHXF 3AK5A 2FWWA 3D23A 3BTDE 4TY7A 1CA0B 4IGDA 4J1YA 3UNRA 3K6ZA 2HPQH 2ZFFH 3H7OA 2FMJA 5ESBA 4B75A 3RXFA 1MKXK 5CHAB 2ZF0H 3MWIU 2FOHA 1KLJH 2K1QA 2Y7XA 3EGKH 4GCHG 2HNTF 3GY7A 3MO3A 2F4LA 4BAMB 5EQRA 1GHYH 1YC0A 1YCPH 2FS9A 2Z9KA 2QXHA 2FM2A 3PWBA 4NIWA 5ETXA 4I8KA 1NPMA 1T8OA 5T6GA 1RJXB 1CU1A 3GCNA 4VGCB 2PV9B 3EE0B 3F0PA 1AE5A 1W7XH 1C1VH 2GV7A 1XUGA 4I31A 4AX9H 1BOQA 1G30B 4A1XA 3UPEA 5EXMA 4DG4A 2EQNA 1ANEA 1ARBA 1O3CA 3FFGA 4HTCH 4H42U 2QIQA 3P8NA 4A92A 3K9XB 2WV4A 2F3CE 4FUHA 1DY9A 2H9TH 3O8DA 6ESTA 1YCPM 1XKAC 1BMFD 3SJIA 3ZVBA 4X0WU 2AHME 2LP6A 1UTPA 1F5RA 1MD8A 4RSPA 1YPJH 2SNVA 3F6UH 1O2KA 2JH6D 1D6WA 1SQTA 2D1JA 3BN9A 1QA7A 1Y5UT 1NESE 1C1NA 1XUIA 1G36A 2BDIA 4WH6A 1HJ9A 5DP8A 2ZC9H 5K0HA 1QJ1B 1TPPA 2FYQA 3KGPA 4U2WA 1C9PA 2VH0A 4JYVH 5SGAE 4RKOB 1GBLA 1GCTB 5BPEA 4MTBA 3T25A 4XFQA 4XBCA 1NRSH 2QXIA 2VWNA 3KL6A 1P2JA 1J9CH 1C5SA 3TK9A 2J92A 3V13A 2ZECA 4Z6AH 1C5TA 2OTVA 2KCAA 2VBCA 1EB1H 2FEQH 4OS2A 4MVNA 2PGQB 4DVAU 4FVDA 2ZFRH 4P00A 1BBRK 3U8TH 3M36A 1GI9B 1V2VT 4X6OA 3QN7A 3TVJB 2XOKD 3ELAH 1YPMH 4YESB 1K1IA 3QTVH 2UUFB 1TBZH 3ENSB 2PTCE 3KCGH 2BMGB 1SGYE 2QE7D 1C1QA 3OEHD 4IN1A 3U98H 4DW2U 1T8NA 4X2XA 1O3GA 1Z8RA 1L2EA 3SU4A 2Y6TA 1A46H 2WV9A 4X1PU 1DWBH 3GYMA 1RTKA 2FPZA 1TPAE 1FUJA 2ULLA 1EAXA 1MTNC 3LGYA 2BLQA 1K0HA 1Y3YA 4WF8A 3T27A 1IQEA 2F9BH 5EPNA 2HVXA 2Y5HA 3VB7A 1PFXC 1MTUA 2D8WA 3QWCH 1GHVH 5IYTA 1TRNA 1KXDA 1P57B 3W94A 1FN8A 2V3MA 4FU7A 2G00A 3O8BA 2O8LA 1KIGH 1HIAA 1O2YA 3TH2H 1A0JA 5J4QA 3ZZCA 1SMFE 5F53A 2BXUH 5HMAA 1THSH 2W3IA 4MDSA 1FQ3A 1MU6B 4AFZA 1YPGH 2UWPA 4KTCA 1F92A 1GL0E 3N7OA 3DFLA 2P59A 3M7UA 2BD7A 3SI3H 1CGIE 1ACBE 2NU3E 2ZGJA 2OP9A 8KME2 1NC6A 1P8VC 3RU4E 2BVSH 1WTGH 5DJ7A 2VB0A 3SO3A 2WYGA 1O2RA 3CNRA 2NU4E 4GLYA 6GCHG 3RXQA 3GICB 3MH7A 4HZHA 1V2PT 3FO8D 2TGDA 1ABIH 1H9IE 1G3BA 3L3TA 2DE9A 2YNAA 1GDQA 3MU1A 2QA9E 1GI0A 5AFZH 1OX1A 4NIVA 3F2FA 5HKKD 1A0HB 1IQGA 1ZTJA 4U32A 1QURH 4O97A 3A7ZA 4MNVA 1P2OA 2ZU4A 4KP0A 5C20A 1BQYA 2FDAA 5EIYA 4GVUA 2BD3A 5GWZA 2TIOA 3RU4D 2ODYB 1DPOA 1QZ8A 2ZI2H 3EYDA 2J98A 4TT3D 3TLOA 1DUAA 2B5TB 2YMSC 1SG8B 3W95A 1BRUP 2L74A 1GHAG 4E05H 1C2MA 1YPHE 1C1RA 2CHAB 3OY5U 2IPQX 4K5ZA 1EUFA 1EAWA 4Z0KA 2FESH 3Q3YA 4YXWD 2Z9JA 1GJ6A 4UE7H 1DANH 1MBMA 1P3EA 4D7GA 1O2OA 2J95A 2XC0A 1GJ9B 4PROA 2NU2E 2ALVA 3RM0H 2ZPQA 3UFAA 3B8JA 2K0QA 3GOVB 4WMFA 1AU8A 1D3TB 4NSVA 1D3DB 2AH4X 1TNIA 1BJUA 1LKAA 2VIVA 1GWAA 1O3AA 1WTHD 3RU4T 3H7TA 3U8OH 4X2VA 1BTZA 1GPZA 1UTOA 2BD9A 5K7RA 4CR9A 1GVLA 3NRLA 1QB6A 3GY4A 1E34B 4VGCC 1GG6C 2O8TA 1F5KU 3MU0A 2HOBA 3URCA 1OPHB 3BEUA 3RXVA 1HDTH 2OUAA 2ZPRA 3IITA 2A5KA 1HAVB 4BXWA 1UK2A 1AO5A 1O3JA 2P16A 2FOAA 2ZFQH 2SNWA 4AZ2B 1O33A 4OS6A 5JPMH 4AFUA 6CHAC 3EAJA 2ZCKP 3DUXH 1ABJH 1SKYE 2STAE 1P2IA 3RXPA 4WXIA 1CHGA 3L33A 2J38A 3K65B 2FZZA 2A0QB 1HPGA 2KFWA 4KTUA 4XD7D 3RDZA 3WW7A 1HUTH 1W8BH 1O37A 3TIUA 1J14A 1YPHC 1SGNE 1EB2A 4OS7A 3STIA 2I6SA 3ZVEA 1S6FA 2FO9A 2PKAA 4CREA 2GCTC 2XYAA 4X1QU 1PPHE 4NA9H 1LQEA 2D2DA 1H9LB 2PSYA 3PLBA 5E8EH 3SNBA 4LZ1H 1S84A 3BTGE 3E90B 1O3MA 2PTNA 4CRDA 3PO1B 1FAKH 2BY6X 1TA2A 3F1SB 1UO6A 3PTNA 2THFB 3A8AA 3SQHE 1OP0A 2WYJA 5DGJA 2ALPA 2ZDMA 1SGCA 1C1WH 3SU2A 1SPJA 3MNBA 3UOPA 1NFYA 2KR7A 2TRMA 1QRXA 1SLWB 2ZIQH 4B2BA 1XVOA 2HNTC 1WYKA 3OTPA 3SU6A 3M3SA 4YLUA 3DSOA 3HPTB 7LPRA 3A81A 3RXHA 1KDQB 1MD7A 1AGJA 1BTUA 3PRDA 4FOUC 2YOLA 2BDBA 1EATA 1ESBA 1K1MA 3FKSD 3R3GB 2ZO3H 1ZZZA 3RXIA 1MABB 2XCNA 1SBWA 1BRCE 3LGIA 2SGEE 1F0SA 3GCHB 4B73A 3V12A 5IDKA 4HI3A 3VG8A 2TGAA 4UDWH 1O3EA 2ZP0H 2J4IA 3UQOA 5AFYH 3GDVA 1O39A 2TPIZ 4YOIA 4FUIA 2FTMA 2AMQA 1DUEA 2A4RA 3MNSA 4X1RU 2BZ6H 2EI7A 2QCYA 4Q7ZA 1UTLM 2UUYA 4WY3A 2BDCA 5LPFA 1EQ9A 2V3HH 1K1PA 2VGCC 3MTYA 3RC5A 5HGGA 1QB1A 1QHRB 3L6PA 1BA8B 1RIWC 4HGCA 3KNXA 3Q3XA 2PLXA 2ZU2A 1V2QT 3VEQB 4H6SB 3SORA 2BOKA 1UJ1A 2G51A 1RTLA 1AVWA 4MNWA 1C5RA 1F0UA 4MPVA 2D26C 3PROA 4FUBA 4ZUHA 3FOAA 1DWDH 3KYGA 2WZQA 2BDHA 2ZDAH 2RFKC 4CR5A 2H9HA 2A5AA 1SGEE 2XRCA 1GL1A 2Z6BD 3B9FH 1MTNB 5C1UA 1EJAA 1MCVA 1QL9A 2GCTB 1QA0A 4FUJA 4ISHH 4YZUA 4AGKA 5C94A 1E0FD 1INCA 1A61H 2FLBH 3UNSA 2Z9LA 1GJAB 1LKBA 4A7IB 2AS9A 5F03A 1JMOH 3GCTF 4O03A 2GZ8A 2XBWA 3A83A 3LPRA 7KMEH 2IJD1 5DP9A 4B6FA 1O36A 3E3TA 1ETTH 1BTYA 5FX6A 2ANYA 1EZSC 5FPSA 6CHAB 4YLQH 2IN2A 1XM1A 3DSPA 4KKDA 1W0KD 1AKSA 4RT0A 3OU0A 2WSSD 1XUHA 1ZTKA 1UW7A 1QL8A 1OP8A 2ANKH 1EX3A 1C5MD 2KAIB 4ZCNA 4D76A 3ZZAA 5DO4H 1F5LA 1OWKA 2ZU5A 1GI7B 1G3EA 1SQOA 2H5DA 1BRBE 4ISLA 1EP5A 3MO6A 2ZU1A 1PPGE 3BTTE 3BTWE 5DP5A 5DP7A 4ABHA 4NIYA 1O5BB 1V2JT 2A2QH 3FP6E 1XUKA 5FXLA 5JBAS 3O8RA 1V2UT 1O5AB 1Y3XA 3QO6A 5FX5A 1O3PB 5E0GA 2ZTYA 4CRBA 3A88A 2Z94A 2STBE 3AAUA 2BHGA 1Y3WA 1ZPBA 3BIUH 5EPYA 4BTTB 1TX8A 1VGCC 1JOUB 1UHBB 1ESAA 2OC1A 4B1TA 5C5NA 2BDGA 4A5TS 4XRNA 1QRZA 3Q76A 2JIZD 4ZKNU 2XBYA 2W6ID 2OLGA 1EOJA 1E38B 3DCLA 1PPEE 1HAYB 2IOTA 1VCPA 5C3NA 5T6DA 1FY1A 2FP7B 3ZZ3A 2P3UB 1HLTH 5A09A 3DHKH 1ZHRA 3S9BA 3SGAE 3VXFH 2FI4E 2O9QA 1CE5A 3V0XA 3HK3B 5DKMA 2QF5A 1A5IA 3CS7A 1C1SA 1O5FH 4IBLH 2JH0D 1HV7A 2WPLS 1GHBG 5A0CA 2GKVE 1C1UH 3LONA 1GCDA 2P8OC 5FBEA 3QX5H 3PM3A 3VB4A 3M37A 2HLDD 2R2WU 2ANMH 1P9SA 3D65E 1MH0A 1OWIA 1EOLA 4ISNA 3F3BA 2M2AA 1OYQA 1AIXH 1O3KA 2PHBA 2FLRH 1T4VH 5FL7D 5FPYA 1GBKA 1P2NA 3SU1A 2XC5A 3A7TA 3SBKA 2ILNA 4AC9A 1EJMA 2JJ1D 1JWTA 1HAXB 1P10A 3T5FH 5KGOA 4IC5A 1TALA 2PKSB 2GTBA 1GDUA 1KMHB 1S5SA 1W11U 1BTXA 1LVMA 2BLWA 5J4SA 1TE0A 4BOHA 2GMTC 2GP9B 2ZTZA 2NWNA 2OINA 2BY7X 3ATWA 4MG3A 4NIXA 3OY6U 5A8ZA 1FJSA 4Y6DA 3S9AA 4ZHAA 1PPBH 1EZQA 3U1IB 1THPB 2VIWA 3P17H 3SV8A 1GBBA 3M5MA 1IHSH 4K1TA 2OQUA 1SL3A 5DPAA 5T1VA 3TGIE 3BTME 5FHTA 2ZGCA 1QJ6B 1SGTA 2XNDD 1TGSZ 1O3LA 2VIQA 1J16A 2XTTB 4H4FA 2ZDVH 1O3DA 4WH8A 1ZOMA 4D7FA 3GYLB 3RXEA 3A86A 4ACAA 4THNH 1HXFH 3ATLA 1HXEH 1TA6A 1FIZA 1HAHH 2XWBI 2KX4A 1G2MA 3KQBA 2GDDA 1BHXB 1HCGA 3BTKE 1IHTH 1D3QB 1FN6A 3MNXA 3SHAH 2QF4A 5EOKA 5HXFA 4X8UH 3LC3A 1O2SA 1AMHA 1S0QA 1TLDA 4INLA 4KGAA 3M5LA 3OFND 1TABE 2FOMB 2V3OH 1PQ5A 2SGPE 2ZWLH 3P92A 3RM2H 2QC2A 4O9VA 2FOEA 1EPTB 2BYAX 1Y8TA 1O34A 3E0PB 1SHHB 1MTSA 1ELGA 1GG6B 1GGDC 2OK5A 3NKKA 4X6PA 2ZZUH 3F9HA 4K1EA 2ZEBA 2Q1JA 1TNGA 2VVCA 1AFQC 1C2JA 2ZFPH 3I78A 1E36B 4BAQB 1O2PA 2H2ZA 1KSNA 1Q31A 2J9NA 5LH8A 4ZKSU 2M5TA 2JETC 4TPYA 4Y7AA 1UMAH 2ZDKA 4FUEA 1TGTA 4Q63A 2FODA 3K6YA 1ZJKA 4ASUD 1SSXA 2Y5GA 3RXLA 2LELA 2V7QD 2WINI 3SNDA 3VB3A 1Z8IB 1P9UA 1C9TA 2EC9H 2PUXB 4OGXA 2C8YB 2GCHF 3FAOA 1QIXB 1ELCA 2FIRH 1GMHG 1ZSLA 4ACBA 2AMDA 2EI6A 1GI8B 1L1NA 2YNBA 1ZMLA 2Z3EA 3SV7A 1GI3A 1ETSH 1IQHA 1UTNA 1SGIB 3SNCA 1O38A 3P95A 3U69H 4AFQA 2A5IA 2HWLB 1DWCH 1UTJA 5LPEA 4Q7YA 1O2XA 1WCZA 1SFIA 3F68H 2QAAA 5C1YA 4ABFA 4CH2B 1W10U 5DP6A 1P2KA 4KTSA 1P02A 4E7NA 3CS0A 3TNTA 1VR1H 4JZ1A 4FU9A 3NZIA 3LJOA 1A4WH 1NRRH 4ZHMU 2PKSC 2W6JD 2PR3A 2F9PA 4WMDA 2Y82A 3A85A 1OWJA 3PMHB 1O2IA 5GCHG 1XXFA 5F8XA 5L2YH 1H8DH 4XE4A 3MYWA 2BM2A 3LU9B 3EA8A 1AD8H 1CO7E 1CT4E 5PTPA 2ZNKH 1PPZA 2W7UA 2VIOA 2BVRH 3PMAB 2ZHFH 3QGNB 1XUJA 5DK1A 5CE1A 4DJZB 1HJAC 2FI5E 2O8MA 3OEED 2OC7A 4X1NU 1N6XA 4M7GA 1TNJA 3G01A 1NRNH 4TYDA 4Y0ZE 4F49A 2R9PA 2FOBA 2DUCA 4XSKU 3ZVGA 4FUDA 1DM4B 1UTMA 1BBRE 2KCPA 1GJ8B 1ELDE 2AMPA 1O2NA 1QB9A 1GJDB 1Z1IA 2G55A 4X6NA 1BMNH 1DLKB 2VU8E 1TNLA 3F0OA 4FUFA 3UREA 1AUJA 1QGFA 3TJUA 3GY8A 2TGTA 1T32A 3BTFE 2Q6FA 4K8YA 4CRFA 2GGVB 4INKA 1BMLA 1ELAA 1VITG 1ZMNA 1GVKB 3LH1A 4D8NA 2ZFTA 1QNJA 3FN8A 4UFGH 3EDXB 1CSOE 5EJZA 5AHGH 2ANWA 2YMSB 4IS5A 2ZGXH 5JDUB 1U6QA 4B6EA 1WUNH 4X8SH 1RS0A 1KLIH 2P95A 1C5WB 2Y7ZA 1NFXA 1D9IA 1D6RA 2TBSA 1MBQA 3A82A 1TQ0B 1C1TA 3MFJA
chains in the Genus database with same CATH topology
3A7VA 5A0BA 1A2CH 2Z7FE 3C27B 4NA7A 3U9AH 1P09A 1DWEH 4I8JA 1OOKB 3M3VA 1HGTH 1SGDE 3A7WA 4X1SU 1SI5H 4AYYB 1GBJA 1EPTC 4NWLA 4ABDA 5LPRA 1OXGA 1CA8B 3GY6A 1GHWH 3ZZBA 4FXGH 2AGIX 4IN2A 3MH6A 2XBXA 3ODFA 3RXGA 2XC4A 1EAUA 2LNCA 1MAXA 1W12U 2ZGHA 5JBCS 3RXJA 1AZ8A 4TPIZ 1LHEH 3SJ9A 2QV1A 2SGDE 1W0ZU 3BG8A 1FXYA 1JRSA 2H5CA 3SOSA 1W3CA 2F9UA 4INHA 4LK4A 1ELEE 3T62A 3AW1A 1TOCB 1EAIA 1VZQH 3BTHE 3PLKA 3FVFB 2OBOA 1GI2A 3HATH 3BEFB 2B7DH 1CGJE 1N8OB 1C2KA 1LHCH 1P0SH 5ESTE 3FZDA 2ODQA 2ZHEH 3H5CB 3DFJA 3AAVA 2XWAA 1DE7H 2AIQA 4ISOA 1AVXA 2RDLA 1FNIA 1GJ7B 3LH3A 3VB5A 4XDEA 3ZZ8A 3SUGA 1ZGVA 2P3FH 1EXFA 1C5OH 1RRKA 3UIRA 4AG1A 3TU7H 2EEKA 1QJ7B 5F6MA 3NK8A 1SHYA 4Y76A 1WQSA 1GMDF 1O0DH 1NFUA 2ZA5A 1C5XB 3BTEE 3OSYA 3KQCA 1DVAH 3PO1C 5F8TA 3SJKA 1K22H 5B6OA 1C5VA 1FIWA 1QFKH 1O2VA 5HM2A 1SC8U 1TQ7B 2BD5A 1BCUH 3STJA 1O3NA 4ISIH 1M9UA 4I32A 3CENA 2PUQH 3ZZ4A 1JIRA 3P8FA 4LOYH 1EZUC 2ESTE 1WAYB 1EKBB 3RLWH 5EXNA 4ZMAH 2ZFSA 3D49H 1P3CA 3LIWA 1TONA 2G4UA 1ZHPA 1O2TA 1W13U 2GX4A 5T6FA 1HB0B 1TMUH 2J94A 4I33A 4YM9A 1C2EA 3VFEA 3A80A 1W14U 1MKXH 3S7KB 1B5GH 1BRAA 1GBFA 1ZPCA 5AF9H 1XX9A 1GMHF 1Z7KA 1H1BA 3BEIB 4CRGA 1GBDA 1C2HA 1P06A 4OS5A 1LHFH 1VJ9U 4DOQA 4X8VH 1P01A 3HKJB 1ZPZA 2AGGX 2FTLE 1PQ8A 1FMGA 2Z3DA 1C1PA 5GXPA 4I8HA 1G37A 2NU1E 2GVFA 1CHOG 3UWIA 2FI3E 2ZDNA 2R0LA 1O2UA 2CF8H 1WQVH 3M7TA 1AFQB 2VWLA 1O2GH 1S85A 1V2TT 1O5CB 5E0JA 8GCHG 1GMCF 1W7GH 2F9NA 4UFEH 3UNQA 1FZZA 1QCPA 3PLPA 4WJG2 3ZVAA 3AW0A 3D62A 1G9IE 1YPKH 2A4GA 4I7YH 1NM6A 3QUMP 1ZLRA 4R0IA 1PPFE 1TRYA 1MZAA 2A7CA 1MUEB 4YT7H 2BY5X 1UTQA 1AUTC 4ESTE 1TNKA 1BITA 3TNSA 2A45B 1YBWA 1AE8H 1TMTH 2C8ZB 2J34A 3RXMA 1G3CA 1XXDA 3LGVA 2W3KA 2BY8X 1NN6A 1V2MT 3MU8A 1DS2E 2ZHWH 4O3UA 2CMYA 5FBIA 1C4U2 1KTSB 2B9LA 2C8WB 4ABIA 4LZ4B 1GI4A 2UWLA 4K1SA 2BXTH 2GT7A 2QXGA 4X2WA 5EODA 1SFQB 2HRVA 3MNCA 4BTIB 1FY5A 1A5HA 2R2MB 3T28A 1CT2E 1DFPA 2C90B 1YKTA 1GJBB 2HALA 2OXSA 2B0FA 3GY5A 3SUEA 2SGFE 1V2WT 3LGUA 2QF0A 2ZTXA 3ESTA 3IWMA 2BD8A 5A0AE 3UOUA 5LGOA 2IPHA 4DURA 1B0EA 5C1XA 4MQAA 3S0NA 7GCHF 2XW9A 1Z6JH 2VVVA 2AIPA 1DLEA 7ESTE 3A8BA 1FAXA 1G3DA 1A3EH 1SR5C 1UVOA 1PQAA 1BBRH 3A84A 1SGRE 3MOCA 1ETRH 3RXAA 1AB9B 1KXAA 1T4UH 1MAYA 1V2ST 1V3XA 4JCNA 1ZJDA 1LMWB 2GZ7A 4AN7A 1O2HA 1SOTA 4NZLA 3T26A 3Q00A 2C4FH 1T8LA 3AVZA 2WPMS 1C5YB 3SUFA 2ZCHP 3ZVDA 3IG6B 3WY8A 2OC8A 5C5OA 2ZHQH 3ZZ5A 1BTHH 3E8LA 1BMAA 1BTWA 1CBWC 4JMYA 1FDPA 1BUIA 1BB0B 1MQ6A 3RXCA 1SVPA 2A7HA 2VINA 1PQ7A 2XBVA 1PPCE 4ZH8A 1HAGE 2VNTA 1V2KT 1HNEE 1BMMH 2G4TA 1K21H 4Y8YA 3LGTA 1HAOH 1ZSJA 5FCKA 1VCWA 1WBGB 2G5NA 3SNAA 1UCYK 2BY9X 3PWCA 4IC6A 1C5ZB 2VGCB 4ABJA 1XMNB 1PYTC 3UR9A 1C2LA 1A3BH 2BQWB 1LDTT 4ZXXH 3OYPA 1S83A 5FCRA 1C5PA 1V2OT 3U8RH 1HJ8A 2WUBA 1QQ4A 3OTJE 4R8TB 5A2MH 1KTTB 3M35A 1GJ5H 1AN1E 1Z1JA 4AG2A 1CQQA 3Q77A 1FPHH 1Q3XA 3SW2B 5DP3A 1TPOA 4LXBH 1Z8GA 3ITIA 4BAOB 3ZV9A 3JZ2B 1C2FA 1LO6A 1Y3UA 4GCHF 3S7HB 1LPZB 1Y5AT 2P94A 2HLCA 1HAZB 1ANCA 1EP6A 1VCQA 1FV9A 1O5EH 4NFEA 3RP2A 2VJ1A 3SU5A 4CHAC 5A8XA 5EQSA 1XVMA 4AGJA 3ZZ7A 2RG3A 5G4BA 1ESTA 3SUDA 1IQLA 5I25A 5GCHF 3E6PH 1HAPH 1C2DA 4OGYA 2CN0H 4WMEA 4DT7B 3FZZA 1OS8A 4RN6A 3RXUA 4BAHB 2BZAA 4BAKB 3B23B 1SLVB 3PYHA 1DXWA 2R0KA 4ABEA 3F9FA 3GY3A 4MNXA 4BNRA 4JZEH 1K1OA 3JZ1B 1ORFA 3TJOA 1Z71A 4AFSA 9ESTA 1OKXA 5EXLA 5AVDA 1C2GA 4GPGA 1SB1H 1KXBA 1MQ5A 1TGNA 2ZPSA 3PTBA 2O8UA 3URDA 2RCEA 3BV9B 5FAHA 2HNTE 4SGAE 3BTQE 1MMJN 2BQ6B 3SZNA 2C8XB 5C67A 1W2KH 3TH3H 4WWYA 5JB9S 3ZZ9A 5L2ZH 1YP9A 1YM0A 1BZXE 4OS4A 1EASA 4ABGA 1W0YH 1OWEA 3SI4H 4B2AA 3VGCC 3AASA 2BD4A 4NGAH 1TBRH 1GI6A 1MCTA 2CJIA 1ZR0A 4JZDH 4DIIH 2A4OA 1BTPA 1MZDA 2C93B 1KYNA 1NY22 1ZHMA 1TOMH 3BF6H 3RMNH 4A1TA 1O2JA 3UUZA 1T7CA 3M5OA 3ZZ6A 1CGHA 1D4PB 3QK1A 1A0LA 5BRRE 1SLXB 2WPJS 4MNYA 3U1JB 3MU4A 1ELBA 4X2YA 4CH8B 3QLPH 1GI5A 4AB8A 1ZYOA 3QGJA 1DOJA 2WPKS 1Y59T 2BX4A 2Y80A 1DT2A 1O2MA 5JBTA 1RGQA 1LPKB 1FY3A 2BOHB 1TAWA 4FUCA 2ASUB 4AB9A 1DSUA 4QT8C 3TPIZ 1EPTA 4MPUA 1CVWH 1BJVA 1SGFA 3RXSA 3OX7U 2XNIA 4GHTA 3TK6A 2G52A 3RUOA 1O5GH 2Q6GA 4B2CA 4FVBA 3BG4B 1C1OA 2ZGBH 1G32B 4JZFH 4K2YA 3GCTG 5EW1H 3K2UA 1UVPA 3DA9B 3KEEA 1DSTA 2W5EA 1ELVA 4Y8ZA 1H4WA 1V2LT 2PWXA 1TX7A 1F0TA 1FPCH 2GD4B 1VJAU 3M7QA 1QRWA 1QL7A 1DICA 1KY9A 1TYNA 1AFEH 1LCYA 4BXSA 3E91A 1ID5H 4CBNA 2GT8A 5GIBA 1L1JA 2FX4A 3VGCB 4Y71A 4XBBA 1TFXA 4TWWA 3CP7A 2SFAA 4CHAB 1ZGIA 6GCHF 2XXLA 4SGBE 3KIDU 5GJ4B 4KELA 2BTCE 5TJXA 1TPSA 1QBVH 5C2ZA 8ESTE 3RXTA 1LVBA 4NG9H 3HGPA 1WV7H 1TMBH 3SV6A 3NUMA 4Q7XA 1UVSH 4TWYA 3SJ8A 1B7XB 1MKWH 3RXDA 2VH6A 4UFFH 2F83A 1BIOA 1PJPA 2W26A 4YTAA 4AOQA 1O2ZA 2AEIH 3TITA 3DT0H 1J17T 3M5NA 1IAUA 5HYOA 2ZHDA 5EW2H 1GDNA 1AY6H 1N8OC 3PMBB 5CMXH 1ANBA 1AZZA 2P8OB 1TWXB 1Q2WA 1P2MA 1BDAA 3GDUA 2C3SA 2VVUA 5H4IB 2BDAA 3ZZDA 1O2WA 1THRH 1A5GH 1V2NT 4NSYA 3HK6B 5EG4A 1TGCA 1GHZA 3RLYH 3SV2H 4E7RG 1NROH 1O3FA 3TJNA 4JZIA 2QYIA 1HBTH 4H6TA 3UWJH 3MU5A 3LT3A 2BLVA 1AVGH 1DITH 4K3JA 3RXOA 4D9RA 2ZCLP 4UFDH 1N6YA 1Z8JB 2O8WA 4AORA 1FY8E 2QN5T 4D9QA 5JYIA 1ELTA 1UHBA 1H9HE 4BANB 3MMGA 4UONA 1J8AA 1ANDA 3PV4A 2J2UA 4YO9A 3ATKA 3UY9A 1KXFA 4YT6H 1IOEA 1X7AC 2SGQE 3C1KA 2RA0A 9LPRA 1NU9A 5A8YA 1P04A 1H8IH 1C5UA 1C5LH 2RA3A 1L1GA 1GBCA 3VXEH 1LPGB 2G5VA 4XOJA 1WOFA 1SLUB 4BTUB 1DXPA 3KQEA 4MLFB 3TGJE 1NRPH 1LTOA 1GBTA 2P93A 1FONA 1TGBA 3KQDA 4J2YB 2BX3A 1LHDH 3ATIA 1O31A 1SGQE 1ZMJA 1IQJA 3GCOA 3FANA 3NPSA 4MPWA 3DD2H 5L6NH 1S0RA 3P8GA 1QTFA 1QR3E 3QZRA 2Z9IA 3I29A 3RMOH 2CHAC 1O32A 4UD9H 1SOZA 2KAIA 1VITF 2BLOA 3QTOH 2QGRA 2R3UA 3ZVFA 1S81A 1NZQH 4GSOA 3LKWA 1KXEA 1ZSKA 1K2I1 4Y8XA 1AKSB 1SQAA 1YLDA 2Q6DA 4Y7BA 2ZDLA 2A4QA 2FX6A 2P3TB 3RXBA 3KN2A 2A32A 3HKIB 4GUXA 1JRTA 2FS8A 3KHVA 4K69A 1TB6H 2CF9H 6LPRA 1YLCA 5I46H 4MPXA 3RXKA 1UK4A 4IMQA 2BQ7B 3M3TA 1LVYA 5E2OA 2HPPH 2BDYA 1T31A 3TH4H 1O30A 3SN8A 3P70B 5EQQA 3T29A 3MH5A 3S9CA 3LOXA 1FLEE 4DIHH 3GY2A 1N1LA 7GCHG 1L4DA 3VPKA 2JKHA 5ABWA 3LJJA 2JETB 2ZQ2A 1TIOA 1LHGH 1MU8B 2Y81A 1IQIA 2BVXH 4UEHH 4NCYA 1EZXC 3SV9A 1IQMA 3F9EA 1QBOA 2H9EH 3LGWA 2DE8A 4RKJB 4GAWA 1S82A 3RXRA 1FI8A 3SQEE 2QXJA 1P12E 1OWHA 1VGCB 1LVOA 1WSSH 1Z6EA 2UUKB 2W7SA 5F8ZA 1K1LA 2UWOA 1G2LA 2H6MA 2UUJB 4NZQA 2OC0A 4WVPE 2Z9GA 3SGBE 2F9VA 1DY8A 1OP2A 3SJOA 1K1JA 1MKWK 1JIMA 2XCFA 3BG4C 4CBOA 3V3MA 3SGQE 2PGBB 3A87A 4B74A 4X8TH 5JBBS 1P03A 3VB6A 1C4Y2 1A7SA 4A1VA 5TCAA 1RTFB 4NWKA 2JH5D 1MTVA 1AI8H 1O2LA 2VWOA 1GJCB 3SHCH 4IMZA 1D3PB 2F9OA 3PB1E 1GHXH 2F91A 2WPHS 4IW4E 4I8GA 3GISB 2GZ9A 1FY4A 4ZAEA 5DG6A 4Q2KA 1O3BA 4I8LA 2V0BA 3A7YA 2A31A 4DCDA 1IQNA 2FXRA 1E35B 1V2RT 1UCYE 4YOGA 1AWHB 3A7XA 3EQ0H 2WPIS 3O8CA 4GHQA 3UR6A 1OSSA 3I77A 1KDQA 5E0HA 3EA9A 1XKBC 3EA7A 2FYRA 4U01A 2EI8A 2ZG0H 1NS3A 3P6ZB 1NU7B 4WXVA 1GHAF 1GBHA 2PW8H 1CHOF 3E16B 2G81E 3NXPA 4ZROA 1C4V2 2OQ5A 1QBNA 2QF3A 3QZQA 1C5QA 1UK3A 2SGAA 1TRMA 4ASHA 1O3OA 8GCHF 4ABBA 1IQKA 1QY6A 1BT7A 2FOCA 3MH4A 3RC4A 1GBMA 1E37B 3ZVCA 1GJ4H 1NFWA 1HAIH 5DP4A 3RMMH 1T8MA 2OD3B 1K28D 1O5DH 4B76A 2PKAB 1YF4A 1HFDA 1TBQH 2VWMA 3E1XB 1UVUH 2VIPA 3T2NA 4O3TA 1VITH 1UTKA 1P11E 1AQ7A 1RXPA 4JYUH 3TK5A 1GVZA 3SU0A 5EGMA 2AYWA 4JYTA 1KXCA 1K1NA 3MI4A 8LPRA 1IQFA 5CHAC 3RMLH 1EJNA 2WV5A 2GCHG 2AGEX 4YOJA 1GMCG 3FP8E 4NA8A 1AB9C 4Q80A 1SGPE 1CA0C 5GPIB 1HAVA 4U30A 4ZKOU 1KLTA 4TY6A 1C5NH 2EA3A 2CGAA 3ATMA 3F9GA 2QY0B 1S6HA 1F2SE 1L0ZA 2B8OH 1XUFA 2VIDA 4Y11E 1GBEA 1ZRKA 2ZKSA 3GDSA 1O35A 4XBDA 1GBIA 2NU0E 1NTPA 3NCLA 5GDSH 2OCVB 2G8TA 1TNHA 3A8DA 2H1UA 2A1DB 2R3YA 1YGCH 5T3HA 1F7ZA 3Q3KA 4NFFA 1P2QA 1WU1A 1GHBF 5EU8A 4CRCA 1AWFH 1MTWA 1YYY1 3HGNA 4B71A 1J15A 1GGDB 1SGFG 1JXPA 1HRTH 3ZYEA 4Y10E 3FP7E 1C1MA 2PSXA 1DX5M 2LPRA 4A6LA 5L30H 1V6DA 4ABAA 2GV6A 3BIVH 4JK6A 3R0FA 2FOFA 3E0NB 4K8BA 2ODPA 4AYVB 2A2XH 2WUCA 4Y79A 4ZHLU 1GI1A 2HGTH 2Z3CA 3UTUH 1JBUH 4E06H 3UQVA 1CT0E 1HYLA 2BB4A 3KF2A 3LC5A 1NRQH 5E2PA 1K9OE 1GCTC 2OBQA 3SNEA 1OYTH 3TGKE 1HJAB 3M61U 4K60A 5JB8S 4CRAA 1CBWB 2Y5FA 3QDZB 1RIWB