5E0SA

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
197
structure length
197
Chain Sequence
b'YILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
total genus 64
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, a, b, c, d, e, f, g
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5e0sA00
3U9RB 1FC6A 4K2NA 3H81A 1WDMA 3K50A 1EF8A 3TDCA 4B3HA 4ELWA 5C9GA 2DEOA 4I4ZA 1UIYA 1N6FA 3OT6A 4FZWA 1N6EA 1XNYA 1PIXA 3T8BA 4ZDDA 1K39A 1FC7A 3R9SA 3HE2A 4FZWC 1XNWA 2WTBA 1Y7OA 3JU1A 4JWVA 2PPYA 2A7SA 2Q2XA 4ELXA 1UYSA 3U9TB 3ZW9A 1VRGA 3ZW8A 5G1RA 3K8XA 3QXIA 4IZDA 3T89A 3PGQA 1HNUA 3BF0A 2F9IA 4B3IA 4HNKA 1XX4A 4HC8A 2J5IB 3TVWA 4EMMA 3P5MA 3KTHA 4Q1IA 5DL1A 5JBXA 4FNDA 3T88A 3QMJA 2GTRA 3PE8A 3ISAA 1ON9A 1HNOA 1EY3A 3QXZA 2FW2A 4B3JA 2X24A 4MI2A 3KTJA 3FF6A 4JSBA 4I42A 3T3WA 2F9YA 3RSIA 2NP9A 4FB8A 3H0JA 2J5SA 2CE3A 3H0QA 5DZKA 2D3TA 4F47A 4KD6A 4JFCA 4RYFH 5FIFA 3U9SB 2ZQQA 3M6MA 4G2RA 4ZDEA 5KDRB 2VX2A 3GF3A 5DKPA 5DZKH 2F9IB 1DUBA 3QWDA 3TT7A 3BPPA 3TZ3A 4ELSA 1SZOA 2J5GA 4FNBA 5FUSA 3T8AA 2FBMA 2DUBA 5KJPA 3PEAA 4U1AA 1RJMA 3KTKA 1EF9A 4U19A 2PG8A 5DTPA 4ASIA 4ZDBA 3KTIA 4MOUA 2F9YB 4U0GA 1JXZA 3GMAA 2UZFA 4FN7A 1NZYA 1O8UA 4L6WA 3R0OA 1UYRA 4JVTA 3Q0GA 4OG1A 1J7XA 1DCIA 3HLN1 3I47A 4EMPA 4U0GH 1UYVA 5INGA 3QK8A 2IEXA 2VSUE 4WZ8B 1PJHA 4FJWD 5G1SA 1WZ8A 1WDLA 3IBBA 1MJ3A 2J5GD 3LKEA 2J5II 3GKBA 3QREA 3OC7A 2HW5A 1K32A 3KQFA 5INFA 1RJNA 5JBWA 4JCRA 2ZQRA 2VSSE 3LAOA 4U0HA 1FCFA 4GHNA 5IKLB 2QQ3A 3GLMA 3ZWBA 3BEZA 1XO6A 2PBPA 2F6IA 4RYFA 5DUFA 3R9QA 1NZYB 3L3SA 2A81A 5DUCA 1W2XA 3FDUA 4OMRA 3RSTA 4QFEA 3TVUA 3V5IA 3Q1TA 4ZDFA 3IB9A 3R6HA 5C90A 3PZKA 3TT6A 4JYLA 5DU8A 1TYFA 3VIVA 5E0SA 4IZBA 3IAVA 5DTWA 5CTBA 2X58A 3GF7A 3R9TA 4ZDCA 3WG5A 2ZL0A 3QYRA 5E0SH 3TV5A 2CBYA 4QIIA 1FC9A 2Q35A 3MYBA 5DU4A 3HINA 3DORA 1WDKA 3H02A 2J5IA 2VSUF 1N6DA 4JYJA 1UYTA 4MXIA 3ZWCA 4QIJA 4JCSA 1Q52A 2Q34A 3SLLA 4JOTA 2F6QA 2C8TA 4I52A 3MT6A 2VSSF 3N6RB 1YG6A 1YG8A 3RRVA 4JCTA 2VSUA 3STAA 1OD2A 3MFMA 1X0UA 4JCQA 4FN8A 4LK5A 2VSUC 3M6NA 3HP0A 2ZL3A 1Q51A 1XNVA 3Q7HA 3Q0JA 2VSSA 4K29A 2BZRA 5KDRA 2FZSA 4GM2A 1TG6A 4Q0GA 5G1QA 4OLQA 2ZL2A 3MOYA 4K3WA 3KTGA 3ST9A 5INIA 3V5EA 4NNQA 3H0SA 2ZL4A 4IZCA 4NEKA 3TRRA 4Z0MA 1HZDA 3DJAA 4YLHA 3NJBA 3SWXA 4U18A 3ZWAA 5E0NX 3HRXA 1OD4A 4JJTA 2EJ5A 4KPKA 2A7KA 1ON3A 5MGBA 3QKAA 3P85A 3G64A 3P2LA 3H0UA 2VREA 4L8KA 4EMLA 4KWBA 3OMEA 4WCZA 4ZU2A 5DU6A 4RCNA 3TLFA 3NJDA 2W3PA 5CTCA 4KNPA 4DI1A 1SG4A 4WYOB
chains in the Genus database with same CATH superfamily
3U9RB 1FC6A 4K2NA 3H81A 1WDMA 3K50A 1EF8A 3TDCA 4B3HA 4ELWA 5C9GA 2DEOA 4I4ZA 1UIYA 1N6FA 3OT6A 4FZWA 1N6EA 1XNYA 1PIXA 3T8BA 4ZDDA 1K39A 1FC7A 3R9SA 3HE2A 4FZWC 1XNWA 2WTBA 1Y7OA 3JU1A 4JWVA 2PPYA 2A7SA 2Q2XA 4ELXA 1UYSA 3U9TB 3ZW9A 1VRGA 3ZW8A 5G1RA 3K8XA 3QXIA 4IZDA 3T89A 3PGQA 1HNUA 3BF0A 2F9IA 4B3IA 4HNKA 1XX4A 2YJGA 4HC8A 2J5IB 3TVWA 4EMMA 3P5MA 3KTHA 4Q1IA 5DL1A 5JBXA 4FNDA 3T88A 3QMJA 2GTRA 3PE8A 3ISAA 1ON9A 1HNOA 1EY3A 3QXZA 2FW2A 4B3JA 2X24A 4MI2A 3KTJA 3FF6A 4JSBA 4I42A 3T3WA 2F9YA 3RSIA 2NP9A 4FB8A 3H0JA 2J5SA 2CE3A 3H0QA 5DZKA 2D3TA 4F47A 4KD6A 4JFCA 4RYFH 5FIFA 3U9SB 2ZQQA 3M6MA 4G2RA 4ZDEA 5KDRB 2VX2A 3GF3A 5DKPA 5DZKH 2F9IB 1DUBA 3QWDA 3TT7A 3BPPA 3TZ3A 4ELSA 1SZOA 2J5GA 4FNBA 5FUSA 3T8AA 2FBMA 2DUBA 5KJPA 3PEAA 4U1AA 1RJMA 3KTKA 1EF9A 4U19A 2PG8A 5DTPA 4ASIA 4ZDBA 3KTIA 4MOUA 2F9YB 4U0GA 1JXZA 3GMAA 2UZFA 4FN7A 1NZYA 1O8UA 4L6WA 3R0OA 1UYRA 4JVTA 3Q0GA 4OG1A 1J7XA 1DCIA 3HLN1 3I47A 4EMPA 4U0GH 4J2UA 1UYVA 5INGA 3QK8A 2IEXA 2VSUE 4WZ8B 1PJHA 4FJWD 5G1SA 1WZ8A 1WDLA 3IBBA 4NARA 1MJ3A 2J5GD 3LKEA 2J5II 3GKBA 3QREA 3OC7A 2HW5A 1K32A 3KQFA 5INFA 1RJNA 5JBWA 4JCRA 2ZQRA 2VSSE 3LAOA 4U0HA 1FCFA 4HDTA 4GHNA 5IKLB 2QQ3A 3GLMA 3ZWBA 3BEZA 1XO6A 2PBPA 2F6IA 4RYFA 5DUFA 3R9QA 1NZYB 3L3SA 2A81A 5DUCA 1W2XA 3FDUA 4OMRA 3RSTA 4QFEA 3TVUA 3V5IA 3Q1TA 4ZDFA 3IB9A 3R6HA 5HUQA 5C90A 3PZKA 3TT6A 4JYLA 5DU8A 1TYFA 3VIVA 5E0SA 4IZBA 3IAVA 5DTWA 5CTBA 2X58A 3GF7A 3R9TA 4ZDCA 3WG5A 2ZL0A 3QYRA 5E0SH 3TV5A 2CBYA 4QIIA 1FC9A 2Q35A 3MYBA 5DU4A 3HINA 3DORA 1WDKA 3H02A 2J5IA 2VSUF 1N6DA 4JYJA 1UYTA 4MXIA 3ZWCA 4QIJA 4JCSA 1Q52A 2Q34A 3SLLA 4JOTA 2F6QA 2C8TA 4I52A 3MT6A 2VSSF 3N6RB 1YG6A 1YG8A 3RRVA 4JCTA 2VSUA 3STAA 1OD2A 3MFMA 1X0UA 4JCQA 4FN8A 4LK5A 2VSUC 3M6NA 3HP0A 2ZL3A 1Q51A 1XNVA 3Q7HA 3Q0JA 2VSSA 4K29A 2BZRA 5KDRA 2FZSA 4GM2A 1TG6A 4Q0GA 5G1QA 4OLQA 2ZL2A 3MOYA 4K3WA 3KTGA 3ST9A 5INIA 3V5EA 4NNQA 3H0SA 2ZL4A 4IZCA 4NEKA 3TRRA 4Z0MA 1HZDA 3DJAA 4YLHA 3NJBA 3SWXA 4U18A 3ZWAA 5E0NX 3HRXA 3BPTA 1OD4A 4JJTA 2EJ5A 4KPKA 2A7KA 1ON3A 5MGBA 3QKAA 3P85A 3G64A 3P2LA 3H0UA 2VREA 4L8KA 4EMLA 4KWBA 3OMEA 4WCZA 4ZU2A 5DU6A 4RCNA 3TLFA 3NJDA 2W3PA 5CTCA 4KNPA 4DI1A 1SG4A 4WYOB
chains in the Genus database with same CATH topology
3U9RB 1FC6A 4K2NA 3H81A 1WDMA 3K50A 1EF8A 3TDCA 4B3HA 4ELWA 5C9GA 2DEOA 4I4ZA 1UIYA 1N6FA 3OT6A 4FZWA 1N6EA 1XNYA 1PIXA 3T8BA 4ZDDA 1K39A 1FC7A 3R9SA 3HE2A 4FZWC 1XNWA 2WTBA 1Y7OA 3JU1A 4JWVA 2PPYA 2A7SA 2Q2XA 4ELXA 1UYSA 3U9TB 3ZW9A 1VRGA 3ZW8A 5G1RA 3K8XA 3QXIA 4IZDA 3T89A 3PGQA 1HNUA 3BF0A 2F9IA 4B3IA 4HNKA 1XX4A 2YJGA 4HC8A 2J5IB 3TVWA 4EMMA 3P5MA 3KTHA 4Q1IA 5DL1A 5JBXA 4FNDA 3T88A 3QMJA 2GTRA 3PE8A 3ISAA 1ON9A 1HNOA 1EY3A 3QXZA 2FW2A 4B3JA 2X24A 4MI2A 3KTJA 3FF6A 4JSBA 4I42A 3T3WA 2F9YA 3RSIA 2NP9A 4FB8A 3H0JA 2J5SA 2CE3A 3H0QA 5DZKA 2D3TA 4F47A 4KD6A 4JFCA 4RYFH 5FIFA 3U9SB 2ZQQA 3M6MA 4G2RA 4ZDEA 5KDRB 2VX2A 3GF3A 5DKPA 5DZKH 2F9IB 1DUBA 3QWDA 3TT7A 3BPPA 3TZ3A 4ELSA 1SZOA 2J5GA 4FNBA 5FUSA 3T8AA 2FBMA 2DUBA 5KJPA 3PEAA 4U1AA 1RJMA 3KTKA 1EF9A 4U19A 2PG8A 5DTPA 4ASIA 4ZDBA 3KTIA 4MOUA 2F9YB 4U0GA 1JXZA 3GMAA 2UZFA 4FN7A 1NZYA 1O8UA 4L6WA 3R0OA 1UYRA 4JVTA 3Q0GA 4OG1A 1J7XA 1DCIA 3HLN1 3I47A 4EMPA 4U0GH 4J2UA 1UYVA 5INGA 3QK8A 2IEXA 2VSUE 4WZ8B 1PJHA 4FJWD 5G1SA 1WZ8A 1WDLA 3IBBA 4NARA 1MJ3A 2J5GD 3LKEA 2J5II 3GKBA 3QREA 3OC7A 2HW5A 1K32A 3KQFA 5INFA 1RJNA 5JBWA 4JCRA 2ZQRA 2VSSE 3LAOA 4U0HA 1FCFA 4HDTA 4GHNA 5IKLB 2QQ3A 3GLMA 3ZWBA 3BEZA 1XO6A 2PBPA 2F6IA 4RYFA 5DUFA 3R9QA 1NZYB 3L3SA 2A81A 5DUCA 1W2XA 3FDUA 4OMRA 3RSTA 4QFEA 3TVUA 3V5IA 3Q1TA 4ZDFA 3IB9A 3R6HA 5HUQA 5C90A 3PZKA 3TT6A 4JYLA 5DU8A 1TYFA 3VIVA 5E0SA 4IZBA 3IAVA 5DTWA 5CTBA 2X58A 3GF7A 3R9TA 4ZDCA 3WG5A 2ZL0A 3QYRA 5E0SH 3TV5A 2CBYA 4QIIA 1FC9A 2Q35A 3MYBA 5DU4A 3HINA 3DORA 1WDKA 3H02A 2J5IA 2VSUF 1N6DA 4JYJA 1UYTA 4MXIA 3ZWCA 4QIJA 4JCSA 1Q52A 2Q34A 3SLLA 4JOTA 2F6QA 2C8TA 4I52A 3MT6A 2VSSF 3N6RB 1YG6A 1YG8A 3RRVA 4JCTA 2VSUA 3STAA 1OD2A 3MFMA 1X0UA 4JCQA 4FN8A 4LK5A 2VSUC 3M6NA 3HP0A 2ZL3A 1Q51A 1XNVA 3Q7HA 3Q0JA 2VSSA 4K29A 2BZRA 5KDRA 2FZSA 4GM2A 1TG6A 4Q0GA 5G1QA 4OLQA 2ZL2A 3MOYA 4K3WA 3KTGA 3ST9A 5INIA 3V5EA 4NNQA 3H0SA 2ZL4A 4IZCA 4NEKA 3TRRA 4Z0MA 1HZDA 3DJAA 4YLHA 3NJBA 3SWXA 4U18A 3ZWAA 5E0NX 3HRXA 3BPTA 1OD4A 4JJTA 2EJ5A 4KPKA 2A7KA 1ON3A 5MGBA 3QKAA 3P85A 3G64A 3P2LA 3H0UA 2VREA 4L8KA 4EMLA 4KWBA 3OMEA 4WCZA 4ZU2A 5DU6A 4RCNA 3TLFA 3NJDA 2W3PA 5CTCA 4KNPA 4DI1A 1SG4A 4WYOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9R B;  1FC6 A;  4K2N A;  3H81 A;  1WDM A;  3K50 A;  1EF8 A;  3TDC A;  4B3H A;  4ELW A;  5C9G A;  2DEO A;  4I4Z A;  1UIY A;  1N6F A;  3OT6 A;  4FZW A;  1N6E A;  1XNY A;  1PIX A;  3T8B A;  4ZDD A;  1K39 A;  1FC7 A;  3R9S A;  3HE2 A;  4FZW C;  1XNW A;  2WTB A;  1Y7O A;  3JU1 A;  4JWV A;  2PPY A;  2A7S A;  2Q2X A;  4ELX A;  1UYS A;  3U9T B;  3ZW9 A;  1VRG A;  3ZW8 A;  5G1R A;  3K8X A;  3QXI A;  4IZD A;  3T89 A;  3PGQ A;  1HNU A;  3BF0 A;  2F9I A;  4B3I A;  4HNK A;  1XX4 A;  4HC8 A;  2J5I B;  3TVW A;  4EMM A;  3P5M A;  3KTH A;  4Q1I A;  5DL1 A;  5JBX A;  4FND A;  3T88 A;  3QMJ A;  2GTR A;  3PE8 A;  3ISA A;  1ON9 A;  1HNO A;  1EY3 A;  3QXZ A;  2FW2 A;  4B3J A;  2X24 A;  4MI2 A;  3KTJ A;  3FF6 A;  4JSB A;  4I42 A;  3T3W A;  2F9Y A;  3RSI A;  2NP9 A;  4FB8 A;  3H0J A;  2J5S A;  2CE3 A;  3H0Q A;  5DZK A;  2D3T A;  4F47 A;  4KD6 A;  4JFC A;  4RYF H;  5FIF A;  3U9S B;  2ZQQ A;  3M6M A;  4G2R A;  4ZDE A;  5KDR B;  2VX2 A;  3GF3 A;  5DKP A;  5DZK H;  2F9I B;  1DUB A;  3QWD A;  3TT7 A;  3BPP A;  3TZ3 A;  4ELS A;  1SZO A;  2J5G A;  4FNB A;  5FUS A;  3T8A A;  2FBM A;  2DUB A;  5KJP A;  3PEA A;  4U1A A;  1RJM A;  3KTK A;  1EF9 A;  4U19 A;  2PG8 A;  5DTP A;  4ASI A;  4ZDB A;  3KTI A;  4MOU A;  2F9Y B;  4U0G A;  1JXZ A;  3GMA A;  2UZF A;  4FN7 A;  1NZY A;  1O8U A;  4L6W A;  3R0O A;  1UYR A;  4JVT A;  3Q0G A;  4OG1 A;  1J7X A;  1DCI A;  3HLN 1;  3I47 A;  4EMP A;  4U0G H;  1UYV A;  5ING A;  3QK8 A;  2IEX A;  2VSU E;  4WZ8 B;  1PJH A;  4FJW D;  5G1S A;  1WZ8 A;  1WDL A;  3IBB A;  1MJ3 A;  2J5G D;  3LKE A;  2J5I I;  3GKB A;  3QRE A;  3OC7 A;  2HW5 A;  1K32 A;  3KQF A;  5INF A;  1RJN A;  5JBW A;  4JCR A;  2ZQR A;  2VSS E;  3LAO A;  4U0H A;  1FCF A;  4GHN A;  5IKL B;  2QQ3 A;  3GLM A;  3ZWB A;  3BEZ A;  1XO6 A;  2PBP A;  2F6I A;  4RYF A;  5DUF A;  3R9Q A;  1NZY B;  3L3S A;  2A81 A;  5DUC A;  1W2X A;  3FDU A;  4OMR A;  3RST A;  4QFE A;  3TVU A;  3V5I A;  3Q1T A;  4ZDF A;  3IB9 A;  3R6H A;  5C90 A;  3PZK A;  3TT6 A;  4JYL A;  5DU8 A;  1TYF A;  3VIV A;  5E0S A;  4IZB A;  3IAV A;  5DTW A;  5CTB A;  2X58 A;  3GF7 A;  3R9T A;  4ZDC A;  3WG5 A;  2ZL0 A;  3QYR A;  5E0S H;  3TV5 A;  2CBY A;  4QII A;  1FC9 A;  2Q35 A;  3MYB A;  5DU4 A;  3HIN A;  3DOR A;  1WDK A;  3H02 A;  2J5I A;  2VSU F;  1N6D A;  4JYJ A;  1UYT A;  4MXI A;  3ZWC A;  4QIJ A;  4JCS A;  1Q52 A;  2Q34 A;  3SLL A;  4JOT A;  2F6Q A;  2C8T A;  4I52 A;  3MT6 A;  2VSS F;  3N6R B;  1YG6 A;  1YG8 A;  3RRV A;  4JCT A;  2VSU A;  3STA A;  1OD2 A;  3MFM A;  1X0U A;  4JCQ A;  4FN8 A;  4LK5 A;  2VSU C;  3M6N A;  3HP0 A;  2ZL3 A;  1Q51 A;  1XNV A;  3Q7H A;  3Q0J A;  2VSS A;  4K29 A;  2BZR A;  5KDR A;  2FZS A;  4GM2 A;  1TG6 A;  4Q0G A;  5G1Q A;  4OLQ A;  2ZL2 A;  3MOY A;  4K3W A;  3KTG A;  3ST9 A;  5INI A;  3V5E A;  4NNQ A;  3H0S A;  2ZL4 A;  4IZC A;  4NEK A;  3TRR A;  4Z0M A;  1HZD A;  3DJA A;  4YLH A;  3NJB A;  3SWX A;  4U18 A;  3ZWA A;  5E0N X;  3HRX A;  1OD4 A;  4JJT A;  2EJ5 A;  4KPK A;  2A7K A;  1ON3 A;  5MGB A;  3QKA A;  3P85 A;  3G64 A;  3P2L A;  3H0U A;  2VRE A;  4L8K A;  4EML A;  4KWB A;  3OME A;  4WCZ A;  4ZU2 A;  5DU6 A;  4RCN A;  3TLF A;  3NJD A;  2W3P A;  5CTC A;  4KNP A;  4DI1 A;  1SG4 A;  4WYO B; 
#chains in the Genus database with same CATH topology
 3U9R B;  1FC6 A;  4K2N A;  3H81 A;  1WDM A;  3K50 A;  1EF8 A;  3TDC A;  4B3H A;  4ELW A;  5C9G A;  2DEO A;  4I4Z A;  1UIY A;  1N6F A;  3OT6 A;  4FZW A;  1N6E A;  1XNY A;  1PIX A;  3T8B A;  4ZDD A;  1K39 A;  1FC7 A;  3R9S A;  3HE2 A;  4FZW C;  1XNW A;  2WTB A;  1Y7O A;  3JU1 A;  4JWV A;  2PPY A;  2A7S A;  2Q2X A;  4ELX A;  1UYS A;  3U9T B;  3ZW9 A;  1VRG A;  3ZW8 A;  5G1R A;  3K8X A;  3QXI A;  4IZD A;  3T89 A;  3PGQ A;  1HNU A;  3BF0 A;  2F9I A;  4B3I A;  4HNK A;  1XX4 A;  2YJG A;  4HC8 A;  2J5I B;  3TVW A;  4EMM A;  3P5M A;  3KTH A;  4Q1I A;  5DL1 A;  5JBX A;  4FND A;  3T88 A;  3QMJ A;  2GTR A;  3PE8 A;  3ISA A;  1ON9 A;  1HNO A;  1EY3 A;  3QXZ A;  2FW2 A;  4B3J A;  2X24 A;  4MI2 A;  3KTJ A;  3FF6 A;  4JSB A;  4I42 A;  3T3W A;  2F9Y A;  3RSI A;  2NP9 A;  4FB8 A;  3H0J A;  2J5S A;  2CE3 A;  3H0Q A;  5DZK A;  2D3T A;  4F47 A;  4KD6 A;  4JFC A;  4RYF H;  5FIF A;  3U9S B;  2ZQQ A;  3M6M A;  4G2R A;  4ZDE A;  5KDR B;  2VX2 A;  3GF3 A;  5DKP A;  5DZK H;  2F9I B;  1DUB A;  3QWD A;  3TT7 A;  3BPP A;  3TZ3 A;  4ELS A;  1SZO A;  2J5G A;  4FNB A;  5FUS A;  3T8A A;  2FBM A;  2DUB A;  5KJP A;  3PEA A;  4U1A A;  1RJM A;  3KTK A;  1EF9 A;  4U19 A;  2PG8 A;  5DTP A;  4ASI A;  4ZDB A;  3KTI A;  4MOU A;  2F9Y B;  4U0G A;  1JXZ A;  3GMA A;  2UZF A;  4FN7 A;  1NZY A;  1O8U A;  4L6W A;  3R0O A;  1UYR A;  4JVT A;  3Q0G A;  4OG1 A;  1J7X A;  1DCI A;  3HLN 1;  3I47 A;  4EMP A;  4U0G H;  4J2U A;  1UYV A;  5ING A;  3QK8 A;  2IEX A;  2VSU E;  4WZ8 B;  1PJH A;  4FJW D;  5G1S A;  1WZ8 A;  1WDL A;  3IBB A;  4NAR A;  1MJ3 A;  2J5G D;  3LKE A;  2J5I I;  3GKB A;  3QRE A;  3OC7 A;  2HW5 A;  1K32 A;  3KQF A;  5INF A;  1RJN A;  5JBW A;  4JCR A;  2ZQR A;  2VSS E;  3LAO A;  4U0H A;  1FCF A;  4HDT A;  4GHN A;  5IKL B;  2QQ3 A;  3GLM A;  3ZWB A;  3BEZ A;  1XO6 A;  2PBP A;  2F6I A;  4RYF A;  5DUF A;  3R9Q A;  1NZY B;  3L3S A;  2A81 A;  5DUC A;  1W2X A;  3FDU A;  4OMR A;  3RST A;  4QFE A;  3TVU A;  3V5I A;  3Q1T A;  4ZDF A;  3IB9 A;  3R6H A;  5HUQ A;  5C90 A;  3PZK A;  3TT6 A;  4JYL A;  5DU8 A;  1TYF A;  3VIV A;  5E0S A;  4IZB A;  3IAV A;  5DTW A;  5CTB A;  2X58 A;  3GF7 A;  3R9T A;  4ZDC A;  3WG5 A;  2ZL0 A;  3QYR A;  5E0S H;  3TV5 A;  2CBY A;  4QII A;  1FC9 A;  2Q35 A;  3MYB A;  5DU4 A;  3HIN A;  3DOR A;  1WDK A;  3H02 A;  2J5I A;  2VSU F;  1N6D A;  4JYJ A;  1UYT A;  4MXI A;  3ZWC A;  4QIJ A;  4JCS A;  1Q52 A;  2Q34 A;  3SLL A;  4JOT A;  2F6Q A;  2C8T A;  4I52 A;  3MT6 A;  2VSS F;  3N6R B;  1YG6 A;  1YG8 A;  3RRV A;  4JCT A;  2VSU A;  3STA A;  1OD2 A;  3MFM A;  1X0U A;  4JCQ A;  4FN8 A;  4LK5 A;  2VSU C;  3M6N A;  3HP0 A;  2ZL3 A;  1Q51 A;  1XNV A;  3Q7H A;  3Q0J A;  2VSS A;  4K29 A;  2BZR A;  5KDR A;  2FZS A;  4GM2 A;  1TG6 A;  4Q0G A;  5G1Q A;  4OLQ A;  2ZL2 A;  3MOY A;  4K3W A;  3KTG A;  3ST9 A;  5INI A;  3V5E A;  4NNQ A;  3H0S A;  2ZL4 A;  4IZC A;  4NEK A;  3TRR A;  4Z0M A;  1HZD A;  3DJA A;  4YLH A;  3NJB A;  3SWX A;  4U18 A;  3ZWA A;  5E0N X;  3HRX A;  3BPT A;  1OD4 A;  4JJT A;  2EJ5 A;  4KPK A;  2A7K A;  1ON3 A;  5MGB A;  3QKA A;  3P85 A;  3G64 A;  3P2L A;  3H0U A;  2VRE A;  4L8K A;  4EML A;  4KWB A;  3OME A;  4WCZ A;  4ZU2 A;  5DU6 A;  4RCN A;  3TLF A;  3NJD A;  2W3P A;  5CTC A;  4KNP A;  4DI1 A;  1SG4 A;  4WYO B; 
#chains in the Genus database with same CATH homology
 3U9R B;  1FC6 A;  4K2N A;  3H81 A;  1WDM A;  3K50 A;  1EF8 A;  3TDC A;  4B3H A;  4ELW A;  5C9G A;  2DEO A;  4I4Z A;  1UIY A;  1N6F A;  3OT6 A;  4FZW A;  1N6E A;  1XNY A;  1PIX A;  3T8B A;  4ZDD A;  1K39 A;  1FC7 A;  3R9S A;  3HE2 A;  4FZW C;  1XNW A;  2WTB A;  1Y7O A;  3JU1 A;  4JWV A;  2PPY A;  2A7S A;  2Q2X A;  4ELX A;  1UYS A;  3U9T B;  3ZW9 A;  1VRG A;  3ZW8 A;  5G1R A;  3K8X A;  3QXI A;  4IZD A;  3T89 A;  3PGQ A;  1HNU A;  3BF0 A;  2F9I A;  4B3I A;  4HNK A;  1XX4 A;  2YJG A;  4HC8 A;  2J5I B;  3TVW A;  4EMM A;  3P5M A;  3KTH A;  4Q1I A;  5DL1 A;  5JBX A;  4FND A;  3T88 A;  3QMJ A;  2GTR A;  3PE8 A;  3ISA A;  1ON9 A;  1HNO A;  1EY3 A;  3QXZ A;  2FW2 A;  4B3J A;  2X24 A;  4MI2 A;  3KTJ A;  3FF6 A;  4JSB A;  4I42 A;  3T3W A;  2F9Y A;  3RSI A;  2NP9 A;  4FB8 A;  3H0J A;  2J5S A;  2CE3 A;  3H0Q A;  5DZK A;  2D3T A;  4F47 A;  4KD6 A;  4JFC A;  4RYF H;  5FIF A;  3U9S B;  2ZQQ A;  3M6M A;  4G2R A;  4ZDE A;  5KDR B;  2VX2 A;  3GF3 A;  5DKP A;  5DZK H;  2F9I B;  1DUB A;  3QWD A;  3TT7 A;  3BPP A;  3TZ3 A;  4ELS A;  1SZO A;  2J5G A;  4FNB A;  5FUS A;  3T8A A;  2FBM A;  2DUB A;  5KJP A;  3PEA A;  4U1A A;  1RJM A;  3KTK A;  1EF9 A;  4U19 A;  2PG8 A;  5DTP A;  4ASI A;  4ZDB A;  3KTI A;  4MOU A;  2F9Y B;  4U0G A;  1JXZ A;  3GMA A;  2UZF A;  4FN7 A;  1NZY A;  1O8U A;  4L6W A;  3R0O A;  1UYR A;  4JVT A;  3Q0G A;  4OG1 A;  1J7X A;  1DCI A;  3HLN 1;  3I47 A;  4EMP A;  4U0G H;  4J2U A;  1UYV A;  5ING A;  3QK8 A;  2IEX A;  2VSU E;  4WZ8 B;  1PJH A;  4FJW D;  5G1S A;  1WZ8 A;  1WDL A;  3IBB A;  4NAR A;  1MJ3 A;  2J5G D;  3LKE A;  2J5I I;  3GKB A;  3QRE A;  3OC7 A;  2HW5 A;  1K32 A;  3KQF A;  5INF A;  1RJN A;  5JBW A;  4JCR A;  2ZQR A;  2VSS E;  3LAO A;  4U0H A;  1FCF A;  4HDT A;  4GHN A;  5IKL B;  2QQ3 A;  3GLM A;  3ZWB A;  3BEZ A;  1XO6 A;  2PBP A;  2F6I A;  4RYF A;  5DUF A;  3R9Q A;  1NZY B;  3L3S A;  2A81 A;  5DUC A;  1W2X A;  3FDU A;  4OMR A;  3RST A;  4QFE A;  3TVU A;  3V5I A;  3Q1T A;  4ZDF A;  3IB9 A;  3R6H A;  5HUQ A;  5C90 A;  3PZK A;  3TT6 A;  4JYL A;  5DU8 A;  1TYF A;  3VIV A;  5E0S A;  4IZB A;  3IAV A;  5DTW A;  5CTB A;  2X58 A;  3GF7 A;  3R9T A;  4ZDC A;  3WG5 A;  2ZL0 A;  3QYR A;  5E0S H;  3TV5 A;  2CBY A;  4QII A;  1FC9 A;  2Q35 A;  3MYB A;  5DU4 A;  3HIN A;  3DOR A;  1WDK A;  3H02 A;  2J5I A;  2VSU F;  1N6D A;  4JYJ A;  1UYT A;  4MXI A;  3ZWC A;  4QIJ A;  4JCS A;  1Q52 A;  2Q34 A;  3SLL A;  4JOT A;  2F6Q A;  2C8T A;  4I52 A;  3MT6 A;  2VSS F;  3N6R B;  1YG6 A;  1YG8 A;  3RRV A;  4JCT A;  2VSU A;  3STA A;  1OD2 A;  3MFM A;  1X0U A;  4JCQ A;  4FN8 A;  4LK5 A;  2VSU C;  3M6N A;  3HP0 A;  2ZL3 A;  1Q51 A;  1XNV A;  3Q7H A;  3Q0J A;  2VSS A;  4K29 A;  2BZR A;  5KDR A;  2FZS A;  4GM2 A;  1TG6 A;  4Q0G A;  5G1Q A;  4OLQ A;  2ZL2 A;  3MOY A;  4K3W A;  3KTG A;  3ST9 A;  5INI A;  3V5E A;  4NNQ A;  3H0S A;  2ZL4 A;  4IZC A;  4NEK A;  3TRR A;  4Z0M A;  1HZD A;  3DJA A;  4YLH A;  3NJB A;  3SWX A;  4U18 A;  3ZWA A;  5E0N X;  3HRX A;  3BPT A;  1OD4 A;  4JJT A;  2EJ5 A;  4KPK A;  2A7K A;  1ON3 A;  5MGB A;  3QKA A;  3P85 A;  3G64 A;  3P2L A;  3H0U A;  2VRE A;  4L8K A;  4EML A;  4KWB A;  3OME A;  4WCZ A;  4ZU2 A;  5DU6 A;  4RCN A;  3TLF A;  3NJD A;  2W3P A;  5CTC A;  4KNP A;  4DI1 A;  1SG4 A;  4WYO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...