5E0QA

Crystal structure of the nup98 c-terminal domain bound to nanobody tp377
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
QVQLVESGGGPVEAGGSLRLSCAASGRSFSNSVMAWFRQAPGKEREFLSVLNWSSGRTSIADSVKGRFTMSRDPAKITVYLQMNGLKPEDTAVYYCAASNRGSLYTLDNQNRYEDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobodies: site-specific labeling for super-resolution imaging, rapid epitope-mapping and native protein complex isolation.
pubmed doi rcsb
source organism Vicugna pacos
molecule tags Transport protein
molecule keywords Anti-Nup98 Nanobody TP377
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e0qA00
2ITDB 1IKNC 2PETA 3MV8D 3EIFA 4PY8I 4PRIB 1ADQL 2ADGA 1J05A 3LRHA 3UTSE 3BESR 4O2EA 2A6JB 1F6LL 1BIIB 3NA4A 1JPST 5D71L 1A6PA 3P9LB 1CFQA 2XWJA 4NRZB 4JGJA 1FG2B 5J1AA 1KYOJ 3VXNB 1ZHKA 4KRMB 1IGTA 4DQOH 5IR1A 4J1UB 1JGVH 3BIBX 3L3GB 5DMKA 5F7MC 2E9IA 2WBJD 2VUYA 1WC7B 2EC9U 2DI7A 3EOAB 1KCSH 2X4PB 4WI3A 3GMMB 4N8VG 1XH3A 3DIFB 2EXWD 5E5MB 4NQVB 4AY0A 1DR9A 3ULVL 4IHOA 2YN5A 1FVDA 3CK0L 3WE6B 3CMOH 4X8JA 3S36L 4XBPA 2C3WA 4PLNC 1PLGH 5IP4A 3REVB 4LEOB 4D9LH 3GSXB 5HHNB 4DUXA 1GVIA 1KJMA 1S9XA 4PTUB 3SGJA 5C2BH 1A6VH 4DOHB 3V0VB 1ZT7A 4KQ3H 3J7HA 3LD8C 1FFQA 3MRLB 4PJ8D 1C1EL 4KJYB 3IJYB 3MGTB 1YECL 3B8SA 1S7VA 1ZVYA 3FQTB 3RUGA 3HI1A 3VFMB 3IAQA 4LGRB 3EO1A 1JHTB 4L5FH 5L2JA 1TJHL 1NGPL 3VXQA 4XNUL 1KTLB 4ODTL 3U6RA 2OZ4H 5AYUH 3PABA 1EGJL 4LLYB 5E8DL 2D9CA 4MS8D 3GZKA 4YXKH 3AAZB 3NFNB 3DVIA 1HDMA 1DQLH 2BDNL 3C5ZA 3KS0H 5I1AA 2CR6A 3LN5B 1M7XA 2DJSA 2WW8A 3PL6D 5KAQF 2P5WA 4YLQT 3C09C 1KEGL 2VNCA 4LLUB 5HVFB 1SJHA 2CDFA 4HFWA 4HK3N 4K94L 1DE4A 2JTDA 2VXQH 1I8KB 3MLWH 4K3DH 4JGMA 1KXQE 3QEUA 2A1WL 2OL3A 2VLKA 3VG9C 4NNYA 1UC6A 3L95A 1KLUA 3H0TB 2MHAA 4JHZA 1CXHA 1N0XH 4XNZC 2X4NA 4JDVA 1OSZA 3N50A 4PLKD 2PW2B 2AEPH 5C07A 1ETZA 3IDMB 1L7IH 1SJEA 1Q1JH 1KJVA 3VG0L 2MQ0A 5HVHC 4LIQL 5CKGA 3UTTD 5LXGH 4HHAB 3S37H 3U7WH 5GJSL 3T0BA 3HAEB 3HI5H 1VENA 2PKDA 5E99H 1D5IH 2HTLD 4RMTA 1UB5B 5AUMB 5F8RC 5TE6H 1N4XH 1QBLL 3IDIA 5DVKA 1U2HA 3LKNA 4BFEA 2YSSB 4LKXB 3L5HA 4Y5VA 4P2QB 1I9JH 3DV4A 5FF6A 1UJ3A 4JFPB 4LMQI 4ETYA 2XY2A 3DXAA 5CGYC 3V95A 4MJ4A 4U6VH 1UWGL 1IAIL 1VFMA 3GGWB 4EN3B 1DVFD 3RGVB 4Y19D 5GGTA 5EBWA 2AAVA 1EXUA 4Y1AA 5F1SA 3UDWC 4ERSL 1I1AC 3L9RA 4ONOA 3D0LB 1RU9H 2ZOLA 4QRRA 4KXZI 5D2LF 2BJMH 4PG9B 3EAKA 5AWNL 5C0BA 2J88H 1JGUL 3FB8B 1FNAA 3QCVH 1LK3H 4NM4L 4OFDA 5ITFB 5C08A 4KTDL 2H9GB 2HH0L 3L7EA 1CK0L 4MDIA 4FS0A 5CEZH 4WGVB 4DGYL 4GKNB 5CJ8A 4UAOB 3BPNC 1A7RL 4YHIA 1WICA 3VFRB 1BBDH 3BDYL 3TT1H 4JVWA 2HFEA 5L2KA 1EO7A 1Z6JT 3NIGE 5C0BE 1HCVA 1NGWB 3MV7B 2HTLC 5D6DA 1UJTA 2YPLE 1ZLVH 3NTCH 4A6YB 1D6EA 1NBQA 3MLUL 1CQYA 1ZXQA 5HDQH 5SX5H 4KQ4L 4I0CC 1KULA 4XTRC 1G7HB 4FXKA 1XCTB 3BPLC 4H26A 1RI8A 4LNRA 2XQYG 5FUCC 2IBZY 3WSQL 4X4ME 4BSVA 5FKPA 4M7KH 5DEZA 1MQKL 1XGQA 3HZVA 1RIHL 1D9KC 3L3KA 3O2WL 2XRAH 3O3EB 4FQPA 3RA7H 3MNWB 1AQKH 4LSVL 3X13B 5EOTB 4ODSL 2P45B 3F7RA 1XGYH 2V2XB 3DNKA 2X89A 2DTML 2DN7A 1G1CA 1U2CA 5H2BA 2L7UA 4UU9A 3WUWB 4UI2A 3FHAA 4OB5H 5B4MD 1T21A 4IIQB 1L9NA 3NFSL 1FN4A 3MOAH 5CMAA 1S8DA 1QRKA 2VZUA 3DETD 5H94A 1AQKL 2BVYA 2DL2A 2R0LH 3C8KB 5FUZL 2FJFA 4IEFB 2BXYA 2J8UF 3WHE0 2OTWB 1KLFA 1NCWL 4NJ9L 1KXTB 3QCTH 2ED9A 4HV8A 4LSSH 2AABL 3C8DA 1EJOH 5T3ZE 5I16B 4Q97A 5ISZB 1IL1A 2OL3B 4LCCC 2DQFB 4GRLB 3WBDA 1KGCD 2BNRB 2F19H 3M8OL 1HQRB 3R0NA 2P49B 3OG6B 3B4NA 3MNVB 1X7QB 1T7ZA 3DX6A 3ZKXC 3QIBA 4P5MB 1AJ7H 4JO2H 3H9SD 1X5XA 3K8MA 3MLRH 5FM5O 1I8MB 4HSQA 2R4SH 4JY5L 4IIQC 4OLVL 3X3FH 3WD5L 4PJAA 4PJFA 1CK0H 1UM6H 3HE6C 5IESH 4NWUH 3BPLB 3AU1A 4TNWK 5FIEA 4RFEA 4HUWA 4ZXBB 4LLVB 4EDWH 4G42A 3WHXA 2ZJSH 1WSST 3MRBA 1ND0A 4QRUA 4LLAA 4XI5C 5EO1A 3KPNA 4PV9A 3T4AA 1KEML 1RJLB 1INQA 4L4JA 3SE9L 3FQUA 2YWZA 5DJDB 3T0XA 4G80A 3O9WB 4G6AC 4N90E 4H1LB 2CLZB 5DQ9A 5FHBH 3HRZA 4JKWA 3WIIH 2BVPB 4GMSL 4F2MA 3G5YB 4JZNA 5J0BA 2VDKH 4ZO8A 1CYGA 1QSFA 4G6FD 2HJFB 8FABB 4YFEA 3LEVH 1YEJL 2LVCA 1BQUA 4QF1B 2W65B 4X4XA 2C7UA 1XF4A 5TE6L 5L88H 3JWDH 1OP5H 1BQHG 5ANMB 3OGCB 3DYMA 3BD4A 3OKKA 4XWGL 2GITB 1D7FA 3I2CH 1Q1JL 1E6JH 4M93C 4CU6A 1LO2H 2EYTB 5F1IA 1P1ZB 4WDIA 5E00A 4LVNC 3WFDL 3D9AH 1CCZA 3WFBH 4KJPC 3QUML 3P0VH 4YDIH 3PDDA 2VIRB 4FFYH 3T8XA 5EPMA 1CFBA 2GQHA 3OXSB 3VXOA 5I1DB 2XOTA 5EBWB 2CH8A 1VADB 4Z7OF 4WI6A 3OKLB 5J1SC 1PZ5B 2V17H 4KH2A 2GW5A 3O9WC 3QPQD 1S7RA 1ZMYA 3HFMH 4P5TA 3VH8B 1S7XA 3BYTA 2BRQA 4IBLT 1P2CA 4FQIL 4LASL 2OJEA 3O6KH 1KUMA 2A9NL 4ETQA 5D9SA 4G8GB 6CGTA 1R3LB 5F9AC 3I85A 2OZ4L 4MQTB 4XP5L 3P4MA 4L4TA 5D7IF 5I2IA 3ARYA 4DZ8A 4HKXA 4ZAKC 1A7PL 3QI9A 5TDOB 1X6NA 2PYED 3H7BA 4XZUB 3GSRA 4Q9QH 1GYAA 3TZVB 1ZLWK 3GKZA 3JTSB 2CIKA 3GRWL 2XPGA 2D4DA 3IDMA 3T0ED 4E41A 1C1EH 4APQB 5DK3A 1BVLA 1F4YL 2A6IB 4X98B 4Z7NF 3CNKA 4RISL 1H8SA 3B6SA 3U2SA 3QJHB 4ODWB 3W9EB 2ED8A 3QEUB 2Y5TA 2VLLA 4X7CC 4D9LL 5GGVL 2ADFH 5DJXA 3QA3B 5CZKA 5HVHB 4OLUL 3LKPB 2EIEA 5FO7B 2WBWB 3FJTA 3RZCA 1NFDF 3UZQA 5GZOC 2GJ6E 5DS8A 4EI6B 5C6TH 2J5LC 2CDGB 1G9NC 3ZO0A 4M7JH 1NUGA 5J6GB 3L3JA 4V1DE 4OZHA 5TGBB 2NXYB 3IXTB 1HZHH 3EYVA 1P84K 5HTSA 5E03A 4WENB 4KMTH 4LPWA 5DUMH 3STLB 3MYJA 3H3PH 4GQ9H 2DQJH 1FGVH 3GKWH 3QFDB 5GGQH 1RZFH 1YN7A 4WV1C 4ZXBA 3M45A 5IMMA 3A6BL 1NAMB 4XMPL 2QADB 4ODXA 1U92B 1JK8A 2AVGA 2HJLA 4PTUA 2FX7H 2Y23A 5I1KH 4F37K 4Y2DB 4QRSA 1SVCP 1B0RB 4Y5YB 3QB7C 5LJYH 3QIBB 3WYRA 3BHBB 4K23L 2KH2B 5EOQL 1UQSB 2XZCH 1U8PA 1TZIB 5ECJE 3TEUA 5DRZA 1IGYB 4U3CA 3FHQA 1LNUA 3RWCB 3U0PB 1YY9C 2ED7A 3TA3D 1VGKA 1RIVL 2D3VA 5DRNA 3H9SA 2V2TA 3KYKH 5A2KH 2GK2A 5C0FA 2WSKA 5D1ZD 3VXUE 5EA0H 1FYTB 3RTQA 3F5WB 4DK6A 3KS0J 3BKMH 1CR9L 3ROOB 4ZAKB 3PWUA 1Y18B 1FL6B 3JTSA 2A38A 4PTTB 1S78D 4K9EH 2VWEC 1T1WB 1AO7B 5DA4A 4NT6A 4QCIA 4RNRB 1LK2A 1KB9J 1W72B 4UUJA 5KAQG 4G8GA 5CGMA 3ARGD 3BWAB 1VSCA 3OKNB 2XQBL 1TPXB 5CUSH 4WFED 4PJ8B 5SWZB 1P4LA 3MUJA 2F54A 2B39A 2F5BH 1BQLH 4IRSA 4Y16C 2DD8H 3HE7D 3V6FB 3SO5A 5IM7A 4PS4H 4OM1H 3VXPB 1MRFH 5SWSD 2IPKB 1AH1A 4ORGB 1R3JA 1U93A 2YD4A 2VIRA 1NMCB 4C56B 2DMBA 1DZBA 4CMMA 1LP9E 3OAUH 5FA3B 2DI8A 5GGRB 3JBG7 4J4PD 3NCYP 5I1EH 3BGMA 4KROB 1UJ3C 4NQCA 1QUNA 1AHWB 1J11A 3MCLL 1L9MA 2R0ZL 3AVEA 4OTXL 1VPOH 3TZVA 3C5SA 3WFDH 1LDPH 4X4YB 2C4FU 3KWWB 4WWKA 4HK0B 5J89A 3WL9B 1QLEL 1U9KA 2E6JA 1F4WH 4BZYA 4M7LH 2DLFH 3N85H 3WIHL 5F7HA 3GBLA 2IANA 4KDTA 3ZKMD 1ZLUH 3VFTA 3QDGE 5DD0L 5E8PB 4G43A 3GJFK 1G9MH 3HC3L 4ZOEA 1OM3L 1A14H 5I19L 1FC2D 4Y1AE 1SEQH 3ZKQD 2CDGA 4U3XA 2DM3A 4QHNA 3UYRH 3DO7B 4GRMB 4PJIB 2WZPD 1WAAE 3U46A 5BS0B 1M6OB 1F45A 1FL6A 2GI7A 4XP9L 4AM0A 3QDJA 3MNVA 3CDGB 1SEQL 4FFVC 4H1LG 3FRPA 5HHPB 4HX1B 4BSJA 2R0WH 4K3HA 2BNRA 4Y89A 1WIPA 3MJ9H 4QT5B 1UWEH 3LIZH 3I9GH 3QWRA 1WZKA 3LPWA 4C55A 1YEFH 2YOCA 2AJSH 1BP3B 2DB8A 4RAVB 2BNQD 4GKZA 3PQYA 5IWLA 5LWYH 4UB0L 4JE4B 3ARFC 4LNRB 3Q3GA 1FVCB 2R0ZH 4OTXH 4W6YB 5C0JA 1CDBA 3LS4L 3HI6H 3WHE1 4LCIH 3BIAX 4WHCA 4EJ1C 3EGSB 3HC4L 2VL5A 1LVEA 3G6AB 4GRWE 3KPSD 3MLRL 3U4BH 3DMMD 4YXHH 1YQVH 3ULUF 5IVXE 4NQEA 2X4RA 3O8XD 3F7QA 4LP4A 5C8JB 1QBMH 3BT2H 2HTKD 2OMBA 4I3RH 4V1DA 4KC3B 4LHJB 4ZUWB 1RD6A 4FMKA 2ADIA 3WIFB 1G7MA 1YN6A 4S0TD 1ZS8B 4IJ3C 3MV7D 2XQBH 4QHMB 3L5XL 2OSLA 4I77L 5D1QC 4CBPA 2W0PA 3CSYA 1P7HL 1T89C 2ZOKA 4JRYE 2ZCLH 5HGAB 1YYML 4UIMA 5T33H 5I1AB 4KRLB 1PEZA 3D6GA 3EBAA 4NQDD 1ZHNA 1RZKL 1F58L 1BEYL 1U58A 3U6RB 3UPRA 3Q1SL 5AAMA 5CEZD 4PJHF 1TVBA 4WO4C 5D1XA 2NY3B 1A9EB 3VD3A 1AHWC 4OF3A 1OW0C 5D7JD 3FN3A 3KYNB 3T77A 5JW4N 5FYJH 1K6QH 4HHAA 1REIA 1BZ7A 4TOYH 3MRQA 4JPWL 2DJ4A 1B90A 1U3HA 4WGWB 3MBEA 3RA7L 3I6LD 5K59E 1BD2D 1WQVT 1RIHH 1TTGA 2BVPA 1CGTA 1T7XA 2Z4QA 4APQA 1XCTA 3E3QE 5L2KE 2DQUH 1V3MA 2VAAB 3T4AB 3TH4T 1F42A 1SQ2N 4NZTL 1TXKA 3GSWA 5CJXA 3BSZL 1MOEA 1GH7A 5D1ZA 2OTUB 5JDSB 1UWXH 5JQ6L 3MLUH 3IGAB 4JM2F 5HDQL 5ETUA 1K9TA 3TYGH 3ZDZE 4GKZB 5F7FA 4NCDA 1NJ9A 4OGYH 2ZNXA 2NY5C 4LVEA 5D8JH 5JOFB 2YSSA 4GQ9L 3F65A 1DQDH 4GMTL 3NIDF 4LLYA 4NSKB 2NW2A 2YZ8A 4CADB 4LMQE 3UTPD 3TPUA 3VXQB 4Z5RB 2HJKA 3LS4H 1CD9B 1NCCL 5HDBE 5A2FA 3MC0A 3BP5B 2BJML 3PGDA 4GW5A 4D2NA 2HMID 1M6OA 2YBRA 2J12B 3CLEH 4XVUD 1OPGH 3AMLA 3BZ4B 3UTSD 5TH2B 1T2QL 4GXVL 2IADB 2EYTA 1G7HA 2R0WL 1RJZB 4LKXA 2C1PA 1OGAB 5MEPB 1FSKC 2J5LB 3DBXB 3HN3A 4MJ2A 5LVEA 1RZ7L 4JFDA 4NQTA 5FKAB 2VDRH 3PXJA 4GW4B 3SQOH 5L2KB 5EIVA 4PRPA 4FXGA 3PJSA 4ZS6D 5I19H 2VDLH 3BYYA 1UA6H 5IF0B 3VXSB 5IIEB 3HI5L 1F4YH 1ETZB 3GBMH 1XZ0A 1MCOL 4CN1A 3PQYB 4N9OB 1G7QA 4RMVA 5CP7A 2NY6C 4XPHL 5KVMC 4WV1B 1I3GL 1MPAH 1JTPA 1X5YA 3L9RB 1LDPL 4GAGL 4NUJA 3U0WH 4WEBL 1B0WA 3MCLH 1LP9F 2P8PB 5DUPH 3SDAD 2LQRA 5KOMC 4KVNH 5IFAL 3HZVB 3GI8L 1RVFL 4D8PA 3PGFL 5CHNA 5SWZA 4PJDA 2DLTA 4MS8C 3MRNB 4Q6IB 5B3JF 2EKSB 3BP4A 2NXZC 2JKXA 3DXAD 1P9MC 4X6BB 1CS6A 5J6GA 1JPTL 4UIMB 1I85A 3RL1A 1JF1B 3NCBB 1RVFH 2C4FT 4Z0XB 1A3RL 3WLWC 4GW4A 5HHMD 4MZ2A 1U3JA 2X4TB 5E8NA 3DUHA 5AYUL 1OP5K 1P69B 2MJWA 3QFJB 4Z0BL 3QUMH 4OAWB 3RVWD 4IRJD 3RVWC 1YDPB 1TJHH 1MPAL 3F5WA 4F9LA 4FQLL 4J23A 3O11B 1FFRA 3I2CL 4K3EH 1OL0A 3BKJH 5EU3B 4ELKA 2YD9A 3BE1H 1YECH 4QRPA 1MCOH 3I6KB 4C4KT 1MJ7H 4P3DB 2YRZA 1FC1A 3RP1A 4WW2C 1YUHA 2ZZUT 1OAYH 1HE7A 5I75C 3OKDA 2OR7A 1XEDA 3C8KA 3STZA 3BKML 3BIKA 3F12B 4JPVH 3MLZH 4JFFB 4XNYH 1KB5A 2WBKA 5GRVL 1NC2A 3CZJA 4AEHL 5CD5C 4GRMA 4PJIA 1PLGL 4Y2DA 2OR9H 4LEXL 2G9HA 3O45B 4MNQA 2EICA 5GJTL 5JDJA 2CK0H 3GHEH 4JKPH 4FQXA 4YX2L 3W11D 4RMSA 3ES6B 4K7FA 5IMOA 1T2QH 5C9KA 5EOQH 1NBVL 4R97C 1OPGL 3VXUD 5JIKA 4YBQD 3QISA 1KCSL 3M1BA 3H2WA 3QO0B 3KPOB 3RGHA 5C0IA 1K85A 1NMCC 4Y4HC 3TJEL 1NCCH 5E6IB 1QVOA 2G60L 5TDPA 1LE5B 1JGVL 4U49A 5FGRA 2VAAA 3GBNH 5D2LA 3FT2B 3IXAA 2BX5A 4OLVH 4XH2A 3UBXI 3FONA 2DYPB 3R06B 1Q9OB 1MCDA 1NC4D 1H3WM 1I1RA 1ADQH 1NDGB 4R4ND 3KLAB 4PJEE 2CKBA 4J3TA 1MRDH 2X10A 2F74A 4U1SA 4WW2A 1KYOK 1NAML 3OKKB 3HLAB 2GTWA 3QG7L 3LSOB 3KPMB 4LIQE 2ESVD 2YEZB 1TTUA 1U8KB 2FEEL 1OAUL 4JFFA 2CDEB 5ACZB 4QRPD 3BAEH 4GRLC 1QEWA 3VFGL 2ZG3A 5FECA 5GRWA 1DEDA 2NLJB 1JIBA 2R0LL 4RNRA 5FUZH 1I4FB 2HG5B 4HJGA 1P7QD 2ERJB 3I50L 1ZT4A 4ZUVB 3BH8B 3G5YA 4JZNB 4P49A 1OVZA 2ZKHH 4Y1AB 2XXCB 3GO1H 4LGSB 4PJ7E 2ADFL 3FQTA 3O3BB 4XPGL 1WUNT 1YDPA 5H35B 5F7EH 1OF2A 3STBA 3WHXB 1BM3H 5JR1L 5D1QD 2R2EB 1JFQH 1Z0NA 3O81A 4RGNE 4Y19A 4D0CA 2QSVA 5C9JB 4KZEL 4U0RB 3D39B 2Z31A 4NQEB 1WFNA 3IJHB 1IGJA 4NQSB 5L8KB 1QFWM 4LSVH 4EOWH 2ZCLL 1IRAY 4HBCH 5GGUB 3WFHA 1DLFH 3GMNB 4XCNA 4WO4B 3QHFH 5I30L 3SDXB 3BW9A 3ARBD 1FV1A 1NC2B 1HHGB 2KQMA 3UTSA 2RGSA 2PCPA 4X6FB 5C0JB 2GCYB 4P9ML 5DK0A 3STZB 1XF5A 5GRJH 3ORJA 4LBEA 3UEZA 1HH9A 5KSAB 4DZBB 1P4IH 2BMKB 1FNGA 5D1QB 1JHKL 3TBSB 1S78C 4MVBD 3U2SB 1A0QL 1J1XH 3U4BL 3K46A 2Q76A 4UNUA 1BBDL 3BDYH 3OXRA 4XBEL 5BV7C 2HKFH 1N26A 1F4XL 4E41B 3DSNA 3HC4H 3QUYC 4U6YA 4QRRD 4XP1H 3ZDXE 4ZFFB 1FO0B 4KTDH 4YHLH 1S8DB 4ZUSB 1GGUA 2RAMA 1KGCE 3SDAA 3GIVA 3RBSA 4G9FA 1IQDB 4JHBA 5DF0A 3QBTB 4ZSOA 1MWAH 5EOCL 5HI3C 4LLQB 2AEQH 5C86A 5I1LA 4K8RL 5J3HD 2FWOA 4NQDA 3FO2A 3MV7E 4RDQG 5D7LB 1YN7B 1KFAL 5C09E 4TSCH 2HVJB 3ARGB 5GGTH 2EZ0D 5IT2H 3MRMA 4BH7A 2B0SL 4BH8B 3BP5A 5IB3B 1R5IA 4NO5A 3HZMB 5LBSL 1Z3GH 4GMSH 2HVKB 4TSCL 4PRNA 4CJ1A 1TQCB 2AERT 1A14L 3Q0HA 1UKSA 3OKMA 4YDLC 1DQML 5FYLD 5HYJB 5INCA 3S34L 4PRBB 4R3SA 1KBGH 1C7TA 4OIIL 3QIUC 2IH1B 2DLFL 3N85L 4L3EB 2W91A 2ZSVA 3NZ8A 3SGEI 5CFHA 2AJZB 4G7VH 1SVZA 5F8QC 5L9DH 4XHJC 5F9OH 2NY4D 4NWUL 2X9YA 1LO0L 4HC1L 2HFEB 2W59A 1UEYA 3QXWA 4Z7UA 1MLCA 1H8NA 2VLRE 4NRYA 5DJ2A 3V6OA 1F4XH 3VJ6B 4KV5E 1WBYB 1R6VA 1U8HA 4HQQL 4UOW0 5KSAC 3V0AC 1J1XL 3QAZB 2MCPL 1MJ8L 3BUYA 3DX8A 1RURL 3T08A 3BEWA 2QHRH 1VEOA 5KW9L 3TVMD 5IV2B 3ROOA 4MSWB 2V5SA 4Y4FB 1J9CT 1NGYB 4F33A 2QADD 4HJJH 2FZ3B 3GMRA 3DOSA 2UVFA 4LAQH 4X5LA 1RULL 2BSSA 4HCRA 5DHVB 3QUKB 1H15B 3MMEA 3R1GH 3Q6GL 4P4KD 4OD1H 2JB5L 1Q9LB 2YXMA 4R8WL 3U0PA 3GI9L 4MNHA 1J8HD 4NM8L 5HYJA 1UT9A 2IBBA 3FO9A 4K9EL 5FGCB 3TPKA 4LSQH 4O51B 3IGAA 1U8IB 1IAKB 1V3JA 5C3TA 1XR9B 3WS6C 1HI6B 3KHOA 5E08L 4UDUA 1CL7H 4OB5L 3CFDB 3JWOC 2NPLX 1UCBL 3UC0H 5SV4A 1L7TL 1KJVB 2NZ9C 3HG1E 1G6RA 3T8XB 4Z76B 5EORL 3TH2T 2FGZA 3U0TA 3F6IA 2AJUL 4EBQL 2VISB 2ATKB 5I1LB 3CK0H 5I1IL 4ZTOL 2IMMA 3CPLA 3HUJA 3PQYE 4PJ5E 2OM5A 3CU1A 3V5DA 1CGWA 2Q7YB 43C9A 4HGMA 3PNWB 3SDDA 4F57H 5IVOA 5MENB 1NCBL 2HFGL 3MOBH 3QRFM 4AENB 2BNQA 5MEOB 1BOGB 4IOFD 2BNUB 4HXBH 2YZ1A 3ULSA 4KKCC 3OGOE 3ARDA 4LRIC 4X7EC 4MAYC 4CN4A 5B3JE 4MD0B 1S7SB 2JK5B 5D71H 4J4PA 5KZCD 1I8MA 5IEKA 4P2OB 5JORA 3C60D 3QIUB 4JDTH 5MP6L 1T2XA 2BY2A 4H25B 5C0EA 1I1FA 3DMMA 1QR1A 1DUYB 2G60H 3DXAB 3ZDZF 1K4CA 1FHGA 1PDKA 1NEZA 2VQUA 2VDPH 2F54D 3F62A 5BW7A 2IAMA 3F7YA 3P3YA 4KKBD 4UQ3B 1NBVH 1FVEB 1EEUA 3UTQB 2O5XL 3O6LL 5HHME 1BZ9A 2HRPH 1ZAGA 2J1KA 3WCYA 3MROB 3O8XC 1PKOA 1TVDA 2HKHL 2IBGA 4XNXH 4ZFOA 2B5IC 4PD4J 2I26N 4OT1H 3WS6A 2OR8A 4MD4A 3GMRB 4N0UE 4JFYB 3SO3B 2YXFA 4N8VA 4LSRL 1YEHL 1FVDB 2XN9E 4L4TB 5I2IB 1K3IA 4JPKH 1Z5LA 4IMLB 3NZ8B 4ZNCD 1RY7B 4IDJH 4ZPVB 4GS7C 2H32H 4O2CA 3HTLX 3DRTA 3AC0A 3OB8A 2NY2C 1N4XL 4LPCA 2ATKA 3C6LA 4PRBA 4R3SB 4UBDC 2ZUSA 2BERA 1W8NA 3L1OH 1MFDH 5K9KB 4XC3H 2FB4H 4G3YH 2KBGA 3G6JA 2Q20A 1IGFL 1PZ5A 3SKOB 1EXUB 2AXGB 4NJAH 4JZJB 4RSVA 2AK1L 4Q9CA 2OXHA 5DYOB 4MQXC 2AJZA 5F96L 3HLAA 4QHNB 1OAZL 4JFPA 3DVGB 5EZLB 3IFLL 4PP2A 2A77L 15C8H 2VXQL 3MLWL 2JK5A 3DUUA 4PGZA 4UMGA 5C0RL 1XFPA 2K7QA 5L6YL 3G6JE 4ACPA 5BW7C 1NSNH 2HT4D 4RQQB 5BO1L 5IFJA 3R06A 3NZHL 2YA2A 4OI9A 4P5KB 3MV7A 4OBSA 4LDLB 5C0RH 5E9DD 3O3EA 1LO5B 1MH5B 5EZOH 1DQLL 3GI8H 1MIEH 3TBTB 2AJYL 4YHIB 1FFOB 3DVFA 3KPRA 4ONGL 3V5DB 3GHBH 4P2RE 1Y6NR 5E4EB 4V1DB 3QXTA 3L7EB 3PP4H 1QSEA 4OZ4B 5HPMA 4JFQA 4JFEB 3OX8A 1R3KA 1RJLA 3MV8A 1YEIH 3TIEA 2UZIL 4LBEB 3ET9F 4NHCL 2FB4L 4G3YL 2RHEA 4UZGA 3GIVB 2XQYK 4L8DB 1M05A 2E6PA 3FB5B 4UNTA 3ZSSA 1PG7L 3KLHD 1KIQB 4Z6AT 1T04B 2E9WA 3RWDA 3BFOA 3TO4A 3KAAA 1X5ZA 3PWNA 4FFZH 1KF9B 1YEJH 3WFZA 3PP3H 4JPKL 4XPBL 5EFIB 1K2DB 3K1KC 1WC7A 1FL3B 5I0ZA 1Q9KA 3F7YB 3JWOH 4TULL 4NKIH 3EJJX 2ID5A 4OQTL 3D39E 3MRGB 1AGBB 2R1YA 1C16B 4MAUH 1QSVA 4HUVB 4KJQD 3VD7A 3WKMH 2H41A 3WN5B 5I15H 4H25A 1MF2H 5I8KL 4WFHD 5D7IA 2FDBP 4EN3A 5FM5M 1A6ZB 5AD0A 3CFEA 3GSUA 4L3ED 2LE9A 2AXFB 1HWHB 5I17A 3UCRA 1CT8A 4XPBH 4QTIL 3GSVB 3GNMH 2EH7H 2NMSA 1FRGH 4NFDA 4R2GB 4Z7WA 4JO1H 4BQCA 2X1PA 5EIIA 2CSPA 3MREB 1YNTB 1A6UH 2NLJA 5GSRB 4IS6A 1KIUA 2OTWA 5E1AB 1MLCB 1JNNH 3AREB 4XBGA 4H0GA 3F58L 4NYLB 4DJMA 3DSFL 2YS4A 1RHHA 3M8OH 1BGXH 4OLWH 5FYKD 3PWNB 4DEPB 4P2RA 1PY9A 4E41E 4POZC 4QRSB 3OXRB 3HUJF 5FEBA 4JB9H 3M17A 5TQ0L 3HAEG 2FJHB 2XFXB 1HKLH 4Z7UE 2F9BT 3VFNA 3QHZH 3VRLF 2BMKA 2P46B 5KBNC 4J3WA 4LKCB 4MNGA 4Y2DC 3RAJH 4LDOB 1CU4L 3HMXA 3SE8H 2GJZA 4YHYC 4TYUA 4IRSD 4XVJH 1CFSA 5IM7B 3U82B 3MACL 5HY9A 1LE9A 3MQIA 2ICWJ 3W11C 2OZ4A 3QHTC 2CKNA 3V0VA 4ZOCA 1IAOB 3QZWG 5AG9A 1T7YA 1JWMA 3OV6A 3LCYA 3B9AA 5FOBB 3I3DA 4QTHA 3CFKB 5F1NA 4ZSOB 4PIRF 2Y36H 4Z7WB 4KRNA 1FBIL 1XGYL 4ODSH 5IEHA 1Z0MA 3ZHKA 4WHTA 4JFZL 5SWQB 4ZXBC 5DMGD 2ENSA 3AM8C 3TF7C 3ZDXF 5JIIA 2V2WB 2AGJL 2XZAL 4I77H 3DX8B 3WSQH 3L3HA 3QDGB 1MRCL 3OXSA 5DQJB 4QGTA 3V4UL 2XY1A 2AV1B 3D18A 4YQXL 5IROC 3ARQA 4LLDA 5K9KA 3GSOB 1QBML 1YEHH 4R2GC 4GG8B 2W60B 3V52H 3ES6A 4K7FB 3GMLA 3HZKA 4IM8A 1K2DA 4H20L 3MRPB 1KIRA 4U0QB 1QRNA 1CICB 1I3RA 1AKJA 3ULVD 4KROD 3TO4B 3HPJB 3EZJB 3E6HB 4OZIE 4PY8J 1KB5B 1QP1A 2HA1A 2WV3A 3C09B 2BC4B 4X4MA 2HH0H 2OXGA 1A6WL 5F1NB 3FFCB 2AQ3A 3OKOA 5L9DL 1JGUH 1PKQA 4IS6B 1A8JH 4KROC 3TIDA 3RVVC 2NW3A 3CVHA 1RU9L 3GSVA 4DKEL 2EDKA 3QNZA 3AREC 4LSDA 5E95B 3O11A 3PHQA 5GIRA 1TJIL 3WNMA 1HYRC 2LABA 4Y5XC 1U8JB 4PJXE 5D72H 5FA4A 4U6VL 2A6DA 4JVUA 2R56L 3DHMA 1GAFL 1N6QH 1JF6A 2ZPKL 2PO6B 4Y19E 5JPMA 4X7DC 5F97E 3CCHA 1F90L 4ENEC 5IT2L 3INUH 1IAII 1WWCA 2Y72A 3KPPB 1RZGA 3NCEB 1UFUA 3C60C 4NOBA 1CGSH 1UKQA 3EYQD 4OD2A 4ZAKD 5KSBA 1CFVL 4D9QE 3CLFH 1T66D 1GGTA 4OV5A 3P9WB 1AD0A 4LIQH 4CW1B 1KPRB 2O5YL 4ZTOH 2YEZA 4RGNC 1E4XH 3QP3A 4N5UA 4FFWD 4EN3C 3PWLB 4PGEB 1AGCB 2CKBH 3MREA 1JRHL 5C0DB 5C70A 1AC0A 1R0AL 2R2BB 4MA7L 5F1KC 3ZL4L 4DZBA 1CL7L 4AQ1B 2Y7QA 5KVFL 1CT8B 1KCVH 1OP3K 4KK9C 2XFXA 1T03H 2XZQH 5IB1A 3RUGB 5EBGA 2KL6A 3PE9A 2FEDC 4PLKC 1U8JA 5FA4B 1IVLA 1NLBH 3KXFE 1JHKH 3MRBB 1YEKL 3P11H 3VFUA 2ZSWB 4U1MB 2NY5H 1BQLL 4HW6A 4PJXB 1BIHA 1PKQB 1A02N 5C07E 1W0VA 1AR1D 5C0AD 3ZHLA 3C5JB 4ODTH 4Q58C 1BHGA 4U1IA 2I9TB 2Z31B 4OF5A 5ENWB 5H2BB 1R5WA 3RL2B 2BVQB 3F7VA 4GS7B 4AIOA 4G8FA 4BKLB 1SM3L 4D8PB 5HHVL 4P5MA 5EUOE 1OT1A 2XG4A 2P1YA 1TCRB 1HINL 5GS0C 3UPCA 5D1ZB 1NLBL 4M1DL 1QYGL 2P8PA 5C0CB 1ZSDA 5J4MA 3V4PL 3VCLA 4HEPG 4UTBH 4DCQB 3TN0A 1GOFA 1OARH 1AIFB 1CR9H 1IL1B 4LHUG 3TVMA 1CDIA 1N5YL 1SYVA 2ICEA 4FABL 2Z4QB 1MI5B 2WAHA 5E2VL 3LHPL 1AGDB 1E4XL 5E2JA 3MV8E 4G9DB 1IC4L 4UILL 2XTJE 4LPVA 4YE4H 1T0NB 1T04A 5CMAB 4ZPTA 1HXYA 3QIBC 1ROWA 3GDBA 5DJAA 2X4TA 2YN3A 4PJ7F 1IBGL 4L9DA 1GC1H 2C1PB 5ILTH 2ESVA 1FH5H 1AR2A 1O7SA 4R6UA 3DX7A 3L6FB 1JYNA 4LCCA 1TITA 2HLAB 1R3HB 3K81A 4F2MB 2ZPKH 5DUBB 5EWIH 5D1ZC 1G6VK 2HWZH 4BFGA 3VRLE 1EAPA 2WLZA 3KPNB 4PV9B 4U6TA 3IAPA 3D0LA 4KV5F 4YHZL 3QR2A 5EOCH 2GSGB 2IH3A 5GGQL 4OJFL 4DKEH 4CADA 2EECA 4NO0B 4BH7B 2OMNA 3TV3L 2UZXB 5C0AA 3LKQA 1FG9C 3EJZC 1UJ3B 4PB9L 4PJ8A 5C0CE 3QUZA 4Y4HB 3MBED 2VUOA 4BSWA 4U2ZA 1FYTE 3P77B 4GG6B 1A6AB 3QYCA 4IRJA 1C5CH 3V6OC 4G6KL 4J8RB 4M7JL 3QDMD 1MCQA 1U8LA 2B7DT 3DROA 4C83A 2E8ZA 1DN0B 3MBEC 1U3HC 4NWTH 2Z93A 3QEQB 3SDDB 1J8HA 4LEXH 5IVXA 1DDHB 3PWPD 2NTFA 3IFNL 4GKNA 1AKJD 4XMLL 3V5HB 5CAYB 3H42L 4KAQL 5EIIB 2X9XA 1J1OH 4M8QA 4JDVB 2E7CA 3VXTB 3MLZL 1TQBC 3G9VA 5ID1A 1U8HB 3MV11 3WO4C 5HI5C 4W70A 2IQ9L 2DQIH 1ZSDB 5FO9B 5K9OA 4ZS6C 4HFUH 3LY6A 4RGMC 3S97C 2HN7B 3IAGC 4QHKI 2VXSH 2CLVB 1UZ6E 3BDXA 1CQKA 1RUPL 5E5RB 4LU5L 5CBAB 3DO7A 2Q6WA 1T21B 4IIQA 4JFHE 1U95A 1ZWIB 5ENWA 1IQWL 3RWGB 1FL3A 5HYSG 1N5AA 3LKNB 2FHFA 5F88A 1SY6L 4LGPB 1FCGA 4PRHE 5A2IH 1ACZA 1UACH 5GS1B 5J57B 1GCFA 3OJDA 2YC1A 3MXWH 2F8XC 5ESVA 3OWEA 1M05B 4HX1A 2NY4B 1C8PA 3VFVA 5LGHH 1OAQL 3NA9H 1QD0A 2WBJA 4JM2A 2Q87A 4MVBC 4JKLA 1NCNA 2GFBB 5ID1B 3MJ7A 3OHXA 1EEYA 1MCKA 1YZZA 5HYJD 4ZO6A 2FSEB 3GB7A 4XCYB 1LO2L 2YD5A 4RGMB 5DFVD 3RNQA 1EFXD 5F7LB 5MEOA 3QUZD 3ULUD 5DJAB 4J4PC 1OB1A 1V7MH 5ISZD 3PNWA 4GKSA 3PWPA 8CGTA 4HK0A 5FO7A 1JNNL 5J9PA 1ZLUK 3LN9A 1N7MH 1WZ1L 3BP7A 3BRDA 3CD4A 3GNML 4KK5C 2VC2L 4KI5D 4PP2B 4Y4FC 2HT2C 2EKJA 1IGMH 2EE2A 3LKQB 4L4VB 3L3IA 4PB0H 1OSPL 1L0QA 1A2YB 1UB6A 1BVLB 1EFXA 3O6FA 2JJTC 4PYHA 4GXVH 5F7YC 5DMYA 1DLHB 5JW5A 1JZ2A 4YR6A 4H88H 4I0PD 2JE8A 3IF1A 3BP6B 1HHHB 3JV6A 5T3XD 5KVGL 3HNSH 4HUUB 1YEEL 1OSPH 4NKIL 4L8SB 1QFWH 2I25N 3WNLA 4HKJB 3NACH 2QHLA 5D7JA 5E6IC 1U0QA 1WISA 2P43B 4OLZL 3L5JA 4U05A 5BZDB 2R29L 3IJSB 4AMKH 3VWKC 4RBPK 1PD6A 5IHUL 3UDWA 3MSPA 1OD7A 2BOCB 1PG7W 4HGKC 1MJ7L 5EIQA 4ZFOB 1K8DA 3PHSA 3K4DA 3C87A 4NQEE 4PV8A 1NC2D 1KIRB 4K3EL 4WFGD 4YBLC 5FFLA 1JMZA 1YC8A 1MVUB 1YNLL 1ZT4B 5KJRL 5BJTA 5GGSA 4MQXD 1N8ZB 4KUZH 4R4NC 5FM4A 1PX3A 1PVHA 5MERA 3AS3A 3SDXE 4X7SH 1IGTB 3FZUC 1CE1L 2DDQL 3GHBL 3SGJC 2YPVH 4OUOA 4EXKA 1HH9B 4X7TB 5E8EA 3B2UD 3OAZH 2XWJB 3ZYOA 4YAQB 2F54B 5T1LD 4D0BB 4UOJA 4G8FB 4LRNH 3WKNA 4P2OA 3SDXA 3HR5B 7FABH 4R4FL 4EI5C 2CUHA 5HYSA 3Q5OA 2OI9B 4U1IB 15C8L 2R2HA 1RUQH 4NKOB 1BX2B 3GM8A 3QXVA 3G04A 3SKNA 3U0WL 3DUSB 2VB5A 2DTMH 4PJGF 1G9NH 1Q9WA 4NJAL 4LU5H 1F58H 4E5XA 4OIAA 3VFUB 4L4VD 3NIFE 3KJ4C 4ZAKA 3MYZA 3VRIB 2XN9A 4HWBH 3VGFA 3RVXC 3EO9L 2NY6B 4N0UA 4OCNC 3KPOA 5CIPA 4I2XB 4CVWA 5ID0B 4M7KL 4HMDA 3IDXH 3RWIA 4LLQA 5GSVA 4ZG1A 3LEXA 4P59L 5T3ZL 3VWJA 3K2MC 1AO7D 1U93B 4HIIB 3T1FA 1ZV5A 5JHDB 4JZOA 5BJTB 1TNNA 3KPSA 5C0GB 3RVXD 2B1AL 3GSXA 4FOMA 2MQ3A 4RX4A 4U3HA 1XZ0B 4FA8A 2XPGB 5H37G 3VXRA 3NCJL 1FO0A 5DQDH 3RPIA 4NP4H 2WM0A 4CW1A 3NTCL 3EDFA 3SHSA 2HRPL 5IB2A 2DQGL 3O4LE 1MAMH 4JRXE 5BZWB 4PJXF 1DL7H 1QSED 2R0KL 1OGAE 3CSPA 2VLLB 5GXBB 3U48A 2DM4A 5EO9A 4M7ZB 1NLDH 4YXLL 3U9UB 1A1MB 2OJEB 5ICXA 1J88A 4HPYH 5I1GH 2XKSA 2R8SL 3KXFD 4QRTB 3KJ6H 1S7XB 3BEVA 3SDAC 3QDMB 3VRIA 1SBBA 4OAWA 1HHJA 5GRYA 5MP6H 3THMH 4TRPL 3KHQA 1IFHL 5DDHA 4AM0B 5D7IB 2A73B 1T1ZB 2VLRB 3BUYB 5JOPE 2DQGH 1JYWA 5C0IB 4YHZH 3WUWG 4GSDL 1UWGH 4BK4A 4FQQA 4BFIB 3P4MB 5DQDL 4ZD3H 4P23C 1R3LA 2ATPA 2DQCL 1GRWA 5FOBA 2VZ3A 4O5LL 1I9JL 3A6CL 3QIUD 5J1TC 1JWUA 3ARGC 1LP9A 4JN2A 4Y4HA 3FN0L 1V3KA 1JTOA 1ZGLB 1Z2KA 1NGXB 1GC1L 1MCCA 2VLJA 1F97A 1EERB 2W9EH 2J4WH 3VH8A 5I1CH 2YUZA 3HC3H 5E99L 3E8UL 1I3RB 1T80A 4L3EA 1OCWL 4OCXH 4Y5XA 4OLYL 3O6FB 5IHZB 4N8CH 1MIML 4ODWA 3MUGA 4QO1A 2WMPA 2IANE 1TQBB 5D5MB 3FOMB 3B6SB 1VPOL 1G7QB 5EORH 4FQ2H 1V3LA 3VFNB 1NBZA 4MA8L 4Y16D 4R26H 4HIXH 4P3WA 5I66A 1VEPA 5I1EL 3P9MB 3CVIH 4NO3B 1JMXA 3T4YA 1DSFH 1X5GA 2MOVA 4K3DL 3P2TA 3V4PH 4Z8FH 3HG1B 1RZKH 5LQBL 1U8QB 3B9EA 4LRNL 4ZPTB 1MI5D 4MXVE 4R0LB 3S35X 4PBXA 2YC1B 4LQ1A 2ICWA 3QDJD 1GZPA 4OZIF 3KYMA 1TPXC 2XZZA 2C5DC 2XWTB 2F5BL 4YXKL 3L5XH 4JRYD 1ZHNB 2OJZL 4OLXL 4ZUSA 2DDQH 3U30C 1JTTA 4X7SL 4FFWC 4APQD 4EN3D 2Q6WB 5J7CC 1EK3A 5GGVY 5I17B 2BSED 2IAMC 1XGPB 4K7PX 4L5FL 3RZCB 3MNZA 1G9MC 4PRID 1N59A 1U8OA 1DQQA 3BD3A 3EFDL 5TFSH 3NVQA 4KY1H 2Q7NA 3FFCD 2I07A 3PGCB 2B2XL 4MX7B 1RFDL 2C3VA 1UGNA 2VDMH 5J11C 1FZJA 4F9PA 3QDAA 5KVFH 3GEWB 3CVIL 3OZ9H 1LO0H 4HC1H 4X98A 3NACL 5DT1L 3RUGF 5I73B 5J9PB 4HIXL 1ZWIA 1JRHH 1NFKA 5BVJA 3HI6L 4YO0A 3BHBA 1OT2A 4NN7B 4M4PA 1QLRB 4WUUA 3RI5F 3G5ZA 2EDJA 1MSPA 4H88L 4J8RA 4WTXA 2HJLB 3DBXA 4EIGB 3D69B 3KYAA 2W9EL 2PR4H 1LEGB 5HYFA 4TSAH 1ZGLP 3A6CH 3MRQB 1QBAA 2X4UA 4AJ0A 2XN9B 1Q0YH 4RMWA 3QFJA 5JW5B 5EU6E 3D39D 5DJCA 4GBXA 4Y4KD 4AH2B 3S98A 1QQDA 4KJWC 2Q8AL 3UTPE 3IKKA 1YMHB 3DV6B 1AE6H 1X5JA 2NW2B 1HSAA 5L0QB 5I73C 4PJBB 4WFHE 3FTGB 3V6ZA 2ILLA 4XCFL 2G5BB 1IEHA 5TQ2H 2XYCA 5FYJD 4H26B 4HULB 4RWYH 3F7PC 3MR9A 4CU7A 2IG2H 4UV7H 2IEPA 3PABB 3ULVC 3DVGA 5EZLA 4ISVA 1TCMA 1KTLA 5IUSA 4WUKL 4A6YL 4XP1L 3PL6C 5F6HI 1J5OL 4EDXA 1TIUA 3QWOB 5JW4Q 4POUB 5I8EA 4X7TA 1OAQH 3NA9L 1CXEA 3VDCA 1U8MA 3RDTB 1OGAA 2NY3D 5CSZA 3UJJH 5DEGB 4XXDA 3W39B 3QNZB 4JRXA 3MV9E 2B1HH 2AEWA 4S1RH 5DK2B 1PGRB 2X4QA 2IALA 3TO4C 2VH5H 4E41D 2R23B 2P8LB 3RU8H 1FNLA 4Z95L 4C56A 1A4KB 3RTQC 3TIDB 3DRTB 4HBQA 5J56B 2FGWL 1ONQA 1WFOA 5GS2D 1NMAH 1FFOA 3KPRB 1NFDE 2J6EH 3D1MC 4S1QH 1QVOB 3VRJB 4GXUN 4QRUB 5T3ZH 1P7KA 4MDJB 4P59H 2CR3A 1AY1L 4PJ5A 1PG7X 2XIDA 2QQKH 5D93B 3MLYL 4YGVA 5EU5B 4HWZA 2LU3A 3RWJA 4XPTL 1RUML 1D6VL 3GMMA 4PJ7A 1D9KA 4QYOB 3RY5A 4QXWA 2G75A 4R96A 1MEXL 3E1F1 1UG9A 4KZEH 1MCHA 1WLHA 5DHVA 3UTOA 5JR1H 4OGAC 1BM3L 4NT6B 4QCIB 4YIQB 4X9GA 1UB5A 4I48A 1BJ1J 4I8DA 4H5SB 3O0RL 4H0HB 1AIFA 2DJUA 1XGUA 1NGYA 4KAQH 1PW3A 3NCMA 3K2UL 4S1RL 4GAJL 1TFHA 4JKMA 1A9BA 3QO1B 5HYQA 1RZKC 2YPLB 4LVHC 5L8LB 4J3XA 1FAKT 2ENYA 5D7LE 3JWDC 4K23H 3TBVB 3FOLB 2H26B 3I3BA 4Y1AD 3C5JA 1EVUA 1CDYA 4FMFA 2YPVL 1DVFA 5C71A 4ODUB 5D93C 4ENED 3EHBD 4PJXA 3TM6A 2QTEA 5TQ2L 1FDLH 1V7NH 1BGXL 1QA9A 4OLWL 4QWWD 3AROA 2D9QB 2EDHA 4TUOB 1AGDA 2XA8H 3QUXD 2E7HA 2GK0A 2APXA 2G5BA 4E0RA 1EUTA 3GJFH 3HRZB 3PHOA 3VGHA 1FGVL 3GKWL 3LEYL 4KHTL 1KG0B 3RVUD 4LSPH 3ZDYE 4X99B 3H3PL 3QG6B 3QJFB 4OLZH 1J7VR 4B53A 1NEZB 1WT5A 5EWIL 5MI0C 4Z76A 1T0MB 3VCLB 2Y07L 4S1SH 3EO1B 4KMTL 4DCQA 3TVMC 1D5ZA 1QFWL 3KR3H 5LAXA 4I48B 3GGWA 1T6VN 4TVPE 3MRMB 1KC5H 3WIFA 1OTSC 3HKFA 4XRCA 3PWVB 2EDOA 4MCYB 4BSVB 4MLSA 5F21B 1FYHB 1RHHB 2VDQL 4P4KC 5I15L 4O51A 5C6TL 3UPRB 1FO0L 3FQRB 4NN5C 4ZUUA 3NABL 3IDYC 5E4EC 4PY7B 4FXKB 3EOTH 2UYLB 5HGGS 3O41B 4PB0L 5IMKB 5E2VH 1YA5A 4YDKL 1MHCA 1P7KB 5C09A 4JPVL 4FABH 2VLRA 1I1YB 4L8CA 4XVUC 1NGWA 1A7QL 1T0NA 1QLFA 1QHOA 3VXSD 1WK0A 2ZCHH 3ARDC 4ONFL 4GRWF 5HYIA 4OCSH 4KFZC 1JZ5A 3VXRD 5DK2A 1EDQA 3BE1L 1RK0B 5JXED 4NNPH 1FFNB 3EFDH 4Q9QL 2BNQE 4YBQC 4YHKL 5M95B 2ZUUA 4NIKB 4NKMB 2PYEA 4DEPC 2ZCKH 5B39A 5ACMA 4DN3H 3ARED 4F7PB 4K3JL 2AABH 4Q6IC 4TSBL 1SJXA 3UTSB 4OBRA 1ZK9A 4P57A 3P4NB 4K3GA 1N6VA 2IF7A 4L29B 3S5LG 1HKFA 3T3PE 4QRRE 1XT5A 4JDZB 1EHXA 3HZKB 4WIQA 1MCFA 1IGJB 4NQSA 3U30B 5EZJB 1UACL 4JLRA 1QSEB 1BREA 4KVNL 1S7WB 4LLMB 1U8OB 3HRPA 3QDGA 3AB0B 4GLRI 3P0VL 4JAMA 5IJVB 4M3KB 1S9WA 3LN4B 4GAGH 4ELMF 3ABZA 3C60A 3P9MA 4NQCB 2O26U 3BEVB 4A2LA 4FXLA 2NW3B 3GMPA 4XX1G 2FWOB 2XRAL 2I5YL 1MFDL 3SKUD 1DBML 2IANB 4XX1E 4XBPB 5E4IA 1QFUH 3LRSB 4OZFG 3QNXB 5IQ9B 3AS2A 5DYOA 2R39A 4HC1A 2VDKL 1TVBB 5D1XB 1IKNA 2GTZA 4JN2B 2ZG1A 1CD1A 1GGIH 4LARH 5DFVC 1OWRM 2Q76B 5D72L 1KEMH 3HB3D 4CVZB 2FECL 1H3PL 2NXYD 3BGAA 4MQ7B 3MXVL 4NN5B 5MEQB 4XB8A 2ZNWA 3K74B 5DD3L 4X8XA 3CFJB 1C12A 2BRRH 2FBOJ 5I75B 1WFTA 2R8SH 2OP4L 4UT9H 4BZ2L 2X89D 1S9WB 4X6CA 2BVTA 2HYMA 3N1QC 2HT3D 4YXLH 3WD5H 2ADGB 3SKMA 3FCTA 3WN5A 3VMNA 2R0KH 4NCC2 3VA2C 2AK4A 2LTQC 5D8JL 4JDTL 4OZHB 5D6DC 3TT3L 4KTYA 3DLQR 1JZ8A 1W72L 4LARL 4LEOA 1GGIL 5D2LE 2F19L 2QL1A 5F89A 3V52L 1DANU 5JOEA 4U1MA 2R4RL 1NQBA 3O6FD 3P30L 1NCAH 2F53D 2NX5D 3QUXB 3S6CA 3CX2A 1A6ZA 2PF6A 3VXRB 3BIKB 3F12A 4EZMA 4YAQA 1PKQE 4N68A 2PO6C 4DUVA 1DBMH 2PYEB 2PW2A 4O58L 5EPMB 3FRUB 3BDBA 3L3IB 5HDLA 2JJWA 4DGIL 5ALBL 2JJTA 2R1YB 1J10A 5E00B 3W81A 3BP7B 2VERN 2I07B 3PGCA 2ZUXA 1MELA 1IC4H 4UILH 3NFSH 1K6QL 5D6CA 1A7NL 4BJLA 1J0JA 5EFIA 1X5IA 2P7TB 4P2RB 1QLFB 2NCMA 4RRPA 2J8UA 2YPLD 3MRIB 4D9RD 5DC0A 1T5XA 1EUUA 5JIHA 3MZGB 5BOPA 4MD5A 3SCMA 5BV7H 4JHAH 5HXMA 1NBYB 4LNVA 1BQSA 3MFFB 4MXQC 5C6PB 2IWGA 4HGWA 3QUYD 4UQ2A 4HDIB 4PJBE 2EKSA 1YY8A 1KCRL 4B0MM 4AIZA 1DBBL 1R5VB 2QKIA 5AAWA 3LDBC 4PJFE 2H6PB 4K3JH 4GAYA 5D2LB 1H3XA 1HKLL 1FQ9C 4F7EB 3MYJB 4HJJL 5TQ0H 4WHDA 4Y8AA 4U7SA 3EYVB 3C6SB 1RURH 1A3LH 1FNSL 5KS9B 1U8IA 1ACYL 1EAPB 2FNBA 3ARDD 3T2NL 4F15C 1ZA6A 2EDNA 2ICCA 2A0LC 2G2RB 3FFDB 5B8CC 4R90L 1U6AL 1UVQB 3CSGA 2F53A 4DAGH 4U6XB 2F15A 2JIXB 1VFUA 5CIPH 2BSSB 4OCWL 3TCXA 2EH7L 3GM0A 1ADQA 5IBLC 4LCIL 1NGXA 1Q0XH 1NFDB 2GTWB 2VN7A 4FQ1L 5F9OL 3QUXC 3MRPA 4EUPG 3GSNH 3SDCB 2J88L 3JV4B 4CUCA 9CGTA 3HNSL 1E4KC 5I18H 4LCWA 4GG6E 1FJ1B 2EDDA 2LTQB 5ICZA 2LAAA 2EH8L 3MUZ1 4BFIA 5D2NB 5SWZD 2H8PA 5IQ7L 1ZHKB 4MAUL 5HYQB 1VFBA 3V79C 3FB8A 3V5KA 3BN9C 5ITBL 3TCLB 4HJ0D 4F37F 3U79A 5CJQH 4KUCD 5CZXC 4HMEA 5LKNA 4M6ML 4P3CL 1QACA 2Y07H 4S1SL 1FSKB 3QQ9D 3UP1A 1GAFH 4I3SL 1U8LB 3DROB 2R56H 3VW3L 2NXZD 4P4KB 1Z9SA 5GZND 3TFKC 1KFAH 1XAUA 5EC2B 5DD0H 3ZYJA 2XACC 3KJ4B 5F7DB 1BVKB 4NBZB 1JGEA 1UQSA 3EO0A 4HWZB 1JE6A 5EG6C 1CL7I 3X12B 2VRAA 1EVTC 1YPZA 3C9NA 1YEDB 2IGFL 4MDJA 3DMMB 3BJ91 2YPKB 2E5EA 1JPGB 4L4VA 4PLJC 4XBEH 3EYUH 2BVOA 5LGHL 4OZFB 1MHPH 3O9WA 3QIWD 4LVOC 4PJCE 4GAJH 2K7PA 4IMLA 4WFGE 4K7PL 4U6HA 3JUZA 5LCVH 3R8QA 5HD8C 3B9KA 3JTTB 2VLKD 5KANG 2C3XA 4PRPB 4HFWB 4MD4B 4XVSH 5E8DH 2VDNH 5EBLA 1LO5A 1FAIH 4QY8B 4OQ1A 5F96H 3O3AB 4J6RL 3T0WA 4Z0XA 1ZHBA 2XA3A 1AP2B 1YMMD 2HT3C 5DJ0B 4FHBD 4KHXL 5HHQA 5I1JL 3OTTA 1INDH 3AAZA 4ORZC 5BS0D 4X83A 4PJBA 3V6ZB 4EOWL 5GPRA 4NOFA 5FYJU 1Q8MA 3MLYH 1RUAH 3ILPB 1KXVC 1G7IB 4OZIB 1I85C 2P47B 2CPCA 3VFVB 2AXGA 5C2BL 5A16B 4OM0H 3L5IA 4NQXA 3T0EE 4AEIH 4BA8A 3LQAC 4GRWB 35C8H 1DQTA 4UBDD 3S36H 4JCMA 2HKHH 4XNXL 2ZUWA 1Q9KB 4NWTL 4LSTH 5IKCB 3D69A 4JVPA 2FR4A 4UOW1 3CU7A 3IDIB 3NN8A 1A7OL 5FB8B 1I1AB 1V5JA 1OB1B 2BNQB 3OB0H 3VFGH 5IOPA 4G6KH 3HAEA 3EDJA 1J5OH 1N6UA 4W6XB 1F3JB 3EGSA 3B9KB 3ZYIA 4Y4FA 4YPGB 4JB9L 2C3HA 3C5ZC 1FVCA 3CPLB 3Q5YA 3QEHB 5D7SL 3WLWD 2WIIB 3L3OB 5DGQA 1OSZB 2QSTA 2ADJA 3CDYA 2Y7QB 1KCUL 5T1KB 3S4SA 4PJIF 5C0AB 2VLKB 3FT3B 4P5TB 2WUBH 1HEZA 5KVEH 5M7QA 1T3FA 4WJ5B 1DLHA 1VKXB 5AZ2L 4HCRH 1DBJL 1YEDA 1S9VB 2UUDK 3S3PA 4P3CH 1JGDB 4HXBL 1I8IB 3V0WL 1G7PA 3UAJC 1QOKA 4JCLA 4KUCF 1HZHL 2NY1B 3MOBL 4JG1H 4LPTA 5C7XL 1IAMA 4XCCL 1ORSA 2PR4L 5BVPL 3ARSA 2HLAA 5D7KD 1J8KA 5DLML 1MF2L 3FFDA 1ZOXA 4PJ9C 1Q9LA 2WQRA 4FQHA 3KXFB 2PXYC 5FYLH 4CRPA 4G9FB 1H0DB 5E6ID 4M61A 3L7FB 5T1DH 1Q9OA 3GHEL 2AJUH 2E27H 4OQTH 4KZDL 5EBLB 1RZIB 2NY2B 4X4XB 1LE9B 1UCBH 3UC0L 2CUMA 2XXMB 1HILB 2VXVH 1E28A 5DT1H 4PJGE 4ZUWA 1IM9D 4MXQD 2OYPA 2V7HB 5F71A 1R3HA 5B39G 3BKCL 2Y25A 1S9YA 3K8LA 2X4RB 2FX9L 1GSMA 2D2OA 3UMTA 1JZ3A 4NRYB 3VJ6A 4ESKA 4F7TA 1U3HB 3K4AA 1YEIL 5TFSL 3B5GA 1A3LL 3ALXA 4Z7VE 3E0GA 2IAND 1ZLVK 1T5XB 3G5VB 5I74C 5J3HC 3V4VL 2E9JA 4W6WB 2FEDD 2J2ZA 1A6TA 3RWFB 4ONGH 3W5NA 1FP5A 2C1OA 2VLRD 3I3EA 4HMCA 3V2AR 2NZIA 5IKCA 2FR4B 4ZXBD 1T1YA 4FQIH 3KPPA 4LASH 2QQQA 4HS8H 3FTGA 2ZG2A 1YEKH 2OS7A 4N1EA 1JVKA 3FAXA 5CBAA 1LQSR 1H15A 2MCPH 2JIXD 1NH6A 5T1MB 3ZKXB 2PNDA 4QOKE 3TBYB 1AXTH 4Z8FL 5ERWB 1I1FB 1N64L 4PGCA 3OR6A 4NRZA 2AKRA 2QR0A 2QSCH 3A67L 1ED3A 5A40E 1IZJA 5IFAH 3VD5A 3UYPA 4MA7H 3ZL4H 3BWUC 3SGEH 5KVDL 4G6JL 3DX9A 5T1LB 3ME0A 4JN1L 3SJVB 4CU8A 1HOCA 4G7VL 4PRIE 5DHYA 2X5PA 4DFIA 4UV4H 2BNRD 3CFKA 4XNMA 5CINL 4PR5B 1BMGA 1LNUB 3RWCA 2HRLA 5FECB 4WY7H 5EC1B 3QUMB 4U1NA 3GBML 5D7IE 1CFVH 1DQMH 3MV9A 3JVGA 2YA0A 1QPXA 5CCKL 1INEL 5J12C 5FUOH 4X6DA 3VE0B 4U1HB 1AI1H 4EVNA 3NAAH 1MJJB 1RZGB 1EA9C 1LD9A 1U91A 5DXWA 4PRAA 3KPLB 3MGOA 1NEUA 1MNUH 1OWWA 4FP8H 4MNQE 2KDGA 4TPRH 4EUPH 1MCBA 4NBYB 2GYSA 4K8RH 5KS9A 3FB7A 3O6LH 4PJFF 4YHNA 1K8IB 2YHGA 3MBXH 3O3UN 4NZDA 2ZJSL 2MSPA 1G84A 2JJUA 4UIKH 3MV9D 3HPLB 1QKZL 3RTQD 2AXHA 4OFIA 5KSVB 2P8MB 1W0WB 1EFQA 1KPRA 5IVXF 5CZXD 3AY4C 1T20B 2Z92B 1MH5A 3VGDA 4NGHL 1Q94B 2QKIB 3MTRA 3CVHB 4X4ZA 4M7ZC 3TYFB 2BRRL 5DVMA 1ZTXL 3D3VA 3QQ3B 5FO8A 3RIAK 1QFOA 2P44B 1CLZH 2Y5EA 1EAJA 5KS9E 1DN2A 3U9PL 2DBJA 3SDAB 1ULVA 1AJ7L 1P84J 3T0EC 3BN9D 5HHOA 1FZOB 1P4IL 5JQ6H 3NCJH 4KKNA 4HS3B 3FT2A 1VACA 3C5SB 1GXEA 3RY6C 1AHWA 5F3HB 5DVLA 5LGKA 4PP1D 1OP9A 4MJ5B 3ROLA 4LSSL 3PIQB 1AGCA 2XZAH 1K5NA 2FIKA 1BBJB 4CVZA 4WWKC 1UYWL 5DEFA 3LS5L 5IHZA 1WTGT 4K55A 2ERJC 1BD2A 4JHWH 2DLHA 3MOAL 3ZDYF 4U1HA 1Q38A 4LQFH 3IU4H 2ZSVB 4M02A 1JFQL 4HKXB 3BZFA 5FF6B 3ZE1F 4Y5VB 2FATH 4TNWF 5D9SB 1A1OA 1A47A 4TQEH 1MCJA 1BEYH 5FDYA 4IRSC 1KJ2H 4X6BA 3ZLQC 1S7UA 5CD5D 5MHSE 4OCRL 1T4KA 1EEZB 3HC0B 4XVJL 3BP6A 3FB6A 1UKTA 2AXFA 1S7RB 5DZNA 3RAJL 5AD0B 4LLMA 4LVOB 3R1GL 1AFVL 4PJ8C 5J12B 1RULH 3BPCB 5JQHC 2MWCA 3VXOB 5FHAH 4P5KA 1MCPH 2E7MA 1CG9A 2XTLA 3LKOA 2ZCKL 4JO3H 5DJ8A 2YRLA 4ZFOL 1JYVA 2D7TH 2ZWLT 1DBAL 5TGBA 3DTXB 5KJRH 3H9ZA 4G6MH 2RR3A 4YHKH 5KG9B 3SJVD 4JDZA 5T5NF 4HKZA 3HCVB 2NY0B 1S5HA 4YDVB 1CIUA 1GGBH 4QKXB 1JI1A 1A4JB 4RIRA 4PG2C 3F58H 3UBXG 5IF0A 4X9FA 4OCSL 2ARJB 5I6XC 4Z18A 1WEJH 3DARA 2A6KA 4HQQH 1VFOA 1EZVY 4KTEH 2P8MA 1OAKL 1YY9D 1BQHB 5E9DE 1VGEL 4QXGL 5ACLA 5JMRA 3KPMA 3TLRA 4C56D 2W92A 2F74B 3NFNA 4L8DA 4WW2B 3GBNL 2QLVB 4ZTPH 1YUHB 3KLAA 4QTIH 3ZE2E 3C6LC 3HR6A 3TBSA 4OGXL 3VI3F 3C2SA 4JQXA 1PEWA 3KG5A 5EU7C 3SJVA 3W0WE 4I2XA 4D0DA 1AGEA 1FO0H 1JPGA 1UZ8A 4X6DB 1NKOA 1N3NB 1KPVA 4Y4KC 2JCCB 3MV9B 1MUJB 3DUSA 3E2HB 5IOPB 1IGML 3OMZA 4YDLB 3RFZC 2AS5M 5J13C 4MWFA 4S2SB 3GSQB 4XNYL 1DVFB 2ITCB 3L3JB 3RRQA 2EO1A 3VMPA 5HHNA 1U42A 2X4SA 5DD1L 4LSPL 4DW2H 3LEYH 4KHTH 1D5IL 4XGZB 4HIJA 4X0KB 1ORSB 2F58H 1JZ4A 2XA8L 5HHOE 1FYTD 2Z35B 3MA9L 4L3CB 4ZYKA 1H3UA 3DIFA 4Y0GA 3O3BA 3HMXH 1V7NL 1K8IA 3QXAA 2EC9T 3GSWB 2AEPL 1RHFA 5T5NG 3RIFF 3SDYL 3TA3B 1ZA3B 5HI4D 2OCFD 1CDUA 3OKEB 2EIDA 5GGSB 4AYFA 2FO4B 3SPVB 5L8JB 5EZOL 1V05A 5JOFA 5IBUB 2VZTA 3HS0A 1CD1B 3QAZC 4QYOA 2WIIA 4P9HL 4XB7A 4BQBA 4I18C 4HS3A 5EU6A 1KEGH 5E2WL 2DKUA 4JANB 5F70A 5F7KC 3QPXL 1NSNL 3K2UH 3IS1X 1TJGH 5C09B 5DD6B 3VRJA 2VABA 4XAWH 1OAZH 2EDYA 3RGVD 5JW4R 4PRDA 2DTSA 3PL6A 3TBVA 1FFPB 5ISZE 2V5MA 4ZO9A 3UTQA 2AK1H 5KZCB 4OI8A 5GRVK 4HLZG 3NFPA 2I9LA 1MEXH 1YPZE 5EH1A 3BZ4A 1CZ8L 4M6NH 4JFHD 1X9QA 1WIOA 3D3VD 3MFGB 1INQB 4P2QD 2AKRB 4JZJA 4HJ0C 1IC5L 5SWSE 2VOTA 5IGXL 1NL0H 1R24A 2WBJC 5MEND 4N0CC 1DBKH 3FT3A 1DJSA 3TGXA 3N1FC 3UZVB 1EMTH 5ALCL 1DQJB 3WXVL 3OPZH 3NPSC 1IMHC 3CX5K 4MD0A 5CEYA 5IW1A 4NRXA 2VH5L 1RIVH 2GITA 2ZKHL 1LK2B 1M4KA 4M6OL 2O5XH 2YD3A 4EUPA 2UWEA 3CLEL 5DMGC 3N1GC 3FQXB 4OF7A 2NY7H 1A7BA 2VDPL 4LDEB 3GJFA 4RZCA 2DQFA 4A6YH 4WUKH 3TA3C 4KXZH 2VDOL 1JHLL 1F11A 3FO0H 1ZGLM 2BY1A 3OHXB 4NN7C 5I16A 4OGZA 1YMMB 5T1LA 3IFOA 1CN4A 5TH2A 3TV3H 5CSZB 3U83A 2YA1A 3JSSA 2WBJB 4MHHI 1B4RA 2VR4A 1RZJL 1AE6L 1CGUA 2NY1D 3TYGL 3SCMD 4GW1B 5DTFA 5HBBA 3QZWB 2XWBB 4HIHA 2HWZL 3KGRA 3TWCL 1Q0YL 4XCEB 3BSZH 4IRZL 3B8YA 4HT1H 2X05A 4KDVA 3V7MA 5IBLD 1SY6A 3VFTB 1IBGH 3GUTB 2D7NA 5GZNC 1MJUH 5IFHH 3HE6D 4Z77A 2VL4A 4P4KA 5JLZA 2OSLB 2JCCA 5GRUH 4L4TD 4RCAA 5HHPA 4AG4H 5I1IH 3VGAC 2QV2A 5HVWA 4JFFE 4WFFD 3ESVF 2OR9L 4HT1L 3SDDD 2RCSH 3B9KC 4AZ8A 4MAYD 4P46A 5GGVH 1L7TH 4G8GE 1C12B 32C2B 3OZ9L 2BVOB 1Z9OA 3TNMA 4QHKJ 1OARL 2VABB 3OBAA 4FG6C 4BQ8A 1RFDH 2X44D 4WI5A 1ZHBB 5SX5K 4KK9D 5C3LD 4LSQL 3UTZA 1BWWA 4P5TC 1HINH 4OLEA 2FX8L 4XPFH 4YNYB 1KN4L 3VXUA 4NZRH 4YDJB 3BN3B 1U8KA 2DIJA 4MCZA 4MA1B 1JGEB 3LRSA 1F8TH 5GQBA 4FG6D 3CSBA 3FO0L 1G6RH 2IPUK 4UT6H 5IW1B 5CEYB 1YYLH 4DFHA 4MNQD 2BY0A 2VAJA 4Z7QF 4K2UL 1IJ9A 2DQHL 3VWKA 1A9BB 3VD4A 3P73B 1JPTH 4JPIA 1AQDA 4NO0A 5DD5H 3UJTL 4M6OH 2GSGA 2IH3B 4YXHL 1RMFL 2R15A 1MJ8H 3L3KB 2EDEA 1MHHB 2EYRB 2C9AA 4PRPD 1NEZG 3RKDC 1T03L 5T3XL 1HIML 2YUVA 2DWDA 3D2UA 3FO9B 1EMTL 4R96B 4G8EB 3ARDB 2FD6H 3H9SB 1YC7A 5DUPL 2CKBL 4PJCA 4GUPA 1AR1C 4S1DD 3IJHA 3WFBL 2GAZA 1JZ7A 4AENA 4ELME 2KZ1B 4P48A 1MIMH 3Q6FB 1TZIA 1E6JL 3I6GB 1KTDA 3FCTB 1J86A 4YEEA 2O5YH 3ARVA 1FLRL 4OCXL 3S34H 2VQ1B 2DQEH 1P6FA 4M93B 3L3DA 4M6NL 1BZ9B 2I60H 2VDLL 4OZHE 3T3ME 4NN6C 5F72S 1F6AA 4U31A 3SQOL 1F90H 5ITFA 4ELMA 4F3FA 4FTVE 5FYKU 5D1QA 1ZANL 3ROLB 2X09A 3WLBA 2OTPA 3QPXH 4P46D 1G9ML 3KYNA 1CFQB 1TJIH 1DQQB 3CIQA 4MAYB 4XP4L 4HWUA 1MWAL 1IFHH 4WHTB 1J05B 1F4WL 1FV1B 2VE6B 3H7LA 4LCUA 5IEKB 2R9HD 5GHWH 1KB5L 1JWUB 1SBSL 3Q5TA 1NDGA 2WINA 4YHLL 4I0PB 3GMQB 1IQDA 3B2VL 5IESL 1UM6L 1TZGL 1CG9B 4MWFB 3DRQA 2F5AH 4RFNB 2HKFL 4R0LA 1WAAA 1NAMA 1CFTA 1KPVB 4OGYL 3KDMB 4JO2L 2KKQA 1A0QH 3CXHJ 1HHJB 3PWVA 1XR8B 1ND0B 4M4RA 3WJJC 3HC0A 2BY3A 3TH3T 4DW2L 5T1KA 3HUJB 4M62L 4NKDB 5C0FB 3AY4A 1YY8B 3UTTE 1DP0A 2B4CH 4HXAL 1VGKB 4YQXH 2W9DH 3L95B 4OD3H 5C1MB 1U91B 2VYRE 4PJFB 4F58H 3PWLA 4PGEA 4PRHD 4NUGL 3MRJA 1NCWH 4JFED 3CUPA 2ZUQB 3QHFL 4FTVB 4HEME 4I5BB 1W2KT 4LCWD 4XWOC 2OL3L 4LLUA 3HR5A 3RY4A 5I1HL 1KIPB 1HCFX 1QA9B 3NBNA 2A6KB 4F9PC 1FIGH 4S0SD 4JPWH 3OR7B 4NDMB 4BQ6A 1LP9B 1RV6X 5DZLA 43CAB 3DPBA 2CRYA 2X42A 1UXSA 3S37X 1L6XA 2MKLC 5HGHB 3DTXA 1J8HE 1LWRA 5F7EL 3RPKA 5DHYB 5ADOH 2APBA 1IT9H 4YWGL 3HNTL 4XC1L 3QJHA 2PO6A 4J1UA 3MLVL 2JB6A 5HYJE 4YHOH 1QZ1A 1TZHA 4H8WC 1OAKH 4HK3J 3RJQB 2N56A 1C08B 1FG2A 5GZOD 3EJYC 2B20A 5KSBE 5HHOB 4AIZB 3GIZL 3OR6B 3C08H 3REWB 4JFFD 3SE8L 2CD0A 1QRNE 5ESQB 3RVTD 3X14A 2IFFH 4NSKA 1VHPA 2YD1A 1L0XA 5DJ0A 5TPWH 3D3VB 2XKNB 2OI9C 4ZQKA 4WDIB 4Z7UB 5BRZB 2Q8BL 4ZOAA 1CLOL 5TF1H 3UTTB 4FQXB 1YNLH 1JWSA 5E6ZA 2X70B 4ODHL 3UJIH 4GRLD 5F7UA 4MAYA 5D7KE 3RVTC 1NFIA 5I30H 1I9EA 3DO3A 2F53B 4OF8A 2JELL 3OKLA 1E0OB 1UXWB 4JREB 1TQCC 3QDGD 5K9QG 5JXEA 4QXUH 1JI2A 5B39B 4WU7A 3TT1L 5L0QC 3TIEB 4G7YH 5T3XE 2DM2A 4YHOL 2FATL 5DUML 3HNTH 1CFNB 2W0FA 1R3JB 4XC1H 4BZ1L 5HPOA 4Y5VC 4PGJA 1CLYL 3QUYA 5EU3A 1DUZB 1HNFA 3EJYD 2PW1B 1YEEH 1YPZB 3C9NB 1K8DB 1JZ6A 4JAMB 3AS0A 3RDTA 2VQ1A 1FIGL 4Q2ZB 4XZUA 4QGYA 1URLA 2D7PA 5D7LA 1BJ1H 4JKKA 2YUWA 1FL5B 4KK6C 3SY0B 4X6CE 2CK0L 4JKPL 4P23D 4XT1C 5EZJA 4OLUH 4PJCB 3JWOL 3FOLA 4R7NA 5ESQA 3X14B 4HUUA 1B0GB 2D0GA 2FJGA 2X41A 2EE6A 1YQ2A 3EW3B 5HGAA 1LO4H 3T04D 1OM3H 3IDJB 2WK2A 1VADA 5F93C 5J6HA 5GJSH 4JQIL 1MAKA 5EULV 3VG9B 4OCLC 4V2BA 1UEMA 1V7ML 1JN6B 2UZIH 4NHCH 3U9PH 3W2DH 3BJLA 3VG0H 3NIDE 4B5EA 1L6ZA 1SEBA 3VU2A 2UV3A 4MJ5A 1T66C 3QG6A 3QJFA 3B2VH 5EUOF 2GY5A 3BPOC 1BAFH 2Z9TA 1U95B 1A3RH 4JY4A 3QNXA 4NQCE 4UIKL 3QUXA 1M71B 1GGCH 2HN7A 2MNUA 3NCCB 3LMJL 2BNRE 5F9JB 2QQNL 1I8LA 1MFBH 5BO1H 3ZKSD 1BFVH 1T0PB 3MXWL 1G0DA 3E2HC 4RBPH 2R9HC 5J13B 2V7HA 2IALB 2X4QB 1SY6H 3OG4B 3FMGH 4HZAA 1EGJH 4Y19B 5CLTA 4FFYL 4IRJC 4WI2A 5CZVL 1TDQA 3GMOA 1K4CB 2NNAB 5TDPB 1BZ7B 3HAEH 5H35A 5FYKH 1L0YA 3SGDH 3BUTA 5DO2C 1S7WA 3LKSA 3STLA 4XPHH 4PLOB 5FUCE 4O4YH 1C5DB 5CINH 4C83B 3ARRA 3T0AA 5IMOB 2DQIL 3CZFB 3JWDL 1UA6L 1I4FA 2DM7A 2HG5A 3B9DA 5L88L 5CP7B 5AZEH 5IBTH 1F3DJ 4X9BA 2WUCH 3MRFB 5INDB 3ZMRA 4IDJL 5DI8B 1LILA 3VXSA 5IIEA 4GBXD 1H5BB 2KQNA 1RZ7H 5JZ7C 2HTKC 5JNYA 1LO3L 1G7PB 4XPAL 5J06A 3A67H 4LSRH 4MCYA 2E7LC 3WIIL 4A6YA 5ANMA 1IEBB 1EEQA 3HI1B 5B38G 3FZUD 4V1DD 1IM9B 1XGTB 4FZ8L 5F9WB 3DURB 1T3FB 4YK4C 5CBEB 3WLBB 3RKDD 4XNMB 3IJYA 2NR6C 3MGTA 2VITB 4OZGB 4LHUB 4JFDD 4X6CF 3IDYB 1NDMA 5D5MF 4CDHA 4F80A 4E0RB 5J11B 3PXHA 1MFCH 3QEHA 4AQOA 3FOMA 1ZVSB 1XGRB 5KN5B 2E9BA 3VXRE 4GW5B 2MFNA 4DQOL 3MRDB 2FX7L 5IBUG 5I1KL 2P5WD 1MHCB 1DQDL 2HJKB 4PJGB 4RMRA 1KN4H 4OJFH 4XPFL 1HHIA 2EIZB 3RL1B 1H3VA 1MFEH 1NCTA 2I27N 4QHUB 2MMXA 4LSUH 3BRFA 3LD8B 3B83A 3BXNB 2DQJL 1ITCA 3AUVA 5F6HJ 4ISVB 3QEQD 3CGTA 1EO8L 4X5WA 4LHUD 3RWFA 2DWDB 5FGBC 2X1WL 5CS7A 4P57B 3BQUD 1FH5L 1T1XB 5H8DA 3SGKC 2CRIA 3TP4A 1XIWB 5F7WC 4NJ9H 2IJ0C 3OKYA 4IJ3B 2EXYC 1S7TA 2R1XA 4QHMA 4JPIB 3H3KA 5KTEL 4YE4L 4DK3A 4WHYH 4Y88A 2WWKT 3BMVA 4M1CD 4CAGA 5BVPH 4GOSA 2W07A 1QHPA 4YBHA 4OZGE 4PREA 1WF5A 4TN9A 2I9TA 4I4WB 1GC1C 2EEAA 4U1GC 1TMCB 4IOFC 4TVPL 3BQUA 3PWJA 1X4YA 5FKAA 2AEIT 3CX5J 3VFWB 4RAUB 3ZT7A 5E70A 2GT9A 5KSAD 5F9JA 4JANA 3K8KA 3KWWA 3SJVE 4YEFA 4AK1A 3EDKA 5CJOH 4ZFGH 1YYMH 1EBAA 3TC9A 1I75A 5E94B 4OD1L 2NY1C 3MJ7B 4FZEH 1I7RA 4ODVL 3UX9B 2GY7B 4L9LB 2CIIA 3FKUS 4WVRA 4B7IA 5DVOA 3TN0B 1PAMA 1ZT1B 1NGZA 1F2XK 3GFUA 3HZMA 1XGTA 3MNWA 2FEEI 1CF8L 4KU1A 5KW9H 2FECI 3ZKNC 4ALAH 5HYEA 1IGIL 2NNAA 3EO0B 5FKPB 1YQVL 3OSKA 4E5XB 4HIJB 5D96B 2BVQA 1UADC 3LZFH 3HUJE 3MR9B 3MRFA 5INDA 4CMHB 4YPGA 2CRZA 3D5OF 5IVZB 3T3MF 4FQJH 1UENA 4DGYH 3CZFA 1KOAA 4HUMB 1XF3A 3MODH 5EB9A 4ZOBA 1CGXA 4LP5A 3D9AL 2DQDL 4QOKA 3QWRD 3BQUB 4F7MB 1RUAL 1IC5H 2X4OB 3PP3K 3VI4F 4ERSH 2X2YA 3QA3A 4PFEA 3IFOB 4G9DA 3QT2A 1UWEL 4ZNEA 1INDL 4KMLB 2V2TB 2JJSA 5DEGA 1W0YT 5FYKL 3VFOA 5L7XH 2DMKA 1KCKA 3LB6C 3DJ9A 1Z3GL 3T0DA 4J6RH 3NGBB 2NTFB 5CZVH 4DN4L 1J8HB 3BKYH 1CIDA 2OQJB 3SOBL 3HG1D 1KSRA 2H1PL 3HNVL 3TPUB 2DYPD 3KNBA 5FXCH 4H5SA 1BFVL 4IHOB 2QQLL 3QEGH 2LU4A 2NXZB 3OJMB 3WS3A 2QQNH 3UPAA 2OK0H 3TBWA 3U1SL 1IC7L 1ZA6B 4JZOB 4EDWL 3OKNA 4GJTB 1D9KB 1N2RB 4JEGB 5DMKB 4MB3A 3GSOA 4ODXB 1I7UB 1KJ2A 2O61B 5JXAH 2YD6A 3ZKMC 3SDYH 3HE7C 3BISA 3U4AA 3QFDA 4PTTA 3X3FL 5J6HB 3LKRA 1KNOA 5GIRB 3P9LA 1NANI 4KWUA 4OKVA 4WNQA 4YGAB 4N1CA 1X5HA 1C08A 2F53E 4G5ZL 1A5FH 2BHYA 2VXTL 4ORGA 2DD8L 1RJCA 2Y6SC 2R2HB 3FFCA 5IVNA 4KKAD 5GRJL 5HGHA 2BDNH 4DWHA 4U7MA 4WHYG 5E5UB 4POYA 2CGRH 3G08B 3S5LB 2W38A 4OV6F 3EYOB 4RAUA 5CUSL 5SWSA 3T77B 1EJOL 2NYYD 4N5ED 1CTNA 2P7TA 4Y8DC 5L7XL 1CDCA 4X4YA 2X70A 5E2UH 4MB4A 5F1OB 2EH8H 3QFJD 4P4RA 2FBJL 1TVHA 5EC2A 5JO5A 2PTVA 5FA3A 3ULUH 3HMWH 2Y06H 4N90D 2A9MH 3HA0A 1CFNA 1GIGL 5D7LD 3GSNL 3TO4D 4Z7NE 4G8IB 3EFFB 2HVKA 3I02A 5CJXC 5E9DB 2GSIA 2OBGA 4ZDHA 3CDGA 2H2PD 1UM5L 3CXDL 3EYSL 3LKSB 4PJIE 4MJID 5TE4H 3MLTA 1P4LB 3BMWA 1JPFB 3SE4C 2JELH 5C0AE 5DRXB 2XNAA 5FV1L 3KYOA 3W0WB 3BWAA 3KPQA 3GRWA 1S9XB 1IGYA 4G8EA 4I0PA 1ODAA 4WCYL 1IZKA 3S36X 2DKMA 2ZUTA 4JO3L 5D1XC 1UH4A 3P0YL 1U3YA 4OGAD 2CJUH 4WWKB 1OY3B 2VL5B 4KK8D 2V9RA 4ODVH 1NAMH 3GSUB 3SEPA 1MFAH 1MRDL 4HWNA 1CDHA 1G7JB 1XGRA 5KN5A 1MCEA 4C54A 2AQ2A 1CICA 5I1DA 1D5XB 5DJXB 5ANME 5CJOL 3DSFH 4BYHA 5H37H 4UT7L 2XTJC 3A6BH 4XMPH 4KDTC 4YC2B 1EZVX 3ARBB 1KLUB 3H0TA 3B3IB 5ELIA 2DLGA 2GJ6A 3I6KA 1N8ZA 2FJHA 4WFFE 2GTZB 4OSUH 3OF6D 2YKLH 5F3BA 2VLJB 2CIKB 3IU4L 1KIPA 4Y5YC 5I74B 1H5BC 2XI9A 3BOVA 3QUMA 4U1NB 2MPAL 1HDMB 3MCKA 4HS6B 2NY3C 1I9RL 2EEDA 5KTEH 4UINL 3IETA 2IC2A 5GSRA 5TE7L 2EDWA 5GGRY 2PTTB 3BVNB 1M7IA 3EYFB 5F9WC 2HMIC 5DJ6A 5GRZA 1JP5A 1SYSA 4AEHH 1ZEAL 5DC9B 3SKMB 1NCAL 3D2UB 5IJVA 2JLLA 2B4CL 3MLTB 4AL8H 4P2OD 2XTJB 3ZSTA 4DKFL 2CXGA 2VXTH 3MGAA 1W72H 1MCWW 4OKDA 1T89A 4LSUL 4G5ZH 4O2FB 5IW3A 3RNKA 3GUTA 5FGSA 1FLTX 4BUGA 3ZZ1A 5E8OB 4EI5A 4RQQA 4B7LA 4U0RC 2SEBB 2EXWC 1CLZL 1U8PB 4XTRD 4YZFE 1I3UA 1WT5C 4PV8B 1BFOA 4YPJA 5ACZA 1B6UA 5E7FA 4LCUB 2Y1VA 4BZ2H 4NGHH 3LQMA 4XMKH 3DGGB 2NY6D 4JJHA 3T3PF 3CUPB 4FTVA 2IPTH 1I7ZA 1MIEL 5DD3H 1JNHA 1J1PL 1AXIB 1JNJA 1BLNA 4NBXB 4YFDB 3QI9D 1WBZA 3KPQB 1R3KB 2GJ6B 2PTUA 2FIKB 3FT4A 4TPRL 4PREB 2AK4B 4KRPD 2CUIA 1OP3H 2H9GA 12E8H 1DVFC 2H1PH 1J12A 2A6IA 1H8OA 3QO1A 4TTDD 3TN0C 3PGFH 3K1DA 3PDOB 3IFLH 1F4AA 3NIGF 3BKYL 1Y18A 1VACB 2WUCL 2XG5A 3QDMA 5E56A 4YDIL 5E6IA 1I7TB 4KPHL 1NGPH 3JWNC 5TF0A 1XF2A 1QSFE 1JRHI 4XVTL 3KPTA 4M9OA 4GG6F 4GKOA 4HWEH 4RFNC 3QEQE 4MQ7A 4XWGH 2M8XA 1FLRH 1AGBA 4R4BB 3L1OL 3BXNA 3G5XB 4W4OA 4QHLB 1II4E 4KRPB 1BFSA 2FD6L 4G9FD 3FMGL 3DXAE 3CC5B 2XWBA 1NAKH 1S7QA 2R69L 1XF4B 2Z8VC 2B8OT 3DHJA 4DVRH 1HIMH 5KSUB 1RZJC 5ICYA 1ZT1A 4CDGC 3KPSB 5C0GA 3FQNB 5E8OA 3P73A 1MQ8A 4EI5B 4GO6B 1JUFB 1RMFH 4L3AA 5DJYA 3VFOB 5HHMB 4CGTA 5I6XB 2Q3AA 4HS8L 1P1ZA 2FHCA 1QSZA 2AI0L 4N0UB 1MCIA 2AK4E 3TNNA 1KV3A 1WWBX 1YYLL 3SDDC 3BRGC 3MLSL 3I6GA 2NX5E 3MOQA 4ODUA 1A9EA 4Z77B 2DRUA 2FL5B 5BRZA 1BFTA 1BX2A 2VSDA 4NZRL 3AU1B 3KVQA 5EZIL 2X1OA 4PY7A 1P2CB 5DHVH 4U1LA 5HSFA 4ONFH 1OTTC 2GUOA 4NNXB 1BJMA 2P4AB 2VKXA 1FE8H 5JA8B 4TNVF 4LAJH 4EIZC 1FZMA