5E0HA

1.95 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic (18-mer) inhibitor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
166
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of triazole-based macrocyclic inhibitors of norovirus protease: Structural, biochemical, spectroscopic, and antiviral studies.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Protease/protease inhibitor
molecule keywords Norovirus 3C-like protease
total genus 39
structure length 166
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0hA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5e0hA01
1SR5C 1MQ6A 1EZUC 2PR3A 3LGUA 4NIYA 1SHHB 3PM3A 1DS2E 2BY7X 3A89A 2A32A 2PFEA 4U01A 1E35B 2ZHFH 3RU4E 4WWYA 5TJXA 1ANDA 2WPMS 1SGIB 4NFFA 1SOTA 1YLCA 3RC4A 4K8YA 1UVUH 1XMNB 3RU4D 1W3CA 1G3DA 1GBDA 2QN5T 4XBCA 2J92A 1K1NA 4OGYA 1EAUA 1C5OH 5AFZH 1YKTA 4A1VA 1LHCH 3Q3XA 1O3GA 4XOJA 2BD9A 2ZHWH 3IITA 1K2I1 1DSTA 2PHBA 4B1TA 2Y5FA 1GGDB 3RC6A 1FIZA 1MBQA 1V2VT 4FU9A 1L2EA 2OP9A 1NC6A 1TNLA 1H4WA 4JZDH 2BDCA 3SBKA 1GJ7B 2BLWA 4YOIA 4NIXA 1RTLA 4X8VH 3PTBA 2ZCLP 4AGKA 1LPZB 2V0BA 2A5IA 2ANYA 3SGAE 2PWXA 5FAHA 2Q6GA 1E36B 3ESTA 1A5GH 3RXAA 4D9RA 3GDUA 3ZZCA 1DLEA 4WF8A 2ALVA 4CHAC 2ZZUH 1RD3B 4I8JA 1OXGA 2GT7A 4Y8XA 1C2DA 4MNVA 1S81A 1FAKH 1HJ8A 3ZZ8A 2QY0B 5HYOA 1OKXA 1FAXA 1GHBF 1O2IA 3LIWA 5PTPA 1BRBE 3SJ9A 3A7WA 4UFDH 1O3CA 2FI4E 1NN6A 1KSNA 4CRGA 4X6NA 7GCHF 1V2MT 1P10A 2W3KA 5EXNA 4ZXYH 1Z8GA 1ZSLA 3A7VA 1LMWB 3HPTB 1TOMH 2VGCC 3FP7E 3HK3B 4NFEA 2FS8A 3GY2A 3U1IB 1AE5A 1NESE 1VZQH 2BD3A 1J8AA 3BTEE 3E16B 1TBQH 1NRNH 3U8RH 2FTMA 1CBWB 3RDZA 4BAMB 1GI3A 1V2KT 1O5CB 1H9HE 2Z9LA 1G9IE 1TLDA 3ZVEA 3UQOA 1KXBA 4XSKU 3SUDA 1TNIA 4Y7BA 4JYUH 3S7HB 1TBZH 3GY8A 1SQTA 4JZEH 1C1VH 1MZAA 1P2QA 4X8TH 1FN6A 5C5NA 1TPAE 1NTPA 4ABEA 1AI8H 8GCHG 4X1PU 2Y81A 3BTFE 4TPIZ 1QNJA 2FX4A 4NIWA 2GV6A 1GL0E 1Z6EA 1ZMNA 4DY7B 3I77A 1EZXC 1BTHH 2ZU5A 2XC5A 2TGAA 5E0JA 1RGQA 5A2MH 2B9LA 2BY5X 2ULLA 4ZROA 2AH4X 3A82A 1C4U2 5A8ZA 2C90B 1GL1A 3AAVA 4BOHA 2FOHA 1K1MA 1N6XA 1FQ3A 1HFDA 4DOQA 2CV3A 3CENA 2XBVA 3JZ2B 3F68H 1P0SH 1TNKA 4DIIH 1P9SA 1O2OA 1YF4A 1FZZA 2R2WU 4D7FA 3U8OH 3V12A 1CT4E 4E7RG 5C1YA 3GYLB 5J4SA 1S6HA 4D76A 1FI8A 1D3PB 3TH2H 1THPB 1EOJA 3UR9A 1DDJA 2B8OH 4YOGA 4RKOB 3MU0A 2ZNKH 1TNJA 2ZFQH 2OUAA 4JYTA 1DY9A 3KN2A 2J94A 1Y3WA 3ZVDA 1QA0A 1IQIA 1JMOH 3BV9B 2NU2E 4ZKRU 1FJSA 1W0YH 1ELCA 1KLIH 4ISLA 1DXWA 2XC0A 1ZGVA 5DPAA 2EI7A 3MFJA 1AE8H 2ESTE 1ANCA 2Z3CA 2G5NA 2PGQB 4IS5A 5HM9A 3P8GA 1TIOA 2HRVA 1CGIE 1UTQA 3GCHC 1OP8A 1RIWC 3A85A 1EJNA 1O2HA 1SGNE 7GCHG 4ZKOU 1MD7A 2BLVA 2ZTXA 3E6PH 5LPEA 2WUCA 1TX6A 1HGTH 3BIVH 5J4QA 5FPTA 6LPRA 1JXPA 2TIOA 2O8LA 5EW2H 1LPGB 1O3LA 1GMDG 4A5TS 2BD7A 3ZZ7A 4B2CA 4Z0KA 3T5FH 2BVRH 2AIQA 8KME2 3KL6A 4B71A 1O3KA 1IOEA 4B73A 1GWAA 3UY9A 3SNDA 3EA9A 1WSSH 2BQ7B 3BSQA 3SO3A 3BEFB 2HVXA 2VNTA 2CXVA 1GI9B 2VIDA 4ZMAH 1TX8A 2WINI 1L4ZA 2TGDA 1SMFE 2XCFA 4ZHLU 1GI5A 2H9TH 1SOZA 5IYTA 1A61H 3AASA 3A7YA 5F8ZA 1NO9H 1D4PB 1X7AC 2UWPA 1GI7B 1SFQB 4X1NU 4DW2U 1QQUA 3P92A 3ATIA 4KELA 1FMGA 3OYPA 2ZDVH 2Y5GA 4INLA 5LGOA 4O03A 2A5KA 1DWDH 4B2AA 3T27A 2BXUH 1V2JT 5C1XA 3D65E 2VIOA 2ZHEH 3VGCB 1HAZB 2BDAA 1T32A 3O8DA 3M36A 3ATWA 1B0EA 2YNBA 3F1SB 1XXFA 1C1UH 1HXEH 1AZ8A 1UTMA 4MDSA 1PPEE 1H9IE 1O2QA 2XBWA 3NKKA 4CBNA 1YC0A 3M5OA 5JBTA 1ARCA 4CH2B 1MKWK 1XUGA 4DURA 5C3NA 4DIHH 3TGKE 1C5TA 2ZGCA 1IQEA 4DJZB 3URDA 2H5CA 2CF9H 2OCVB 1YPEH 3UTUH 4A6LA 5JB8S 5LPFA 3A8DA 3SU0A 3K9XB 4YZUA 3RM2H 2J38A 2PTCE 2UWLA 2VWNA 1Y3VA 2FXRA 4IN2A 2P93A 1C1RA 5E2OA 1XX9A 2YNAA 4KTUA 2OBQA 1QB1A 2IPHA 3M3SA 1ELEE 5EPNA 4Y7AA 5ESBA 2AYWA 4GLYA 1ESAA 1GJ6A 1VR1H 3EE0B 3DFJA 2PUXB 1HAHH 4ABFA 1S5SA 1Z1JA 1MKWH 2XBYA 3LC3A 3SU1A 2QXHA 3TJNA 4K8BA 1SLVB 5ABWA 3FAOA 1OWHA 3ZVAA 4Q7XA 1AKSB 3QK1A 1QRXA 3SV2H 4K69A 1TE0A 1C1SA 2VVUA 2FMJA 1YPHE 2EI8A 4ZKNU 2AGGX 3RLWH 1CA8B 1ELGA 3LGWA 2IN2A 3BTTE 3ATLA 4CH8B 4NG9H 3A83A 1BRUP 3C1KA 2GCTB 4Y71A 2B7DH 3BTKE 1LVMA 1W7GH 2FOCA 4OS4A 2UUKB 1BJVA 1ZJDA 2O8UA 4ZXXH 1JRSA 1CHOG 5F8TA 2ZGXH 1O2NA 2W7SA 4BXSA 1A4WH 2Z7FE 1BTYA 2EEKA 3PMHB 5GIBA 1HLTH 3URCA 2R3UA 3M5MA 2BOHB 2NU3E 2ZO3H 3KGPA 5EODA 2FZZA 1K21H 1GI2A 1EAXA 1KLTA 1P06A 1E37B 1YPGH 3QGNB 2R2MB 1HJAC 3U69H 2GDDA 1C1QA 2XTTB 2ZC9H 5EXLA 1FDPA 1NS3A 1L0ZA 2VGCB 3V3MA 3OX7U 4JK5A 3S0NA 1EB2A 2BQWB 4Y79A 2M5TA 2XNIA 4U2WA 2SGAA 5EGMA 1J16A 1KXDA 2QYIA 1XVOA 5DP5A 1DITH 1Z6JH 1LCYA 1QTFA 4YM9A 2Z9IA 4CR5A 2C8XB 1GVZA 4AOQA 2D26C 1QURH 1UTPA 8ESTE 1UTKA 4ISNA 2XRCA 2ZTYA 6ESTA 4JMYA 2BMGB 5K7RA 2ZFFH 4YOJA 1C5SA 4CRFA 1MU8B 4X1QU 3O8BA 1IAUA 3QDZB 1NRPH 2GMTC 1YYY1 1AY6H 1GJBB 1DX5M 1A2CH 1G32B 1GBCA 2SGEE 2Z9GA 3RXSA 1A46H 2GX4A 3ATMA 4FUBA 6CHAB 3UQVA 3QGJA 1AZZA 1W7XH 4U32A 2FOBA 2BOKA 2EA3A 3ZV8A 1SGEE 1HAIH 1GHBG 2BHGA 1PFXC 1O5FH 1NRQH 4JCNA 2RG3A 1EXFA 1GGDC 4WMFA 1MQ5A 2PKSC 5GJ4B 1PPBH 5BRRE 1ELFA 2G52A 1PQ5A 1INCA 1AU8A 1F0RA 1DPOA 1NFXA 3NK8A 1LQDB 5T6FA 1GBIA 1BITA 1MTNB 5FBIA 5K0HA 4KGAA 5A8YA 3A84A 3UR6A 3KF2A 1MUEB 3R3GB 2VWOA 4FU7A 3ODDA 1Y3UA 3Q3YA 2R0LA 2A2XH 1FPHH 4MNXA 5EPYA 2ZDAH 1OWDA 1HIAA 1O33A 4H6SB 1D6RA 4Y76A 1EASA 2ZCKP 4ABBA 3GOVB 3SJ8A 2OTVA 4K1SA 4FUFA 3GY6A 5DP8A 2TRMA 4CRBA 9LPRA 3TNSA 4AFUA 1TB6H 3MOCA 4BXWA 1MTVA 1OS8A 2STAE 1ZRKA 1KTTB 2FI5E 3MU8A 5I46H 2BD5A 3E0PB 1C5WB 4WJG2 4A92A 9ESTA 3QO6A 5DP9A 2F9VA 3MI4A 5E0HA 3KCGH 4NA7A 1XUFA 4X6PA 1K1JA 1O36A 4IW4E 4B2BA 2NU0E 2ZPRA 3C27B 2BY9X 3PO1B 2FYQA 1ELVA 1O2ZA 4YLUA 5HXFA 1P3EA 6GCHF 5AVDA 5FHTA 1PQAA 1C5ZB 2G5VA 4I8LA 1SLUB 1TNGA 1RS0A 2BX3A 2FIRH 2A5AA 2P3FH 1EP5A 1AQ7A 1AVGH 4Z6AH 1EAIA 1G2MA 1VCWA 5T6GA 3UNQA 1V2NT 2G81E 3K6ZA 1GVKB 1P05A 1C1PA 1FLEE 2A1DB 2XW9A 1C2JA 5L2ZH 4ABAA 1TYNA 4CREA 3GICB 3A80A 3M7QA 1JIRA 1TGTA 4MVNA 3RXFA 2C8WB 3F9HA 4X6MA 3MNBA 3STIA 1V2ST 1ZSJA 2SGFE 4H4FA 4K2YA 3KQDA 1PQ8A 4XE4A 1O3DA 4NSVA 4AFSA 5EXMA 1Z1IA 1XM1A 5F6MA 1GHZA 3DUXH 4R0IA 4ZUHA 1EPTA 1N8OB 1GBMA 4CRAA 1HAGE 2OC0A 1MKXH 1V2QT 4CBOA 1TONA 3QZRA 3RP2A 1G2LA 1GG6C 1TRNA 2OQ5A 1F5LA 4AG1A 3MMGA 2P95A 1KDQB 1LVYA 5HM2A 1ELDE 2O8MA 2STBE 2A4QA 3TJVA 1LVOA 4I32A 3T28A 1A5HA 5JBBS 4TWWA 2D2DA 4WH6A 1SB1H 3PWBA 1GBTA 1IQFA 1BDAA 3VB6A 1N6YA 1HPGA 3A8CA 3LKWA 1ZHRA 3LOXA 4K1EA 1QL7A 1DM4B 1Y3YA 3M35A 4NIVA 1ELTA 3W95A 1W0ZU 3BF6H 3P6ZB 3S69A 1ID5H 2HWLB 3SGBE 3PO1C 3B9FH 1BQYA 3MH6A 2NU4E 4WXIA 3FZZA 1UMAH 3H5CB 1GDQA 1S0RA 4UDWH 2BZ6H 1VGCB 2VIWA 1ZJKA 3ZVGA 2H1UA 2ZDKA 2SGQE 3S9BA 5EQRA 1O2RA 4TY6A 1C2LA 2DUCA 3EYDA 2I6SA 2H2ZA 3DT0H 1C5RA 1DT2A 2ANKH 2GMTB 1QIXB 1SGCA 1WTHD 1QB9A 3GISB 4MPWA 4TWYA 1V3XA 2HGTH 3A7TA 3A7ZA 1GJDB 4A7IB 3W94A 4FXGH 3SU6A 4ISIH 3PLPA 3RXCA 2F83A 3ZZ4A 1U6QA 4KTCA 2BVSH 2ZFRH 2AFQB 1NFUA 1V2OT 3BTDE 1XKAC 1RRKA 2ZFSA 2R9PA 5GXPA 4J1YA 4GUXA 2H9HA 1HAOH 1WV7H 1HBTH 2ZGBH 1MCVA 4FUHA 2SGDE 1XVMA 3M37A 4VGCB 4AYVB 1UCYE 1G3CA 3UOPA 1V2TT 1BTUA 1DFPA 2B5TB 1C1OA 1WCZA 2BDYA 3TLOA 3BTGE 2G55A 6CHAC 2QA9E 1FY5A 1MH0A 2ZEBA 1UHBB 1D3DB 1QBNA 2FOAA 5LPRA 5FX6A 2SGPE 3TVJB 1H8DH 1C5NH 1QCPA 2XXLA 6GCHG 4AGJA 2ZPQA 1Q2WA 3TH4H 5E2PA 5EOKA 2JH6D 1AB9C 1WYKA 2WV4A 5FCRA 3FP8E 3RXHA 1GHVH 2FM2A 3F6UH 2VVCA 1O5AB 1F0SA 4GVUA 1DOJA 3MO9A 1QBVH 1YPHC 4NWLA 2ZDLA 3EGKH 1ZPZA 2V6NA 2ZFTA 1C9TA 4D7GA 1P01A 3MNCA 4WMEA 1AVXA 1QJ6B 3UNSA 3D23A 4J2YB 3RMNH 1FY3A 1D6WA 1P2NA 3MU1A 5FBEA 1GBAA 1UVTH 2LPRA 1HJAB 3M7UA 1C2HA 1TOCB 3ZZBA 1B5GH 2JH0D 5JPMH 1DSUA 1TGSZ 3SNBA 2ZHDA 3DFLA 2WPHS 2C8YB 4OS5A 4TPYA 3M5LA 3BTHE 3TU7H 1C4V2 2HNTE 2GD4B 2ZI2H 3SNCA 1AUTC 1HUTH 3LGVA 4K1TA 1K28D 1AFQC 2ZU1A 4HTCH 2FEQH 1ZSKA 1GDNA 1HYLA 1C5VA 5C20A 1UTJA 1O2XA 2ZDNA 2EI6A 2GZ8A 4X1SU 3PROA 4AORA 3PLBA 5DJ7A 1QY6A 2BZAA 2J9NA 4UE7H 1LTOA 1O31A 4M7GA 1O3JA 1Y5BT 2C3SA 3BN9A 3GY5A 3QZQA 3T62A 2ZPSA 1UK4A 1CHOF 1GMHG 2GZ7A 2GV7A 1L1GA 1PJPA 1FN8A 2XC4A 4Q2KA 2LNCA 1D3TB 2RDLA 3VGCC 2QGRA 2BLOA 1IQLA 3BTME 1ZGIA 4BTIB 2A31A 1XXDA 3LPRA 1DWEH 4HI3A 4DGJA 1GI1A 1O38A 2Q1JA 1A0JA 1W8BH 3RXTA 3DD2H 2UUFB 1UVPA 4TY7A 1ABIH 2HALA 4BTTB 3B8JA 4OGXA 3ZYDA 1NM6A 3P8NA 2Y82A 1P09A 3TGIE 4O3TA 2IJOB 5DK1A 3RXVA 3U1JB 3BTQE 2FPZA 3MNSA 2GDEH 1IHTH 1PYTD 1AN1E 1O0DH 2G00A 4NZQA 5B6OA 1DANH 4WMDA 1HXFH 3LGIA 1AFQB 3LGTA 2PUQH 1HIAB 5EQQA 3SZNA 1ESBA 1DUAA 1C1NA 1KXFA 1FNIA 1HDTH 1WQSA 2WPJS 3GDVA 4IMQA 1DVAH 1GPZA 1YCPH 5EG4A 1JWTA 2J2UA 1K9OE 3RXLA 4FUCA 4IMZA 4JYVH 1N1LA 3LH1A 1QJ1B 3GDSA 4Y10E 1L4DA 4YO9A 4LOYH 2B0FA 3QTVH 2FX6A 4TYDA 4AFZA 1HJ9A 1YCPK 4NCYA 1O3IA 3K6YA 3QTOH 1UO6A 5C2ZA 3MYWA 1GJAB 1BHXB 3HK6B 4FUGA 4A1TA 1UCYH 3RXDA 3VB3A 4JK6A 1UCYK 1KY9A 4MTBA 1SC8U 2ZU3A 4AX9H 3S9AA 1TABE 4Y6DA 2GZ9A 4WXVA 2O9QA 2GP9B 1CHGA 1ZTLA 2NU1E 1WQVH 4D9QA 1PYTC 1CO7E 1GJ9B 4MNYA 3Q3KA 2ZCHP 3TITA 1BOQA 5GWZA 2A4GA 1W11U 1Y5AT 2VINA 3KIDU 1EZSC 1F0UA 1OYQA 1F92A 2WPKS 4K3JA 1BIOA 2JKHA 1GBKA 4O97A 1TRMA 1ETRH 2CGAA 1V2LT 2HLCA 1P2OA 4VGCC 1IQKA 1BUIA 1QFKH 1GJCB 2ZQ1A 3F9FA 1CGHA 2VIVA 2F9UA 1MAYA 1OP2A 4QT8C 3BEIB 4XBDA 4CRCA 1VITF 1GI4A 1J9CH 2Z3EA 5L30H 1C4Y2 3RXPA 2H9EH 3EDXB 1SGPE 1HV7A 1LDTT 1P04A 1CT0E 1AWFH 3ZZDA 1TMTH 5JYIA 3LU9B 1C5QA 1O2GH 1PPCE 4I8GA 1P9UA 1SGRE 4LK4A 1S6FA 1C9PA 4GSOA 2FESH 3OSYA 3RC5A 4X8UH 4YT6H 3SGQE 1MZDA 3QX5H 3BG8A 3ZZ3A 1CQQA 3BTWE 2PKAB 2ZFPH 5AF9H 1BRAA 1O35A 3SV9A 1ACBE 7KMEH 5DGJA 1S84A 1RTFB 1MD8A 3ENSB 1PPHE 1GBBA 1WU1A 3V7TA 5T6DA 4FVBA 2OQUA 1P2KA 3TIUA 2P16A 1T8LA 1XUHA 1V2RT 1MTWA 1KIGH 1N8OC 4DCDA 3SQEE 4XDEA 4GAWA 3VPKA 2Z9JA 2CHAC 3WY8A 1ZLRA 1Z71A 1GVLA 2AIPA 1GI8B 5F03A 1F7ZA 5E0GA 1DICA 3SJOA 4Q7ZA 1P2MA 2P3TB 4ABHA 1C1MA 1K1OA 1W13U 4X2WA 4X2XA 3NPSA 1GG6B 3E3TA 1A1RA 1ARBA 2FI3E 3RMLH 3NCLA 3RXMA 3SUFA 3O8RA 4B75A 4JZFH 4ISOA 1F0TA 1EJMA 2PW8H 4A1XA 4I31A 1BHXF 1HAVB 2ANMH 2GT8A 1AMHA 1O2SA 1K22H 1S0QA 1OP0A 5DG6A 3BEUA 1SGFG 3A7XA 3TH3H 3N7OA 2ANWA 1ETTH 4ABGA 1SL3A 3ZVCA 3VB7A 2P3UB 2AGIX 4LXBH 1O2YA 2BDGA 2YOLA 2BD4A 4U30A 2ZA5A 3VFEA 1WTGH 2ZDMA 1C1WH 3R0FA 2D1JA 3UREA 2P59A 2XWAA 3PYHA 1ZHPA 1SLWB 1ZYOA 2ZQ2A 5FPYA 3O8CA 1Z8IB 1TQ7B 4X2YA 4WY3A 1QHRB 3CP7A 4DT7B 2HPPH 1K1IA 1H1BA 1C2KA 4ZHAA 2CMYA 1T7CA 1AHTH 1RTKA 3UUZA 4E06H 1O5GH 1IQHA 2AMDA 2ODYB 3MH5A 4NZLA 3A86A 1GCTC 4NWKA 4RN6A 3RXBA 3SQHE 2Z9KA 4IN1A 1AO5A 3D62A 1PPFE 3SJIA 1TFXA 1B7XB 2GKVE 5LH8A 1THRH 3NZIA 1PQ7A 1BBRK 1FV9A 4YESB 5CE1A 3L3TA 1MTNC 2TGPZ 3JZ1B 4Y0YE 1FPCH 2W7UA 1TGNA 2ZU2A 1XUJA 2FOGA 1VCQA 2GCHF 2F9PA 2R0KA 4BNRA 1AKSA 4OS1A 1GBFA 2OC7A 1A0HB 1O2PA 4NGAH 1V6DA 1EB1H 5JBAS 2JH5D 1OPHB 3AVZA 4GPGA 3I29A 3GCNA 1FUJA 2XBXA 4PROA 3NUMA 2GTBA 2ZIQH 1BTXA 3D49H 1O2VA 1AFEH 4NA9H 5AHGH 3LONA 1O2UA 1UTOA 4INHA 2FO9A 1AVWA 3LC5A 2PTNA 4IC5A 3MTYA 4ISHH 1NZQH 1OWEA 5DP4A 3CS0A 4FUJA 3FP6E 3Q77A 1L1NA 1TPPA 5HGGA 2FDAA 2G8TA 2OC1A 2BD8A 3BIUH 1O5BB 1BJUA 3LDXH 1ZTKA 3M7TA 1C2MA 3SI3H 1D9IA 4AB9A 2VWLA 2BX4A 3MO3A 4MPVA 3RXQA 4BAKB 4B74A 1IQJA 1S85A 2FLRH 2QXJA 1LPKB 1MKXK 1GI6A 2PKAA 3AW0A 1AWHB 1ZR0A 3T25A 2ZGHA 1SBWA 2BQ6B 2W3IA 1NY22 2A7CA 1SFIA 1BMAA 1IHSH 1CU1A 2OC8A 1P02A 4YT7H 3HATH 1VITH 2CJIA 1BZXE 2TBSA 4D8NA 1BB0B 3SNEA 1L1JA 1YM0A 4UONA 3H7OA 1GDUA 1NFYA 4I8KA 2QXGA 4JZIA 1HAPH 4I33A 2VH6A 1AGJA 1VJ9U 2XYAA 3FVFB 4HGCA 2BDBA 1H8IH 1P57B 1RIWB 1OSSA 1YLDA 3GCHB 2ZP0H 1QRWA 3GCOA 1ABJH 3A87A 2ZHQH 3G01A 1V2WT 1GMDF 1ZZZA 2V35A 1BTZA 1Y5UT 3L33A 4H6TA 2RA0A 2WYJA 2J34A 3OY5U 3T26A 3E90B 3F9EA 1YPKH 4UFGH 4IC6A 1TX7A 2ZECA 1FY1A 5DP6A 3AAUA 4GHTA 1ZHMA 3GY7A 3AW1A 4ESTE 4X8SH 3SUEA 1VJAU 3IG6B 1T8MA 2Z94A 1O37A 1E0FD 4AN7A 1GMCF 2RCEA 1A5IA 4MLFB 1K1PA 1WBGB 1YBWA 4X1RU 1QRZA 3RUOA 1KXEA 1T31A 1YP9A 2AERH 2GCTC 2HPQH 2ODPA 2VH0A 3K2UA 3ITIA 4XFQA 1ZMJA 3F9GA 1EQ9A 1O3MA 2GGVB 4SGAE 1MCTA 2BDIA 1C2IA 1GI0A 1NU9A 4UD9H 1SGDE 4E7NA 1P11E 1O2LA 3E91A 4SGBE 4CRDA 4Q80A 4ZAEA 1E38B 2OXSA 3A88A 5CMXH 2BB4A 2A4RA 1TPOA 1QL8A 1A0LA 3LJOA 2VIQA 2TGTA 1KDQA 2F91A 1W2KH 1ZRBA 5CHAB 3SORA 1CGJE 3SU4A 1EOLA 5GDSH 1EX3A 2HNTC 3RXJA 3A81A 1HCGA 1O2MA 3E0NB 1M9UA 4JZ1A 2CHAB 4FVDA 1ZPCA 2QXIA 3SOSA 1GJ5H 1HRTH 3M3VA 3TJOA 3SU3A 1RFNA 3M61U 1DLKB 2FYRA 3MNXA 3OU0A 5A0CA 1BTPA 1C2EA 1LHFH 3MO6A 1NPMA 3SI4H 1NRRH 1QR3E 1H9LB 4ABJA 5F8XA 4X0WU 3TPIZ 1XUKA 3PWCA 3NXPA 3QLPH 2ZGJA 3VEQB 2OBOA 3ZZ9A 1VCPA 5EW1H 1TMBH 5A0BA 1LHGH 2XWBI 3V0XA 1UK3A 3GY3A 5ESTE 5DP3A 1EPTB 2OLGA 1O3NA 2SFAA 1QJ7B 1BBRH 3FFGA 4NSYA 3ZZ6A 5DO4H 3TK9A 2G4TA 4OS7A 5FPSA 1FXYA 1EUFA 3U8TH 2KAIA 1G30B 2GCHG 4ASHA 3UNRA 2UUJB 5IDKA 3SJKA 3GYMA 1MU6B 2W26A 4F4OC 1FIWA 4K5ZA 1KLJH 1GHWH 2BTCE 3RXGA 1ZTJA 2PSXA 2A0QB 4FUIA 2BD2A 5EU8A 2Q6DA 2AMPA 2AGEX 1EPTC 3P8OA 5C5OA 1MTUA 1SGTA 2BY6X 2QF3A 1BTWA 5L2YH 1QQ4A 2VVVA 4IGDA 1YPMH 4HZHA 4IBLH 4MG3A 4KKDA 3A8AA 2WYGA 3LGYA 4FU8A 5FXLA 1O32A 1ZPBA 4RKJB 3RXIA 2FTLE 4O9VA 3RXEA 1TA6A 1DWBH 2HNTF 2BM2A 1JIMA 1AD8H 2PLXA 2SNWA 1WOFA 1DUEA 2C8ZB 2AMQA 3LT3A 1NROH 1C5LH 2Y7XA 7ESTE 2C93B 1GCDA 1C5PA 2W5EA 3ATKA 1TMUH 1T8NA 2CF8H 2VJ1A 2D8WA 1CT2E 5I25A 2WPIS 3KEEA 1GHYH 1AB9B 3EA7A 1YCPM 2H5DA 5HMAA 1W10U 2IOTA 3EAJA 3PTNA 2FS9A 3SW2B 2P8OB 1C2FA 4FUEA 2HOBA 3RXUA 1DE7H 1G3BA 2F9BH 1P03A 3UIRA 2F3CE 5CHAC 3RU4T 1LKBA 1TRYA 1OWKA 2A4OA 5FCKA 2DE9A 1GJ4H 3UWIA 2XCNA 3ZVBA 4ZKSU 2RA3A 2CN0H 2BY8X 2V3OH 1D3QB 1B0FA 2J95A 2BDHA 1BMNH 4AFQA 1SQAA 4YLQH 8GCHF 2ILNA 3I78A 1SQOA 3HGNA 4OS6A 1SGFA 2A45B 1UHBA 4GCHG 1CBWC 2ZTZA 2F9OA 2QF0A 4O3UA 1P8VC 4THNH 1GBLA 1C5XB 4GHQA 4LZ1H 3SU5A 3ZZ5A 1J17T 1C5YB 1W14U 2UUYA 2VU8E 1QGFA 1BT7A 2I6QA 2QC2A 1O2TA 1TGCA 1NRSH 1NU7B 2OD3B 1W12U 1MBMA 4CR9A 1GBHA 3UWJH 1JOUB 2A7JA 2PSYA 3KQBA 4DG4A 3M3TA 1EZQA 5C67A 1Z7KA 3H7TA 4KTSA 1O3FA 3HKIB 1J15A 1F5RA 4MNWA 4UFEH 2Y80A 1KXAA 3RLYH 3SHAH 5FX5A 5AFYH 1S82A 2A7HA 1CA0C 4FUDA 1O2KA 4X2VA 1SVPA 1BCUH 1C5MD 1MAXA 3K65B 4UFFH 4K60A 3TK6A 1GBEA 3PMJA 4X6OA 3VB4A 1XUIA 2Z3DA 1HAXB 3IWMA 5JB9S 1E34B 2BLQA 1TWXB 3MU4A 3VB5A 1GMHF 1ANEA 1QBOA 3MU5A 1DXPA 1V2PT 1O39A 3U98H 1BMMH 1O3BA 2PGBB 2PV9B 1ELBA 3VXFH 4I7YH 2VIPA 2WPLS 2AEIH 1KYNA 1SLXB 1T8OA 4ABIA 2BYAX 3P70B 3PLKA 1FY8E 1O3AA 2H6MA 1IQGA 1HNEE 1QL9A 3S9CA 4XBBA 2ZWLH 1HAYB 3MHWU 2Q6FA 8LPRA 2KAIB 1BBRE 4BANB 3UFAA 1TA2A 4WVPE 1O2JA 3SU2A 3E8LA 1GCTB 1G37A 4CHAB 1Y59T 2ODQA 1XKBC 1A3EH 4Y8YA 2NWNA 3A8BA 1PPZA 2G51A 1Z8RA 4AG2A 1O3PB 3EA8A 3PV4A 5G4BA 5GPIB 1KTSB 1Q3XA 2FOMB 4Y11E 3V13A 2A2QH 3BG4C 3KQCA 4MPXA 1LKAA 1QA7A 4GCHF 2QCYA 2FP7B 3P8FA 1Z8JB 1BA8B 1O34A 3SV8A 2ZU4A 1GHXH 1EJAA 1GMCG 3P17H 1GHAG 3GCTG 3TNTA 2DE8A 1LQEA 2G4UA 1P2JA 3HGPA 3SV7A 3SN8A 4AYYB 2FOEA 2J4IA 1WUNH 1O3HA 2Y7ZA 4MQAA 2BVXH 2BXTH 3Q76A 1P12E 4UEHH 4BTUB 4HFPB 4B76A 4AZ2B 3T2NA 1IQNA 3QN7A 4DVAU 1O5DH 1MMJN 2FLBH 3M5NA 2VWMA 5L6NH 1P2IA 5BPEA 1C2GA 3BG4B 3U9AH 1NFWA 4KP0A 4LZ4B 3MWIU 2QV1A 1LVBA 5A09A 3RMOH 1Q31A 1A3BH 4ZH8A 4E05H 1S83A 5H4IB 4BAHB 1EATA 2FODA 1ZMLA 1ANBA 4H42U 2FOFA 1QB6A 1BRCE 1C5UA 2P8OC 3STJA 1JRTA 3PMAB 1SHYA 1F2SE 3ZZAA 1TNHA 3GY4A 1PPGE 4MPUA 3RM0H 1OOKB 3DA9B 3RXRA 3RMMH 1YGCH 3LJJA 2WUBA 2ALPA 1TBRH 2P94A 2THFB 1MTSA 1RXPA 1KXCA 2TPIZ 1FY4A 1AUJA 1TQ0B 1HB0B 1ELAA 1LHDH 5JBCS 5T3HA 3VXEH 3T29A 2C4FH 1CVWH 2ZG0H 3ZYEA 3P95A 3KNXA 5A0AE 4AB8A 3LH3A 1GBJA 1DWCH 4RSPA 1LO6A 1CE5A 1OYTH 1O3EA 1SGQE 2O8TA 4ABDA 3QWCH 3E1XB 4F49A 1EP6A 2GVFA 3HKJB 1C1TA 5GCHG 1F5KU 3FZDA 2O8WA 3ZV9A 1O2WA 1SGYE 1GHAF 3GCTF 3ZVFA 1OWIA 3SV6A 1K1LA 2Z6BD 5GCHF 1SPJA 3KQEA 1ETSH 1O3OA 4INKA 3UPEA 4Y8ZA 1OX1A 4BAOB 5C1UA 1YPJH 3DHKH 1WAYB 3KHVA 2ZF0H 4Q7YA 1T4VH 1TALA 2ZKSA 2QIQA 3MH4A 4NA8A 3TK5A 5ETXA 3MH7A 2K1QA 3CS7A 1Y3XA 3TGJE 3EQ0H 1BMLA 3SNAA 5TCCA 3UOUA 1ORFA 2FWWA 4YTAA 1TPSA 1UVOA 3L6PA 4OS2A 7LPRA 1HAVA 2ASUB 5E8EH 3B23B 1T4UH 1Y8TA 5EQSA 1VITG 3RXOA 1CA0B 2V3HH 1AIXH 1TAWA 3S7KB 1DY8A 1A7SA 4R8TB 5SGAE 5JDUB 1JBUH 4I8HA 2R3YA 1UJ1A 3QUMP 1RJXB 1O30A 1ESTA 3SUGA 1CSOE 1VGCC 2EC9H 3PMBB 1V2UT 1NT1A 1OWJA 1YPLH 3RXKA 1TGBA 1O5EH 1UTLM 3ELAH 1FONA 1UVSH 1J14A 4ZHMU 2SNVA 1EKBB 3ODFA 3OY6U 4BAQB 2UWOA 2AS9A 2JETC 2JETB 2OINA 1G3EA 1UK2A 1IQMA 2WV5A 1UTNA 5DP7A 3OTJE 2VB0A 2Y6TA 1P3CA 1EAWA 2F9NA 1LHEH 2PKSB 3FANA 2Y5HA 5A8XA 3PB1E 4Y0ZE 2QAAA 3SHCH 1SI5H 3NWUA 1THSH 1GJ8B 1SG8B 4WH8A 1ZOMA 1G36A 5TCAA 1SSXA 3Q00A 3TJUA 5DKMA
chains in the Genus database with same CATH superfamily
1SR5C 1MQ6A 1QZ8A 1EZUC 2PR3A 3LGUA 4NIYA 1SHHB 3PM3A 1DS2E 2BY7X 2EY4C 3A89A 2A32A 2PFEA 4U01A 1E35B 2ZHFH 5C94A 3RU4E 4WWYA 5TJXA 1ANDA 2WPMS 1SGIB 4NFFA 1SOTA 1YLCA 3RC4A 4K8YA 1UVUH 1XMNB 3RU4D 1W3CA 1G3DA 1GBDA 2QN5T 2XNDD 4XBCA 2J92A 1K1NA 4OGYA 1EAUA 1C5OH 5AFZH 1YKTA 4A1VA 2PP6A 1LHCH 3Q3XA 1O3GA 2OK5A 4XOJA 2BD9A 2ZHWH 3IITA 1K2I1 1H8ED 4FETA 1DSTA 2PHBA 4B1TA 2Y5FA 1GGDB 3RC6A 1FIZA 1MBQA 1V2VT 4FU9A 3OFND 1L2EA 2OP9A 1NC6A 1TNLA 1H4WA 4JZDH 2BDCA 3SBKA 1GJ7B 2BLWA 3WWFA 4YOIA 4NIXA 1RTLA 4X8VH 3PTBA 2ZCLP 4AGKA 1LPZB 2V0BA 2A5IA 2ANYA 3SGAE 2PWXA 5FAHA 2Q6GA 1E36B 3ESTA 1A5GH 3RXAA 4D9RA 3GDUA 3ZZCA 1DLEA 4WF8A 4DT4A 2ALVA 4CHAC 2ZZUH 1RD3B 4I8JA 1OXGA 2GT7A 4Y8XA 1C2DA 4MNVA 1S81A 1FAKH 1HJ8A 3ZZ8A 2QY0B 5HYOA 1OKXA 1FAXA 2YMSC 3OEHD 1GHBF 1O2IA 3LIWA 5PTPA 1BRBE 3SJ9A 3A7WA 4UFDH 1O3CA 2FI4E 1NN6A 1KSNA 4CRGA 4X6NA 7GCHF 1V2MT 1P10A 2W3KA 5EXNA 4ZXYH 1Z8GA 1ZSLA 2XOKD 3A7VA 2K0QA 1LMWB 3HPTB 2WPDD 1H8HD 1TOMH 2VGCC 3FP7E 3HK3B 4NFEA 2FS8A 3GY2A 3U1IB 1AE5A 1NESE 1VZQH 2BD3A 1J8AA 3BTEE 3E16B 1TBQH 1NRNH 3U8RH 2FTMA 1CBWB 3RDZA 2RFKC 4BAMB 1GI3A 1V2KT 1O5CB 1H9HE 1SQRA 2Z9LA 1G9IE 1TLDA 3ZVEA 3UQOA 1KXBA 4XSKU 3SUDA 1TNIA 4Y7BA 4JYUH 1E1QD 3S7HB 1TBZH 3GY8A 1SQTA 4JZEH 1C1VH 1MZAA 1P2QA 4X8TH 3N7EA 1FN6A 5C5NA 1TPAE 1NTPA 4ABEA 1AI8H 8GCHG 4X1PU 2Y81A 3BTFE 4TPIZ 1QNJA 2FX4A 4NIWA 2GV6A 1GL0E 1Z6EA 1ZMNA 3F2FA 4DY7B 3I77A 1EZXC 1BTHH 2ZU5A 2XC5A 2TGAA 5E0JA 1RGQA 5A2MH 2B9LA 2BY5X 1NBMD 2ULLA 4ZROA 2AH4X 3A82A 1C4U2 5A8ZA 2C90B 1GL1A 3AAVA 4BOHA 2FOHA 1K1MA 1N6XA 1FQ3A 1HFDA 4DOQA 2CV3A 3CENA 2XBVA 3JZ2B 3F68H 1P0SH 1TNKA 4DIIH 1P9SA 1O2OA 1YF4A 1FZZA 2R2WU 2GJGA 3U8OH 4D7FA 3V12A 1CT4E 4E7RG 5C1YA 3GYLB 5J4SA 1S6HA 4D76A 1FI8A 1D3PB 3TH2H 1THPB 1EOJA 3UR9A 1DDJA 2B8OH 4YOGA 4RKOB 3MU0A 2ZNKH 1TNJA 2ZFQH 2OUAA 4JYTA 1DY9A 3KN2A 3H09A 2J94A 1Y3WA 3ZVDA 1QA0A 1IQIA 1JMOH 3BV9B 2NU2E 4ZKRU 1FJSA 1W0YH 1ELCA 1KLIH 4ISLA 1DXWA 2XC0A 1ZGVA 5DPAA 2EI7A 5IK2D 3MFJA 1AE8H 2ESTE 1ANCA 2Z3CA 2G5NA 2PGQB 4IS5A 5HM9A 3P8GA 1TIOA 4HG6A 2HRVA 1CGIE 1UTQA 4RT0A 3GCHC 1OP8A 1RIWC 3A85A 1EJNA 1O2HA 1SGNE 7GCHG 4ZKOU 1MD7A 2BLVA 2ZTXA 3E6PH 5LPEA 2WUCA 1TX6A 5C17A 1HGTH 3BIVH 5J4QA 5FPTA 6LPRA 1JXPA 2TIOA 2O8LA 5EW2H 1LPGB 1O3LA 1GMDG 4A5TS 2BD7A 3ZZ7A 4B2CA 4Z0KA 3T5FH 2BVRH 2AIQA 8KME2 3KL6A 4B71A 1O3KA 1IOEA 4B73A 5F53A 1GWAA 3UY9A 3SNDA 3EA9A 1WSSH 2BQ7B 3BSQA 3SO3A 1YWUA 3BEFB 2HVXA 2VNTA 2CXVA 1GI9B 4AC9A 2VIDA 4ZMAH 1TX8A 2WINI 1L4ZA 2TGDA 1SMFE 2XCFA 4ZHLU 1GI5A 2H9TH 1SOZA 5IYTA 1A61H 3AASA 4ZCNA 3A7YA 5F8ZA 1NO9H 1D4PB 1X7AC 2UWPA 1GI7B 1SFQB 4X1NU 4DW2U 1QQUA 3P92A 3ATIA 4KELA 1FMGA 3OYPA 4B6FA 2ZDVH 2Y5GA 4INLA 5LGOA 4O03A 2A5KA 1DWDH 4B2AA 3T27A 2BXUH 1V2JT 5C1XA 3D65E 2VIOA 2ZHEH 3VGCB 1HAZB 2JDID 2BDAA 1T32A 3O8DA 3M36A 3ATWA 1B0EA 2EQNA 2YNBA 3F1SB 1XXFA 1C1UH 1HXEH 1AZ8A 1UTMA 4MDSA 2KFWA 1PPEE 1H9IE 1O2QA 2XBWA 3NKKA 4CBNA 1YC0A 3M5OA 5JBTA 1ARCA 4CH2B 1MKWK 1XUGA 4DURA 5C3NA 4DIHH 3TGKE 1C5TA 2ZGCA 1IQEA 4DJZB 3URDA 2H5CA 2CF9H 2OCVB 1YPEH 3UTUH 4A6LA 5JB8S 5LPFA 3A8DA 3SU0A 3K9XB 4YZUA 3RM2H 2J38A 2PTCE 2UWLA 2VWNA 1Y3VA 2FXRA 4IN2A 2P93A 1C1RA 5E2OA 1XX9A 2YNAA 4KTUA 2HLDD 2OBQA 1QB1A 2IPHA 3M3SA 1ELEE 5EPNA 4Y7AA 5ESBA 2AYWA 4GLYA 1ESAA 1GJ6A 1VR1H 3EE0B 3DFJA 2PUXB 4P00A 1HAHH 4ABFA 1S5SA 1Z1JA 1MKWH 2XBYA 3LC3A 3SU1A 2QXHA 3TJNA 4K8BA 1SLVB 5ABWA 3FAOA 1OWHA 3ZVAA 4Q7XA 1AKSB 3QK1A 1QRXA 3SV2H 4K69A 1TE0A 1C1SA 2VVUA 4Q4LA 2FMJA 1YPHE 2EI8A 4ZKNU 2AGGX 3RLWH 1CA8B 1ELGA 3LGWA 2IN2A 3BTTE 3ATLA 4CH8B 4NG9H 3A83A 1BRUP 3C1KA 2GCTB 4Y71A 2B7DH 3BTKE 1LVMA 1W7GH 2FOCA 4OS4A 2UUKB 1BJVA 1ZJDA 2O8UA 4ZXXH 1JRSA 1CHOG 5F8TA 2ZGXH 1O2NA 2W7SA 4BXSA 1A4WH 2Z7FE 1BTYA 2EEKA 4XRNA 3PMHB 5GIBA 1HLTH 3URCA 2R3UA 3M5MA 1UW7A 2BOHB 2NU3E 3F3BA 2ZO3H 3KGPA 5EODA 2FZZA 1K21H 1GI2A 1EAXA 1KLTA 1P06A 1E37B 1MABB 1YPGH 3QGNB 2R2MB 1HJAC 3U69H 2GDDA 1C1QA 2XTTB 2ZC9H 5EXLA 1FDPA 1NS3A 1L0ZA 2VGCB 3V3MA 3OX7U 4JK5A 3S0NA 1EB2A 2BQWB 4Y79A 5EIYA 2M5TA 2XNIA 4U2WA 2SGAA 5EGMA 1J16A 1KXDA 2QYIA 1XVOA 2HVYB 5DP5A 1DITH 1Z6JH 1LCYA 1QTFA 4YM9A 2Z9IA 4CR5A 2C8XB 1GVZA 4AOQA 2D26C 1QURH 1UTPA 8ESTE 1UTKA 4ISNA 2XRCA 2ZTYA 6ESTA 4JMYA 2BMGB 5K7RA 2ZFFH 4YOJA 2J97A 1C5SA 4CRFA 1MU8B 4X1QU 3O8BA 1IAUA 3QDZB 1BMFD 1NRPH 2GMTC 1YYY1 1AY6H 1GJBB 1DX5M 1A2CH 1G32B 5GNDA 2SGEE 1GBCA 2Z9GA 3RXSA 2L6OA 1A46H 2GX4A 3ATMA 4FUBA 6CHAB 3UQVA 3QGJA 1AZZA 1W7XH 4U32A 2FOBA 2BOKA 2EA3A 3ZV8A 1SGEE 1HAIH 1GHBG 2BHGA 1PFXC 1O5FH 1NRQH 4JCNA 2RG3A 1EXFA 1GGDC 4WMFA 1MQ5A 2PKSC 5GJ4B 1PPBH 5BRRE 1ELFA 2G52A 1PQ5A 1INCA 1AU8A 1F0RA 1DPOA 1NFXA 3NK8A 1LQDB 5T6FA 1GBIA 1BITA 1MTNB 5FBIA 5K0HA 4KGAA 5A8YA 3A84A 3UR6A 3KF2A 1MUEB 3R3GB 2VWOA 4FU7A 3ODDA 1Y3UA 3Q3YA 2R0LA 2A2XH 1FPHH 4MNXA 5EPYA 2ZDAH 1OWDA 1HIAA 1O33A 4H6SB 1D6RA 4Y76A 1EASA 2ZCKP 4ABBA 3GOVB 3SJ8A 2OTVA 4K1SA 4FUFA 3GY6A 5DP8A 2TRMA 4CRBA 9LPRA 3TNSA 4AFUA 1TB6H 3MOCA 4BXWA 1MTVA 1OS8A 2STAE 1ZRKA 1KTTB 2FI5E 3MU8A 5I46H 2BD5A 3E0PB 1C5WB 4WJG2 4A92A 9ESTA 3QO6A 5DP9A 2F9VA 3MI4A 5E0HA 3KCGH 4NA7A 1XUFA 3F2HA 1K1JA 4X6PA 1O36A 4IW4E 4B2BA 2NU0E 2ZPRA 3C27B 2BY9X 3PO1B 2FYQA 1ELVA 1O2ZA 4FOUC 4YLUA 5HXFA 1P3EA 6GCHF 5AVDA 5FHTA 1PQAA 1C5ZB 2G5VA 4I8LA 1SLUB 1TNGA 1RS0A 2BX3A 2FIRH 2A5AA 2P3FH 5HIYA 1EP5A 1AQ7A 1AVGH 4Z6AH 1EAIA 1G2MA 1VCWA 5T6GA 3UNQA 1V2NT 2G81E 3K6ZA 1GVKB 1P05A 1C1PA 1FLEE 2A1DB 2XW9A 1C2JA 5L2ZH 4ABAA 1TYNA 4CREA 3GICB 3A80A 3M7QA 1JIRA 1TGTA 4MVNA 3RXFA 2C8WB 3F9HA 4X6MA 3MNBA 3STIA 1V2ST 1ZSJA 2SGFE 4H4FA 5DSFA 4K2YA 3KQDA 1PQ8A 4XE4A 1O3DA 4NSVA 4AFSA 5EXMA 1Z1IA 1XM1A 5F6MA 1GHZA 3DUXH 4R0IA 4ZUHA 1EPTA 1N8OB 1GBMA 4CRAA 1HAGE 2OC0A 1MKXH 1V2QT 4CBOA 1TONA 3QZRA 3RP2A 1G2LA 1GG6C 1TRNA 2OQ5A 1F5LA 4AG1A 3MMGA 2P95A 1KDQB 1LVYA 5HM2A 1ELDE 2O8MA 2STBE 5DN6D 2A4QA 3TJVA 1LVOA 4I32A 3T28A 1A5HA 5JBBS 4TWWA 2D2DA 4WH6A 1SB1H 3PWBA 1GBTA 1IQFA 1BDAA 3VB6A 1N6YA 1HPGA 3A8CA 3LKWA 1ZHRA 3LOXA 4K1EA 1QL7A 1DM4B 1Y3YA 3M35A 4NIVA 1ELTA 3W95A 1W0ZU 3BF6H 3P6ZB 3S69A 1ID5H 2HWLB 3SGBE 3PO1C 3B9FH 1BQYA 3MH6A 2NU4E 4WXIA 3FZZA 1UMAH 3H5CB 1GDQA 1S0RA 4UDWH 2BZ6H 1VGCB 2VIWA 1ZJKA 3ZVGA 2H1UA 2ZDKA 2SGQE 3S9BA 5EQRA 1O2RA 4TY6A 1C2LA 2DUCA 3EYDA 2I6SA 2H2ZA 3DT0H 1C5RA 1DT2A 2ANKH 2W6JD 2GMTB 1QIXB 1SGCA 1WTHD 1QB9A 3GISB 4MPWA 4TWYA 1V3XA 2HGTH 3A7TA 3A7ZA 1VKYA 1GJDB 4A7IB 3W94A 4F48B 4FXGH 3SU6A 4ISIH 2F43B 3PLPA 3RXCA 2F83A 3ZZ4A 1U6QA 4KTCA 2BVSH 2ZFRH 5C0TA 2AFQB 1NFUA 5T1VA 1V2OT 3BTDE 1XKAC 1RRKA 2ZFSA 2R9PA 5GXPA 4J1YA 4GUXA 2H9HA 1HAOH 1WV7H 1HBTH 2ZGBH 1MCVA 4FUHA 2SGDE 1XVMA 3M37A 4VGCB 4AYVB 1UCYE 1G3CA 3UOPA 1V2TT 1BTUA 1DFPA 2B5TB 1C1OA 1WCZA 2BDYA 1FX0B 3TLOA 3BTGE 2G55A 6CHAC 2QA9E 1FY5A 1MH0A 2V7QD 2ZEBA 1UHBB 1D3DB 3KYFA 1QBNA 2FOAA 5LPRA 5FX6A 2SGPE 3TVJB 1H8DH 1C5NH 1QCPA 2XXLA 6GCHG 4AGJA 2VBCA 2ZPQA 1Q2WA 3TH4H 5E2PA 5EOKA 2JH6D 1AB9C 1WYKA 2WV4A 2AHME 5FCRA 3FP8E 3RXHA 1GHVH 2FM2A 3F6UH 2VVCA 1O5AB 1F0SA 4GVUA 1DOJA 3MO9A 1QBVH 1YPHC 4NWLA 2ZDLA 3EGKH 1ZPZA 1E79D 2V6NA 2ZFTA 1C9TA 4D7GA 1P01A 3MNCA 4WMEA 1AVXA 1QJ6B 3UNSA 3D23A 4J2YB 3RMNH 1FY3A 1D6WA 1P2NA 3MU1A 5FBEA 2KZ4A 1GBAA 1UVTH 2LPRA 1HJAB 3M7UA 1C2HA 1TOCB 3ZZBA 1B5GH 2JH0D 5JPMH 1DSUA 1TGSZ 1W0JD 3SNBA 2ZHDA 3DFLA 2WPHS 2C8YB 1WDIA 4OS5A 4TPYA 3M5LA 3BTHE 3TU7H 1C4V2 2HNTE 2GD4B 2ZI2H 3SNCA 1AUTC 1HUTH 3LGVA 4K1TA 5EJZA 3SZEA 1K28D 1AFQC 2ZU1A 4HTCH 2FEQH 1ZSKA 1GDNA 1HYLA 1C5VA 5C20A 1UTJA 1O2XA 2ZDNA 2EI6A 2GZ8A 4X1SU 3PROA 4AORA 2WSSD 3PLBA 5DJ7A 1QY6A 2BZAA 2J9NA 4UE7H 1LTOA 1O31A 4M7GA 4ACAA 1O3JA 1Y5BT 2C3SA 3BN9A 3GY5A 3QZQA 3T62A 2ZPSA 1UK4A 1CHOF 1GMHG 2GZ7A 2GV7A 1L1GA 1PJPA 1FN8A 2XC4A 4Q2KA 2LNCA 1D3TB 2RDLA 3VGCC 2KCAA 2QGRA 2QF5A 2BLOA 1IQLA 3BTME 1ZGIA 4Z1MD 4BTIB 2A31A 1XXDA 3LPRA 1DWEH 4HI3A 4DGJA 1GI1A 1O38A 2Q1JA 1A0JA 1W8BH 4XD7D 3RXTA 3DD2H 2UUFB 1UVPA 4TY7A 1ABIH 2HALA 5HIZA 5KEDA 4BTTB 3B8JA 4OGXA 3ZYDA 1NM6A 3P8NA 2Y82A 1P09A 3DSGA 3TGIE 4O3TA 2IJOB 3PRDA 5DK1A 3RXVA 3U1JB 3BTQE 2FPZA 3MNSA 2GDEH 1IHTH 3SYJA 1PYTD 1AN1E 1O0DH 2G00A 4NZQA 5B6OA 1DANH 4WMDA 1HXFH 3LGIA 1AFQB 3LGTA 2PUQH 1HIAB 5EQQA 3SZNA 1ESBA 1DUAA 1C1NA 1KXFA 1FNIA 1HDTH 1WQSA 2WPJS 3GDVA 4IMQA 1DVAH 1GPZA 1YCPH 5EG4A 3DSOA 4OM9A 1JWTA 2J98B 2J2UA 1K9OE 3RXLA 4FUCA 4IMZA 4JYVH 1N1LA 3LH1A 1QJ1B 3GDSA 4Y10E 1L4DA 4YO9A 4LOYH 2B0FA 3GS9A 3QTVH 2FX6A 4TYDA 4AFZA 1HJ9A 1YCPK 4NCYA 1O3IA 3K6YA 3QTOH 1UO6A 5C2ZA 3MYWA 1GJAB 1BHXB 3HK6B 4FUGA 4A1TA 1UCYH 3RXDA 3VB3A 4JK6A 1UCYK 1KY9A 4MTBA 1SC8U 2ZU3A 4AX9H 3S9AA 1TABE 4Y6DA 2GZ9A 4WXVA 2F4LA 2O9QA 2GP9B 1CHGA 1ZTLA 2NU1E 2L74A 1WQVH 4D9QA 1PYTC 2JJ2D 1CO7E 1GJ9B 4MNYA 2CK3D 3Q3KA 2ZCHP 3TITA 1BOQA 5GWZA 2A4GA 1W11U 1Y5AT 2VINA 3KIDU 1EZSC 1F0UA 1OYQA 1F92A 2WPKS 4K3JA 1BIOA 2JKHA 1GBKA 4O97A 1TRMA 1ETRH 2CGAA 1V2LT 2HLCA 1P2OA 4VGCC 1IQKA 1BUIA 1QFKH 1GJCB 2ZQ1A 3F9FA 1CGHA 2VIVA 2F9UA 1MAYA 1OP2A 4QT8C 3BEIB 4XBDA 4CRCA 1VITF 1GI4A 1J9CH 2Z3EA 5L30H 1C4Y2 3RXPA 2H9EH 2J98A 3EDXB 1SGPE 5FL7D 1HV7A 3UB0A 1LDTT 3ZIAD 1P04A 1CT0E 1AWFH 3ZZDA 1TMTH 5JYIA 3LU9B 1C5QA 1O2GH 2IPQX 1PPCE 4I8GA 1P9UA 1SGRE 4LK4A 1S6FA 1K0HA 1C9PA 4GSOA 2FESH 3FO8D 3OSYA 3RC5A 2KR7A 2V3MA 4X8UH 4YT6H 3SGQE 1MZDA 3QX5H 3BG8A 3ZZ3A 1CQQA 3BTWE 2PKAB 2ZFPH 5AF9H 1BRAA 1O35A 3W1EA 1ACBE 7KMEH 3SV9A 5DGJA 1S84A 1RTFB 1MD8A 3ENSB 1PPHE 1GBBA 1WU1A 3V7TA 5T6DA 4FVBA 2OQUA 1P2KA 2IJD1 3TIUA 2P16A 1T8LA 1XUHA 1V2RT 1MTWA 1KIGH 1N8OC 4DCDA 3SQEE 4XDEA 4GAWA 3VPKA 2Z9JA 2CHAC 3WY8A 1ZLRA 1Z71A 1GVLA 2AIPA 1GI8B 5F03A 1F7ZA 5E0GA 1DICA 3SJOA 4Q7ZA 1P2MA 2P3TB 2WHXA 4ABHA 1C1MA 1K1OA 1W13U 4X2WA 4X2XA 3NPSA 1GG6B 3E3TA 1A1RA 1ARBA 2FI3E 1NBME 3RMLH 5C0UA 3NCLA 3RXMA 3SUFA 3O8RA 4B75A 4JZFH 4ISOA 1F0TA 1EJMA 2PW8H 4A1XA 4I31A 1BHXF 1HAVB 2ANMH 2GT8A 1AMHA 1O2SA 1K22H 2KM0A 1S0QA 1OP0A 5DG6A 3BEUA 1SGFG 3A7XA 3TH3H 3N7OA 2ANWA 1ETTH 4ABGA 1SL3A 3ZVCA 3VB7A 2P3UB 1SKYE 2AGIX 4LXBH 1O2YA 2BDGA 2YOLA 2BD4A 4U30A 2ZA5A 3VFEA 1WTGH 2ZDMA 1C1WH 3R0FA 2D1JA 3UREA 2P59A 2XWAA 2RDEA 3PYHA 1ZHPA 1SLWB 1ZYOA 2LP6A 2ZQ2A 5FPYA 3O8CA 1Z8IB 1TQ7B 4X2YA 4WY3A 1QHRB 3CP7A 4DT7B 2HPPH 1K1IA 1H1BA 1C2KA 3DCLA 4ZHAA 2CMYA 1T7CA 1AHTH 1RTKA 3N7DA 3UUZA 4E06H 1O5GH 3F0PA 1IQHA 2AMDA 2ODYB 3MH5A 4NZLA 3A86A 1GCTC 4NWKA 3OTPA 4RN6A 3RXBA 3SQHE 2Z9KA 4IN1A 1AO5A 3D62A 1PPFE 3SJIA 1TFXA 1B7XB 2GKVE 2KCOA 5LH8A 1THRH 3NZIA 1PQ7A 1BBRK 1FV9A 3FOAA 4YESB 5CE1A 3L3TA 1KMHB 1MTNC 2JIZD 2TGPZ 3JZ1B 4Y0YE 1FPCH 2W7UA 1TGNA 2ZU2A 1XUJA 2FOGA 1VCQA 2GCHF 2F9PA 2R0KA 4BNRA 1AKSA 4OS1A 1GBFA 1WXRA 2OC7A 1A0HB 1O2PA 4NGAH 1V6DA 1EB1H 5JBAS 3OEED 2JH5D 1OPHB 3AVZA 4GPGA 3I29A 3GCNA 1FUJA 2XBXA 4PROA 3NUMA 2GTBA 2ZIQH 1BTXA 1COWD 3D49H 1O2VA 1AFEH 4NA9H 5AHGH 5EJLA 3LONA 1O2UA 1UTOA 4INHA 2FO9A 1AVWA 3LC5A 2PTNA 4IC5A 3MTYA 4ISHH 1NZQH 1OWEA 5DP4A 3CS0A 3UAIC 4FUJA 3FP6E 3Q77A 1L1NA 1TPPA 5HGGA 2FDAA 2G8TA 2OC1A 2BD8A 3BIUH 1O5BB 1BJUA 3LDXH 1ZTKA 3M7TA 1C2MA 3SI3H 1D9IA 4AB9A 2VWLA 2BX4A 3MO3A 4MPVA 3RXQA 4BAKB 4B74A 1IQJA 1S85A 2FLRH 2QXJA 1LPKB 1MKXK 1GI6A 2PKAA 3AW0A 1AWHB 1ZR0A 3T25A 2ZGHA 1SBWA 2BQ6B 1NY22 2W3IA 2A7CA 1SFIA 1BMAA 1IHSH 1CU1A 2WV9A 2OC8A 1P02A 4YT7H 3HATH 1VITH 2CJIA 1BZXE 2TBSA 4D8NA 1BB0B 3SNEA 2LELA 1L1JA 1YM0A 4UONA 3H7OA 1GDUA 1NFYA 4I8KA 2QXGA 4JZIA 1HAPH 4I33A 2VH6A 1AGJA 1VJ9U 2XYAA 3FVFB 4HGCA 2BDBA 4M9FA 1H8IH 1P57B 1RIWB 1OSSA 1YLDA 3GCHB 2ZP0H 1QRWA 3GCOA 3PRBA 1ABJH 3A87A 2ZHQH 3G01A 1V2WT 1YLNA 1GMDF 1ZZZA 2V35A 1BTZA 3PV5A 1Y5UT 3L33A 4H6TA 2RA0A 2WYJA 2J34A 3OY5U 3T26A 3E90B 3F9EA 1YPKH 4UFGH 4IC6A 1TX7A 2ZECA 1FY1A 5DP6A 3AAUA 4GHTA 1ZHMA 3GY7A 3AW1A 4ESTE 4X8SH 3SUEA 1VJAU 3IG6B 1T8MA 2Z94A 1O37A 1E0FD 4AN7A 1GMCF 2RCEA 1A5IA 4MLFB 1K1PA 5KGOA 1WBGB 1YBWA 4X1RU 1QRZA 3RUOA 1KXEA 1T31A 1YP9A 2AERH 2GCTC 2HPQH 2ODPA 2VH0A 3K2UA 3ITIA 3KQ5A 4XFQA 2JJ1D 1ZMJA 3F9GA 1EQ9A 1O3MA 2GGVB 4SGAE 4TT3D 1MCTA 2BDIA 1C2IA 1GI0A 1NU9A 4UD9H 1SGDE 4E7NA 1P11E 1O2LA 3E91A 4SGBE 4CRDA 4Q80A 4ZAEA 1E38B 2OXSA 3A88A 5CMXH 2BB4A 2A4RA 1TPOA 1QL8A 1A0LA 3LJOA 2VIQA 5CDFE 2TGTA 1KDQA 2F91A 1W2KH 1ZRBA 5CHAB 3SORA 1CGJE 3SU4A 1EOLA 5GDSH 1EX3A 2HNTC 3RXJA 3A81A 1HCGA 1O2MA 3E0NB 1M9UA 4JZ1A 4ACBA 2CHAB 4FVDA 1ZPCA 2QXIA 3SOSA 1GJ5H 5B6LA 1HRTH 3M3VA 3TJOA 3SU3A 1RFNA 4P02A 3M61U 1DLKB 2FYRA 3MNXA 3OU0A 1OHHD 5A0CA 1BTPA 1C2EA 1LHFH 3MO6A 1NPMA 3SI4H 1NRRH 1QR3E 1H9LB 1S6LA 4ABJA 5F8XA 2QF4A 4X0WU 3TPIZ 1XUKA 3PWCA 3NXPA 3QLPH 2ZGJA 3VEQB 2OBOA 3ZZ9A 1VCPA 4I86A 5EW1H 1TMBH 5A0BA 1LHGH 2XWBI 3V0XA 1UK3A 3GY3A 5ESTE 5DP3A 1EPTB 2OLGA 1O3NA 2SFAA 1QJ7B 1BBRH 3FFGA 4NSYA 3ZZ6A 5DO4H 3TK9A 2G4TA 4OS7A 5FPSA 1FXYA 1EUFA 3U8TH 2KAIA 1G30B 2GCHG 4ASHA 3UNRA 2UUJB 3F0OA 1W0KD 5IDKA 3F2GA 3SJKA 3GYMA 1MU6B 2W26A 4F4OC 1FIWA 4K5ZA 1KLJH 1GHWH 2BTCE 3RXGA 1ZTJA 2PSXA 2A0QB 4FUIA 2BD2A 5EU8A 2Q6DA 2AMPA 2AGEX 1EPTC 3P8OA 5C5OA 1MTUA 1SGTA 2BY6X 2QF3A 1BTWA 5L2YH 1QQ4A 2VVVA 4IGDA 1YPMH 4HZHA 4IBLH 4MG3A 4KKDA 3A8AA 2WYGA 3LGYA 4FU8A 5FXLA 1O32A 1ZPBA 4RKJB 3RXIA 2FTLE 4O9VA 3RXEA 1TA6A 1DWBH 2HNTF 2BM2A 1JIMA 1AD8H 2PLXA 2SNWA 1WOFA 1DUEA 2C8ZB 2AMQA 3LT3A 1NROH 1C5LH 2YMSB 2Y7XA 7ESTE 2C93B 1GCDA 1C5PA 2W5EA 3ATKA 1TMUH 1T8NA 2CF8H 2VJ1A 2D8WA 2KX4A 1CT2E 5I25A 2WPIS 2KCPA 3KEEA 1GHYH 1AB9B 3EA7A 1YCPM 2H5DA 5HMAA 1W10U 2IOTA 3EAJA 3PTNA 2FS9A 3SW2B 2P8OB 1C2FA 4FUEA 2HOBA 3RXUA 1DE7H 1G3BA 2F9BH 1P03A 3UIRA 2F3CE 5CHAC 3RU4T 1LKBA 1TRYA 1OWKA 2A4OA 5FCKA 2DE9A 1GJ4H 3UWIA 2XCNA 3ZVBA 4ZKSU 2RA3A 2CN0H 2BY8X 2V3OH 1D3QB 1B0FA 2J95A 2BDHA 1BMNH 4AFQA 1SQAA 4YLQH 8GCHF 2ILNA 3I78A 1SQOA 3HGNA 4OS6A 1SGFA 2A45B 1UHBA 4GCHG 3OAAD 1CBWC 2ZTZA 2F9OA 2QF0A 4O3UA 5KECA 1P8VC 4THNH 1GBLA 1C5XB 4GHQA 4LZ1H 3SU5A 3ZZ5A 1J17T 1C5YB 1W14U 2UUYA 2VU8E 1QGFA 1BT7A 2I6QA 2QC2A 1O2TA 1TGCA 1NRSH 1NU7B 2OD3B 1W12U 1MBMA 4CR9A 1GBHA 3UWJH 1JOUB 2A7JA 2PSYA 3KQBA 4DG4A 3M3TA 1EZQA 5C67A 1Z7KA 3H7TA 4KTSA 1O3FA 3HKIB 1J15A 1F5RA 4MNWA 4UFEH 2Y80A 1KXAA 3RLYH 3SHAH 5FX5A 5AFYH 1S82A 2A7HA 1CA0C 4FUDA 1O2KA 4X2VA 1SVPA 1BCUH 1C5MD 1MAXA 3K65B 4UFFH 4Q63A 4K60A 3TK6A 1GBEA 3PMJA 4X6OA 3VB4A 1XUIA 2Z3DA 1HAXB 3IWMA 5JB9S 1E34B 2BLQA 1TWXB 3MU4A 3VB5A 1GMHF 1ANEA 1QBOA 3MU5A 1DXPA 1V2PT 1O39A 3KYGA 3U98H 1BMMH 1O3BA 2PGBB 3PV2A 2PV9B 1ELBA 4YXWD 3VXFH 4I7YH 2VIPA 2WPLS 2AEIH 1KYNA 1SLXB 1T8OA 4ABIA 2BYAX 3P70B 3PLKA 1FY8E 2YMSD 1O3AA 2H6MA 1IQGA 1HNEE 3U28C 1QL9A 2KCYA 3OE7D 4XBBA 3S9CA 2ZWLH 1HAYB 3MHWU 2Q6FA 8LPRA 2KAIB 1BBRE 4BANB 3UFAA 1TA2A 4WVPE 1O2JA 3SU2A 3E8LA 1GCTB 1G37A 4CHAB 1Y59T 2ODQA 1XKBC 1A3EH 4Y8YA 2NWNA 3A8BA 1PPZA 2G51A 1Z8RA 4AG2A 1O3PB 3EA8A 3FN8A 3PV4A 5G4BA 5GPIB 1KTSB 1Q3XA 2WZQA 2FOMB 3EE7A 1EFRD 4Y11E 3V13A 2A2QH 5EJ1A 3BG4C 3KQCA 4MPXA 1LKAA 1QA7A 4GCHF 2QCYA 2FP7B 2K8IA 3P8FA 1Z8JB 1BA8B 1O34A 3SV8A 2ZU4A 1GHXH 1EJAA 1GMCG 3P17H 1GHAG 3GCTG 3TNTA 2DE8A 1LQEA 2G4UA 1P2JA 2QE7D 3HGPA 3SV7A 3SN8A 4AYYB 2FOEA 3WW7A 2J4IA 1WUNH 1O3HA 2Y7ZA 4MQAA 2BVXH 2BXTH 3Q76A 1P12E 4UEHH 4BTUB 4HFPB 4RI0A 4B76A 4AZ2B 3T2NA 1IQNA 3QN7A 4DVAU 1O5DH 1MMJN 2FLBH 3M5NA 2VWMA 3MQKC 5L6NH 1P2IA 5BPEA 5HKKD 1C2GA 3BG4B 3NRLA 3U9AH 1NFWA 4KP0A 4LZ4B 3MWIU 2QV1A 1LVBA 5A09A 3RMOH 1Q31A 1A3BH 4ZH8A 4E05H 1S83A 5H4IB 4BAHB 1EATA 2FODA 1ZMLA 1ANBA 4H42U 2FOFA 1QB6A 1BRCE 1C5UA 2P8OC 3STJA 1JRTA 3PMAB 1SHYA 1F2SE 3ZZAA 4ASUD 4B6EA 1TNHA 3GY4A 1PPGE 4MPUA 3RM0H 1OOKB 3DA9B 4RT1A 3RXRA 3RMMH 1YGCH 3LJJA 2WUBA 2ALPA 1TBRH 2P94A 2THFB 1MTSA 1RXPA 1KXCA 2TPIZ 1FY4A 1AUJA 1TQ0B 1HB0B 1ELAA 1LHDH 5JBCS 5T3HA 3VXEH 3T29A 2C4FH 1CVWH 2ZG0H 3ZYEA 4F55A 3P95A 3KNXA 5A0AE 4AB8A 3LH3A 1GBJA 1DWCH 4RSPA 1LO6A 1CE5A 1OYTH 1O3EA 1SGQE 2O8TA 4ABDA 3QWCH 3E1XB 4F49A 1EP6A 2GVFA 3HKJB 3N99A 1C1TA 5GCHG 1F5KU 3FZDA 2O8WA 3DSPA 3ZV9A 1O2WA 1SGYE 1GHAF 3GCTF 3ZVFA 1OWIA 3SV6A 1K1LA 2Z6BD 3FKSD 5GCHF 1SPJA 1YY3A 1ETSH 3KQEA 1O3OA 4INKA 3UPEA 4Y8ZA 1OX1A 4BAOB 5C1UA 1YPJH 3DHKH 1WAYB 3KHVA 2ZF0H 4Q7YA 3AK5A 1T4VH 1TALA 2ZKSA 2QIQA 3MH4A 4NA8A 3TK5A 5ETXA 2M2AA 3MH7A 2K1QA 3CS7A 1Y3XA 3TGJE 3EQ0H 1BMLA 3SNAA 5TCCA 3UOUA 1ORFA 2FWWA 4YTAA 1TPSA 1UVOA 1E1RD 3L6PA 4OS2A 7LPRA 1HAVA 2ASUB 5E8EH 3B23B 1T4UH 1Y8TA 5EQSA 1VITG 3RXOA 3WWBA 1CA0B 2V3HH 1AIXH 1TAWA 3S7KB 1DY8A 1A7SA 4R8TB 5SGAE 5JDUB 1JBUH 4I8HA 2R3YA 1UJ1A 3QUMP 1RJXB 1O30A 1ESTA 3SUGA 1CSOE 1VGCC 2EC9H 3PMBB 1V2UT 1NT1A 1OWJA 1YPLH 3CNRA 3RXKA 1TGBA 1O5EH 1UTLM 3ELAH 1FONA 1UVSH 1J14A 4ZHMU 2SNVA 1EKBB 3ODFA 2J5UA 3OY6U 4BAQB 2UWOA 2AS9A 2JETC 2JETB 2OINA 1G3EA 1UK2A 1IQMA 2WV5A 1UTNA 5DP7A 3OTJE 2VB0A 2W6ID 2Y6TA 1P3CA 4TSFD 3VG8A 1EAWA 2F9NA 1LHEH 2PKSB 3FANA 2Y5HA 5A8XA 3PB1E 4Y0ZE 2QAAA 3SHCH 1SI5H 3NWUA 5CHBA 1THSH 1GJ8B 1SG8B 4WH8A 1ZOMA 1G36A 5TCAA 1SSXA 3Q00A 3TJUA 5DKMA
chains in the Genus database with same CATH topology
1SR5C 1MQ6A 1EZUC 2PR3A 3LGUA 4NIYA 1SHHB 3PM3A 1DS2E 2BY7X 3A89A 2A32A 2PFEA 4U01A 1E35B 2ZHFH 3RU4E 4WWYA 5TJXA 1ANDA 2WPMS 1SGIB 4NFFA 1SOTA 1YLCA 3RC4A 4K8YA 1UVUH 1XMNB 3RU4D 1W3CA 1G3DA 1GBDA 2QN5T 4XBCA 2J92A 1K1NA 4OGYA 1EAUA 1C5OH 5AFZH 1YKTA 4A1VA 1LHCH 3Q3XA 1O3GA 4XOJA 2BD9A 2ZHWH 3IITA 1K2I1 1DSTA 2PHBA 4B1TA 2Y5FA 1GGDB 3RC6A 1FIZA 1MBQA 1V2VT 4FU9A 1L2EA 2OP9A 1NC6A 1TNLA 1H4WA 4JZDH 2BDCA 3SBKA 1GJ7B 2BLWA 4YOIA 4NIXA 1RTLA 4X8VH 3PTBA 2ZCLP 4AGKA 1LPZB 2V0BA 2A5IA 2ANYA 3SGAE 2PWXA 5FAHA 2Q6GA 1E36B 3ESTA 1A5GH 3RXAA 4D9RA 3GDUA 3ZZCA 1DLEA 4WF8A 2ALVA 4CHAC 2ZZUH 1RD3B 4I8JA 1OXGA 2GT7A 4Y8XA 1C2DA 4MNVA 1S81A 1FAKH 1HJ8A 3ZZ8A 2QY0B 5HYOA 1OKXA 1FAXA 1GHBF 1O2IA 3LIWA 5PTPA 1BRBE 3SJ9A 3A7WA 4UFDH 1O3CA 2FI4E 1NN6A 1KSNA 4CRGA 4X6NA 7GCHF 1V2MT 1P10A 2W3KA 5EXNA 4ZXYH 1Z8GA 1ZSLA 3A7VA 1LMWB 3HPTB 1TOMH 2VGCC 3FP7E 3HK3B 4NFEA 2FS8A 3GY2A 3U1IB 1AE5A 1NESE 1VZQH 2BD3A 1J8AA 3BTEE 3E16B 1TBQH 1NRNH 3U8RH 2FTMA 1CBWB 3RDZA 4BAMB 1GI3A 1V2KT 1O5CB 1H9HE 2Z9LA 1G9IE 1TLDA 3ZVEA 3UQOA 1KXBA 4XSKU 3SUDA 1TNIA 4Y7BA 4JYUH 3S7HB 1TBZH 3GY8A 1SQTA 4JZEH 1C1VH 1MZAA 1P2QA 4X8TH 1FN6A 5C5NA 1TPAE 1NTPA 4ABEA 1AI8H 8GCHG 4X1PU 2Y81A 3BTFE 4TPIZ 1QNJA 2FX4A 4NIWA 2GV6A 1GL0E 1Z6EA 1ZMNA 4DY7B 3I77A 1EZXC 1BTHH 2ZU5A 2XC5A 2TGAA 5E0JA 1RGQA 5A2MH 2B9LA 2BY5X 2ULLA 4ZROA 2AH4X 3A82A 1C4U2 5A8ZA 2C90B 1GL1A 3AAVA 4BOHA 2FOHA 1K1MA 1N6XA 1FQ3A 1HFDA 4DOQA 2CV3A 3CENA 2XBVA 3JZ2B 3F68H 1P0SH 1TNKA 4DIIH 1P9SA 1O2OA 1YF4A 1FZZA 2R2WU 4D7FA 3U8OH 3V12A 1CT4E 4E7RG 5C1YA 3GYLB 5J4SA 1S6HA 4D76A 1FI8A 1D3PB 3TH2H 1THPB 1EOJA 3UR9A 1DDJA 2B8OH 4YOGA 4RKOB 3MU0A 2ZNKH 1TNJA 2ZFQH 2OUAA 4JYTA 1DY9A 3KN2A 2J94A 1Y3WA 3ZVDA 1QA0A 1IQIA 1JMOH 3BV9B 2NU2E 4ZKRU 1FJSA 1W0YH 1ELCA 1KLIH 4ISLA 1DXWA 2XC0A 1ZGVA 5DPAA 2EI7A 3MFJA 1AE8H 2ESTE 1ANCA 2Z3CA 2G5NA 2PGQB 4IS5A 5HM9A 3P8GA 1TIOA 2HRVA 1CGIE 1UTQA 3GCHC 1OP8A 1RIWC 3A85A 1EJNA 1O2HA 1SGNE 7GCHG 4ZKOU 1MD7A 2BLVA 2ZTXA 3E6PH 5LPEA 2WUCA 1TX6A 1HGTH 3BIVH 5J4QA 5FPTA 6LPRA 1JXPA 2TIOA 2O8LA 5EW2H 1LPGB 1O3LA 1GMDG 4A5TS 2BD7A 3ZZ7A 4B2CA 4Z0KA 3T5FH 2BVRH 2AIQA 8KME2 3KL6A 4B71A 1O3KA 1IOEA 4B73A 1GWAA 3UY9A 3SNDA 3EA9A 1WSSH 2BQ7B 3BSQA 3SO3A 3BEFB 2HVXA 2VNTA 2CXVA 1GI9B 2VIDA 4ZMAH 1TX8A 2WINI 1L4ZA 2TGDA 1SMFE 2XCFA 4ZHLU 1GI5A 2H9TH 1SOZA 5IYTA 1A61H 3AASA 3A7YA 5F8ZA 1NO9H 1D4PB 1X7AC 2UWPA 1GI7B 1SFQB 4X1NU 4DW2U 1QQUA 3P92A 3ATIA 4KELA 1FMGA 3OYPA 2ZDVH 2Y5GA 4INLA 5LGOA 4O03A 2A5KA 1DWDH 4B2AA 3T27A 2BXUH 1V2JT 5C1XA 3D65E 2VIOA 2ZHEH 3VGCB 1HAZB 2BDAA 1T32A 3O8DA 3M36A 3ATWA 1B0EA 2YNBA 3F1SB 1XXFA 1C1UH 1HXEH 1AZ8A 1UTMA 4MDSA 1PPEE 1H9IE 1O2QA 2XBWA 3NKKA 4CBNA 1YC0A 3M5OA 5JBTA 1ARCA 4CH2B 1MKWK 1XUGA 4DURA 5C3NA 4DIHH 3TGKE 1C5TA 2ZGCA 1IQEA 4DJZB 3URDA 2H5CA 2CF9H 2OCVB 1YPEH 3UTUH 4A6LA 5JB8S 5LPFA 3A8DA 3SU0A 3K9XB 4YZUA 3RM2H 2J38A 2PTCE 2UWLA 2VWNA 1Y3VA 2FXRA 4IN2A 2P93A 1C1RA 5E2OA 1XX9A 2YNAA 4KTUA 2OBQA 1QB1A 2IPHA 3M3SA 1ELEE 5EPNA 4Y7AA 5ESBA 2AYWA 4GLYA 1ESAA 1GJ6A 1VR1H 3EE0B 3DFJA 2PUXB 1HAHH 4ABFA 1S5SA 1Z1JA 1MKWH 2XBYA 3LC3A 3SU1A 2QXHA 3TJNA 4K8BA 1SLVB 5ABWA 3FAOA 1OWHA 3ZVAA 4Q7XA 1AKSB 3QK1A 1QRXA 3SV2H 4K69A 1TE0A 1C1SA 2VVUA 2FMJA 1YPHE 2EI8A 4ZKNU 2AGGX 3RLWH 1CA8B 1ELGA 3LGWA 2IN2A 3BTTE 3ATLA 4CH8B 4NG9H 3A83A 1BRUP 3C1KA 2GCTB 4Y71A 2B7DH 3BTKE 1LVMA 1W7GH 2FOCA 4OS4A 2UUKB 1BJVA 1ZJDA 2O8UA 4ZXXH 1JRSA 1CHOG 5F8TA 2ZGXH 1O2NA 2W7SA 4BXSA 1A4WH 2Z7FE 1BTYA 2EEKA 3PMHB 5GIBA 1HLTH 3URCA 2R3UA 3M5MA 2BOHB 2NU3E 2ZO3H 3KGPA 5EODA 2FZZA 1K21H 1GI2A 1EAXA 1KLTA 1P06A 1E37B 1YPGH 3QGNB 2R2MB 1HJAC 3U69H 2GDDA 1C1QA 2XTTB 2ZC9H 5EXLA 1FDPA 1NS3A 1L0ZA 2VGCB 3V3MA 3OX7U 4JK5A 3S0NA 1EB2A 2BQWB 4Y79A 2M5TA 2XNIA 4U2WA 2SGAA 5EGMA 1J16A 1KXDA 2QYIA 1XVOA 5DP5A 1DITH 1Z6JH 1LCYA 1QTFA 4YM9A 2Z9IA 4CR5A 2C8XB 1GVZA 4AOQA 2D26C 1QURH 1UTPA 8ESTE 1UTKA 4ISNA 2XRCA 2ZTYA 6ESTA 4JMYA 2BMGB 5K7RA 2ZFFH 4YOJA 1C5SA 4CRFA 1MU8B 4X1QU 3O8BA 1IAUA 3QDZB 1NRPH 2GMTC 1YYY1 1AY6H 1GJBB 1DX5M 1A2CH 1G32B 1GBCA 2SGEE 2Z9GA 3RXSA 1A46H 2GX4A 3ATMA 4FUBA 6CHAB 3UQVA 3QGJA 1AZZA 1W7XH 4U32A 2FOBA 2BOKA 2EA3A 3ZV8A 1SGEE 1HAIH 1GHBG 2BHGA 1PFXC 1O5FH 1NRQH 4JCNA 2RG3A 1EXFA 1GGDC 4WMFA 1MQ5A 2PKSC 5GJ4B 1PPBH 5BRRE 1ELFA 2G52A 1PQ5A 1INCA 1AU8A 1F0RA 1DPOA 1NFXA 3NK8A 1LQDB 5T6FA 1GBIA 1BITA 1MTNB 5FBIA 5K0HA 4KGAA 5A8YA 3A84A 3UR6A 3KF2A 1MUEB 3R3GB 2VWOA 4FU7A 3ODDA 1Y3UA 3Q3YA 2R0LA 2A2XH 1FPHH 4MNXA 5EPYA 2ZDAH 1OWDA 1HIAA 1O33A 4H6SB 1D6RA 4Y76A 1EASA 2ZCKP 4ABBA 3GOVB 3SJ8A 2OTVA 4K1SA 4FUFA 3GY6A 5DP8A 2TRMA 4CRBA 9LPRA 3TNSA 4AFUA 1TB6H 3MOCA 4BXWA 1MTVA 1OS8A 2STAE 1ZRKA 1KTTB 2FI5E 3MU8A 5I46H 2BD5A 3E0PB 1C5WB 4WJG2 4A92A 9ESTA 3QO6A 5DP9A 2F9VA 3MI4A 5E0HA 3KCGH 4NA7A 1XUFA 4X6PA 1K1JA 1O36A 4IW4E 4B2BA 2NU0E 2ZPRA 3C27B 2BY9X 3PO1B 2FYQA 1ELVA 1O2ZA 4YLUA 5HXFA 1P3EA 6GCHF 5AVDA 5FHTA 1PQAA 1C5ZB 2G5VA 4I8LA 1SLUB 1TNGA 1RS0A 2BX3A 2FIRH 2A5AA 2P3FH 1EP5A 1AQ7A 1AVGH 4Z6AH 1EAIA 1G2MA 1VCWA 5T6GA 3UNQA 1V2NT 2G81E 3K6ZA 1GVKB 1P05A 1C1PA 1FLEE 2A1DB 2XW9A 1C2JA 5L2ZH 4ABAA 1TYNA 4CREA 3GICB 3A80A 3M7QA 1JIRA 1TGTA 4MVNA 3RXFA 2C8WB 3F9HA 4X6MA 3MNBA 3STIA 1V2ST 1ZSJA 2SGFE 4H4FA 4K2YA 3KQDA 1PQ8A 4XE4A 1O3DA 4NSVA 4AFSA 5EXMA 1Z1IA 1XM1A 5F6MA 1GHZA 3DUXH 4R0IA 4ZUHA 1EPTA 1N8OB 1GBMA 4CRAA 1HAGE 2OC0A 1MKXH 1V2QT 4CBOA 1TONA 3QZRA 3RP2A 1G2LA 1GG6C 1TRNA 2OQ5A 1F5LA 4AG1A 3MMGA 2P95A 1KDQB 1LVYA 5HM2A 1ELDE 2O8MA 2STBE 2A4QA 3TJVA 1LVOA 4I32A 3T28A 1A5HA 5JBBS 4TWWA 2D2DA 4WH6A 1SB1H 3PWBA 1GBTA 1IQFA 1BDAA 3VB6A 1N6YA 1HPGA 3A8CA 3LKWA 1ZHRA 3LOXA 4K1EA 1QL7A 1DM4B 1Y3YA 3M35A 4NIVA 1ELTA 3W95A 1W0ZU 3BF6H 3P6ZB 3S69A 1ID5H 2HWLB 3SGBE 3PO1C 3B9FH 1BQYA 3MH6A 2NU4E 4WXIA 3FZZA 1UMAH 3H5CB 1GDQA 1S0RA 4UDWH 2BZ6H 1VGCB 2VIWA 1ZJKA 3ZVGA 2H1UA 2ZDKA 2SGQE 3S9BA 5EQRA 1O2RA 4TY6A 1C2LA 2DUCA 3EYDA 2I6SA 2H2ZA 3DT0H 1C5RA 1DT2A 2ANKH 2GMTB 1QIXB 1SGCA 1WTHD 1QB9A 3GISB 4MPWA 4TWYA 1V3XA 2HGTH 3A7TA 3A7ZA 1GJDB 4A7IB 3W94A 4FXGH 3SU6A 4ISIH 3PLPA 3RXCA 2F83A 3ZZ4A 1U6QA 4KTCA 2BVSH 2ZFRH 2AFQB 1NFUA 1V2OT 3BTDE 1XKAC 1RRKA 2ZFSA 2R9PA 5GXPA 4J1YA 4GUXA 2H9HA 1HAOH 1WV7H 1HBTH 2ZGBH 1MCVA 4FUHA 2SGDE 1XVMA 3M37A 4VGCB 4AYVB 1UCYE 1G3CA 3UOPA 1V2TT 1BTUA 1DFPA 2B5TB 1C1OA 1WCZA 2BDYA 3TLOA 3BTGE 2G55A 6CHAC 2QA9E 1FY5A 1MH0A 2ZEBA 1UHBB 1D3DB 1QBNA 2FOAA 5LPRA 5FX6A 2SGPE 3TVJB 1H8DH 1C5NH 1QCPA 2XXLA 6GCHG 4AGJA 2ZPQA 1Q2WA 3TH4H 5E2PA 5EOKA 2JH6D 1AB9C 1WYKA 2WV4A 5FCRA 3FP8E 3RXHA 1GHVH 2FM2A 3F6UH 2VVCA 1O5AB 1F0SA 4GVUA 1DOJA 3MO9A 1QBVH 1YPHC 4NWLA 2ZDLA 3EGKH 1ZPZA 2V6NA 2ZFTA 1C9TA 4D7GA 1P01A 3MNCA 4WMEA 1AVXA 1QJ6B 3UNSA 3D23A 4J2YB 3RMNH 1FY3A 1D6WA 1P2NA 3MU1A 5FBEA 1GBAA 1UVTH 2LPRA 1HJAB 3M7UA 1C2HA 1TOCB 3ZZBA 1B5GH 2JH0D 5JPMH 1DSUA 1TGSZ 3SNBA 2ZHDA 3DFLA 2WPHS 2C8YB 4OS5A 4TPYA 3M5LA 3BTHE 3TU7H 1C4V2 2HNTE 2GD4B 2ZI2H 3SNCA 1AUTC 1HUTH 3LGVA 4K1TA 1K28D 1AFQC 2ZU1A 4HTCH 2FEQH 1ZSKA 1GDNA 1HYLA 1C5VA 5C20A 1UTJA 1O2XA 2ZDNA 2EI6A 2GZ8A 4X1SU 3PROA 4AORA 3PLBA 5DJ7A 1QY6A 2BZAA 2J9NA 4UE7H 1LTOA 1O31A 4M7GA 1O3JA 1Y5BT 2C3SA 3BN9A 3GY5A 3QZQA 3T62A 2ZPSA 1UK4A 1CHOF 1GMHG 2GZ7A 2GV7A 1L1GA 1PJPA 1FN8A 2XC4A 4Q2KA 2LNCA 1D3TB 2RDLA 3VGCC 2QGRA 2BLOA 1IQLA 3BTME 1ZGIA 4BTIB 2A31A 1XXDA 3LPRA 1DWEH 4HI3A 4DGJA 1GI1A 1O38A 2Q1JA 1A0JA 1W8BH 3RXTA 3DD2H 2UUFB 1UVPA 4TY7A 1ABIH 2HALA 4BTTB 3B8JA 4OGXA 3ZYDA 1NM6A 3P8NA 2Y82A 1P09A 3TGIE 4O3TA 2IJOB 5DK1A 3RXVA 3U1JB 3BTQE 2FPZA 3MNSA 2GDEH 1IHTH 1PYTD 1AN1E 1O0DH 2G00A 4NZQA 5B6OA 1DANH 4WMDA 1HXFH 3LGIA 1AFQB 3LGTA 2PUQH 1HIAB 5EQQA 3SZNA 1ESBA 1DUAA 1C1NA 1KXFA 1FNIA 1HDTH 1WQSA 2WPJS 3GDVA 4IMQA 1DVAH 1GPZA 1YCPH 5EG4A 1JWTA 2J2UA 1K9OE 3RXLA 4FUCA 4IMZA 4JYVH 1N1LA 3LH1A 1QJ1B 3GDSA 4Y10E 1L4DA 4YO9A 4LOYH 2B0FA 3QTVH 2FX6A 4TYDA 4AFZA 1HJ9A 1YCPK 4NCYA 1O3IA 3K6YA 3QTOH 1UO6A 5C2ZA 3MYWA 1GJAB 1BHXB 3HK6B 4FUGA 4A1TA 1UCYH 3RXDA