5E0SH

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
MRSNSQGLSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
total genus 64
structure length 186
sequence length 186
chains with identical sequence I, J, K, L, M, N, h, i, j, k, l, m, n
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5e0sH00
3R0OA 2J5GD 1SZOA 1FC6A 3TVWA 3MYBA 2A7SA 3VIVA 3M6NA 2QQ3A 4ZDDA 1X0UA 1UYTA 3P2LA 4JOTA 4FNDA 3MT6A 5INFA 3ZWBA 3R9TA 2FW2A 4B3HA 4QIJA 1EY3A 1WDKA 4QIIA 3ZWAA 4JFCA 1K39A 2VSUC 3T8AA 1UYVA 2VSSF 4F47A 4I42A 1FC9A 5CTCA 1HNOA 3LKEA 2VSUF 3TRRA 5DZKA 3GMAA 2A81A 4FN8A 5DL1A 4JYJA 1RJNA 2VREA 2BZRA 3IBBA 3KTKA 4DI1A 3H0SA 3H02A 1Q51A 2D3TA 4I52A 2FZSA 4ZU2A 3TV5A 4WZ8B 4JCTA 3SLLA 4EMPA 1OD2A 3P85A 1O8UA 4ELWA 2F6IA 3SWXA 4IZDA 5DUCA 5G1SA 2W3PA 2F9IA 5MGBA 3H0UA 3PE8A 3TLFA 3BEZA 5FIFA 4K2NA 4JSBA 3BPPA 5INIA 2Q2XA 3KTGA 4WYOB 3ZW9A 3QK8A 1ON9A 3OMEA 4JJTA 1HZDA 3TVUA 3HP0A 3GF7A 4JCQA 5FUSA 5KDRA 3T3WA 3V5EA 3N6RB 3FDUA 1YG8A 1PIXA 4U19A 3Q7HA 4B3IA 3IB9A 2WTBA 4MOUA 5E0NX 3T8BA 5DTWA 4KNPA 4FZWA 1SG4A 2VSUE 4OG1A 3MOYA 4RCNA 4K29A 3ISAA 3DJAA 1OD4A 2A7KA 2FBMA 3P5MA 3KTIA 2J5GA 2VX2A 1UYSA 2J5SA 3STAA 4U1AA 3QXZA 3PZKA 2Q35A 4HC8A 3JU1A 4U0HA 1XO6A 3R9SA 3GLMA 2ZL2A 3TDCA 3NJDA 4B3JA 4EMMA 2VSUA 3TT7A 1PJHA 2C8TA 1FCFA 1ON3A 4L8KA 3R9QA 3QKAA 2ZL3A 5DTPA 2F9YA 5C90A 2CE3A 1Q52A 1UIYA 5INGA 5JBXA 4JWVA 2X58A 2GTRA 4FZWC 3T88A 3I47A 3HE2A 5CTBA 5DUFA 4JCRA 3HLN1 4JVTA 3TT6A 1DUBA 2J5IA 3OC7A 2PG8A 4ZDCA 4Q0GA 3GF3A 2NP9A 1J7XA 1XX4A 4JYLA 3HINA 3RRVA 5DU6A 3K50A 2F9IB 3PGQA 5DKPA 3Q1TA 1UYRA 4KWBA 5G1QA 4ELXA 5DU4A 4QFEA 2ZQRA 1YG6A 1MJ3A 4JCSA 3U9TB 5KDRB 2VSSE 1JXZA 2ZL4A 1K32A 3BF0A 4IZBA 3QWDA 5IKLB 5DU8A 1XNWA 4FB8A 2VSSA 1WDLA 4KD6A 3ST9A 1VRGA 1EF9A 1N6EA 1FC7A 1N6FA 1NZYA 1XNYA 2F6QA 3GKBA 3RSTA 3MFMA 3H0QA 3NJBA 4GM2A 3HRXA 3U9RB 2DUBA 4EMLA 3QXIA 3R6HA 1N6DA 1WZ8A 4RYFA 4U0GH 3M6MA 5DZKH 3T89A 4LK5A 3H81A 4Q1IA 2PBPA 4FJWD 2UZFA 2EJ5A 4G2RA 3Q0JA 2HW5A 3V5IA 4K3WA 3L3SA 1EF8A 1Y7OA 3TZ3A 5E0SA 2J5IB 3K8XA 4RYFH 4U0GA 2IEXA 5C9GA 2J5II 4ASIA 2ZL0A 3PEAA 1XNVA 3KTHA 2ZQQA 1WDMA 3DORA 3KQFA 3OT6A 3Q0GA 3U9SB 4HNKA 1NZYB 1DCIA 3IAVA 3ZWCA 4NNQA 4MI2A 1RJMA 1TG6A 4YLHA 1W2XA 3FF6A 2DEOA 3QMJA 4I4ZA 3QREA 4FNBA 3H0JA 3LAOA 5E0SH 4ZDBA 5JBWA 4L6WA 4ZDEA 3RSIA 3QYRA 4ELSA 4OLQA 5G1RA 3G64A 4MXIA 1TYFA 2F9YB 4KPKA 1HNUA 2X24A 3KTJA 4IZCA 4Z0MA 4U18A 2PPYA 4GHNA 4ZDFA 2Q34A 3WG5A 3ZW8A 5KJPA 4FN7A 4NEKA 4OMRA 2CBYA 4WCZA
chains in the Genus database with same CATH superfamily
3R0OA 2J5GD 1SZOA 1FC6A 3TVWA 3MYBA 2A7SA 3VIVA 3M6NA 2QQ3A 4ZDDA 1X0UA 1UYTA 3P2LA 4JOTA 4FNDA 3MT6A 5INFA 3ZWBA 3R9TA 2FW2A 4B3HA 2YJGA 4QIJA 1EY3A 1WDKA 4QIIA 3ZWAA 4JFCA 1K39A 2VSUC 3T8AA 1UYVA 2VSSF 4F47A 4I42A 1FC9A 5CTCA 1HNOA 3LKEA 2VSUF 3TRRA 5DZKA 3GMAA 2A81A 4FN8A 5DL1A 4JYJA 1RJNA 2VREA 2BZRA 3IBBA 3KTKA 4DI1A 3H0SA 3H02A 1Q51A 2D3TA 4I52A 2FZSA 4ZU2A 3TV5A 4WZ8B 4JCTA 3SLLA 4EMPA 1OD2A 3P85A 1O8UA 4ELWA 2F6IA 3SWXA 4IZDA 5DUCA 5G1SA 2W3PA 2F9IA 5MGBA 3H0UA 3PE8A 3TLFA 3BEZA 5FIFA 4K2NA 4JSBA 4NARA 3BPPA 5INIA 2Q2XA 3KTGA 4WYOB 3ZW9A 3QK8A 1ON9A 3OMEA 4JJTA 1HZDA 3TVUA 3HP0A 3GF7A 4JCQA 5FUSA 5KDRA 3T3WA 3V5EA 3N6RB 3FDUA 1YG8A 1PIXA 4U19A 3Q7HA 4B3IA 3IB9A 2WTBA 4MOUA 5E0NX 3T8BA 5DTWA 4KNPA 4FZWA 1SG4A 2VSUE 4OG1A 3MOYA 5HUQA 4RCNA 4K29A 3ISAA 3DJAA 1OD4A 2A7KA 4HDTA 2FBMA 3P5MA 3KTIA 2J5GA 2VX2A 1UYSA 2J5SA 3STAA 4U1AA 3QXZA 3PZKA 2Q35A 4HC8A 3JU1A 4U0HA 1XO6A 3R9SA 3GLMA 2ZL2A 3TDCA 3BPTA 3NJDA 4B3JA 4EMMA 2VSUA 3TT7A 1PJHA 2C8TA 1FCFA 1ON3A 4L8KA 3R9QA 3QKAA 2ZL3A 5DTPA 2F9YA 5C90A 2CE3A 1Q52A 1UIYA 5INGA 5JBXA 4JWVA 2X58A 2GTRA 4FZWC 3T88A 3I47A 3HE2A 5CTBA 4J2UA 5DUFA 4JCRA 3HLN1 4JVTA 3TT6A 1DUBA 2J5IA 3OC7A 2PG8A 4ZDCA 4Q0GA 3GF3A 2NP9A 1J7XA 1XX4A 4JYLA 3HINA 3RRVA 5DU6A 3K50A 2F9IB 3PGQA 5DKPA 3Q1TA 1UYRA 4KWBA 5G1QA 4ELXA 5DU4A 4QFEA 2ZQRA 1YG6A 1MJ3A 4JCSA 3U9TB 5KDRB 2VSSE 1JXZA 2ZL4A 1K32A 3BF0A 4IZBA 3QWDA 5IKLB 5DU8A 1XNWA 4FB8A 2VSSA 1WDLA 4KD6A 3ST9A 1VRGA 1EF9A 1N6EA 1FC7A 1N6FA 1NZYA 1XNYA 2F6QA 3GKBA 3RSTA 3MFMA 3H0QA 3NJBA 4GM2A 3HRXA 3U9RB 2DUBA 4EMLA 3QXIA 3R6HA 1N6DA 1WZ8A 4RYFA 4U0GH 3M6MA 5DZKH 3T89A 4LK5A 3H81A 4Q1IA 2PBPA 4FJWD 2UZFA 2EJ5A 4G2RA 3Q0JA 2HW5A 3V5IA 4K3WA 3L3SA 1EF8A 1Y7OA 3TZ3A 5E0SA 2J5IB 3K8XA 4RYFH 4U0GA 2IEXA 5C9GA 2J5II 4ASIA 2ZL0A 3PEAA 1XNVA 3KTHA 2ZQQA 1WDMA 3DORA 3KQFA 3OT6A 3Q0GA 3U9SB 4HNKA 1NZYB 1DCIA 3IAVA 3ZWCA 4NNQA 4MI2A 1RJMA 1TG6A 4YLHA 1W2XA 3FF6A 2DEOA 3QMJA 4I4ZA 3QREA 4FNBA 3H0JA 3LAOA 5E0SH 4ZDBA 5JBWA 4L6WA 4ZDEA 3RSIA 3QYRA 4ELSA 4OLQA 5G1RA 3G64A 4MXIA 1TYFA 2F9YB 4KPKA 1HNUA 2X24A 3KTJA 4IZCA 4Z0MA 4U18A 2PPYA 4GHNA 4ZDFA 2Q34A 3WG5A 3ZW8A 5KJPA 4FN7A 4NEKA 4OMRA 2CBYA 4WCZA
chains in the Genus database with same CATH topology
3R0OA 2J5GD 1SZOA 1FC6A 3TVWA 3MYBA 2A7SA 3VIVA 3M6NA 2QQ3A 4ZDDA 1X0UA 1UYTA 3P2LA 4JOTA 4FNDA 3MT6A 5INFA 3ZWBA 3R9TA 2FW2A 4B3HA 2YJGA 4QIJA 1EY3A 1WDKA 4QIIA 3ZWAA 4JFCA 1K39A 2VSUC 3T8AA 1UYVA 2VSSF 4F47A 4I42A 1FC9A 5CTCA 1HNOA 3LKEA 2VSUF 3TRRA 5DZKA 3GMAA 2A81A 4FN8A 5DL1A 4JYJA 1RJNA 2VREA 2BZRA 3IBBA 3KTKA 4DI1A 3H0SA 3H02A 1Q51A 2D3TA 4I52A 2FZSA 4ZU2A 3TV5A 4WZ8B 4JCTA 3SLLA 4EMPA 1OD2A 3P85A 1O8UA 4ELWA 2F6IA 3SWXA 4IZDA 5DUCA 5G1SA 2W3PA 2F9IA 5MGBA 3H0UA 3PE8A 3TLFA 3BEZA 5FIFA 4K2NA 4JSBA 4NARA 3BPPA 5INIA 2Q2XA 3KTGA 4WYOB 3ZW9A 3QK8A 1ON9A 3OMEA 4JJTA 1HZDA 3TVUA 3HP0A 3GF7A 4JCQA 5FUSA 5KDRA 3T3WA 3V5EA 3N6RB 3FDUA 1YG8A 1PIXA 4U19A 3Q7HA 4B3IA 3IB9A 2WTBA 4MOUA 5E0NX 3T8BA 5DTWA 4KNPA 4FZWA 1SG4A 2VSUE 4OG1A 3MOYA 5HUQA 4RCNA 4K29A 3ISAA 3DJAA 1OD4A 2A7KA 4HDTA 2FBMA 3P5MA 3KTIA 2J5GA 2VX2A 1UYSA 2J5SA 3STAA 4U1AA 3QXZA 3PZKA 2Q35A 4HC8A 3JU1A 4U0HA 1XO6A 3R9SA 3GLMA 2ZL2A 3TDCA 3BPTA 3NJDA 4B3JA 4EMMA 2VSUA 3TT7A 1PJHA 2C8TA 1FCFA 1ON3A 4L8KA 3R9QA 3QKAA 2ZL3A 5DTPA 2F9YA 5C90A 2CE3A 1Q52A 1UIYA 5INGA 5JBXA 4JWVA 2X58A 2GTRA 4FZWC 3T88A 3I47A 3HE2A 5CTBA 4J2UA 5DUFA 4JCRA 3HLN1 4JVTA 3TT6A 1DUBA 2J5IA 3OC7A 2PG8A 4ZDCA 4Q0GA 3GF3A 2NP9A 1J7XA 1XX4A 4JYLA 3HINA 3RRVA 5DU6A 3K50A 2F9IB 3PGQA 5DKPA 3Q1TA 1UYRA 4KWBA 5G1QA 4ELXA 5DU4A 4QFEA 2ZQRA 1YG6A 1MJ3A 4JCSA 3U9TB 5KDRB 2VSSE 1JXZA 2ZL4A 1K32A 3BF0A 4IZBA 3QWDA 5IKLB 5DU8A 1XNWA 4FB8A 2VSSA 1WDLA 4KD6A 3ST9A 1VRGA 1EF9A 1N6EA 1FC7A 1N6FA 1NZYA 1XNYA 2F6QA 3GKBA 3RSTA 3MFMA 3H0QA 3NJBA 4GM2A 3HRXA 3U9RB 2DUBA 4EMLA 3QXIA 3R6HA 1N6DA 1WZ8A 4RYFA 4U0GH 3M6MA 5DZKH 3T89A 4LK5A 3H81A 4Q1IA 2PBPA 4FJWD 2UZFA 2EJ5A 4G2RA 3Q0JA 2HW5A 3V5IA 4K3WA 3L3SA 1EF8A 1Y7OA 3TZ3A 5E0SA 2J5IB 3K8XA 4RYFH 4U0GA 2IEXA 5C9GA 2J5II 4ASIA 2ZL0A 3PEAA 1XNVA 3KTHA 2ZQQA 1WDMA 3DORA 3KQFA 3OT6A 3Q0GA 3U9SB 4HNKA 1NZYB 1DCIA 3IAVA 3ZWCA 4NNQA 4MI2A 1RJMA 1TG6A 4YLHA 1W2XA 3FF6A 2DEOA 3QMJA 4I4ZA 3QREA 4FNBA 3H0JA 3LAOA 5E0SH 4ZDBA 5JBWA 4L6WA 4ZDEA 3RSIA 3QYRA 4ELSA 4OLQA 5G1RA 3G64A 4MXIA 1TYFA 2F9YB 4KPKA 1HNUA 2X24A 3KTJA 4IZCA 4Z0MA 4U18A 2PPYA 4GHNA 4ZDFA 2Q34A 3WG5A 3ZW8A 5KJPA 4FN7A 4NEKA 4OMRA 2CBYA 4WCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0O A;  2J5G D;  1SZO A;  1FC6 A;  3TVW A;  3MYB A;  2A7S A;  3VIV A;  3M6N A;  2QQ3 A;  4ZDD A;  1X0U A;  1UYT A;  3P2L A;  4JOT A;  4FND A;  3MT6 A;  5INF A;  3ZWB A;  3R9T A;  2FW2 A;  4B3H A;  4QIJ A;  1EY3 A;  1WDK A;  4QII A;  3ZWA A;  4JFC A;  1K39 A;  2VSU C;  3T8A A;  1UYV A;  2VSS F;  4F47 A;  4I42 A;  1FC9 A;  5CTC A;  1HNO A;  3LKE A;  2VSU F;  3TRR A;  5DZK A;  3GMA A;  2A81 A;  4FN8 A;  5DL1 A;  4JYJ A;  1RJN A;  2VRE A;  2BZR A;  3IBB A;  3KTK A;  4DI1 A;  3H0S A;  3H02 A;  1Q51 A;  2D3T A;  4I52 A;  2FZS A;  4ZU2 A;  3TV5 A;  4WZ8 B;  4JCT A;  3SLL A;  4EMP A;  1OD2 A;  3P85 A;  1O8U A;  4ELW A;  2F6I A;  3SWX A;  4IZD A;  5DUC A;  5G1S A;  2W3P A;  2F9I A;  5MGB A;  3H0U A;  3PE8 A;  3TLF A;  3BEZ A;  5FIF A;  4K2N A;  4JSB A;  3BPP A;  5INI A;  2Q2X A;  3KTG A;  4WYO B;  3ZW9 A;  3QK8 A;  1ON9 A;  3OME A;  4JJT A;  1HZD A;  3TVU A;  3HP0 A;  3GF7 A;  4JCQ A;  5FUS A;  5KDR A;  3T3W A;  3V5E A;  3N6R B;  3FDU A;  1YG8 A;  1PIX A;  4U19 A;  3Q7H A;  4B3I A;  3IB9 A;  2WTB A;  4MOU A;  5E0N X;  3T8B A;  5DTW A;  4KNP A;  4FZW A;  1SG4 A;  2VSU E;  4OG1 A;  3MOY A;  4RCN A;  4K29 A;  3ISA A;  3DJA A;  1OD4 A;  2A7K A;  2FBM A;  3P5M A;  3KTI A;  2J5G A;  2VX2 A;  1UYS A;  2J5S A;  3STA A;  4U1A A;  3QXZ A;  3PZK A;  2Q35 A;  4HC8 A;  3JU1 A;  4U0H A;  1XO6 A;  3R9S A;  3GLM A;  2ZL2 A;  3TDC A;  3NJD A;  4B3J A;  4EMM A;  2VSU A;  3TT7 A;  1PJH A;  2C8T A;  1FCF A;  1ON3 A;  4L8K A;  3R9Q A;  3QKA A;  2ZL3 A;  5DTP A;  2F9Y A;  5C90 A;  2CE3 A;  1Q52 A;  1UIY A;  5ING A;  5JBX A;  4JWV A;  2X58 A;  2GTR A;  4FZW C;  3T88 A;  3I47 A;  3HE2 A;  5CTB A;  5DUF A;  4JCR A;  3HLN 1;  4JVT A;  3TT6 A;  1DUB A;  2J5I A;  3OC7 A;  2PG8 A;  4ZDC A;  4Q0G A;  3GF3 A;  2NP9 A;  1J7X A;  1XX4 A;  4JYL A;  3HIN A;  3RRV A;  5DU6 A;  3K50 A;  2F9I B;  3PGQ A;  5DKP A;  3Q1T A;  1UYR A;  4KWB A;  5G1Q A;  4ELX A;  5DU4 A;  4QFE A;  2ZQR A;  1YG6 A;  1MJ3 A;  4JCS A;  3U9T B;  5KDR B;  2VSS E;  1JXZ A;  2ZL4 A;  1K32 A;  3BF0 A;  4IZB A;  3QWD A;  5IKL B;  5DU8 A;  1XNW A;  4FB8 A;  2VSS A;  1WDL A;  4KD6 A;  3ST9 A;  1VRG A;  1EF9 A;  1N6E A;  1FC7 A;  1N6F A;  1NZY A;  1XNY A;  2F6Q A;  3GKB A;  3RST A;  3MFM A;  3H0Q A;  3NJB A;  4GM2 A;  3HRX A;  3U9R B;  2DUB A;  4EML A;  3QXI A;  3R6H A;  1N6D A;  1WZ8 A;  4RYF A;  4U0G H;  3M6M A;  5DZK H;  3T89 A;  4LK5 A;  3H81 A;  4Q1I A;  2PBP A;  4FJW D;  2UZF A;  2EJ5 A;  4G2R A;  3Q0J A;  2HW5 A;  3V5I A;  4K3W A;  3L3S A;  1EF8 A;  1Y7O A;  3TZ3 A;  5E0S A;  2J5I B;  3K8X A;  4RYF H;  4U0G A;  2IEX A;  5C9G A;  2J5I I;  4ASI A;  2ZL0 A;  3PEA A;  1XNV A;  3KTH A;  2ZQQ A;  1WDM A;  3DOR A;  3KQF A;  3OT6 A;  3Q0G A;  3U9S B;  4HNK A;  1NZY B;  1DCI A;  3IAV A;  3ZWC A;  4NNQ A;  4MI2 A;  1RJM A;  1TG6 A;  4YLH A;  1W2X A;  3FF6 A;  2DEO A;  3QMJ A;  4I4Z A;  3QRE A;  4FNB A;  3H0J A;  3LAO A;  5E0S H;  4ZDB A;  5JBW A;  4L6W A;  4ZDE A;  3RSI A;  3QYR A;  4ELS A;  4OLQ A;  5G1R A;  3G64 A;  4MXI A;  1TYF A;  2F9Y B;  4KPK A;  1HNU A;  2X24 A;  3KTJ A;  4IZC A;  4Z0M A;  4U18 A;  2PPY A;  4GHN A;  4ZDF A;  2Q34 A;  3WG5 A;  3ZW8 A;  5KJP A;  4FN7 A;  4NEK A;  4OMR A;  2CBY A;  4WCZ A; 
#chains in the Genus database with same CATH topology
 3R0O A;  2J5G D;  1SZO A;  1FC6 A;  3TVW A;  3MYB A;  2A7S A;  3VIV A;  3M6N A;  2QQ3 A;  4ZDD A;  1X0U A;  1UYT A;  3P2L A;  4JOT A;  4FND A;  3MT6 A;  5INF A;  3ZWB A;  3R9T A;  2FW2 A;  4B3H A;  2YJG A;  4QIJ A;  1EY3 A;  1WDK A;  4QII A;  3ZWA A;  4JFC A;  1K39 A;  2VSU C;  3T8A A;  1UYV A;  2VSS F;  4F47 A;  4I42 A;  1FC9 A;  5CTC A;  1HNO A;  3LKE A;  2VSU F;  3TRR A;  5DZK A;  3GMA A;  2A81 A;  4FN8 A;  5DL1 A;  4JYJ A;  1RJN A;  2VRE A;  2BZR A;  3IBB A;  3KTK A;  4DI1 A;  3H0S A;  3H02 A;  1Q51 A;  2D3T A;  4I52 A;  2FZS A;  4ZU2 A;  3TV5 A;  4WZ8 B;  4JCT A;  3SLL A;  4EMP A;  1OD2 A;  3P85 A;  1O8U A;  4ELW A;  2F6I A;  3SWX A;  4IZD A;  5DUC A;  5G1S A;  2W3P A;  2F9I A;  5MGB A;  3H0U A;  3PE8 A;  3TLF A;  3BEZ A;  5FIF A;  4K2N A;  4JSB A;  4NAR A;  3BPP A;  5INI A;  2Q2X A;  3KTG A;  4WYO B;  3ZW9 A;  3QK8 A;  1ON9 A;  3OME A;  4JJT A;  1HZD A;  3TVU A;  3HP0 A;  3GF7 A;  4JCQ A;  5FUS A;  5KDR A;  3T3W A;  3V5E A;  3N6R B;  3FDU A;  1YG8 A;  1PIX A;  4U19 A;  3Q7H A;  4B3I A;  3IB9 A;  2WTB A;  4MOU A;  5E0N X;  3T8B A;  5DTW A;  4KNP A;  4FZW A;  1SG4 A;  2VSU E;  4OG1 A;  3MOY A;  5HUQ A;  4RCN A;  4K29 A;  3ISA A;  3DJA A;  1OD4 A;  2A7K A;  4HDT A;  2FBM A;  3P5M A;  3KTI A;  2J5G A;  2VX2 A;  1UYS A;  2J5S A;  3STA A;  4U1A A;  3QXZ A;  3PZK A;  2Q35 A;  4HC8 A;  3JU1 A;  4U0H A;  1XO6 A;  3R9S A;  3GLM A;  2ZL2 A;  3TDC A;  3BPT A;  3NJD A;  4B3J A;  4EMM A;  2VSU A;  3TT7 A;  1PJH A;  2C8T A;  1FCF A;  1ON3 A;  4L8K A;  3R9Q A;  3QKA A;  2ZL3 A;  5DTP A;  2F9Y A;  5C90 A;  2CE3 A;  1Q52 A;  1UIY A;  5ING A;  5JBX A;  4JWV A;  2X58 A;  2GTR A;  4FZW C;  3T88 A;  3I47 A;  3HE2 A;  5CTB A;  4J2U A;  5DUF A;  4JCR A;  3HLN 1;  4JVT A;  3TT6 A;  1DUB A;  2J5I A;  3OC7 A;  2PG8 A;  4ZDC A;  4Q0G A;  3GF3 A;  2NP9 A;  1J7X A;  1XX4 A;  4JYL A;  3HIN A;  3RRV A;  5DU6 A;  3K50 A;  2F9I B;  3PGQ A;  5DKP A;  3Q1T A;  1UYR A;  4KWB A;  5G1Q A;  4ELX A;  5DU4 A;  4QFE A;  2ZQR A;  1YG6 A;  1MJ3 A;  4JCS A;  3U9T B;  5KDR B;  2VSS E;  1JXZ A;  2ZL4 A;  1K32 A;  3BF0 A;  4IZB A;  3QWD A;  5IKL B;  5DU8 A;  1XNW A;  4FB8 A;  2VSS A;  1WDL A;  4KD6 A;  3ST9 A;  1VRG A;  1EF9 A;  1N6E A;  1FC7 A;  1N6F A;  1NZY A;  1XNY A;  2F6Q A;  3GKB A;  3RST A;  3MFM A;  3H0Q A;  3NJB A;  4GM2 A;  3HRX A;  3U9R B;  2DUB A;  4EML A;  3QXI A;  3R6H A;  1N6D A;  1WZ8 A;  4RYF A;  4U0G H;  3M6M A;  5DZK H;  3T89 A;  4LK5 A;  3H81 A;  4Q1I A;  2PBP A;  4FJW D;  2UZF A;  2EJ5 A;  4G2R A;  3Q0J A;  2HW5 A;  3V5I A;  4K3W A;  3L3S A;  1EF8 A;  1Y7O A;  3TZ3 A;  5E0S A;  2J5I B;  3K8X A;  4RYF H;  4U0G A;  2IEX A;  5C9G A;  2J5I I;  4ASI A;  2ZL0 A;  3PEA A;  1XNV A;  3KTH A;  2ZQQ A;  1WDM A;  3DOR A;  3KQF A;  3OT6 A;  3Q0G A;  3U9S B;  4HNK A;  1NZY B;  1DCI A;  3IAV A;  3ZWC A;  4NNQ A;  4MI2 A;  1RJM A;  1TG6 A;  4YLH A;  1W2X A;  3FF6 A;  2DEO A;  3QMJ A;  4I4Z A;  3QRE A;  4FNB A;  3H0J A;  3LAO A;  5E0S H;  4ZDB A;  5JBW A;  4L6W A;  4ZDE A;  3RSI A;  3QYR A;  4ELS A;  4OLQ A;  5G1R A;  3G64 A;  4MXI A;  1TYF A;  2F9Y B;  4KPK A;  1HNU A;  2X24 A;  3KTJ A;  4IZC A;  4Z0M A;  4U18 A;  2PPY A;  4GHN A;  4ZDF A;  2Q34 A;  3WG5 A;  3ZW8 A;  5KJP A;  4FN7 A;  4NEK A;  4OMR A;  2CBY A;  4WCZ A; 
#chains in the Genus database with same CATH homology
 3R0O A;  2J5G D;  1SZO A;  1FC6 A;  3TVW A;  3MYB A;  2A7S A;  3VIV A;  3M6N A;  2QQ3 A;  4ZDD A;  1X0U A;  1UYT A;  3P2L A;  4JOT A;  4FND A;  3MT6 A;  5INF A;  3ZWB A;  3R9T A;  2FW2 A;  4B3H A;  2YJG A;  4QIJ A;  1EY3 A;  1WDK A;  4QII A;  3ZWA A;  4JFC A;  1K39 A;  2VSU C;  3T8A A;  1UYV A;  2VSS F;  4F47 A;  4I42 A;  1FC9 A;  5CTC A;  1HNO A;  3LKE A;  2VSU F;  3TRR A;  5DZK A;  3GMA A;  2A81 A;  4FN8 A;  5DL1 A;  4JYJ A;  1RJN A;  2VRE A;  2BZR A;  3IBB A;  3KTK A;  4DI1 A;  3H0S A;  3H02 A;  1Q51 A;  2D3T A;  4I52 A;  2FZS A;  4ZU2 A;  3TV5 A;  4WZ8 B;  4JCT A;  3SLL A;  4EMP A;  1OD2 A;  3P85 A;  1O8U A;  4ELW A;  2F6I A;  3SWX A;  4IZD A;  5DUC A;  5G1S A;  2W3P A;  2F9I A;  5MGB A;  3H0U A;  3PE8 A;  3TLF A;  3BEZ A;  5FIF A;  4K2N A;  4JSB A;  4NAR A;  3BPP A;  5INI A;  2Q2X A;  3KTG A;  4WYO B;  3ZW9 A;  3QK8 A;  1ON9 A;  3OME A;  4JJT A;  1HZD A;  3TVU A;  3HP0 A;  3GF7 A;  4JCQ A;  5FUS A;  5KDR A;  3T3W A;  3V5E A;  3N6R B;  3FDU A;  1YG8 A;  1PIX A;  4U19 A;  3Q7H A;  4B3I A;  3IB9 A;  2WTB A;  4MOU A;  5E0N X;  3T8B A;  5DTW A;  4KNP A;  4FZW A;  1SG4 A;  2VSU E;  4OG1 A;  3MOY A;  5HUQ A;  4RCN A;  4K29 A;  3ISA A;  3DJA A;  1OD4 A;  2A7K A;  4HDT A;  2FBM A;  3P5M A;  3KTI A;  2J5G A;  2VX2 A;  1UYS A;  2J5S A;  3STA A;  4U1A A;  3QXZ A;  3PZK A;  2Q35 A;  4HC8 A;  3JU1 A;  4U0H A;  1XO6 A;  3R9S A;  3GLM A;  2ZL2 A;  3TDC A;  3BPT A;  3NJD A;  4B3J A;  4EMM A;  2VSU A;  3TT7 A;  1PJH A;  2C8T A;  1FCF A;  1ON3 A;  4L8K A;  3R9Q A;  3QKA A;  2ZL3 A;  5DTP A;  2F9Y A;  5C90 A;  2CE3 A;  1Q52 A;  1UIY A;  5ING A;  5JBX A;  4JWV A;  2X58 A;  2GTR A;  4FZW C;  3T88 A;  3I47 A;  3HE2 A;  5CTB A;  4J2U A;  5DUF A;  4JCR A;  3HLN 1;  4JVT A;  3TT6 A;  1DUB A;  2J5I A;  3OC7 A;  2PG8 A;  4ZDC A;  4Q0G A;  3GF3 A;  2NP9 A;  1J7X A;  1XX4 A;  4JYL A;  3HIN A;  3RRV A;  5DU6 A;  3K50 A;  2F9I B;  3PGQ A;  5DKP A;  3Q1T A;  1UYR A;  4KWB A;  5G1Q A;  4ELX A;  5DU4 A;  4QFE A;  2ZQR A;  1YG6 A;  1MJ3 A;  4JCS A;  3U9T B;  5KDR B;  2VSS E;  1JXZ A;  2ZL4 A;  1K32 A;  3BF0 A;  4IZB A;  3QWD A;  5IKL B;  5DU8 A;  1XNW A;  4FB8 A;  2VSS A;  1WDL A;  4KD6 A;  3ST9 A;  1VRG A;  1EF9 A;  1N6E A;  1FC7 A;  1N6F A;  1NZY A;  1XNY A;  2F6Q A;  3GKB A;  3RST A;  3MFM A;  3H0Q A;  3NJB A;  4GM2 A;  3HRX A;  3U9R B;  2DUB A;  4EML A;  3QXI A;  3R6H A;  1N6D A;  1WZ8 A;  4RYF A;  4U0G H;  3M6M A;  5DZK H;  3T89 A;  4LK5 A;  3H81 A;  4Q1I A;  2PBP A;  4FJW D;  2UZF A;  2EJ5 A;  4G2R A;  3Q0J A;  2HW5 A;  3V5I A;  4K3W A;  3L3S A;  1EF8 A;  1Y7O A;  3TZ3 A;  5E0S A;  2J5I B;  3K8X A;  4RYF H;  4U0G A;  2IEX A;  5C9G A;  2J5I I;  4ASI A;  2ZL0 A;  3PEA A;  1XNV A;  3KTH A;  2ZQQ A;  1WDM A;  3DOR A;  3KQF A;  3OT6 A;  3Q0G A;  3U9S B;  4HNK A;  1NZY B;  1DCI A;  3IAV A;  3ZWC A;  4NNQ A;  4MI2 A;  1RJM A;  1TG6 A;  4YLH A;  1W2X A;  3FF6 A;  2DEO A;  3QMJ A;  4I4Z A;  3QRE A;  4FNB A;  3H0J A;  3LAO A;  5E0S H;  4ZDB A;  5JBW A;  4L6W A;  4ZDE A;  3RSI A;  3QYR A;  4ELS A;  4OLQ A;  5G1R A;  3G64 A;  4MXI A;  1TYF A;  2F9Y B;  4KPK A;  1HNU A;  2X24 A;  3KTJ A;  4IZC A;  4Z0M A;  4U18 A;  2PPY A;  4GHN A;  4ZDF A;  2Q34 A;  3WG5 A;  3ZW8 A;  5KJP A;  4FN7 A;  4NEK A;  4OMR A;  2CBY A;  4WCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...