5E0SH

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
b'MRSNSQGLSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
total genus 64
structure length 186
sequence length 186
chains with identical sequence I, J, K, L, M, N, h, i, j, k, l, m, n
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5e0sH00
3QWDA 4JJTA 1OD2A 2F6QA 4IZBA 2C8TA 2F6IA 5G1QA 3LAOA 4B3JA 5DZKA 4ZDCA 4B3HA 1FC7A 3GMAA 2F9IB 5DUCA 3QYRA 3H02A 3T8BA 4NNQA 3H0JA 4WZ8B 2CE3A 5JBWA 3GKBA 1RJMA 3FF6A 3OT6A 5C9GA 2GTRA 3TT7A 1PJHA 3U9TB 5C90A 4WCZA 2ZL2A 3TT6A 2PG8A 2PPYA 3TZ3A 3T3WA 1YG8A 2A7SA 5DTWA 2J5IA 4JWVA 3R0OA 4JCRA 4K2NA 4K29A 3HLN1 2UZFA 1O8UA 3RSTA 1XNYA 4FNDA 4B3IA 1PIXA 1DCIA 5E0SH 1FCFA 2W3PA 2ZQRA 5DUFA 3M6NA 3KTKA 4MOUA 3H0QA 4QIIA 2J5SA 4GM2A 4YLHA 5DL1A 3Q0JA 3PE8A 3Q0GA 1UIYA 4ELXA 5DU4A 2WTBA 2HW5A 3PGQA 2VREA 1K39A 4L6WA 3KTHA 4ASIA 1RJNA 3R9SA 5KJPA 4Q0GA 2BZRA 3ISAA 3K50A 1FC6A 2X58A 1XNWA 4RCNA 4KWBA 4FN7A 2F9YA 5DU8A 5FIFA 3ZW9A 4JFCA 1WZ8A 1HNOA 1Q52A 4LK5A 3SWXA 3R9TA 4EMMA 2NP9A 1TYFA 1W2XA 4ZDFA 3RRVA 1WDKA 3G64A 4U0GH 3M6MA 3LKEA 3HE2A 5MGBA 1ON3A 3MOYA 2F9IA 3V5EA 2J5GA 4WYOB 4ZU2A 4I4ZA 4HC8A 3I47A 3T89A 3N6RB 3T88A 3IAVA 3DORA 3V5IA 4U19A 1UYTA 3KQFA 4FZWA 5E0NX 4U18A 3Q1TA 4L8KA 2VX2A 5G1SA 1X0UA 4OMRA 2Q35A 3VIVA 1YG6A 3TVUA 4FB8A 1ON9A 4MI2A 1XO6A 3DJAA 3BPPA 3STAA 4KD6A 2ZL3A 3T8AA 4Q1IA 2A81A 4FZWC 5DKPA 3BEZA 4IZCA 3TRRA 1Y7OA 1SG4A 4K3WA 3KTGA 4U1AA 4I42A 4DI1A 3BF0A 3NJBA 1Q51A 5IKLB 3TDCA 1NZYB 4ZDBA 1OD4A 1VRGA 1HZDA 3GF7A 3PEAA 3QXZA 3TLFA 3HP0A 1TG6A 2FZSA 1N6DA 2J5II 3QK8A 3GF3A 2DEOA 2VSUC 4QFEA 2FBMA 3WG5A 3U9RB 4ELWA 4GHNA 4FJWD 5JBXA 4EMLA 3IB9A 2D3TA 3H0UA 3Q7HA 1J7XA 3MFMA 4JCSA 1UYRA 4RYFH 3H0SA 2PBPA 4JOTA 4EMPA 5INGA 3K8XA 2X24A 3OC7A 5DTPA 4F47A 1DUBA 3ZWAA 1JXZA 2VSSE 1FC9A 3P2LA 1XX4A 4NEKA 4ZDDA 3SLLA 2QQ3A 1XNVA 4Z0MA 4JSBA 5DZKH 3ZW8A 4JCTA 2VSSA 2EJ5A 4OLQA 3NJDA 4FNBA 2A7KA 2IEXA 3MT6A 3PZKA 5KDRA 5KDRB 3ZWBA 5CTCA 4IZDA 1UYSA 1WDMA 2VSUE 3P85A 4ELSA 5FUSA 3HINA 5DU6A 2ZQQA 3GLMA 4U0HA 3ZWCA 3QREA 5INFA 4JYJA 2FW2A 1N6FA 3TV5A 5E0SA 3P5MA 4FN8A 3R6HA 5CTBA 1EY3A 2VSUA 3FDUA 2J5IB 2VSSF 2J5GD 3OMEA 1UYVA 4JCQA 3HRXA 1EF8A 3KTIA 4G2RA 4JYLA 5INIA 1EF9A 3KTJA 4I52A 2DUBA 3H81A 3QMJA 1HNUA 1SZOA 1NZYA 4JVTA 2ZL4A 1N6EA 2Q34A 4HNKA 3QKAA 4ZDEA 3U9SB 2ZL0A 3QXIA 1WDLA 2VSUF 4OG1A 2CBYA 3JU1A 1K32A 3RSIA 2Q2XA 4QIJA 3R9QA 4MXIA 4KPKA 3IBBA 3ST9A 3L3SA 3MYBA 1MJ3A 4RYFA 5G1RA 4U0GA 3TVWA 2F9YB 4KNPA
chains in the Genus database with same CATH superfamily
3QWDA 4JJTA 1OD2A 2F6QA 4IZBA 2C8TA 2F6IA 5G1QA 3LAOA 4B3JA 5DZKA 4ZDCA 4B3HA 1FC7A 3GMAA 2F9IB 5DUCA 3QYRA 3H02A 3T8BA 4NNQA 3H0JA 4WZ8B 2CE3A 5JBWA 3GKBA 1RJMA 3FF6A 3OT6A 5C9GA 2GTRA 3TT7A 1PJHA 3U9TB 5C90A 4WCZA 2ZL2A 3TT6A 2PG8A 2PPYA 3TZ3A 3T3WA 1YG8A 2A7SA 5DTWA 2J5IA 4JWVA 3R0OA 4JCRA 4K2NA 4K29A 3HLN1 2UZFA 1O8UA 3RSTA 1XNYA 4FNDA 4B3IA 1PIXA 1DCIA 5E0SH 1FCFA 2W3PA 2ZQRA 5DUFA 3M6NA 3KTKA 4MOUA 3H0QA 4QIIA 2J5SA 4GM2A 4YLHA 5DL1A 3Q0JA 3PE8A 3Q0GA 1UIYA 4ELXA 5DU4A 2WTBA 2HW5A 3PGQA 2VREA 1K39A 4L6WA 3KTHA 4ASIA 1RJNA 3R9SA 5KJPA 4Q0GA 2BZRA 3ISAA 4HDTA 3K50A 1FC6A 2X58A 1XNWA 4RCNA 4KWBA 4FN7A 2F9YA 5DU8A 5FIFA 3ZW9A 4JFCA 1WZ8A 1HNOA 1Q52A 4LK5A 3SWXA 3R9TA 4EMMA 2NP9A 2YJGA 1TYFA 1W2XA 4ZDFA 3RRVA 1WDKA 3G64A 4U0GH 3M6MA 3LKEA 3HE2A 5MGBA 1ON3A 3MOYA 2F9IA 3V5EA 2J5GA 4WYOB 4ZU2A 4I4ZA 4HC8A 3I47A 3T89A 3N6RB 3T88A 3IAVA 3DORA 3V5IA 4U19A 1UYTA 3KQFA 4FZWA 5E0NX 4U18A 3Q1TA 5HUQA 4L8KA 2VX2A 5G1SA 1X0UA 4OMRA 2Q35A 3VIVA 1YG6A 3TVUA 4FB8A 1ON9A 4MI2A 1XO6A 3DJAA 3BPPA 3STAA 4KD6A 2ZL3A 3T8AA 4Q1IA 2A81A 4FZWC 5DKPA 3BEZA 4IZCA 3TRRA 1Y7OA 1SG4A 4K3WA 3KTGA 4U1AA 4I42A 4DI1A 3BF0A 3NJBA 1Q51A 5IKLB 3TDCA 1NZYB 4ZDBA 1OD4A 1VRGA 1HZDA 3GF7A 3PEAA 3QXZA 3TLFA 3HP0A 1TG6A 2FZSA 1N6DA 2J5II 3QK8A 3GF3A 2DEOA 2VSUC 4QFEA 2FBMA 3WG5A 3U9RB 4ELWA 4GHNA 4FJWD 5JBXA 4EMLA 3IB9A 2D3TA 3H0UA 3Q7HA 1J7XA 3MFMA 4JCSA 1UYRA 4RYFH 3BPTA 3H0SA 2PBPA 4JOTA 4EMPA 5INGA 3K8XA 2X24A 3OC7A 5DTPA 4F47A 1DUBA 3ZWAA 1JXZA 2VSSE 1FC9A 3P2LA 1XX4A 4NEKA 4ZDDA 3SLLA 2QQ3A 1XNVA 4Z0MA 4JSBA 5DZKH 3ZW8A 4JCTA 2VSSA 2EJ5A 4OLQA 3NJDA 4FNBA 2A7KA 2IEXA 3MT6A 3PZKA 5KDRA 5KDRB 3ZWBA 5CTCA 4J2UA 4IZDA 1UYSA 1WDMA 2VSUE 3P85A 4ELSA 5FUSA 3HINA 5DU6A 2ZQQA 3GLMA 4NARA 4U0HA 3ZWCA 3QREA 5INFA 4JYJA 2FW2A 1N6FA 3TV5A 5E0SA 3P5MA 4FN8A 3R6HA 5CTBA 1EY3A 2VSUA 3FDUA 2J5IB 2VSSF 2J5GD 3OMEA 1UYVA 4JCQA 3HRXA 1EF8A 3KTIA 4G2RA 4JYLA 5INIA 1EF9A 3KTJA 4I52A 2DUBA 3H81A 3QMJA 1HNUA 1SZOA 1NZYA 4JVTA 2ZL4A 1N6EA 2Q34A 4HNKA 3QKAA 4ZDEA 3U9SB 2ZL0A 3QXIA 1WDLA 2VSUF 4OG1A 2CBYA 3JU1A 1K32A 3RSIA 2Q2XA 4QIJA 3R9QA 4MXIA 4KPKA 3IBBA 3ST9A 3L3SA 3MYBA 1MJ3A 4RYFA 5G1RA 4U0GA 3TVWA 2F9YB 4KNPA
chains in the Genus database with same CATH topology
3QWDA 4JJTA 1OD2A 2F6QA 4IZBA 2C8TA 2F6IA 5G1QA 3LAOA 4B3JA 5DZKA 4ZDCA 4B3HA 1FC7A 3GMAA 2F9IB 5DUCA 3QYRA 3H02A 3T8BA 4NNQA 3H0JA 4WZ8B 2CE3A 5JBWA 3GKBA 1RJMA 3FF6A 3OT6A 5C9GA 2GTRA 3TT7A 1PJHA 3U9TB 5C90A 4WCZA 2ZL2A 3TT6A 2PG8A 2PPYA 3TZ3A 3T3WA 1YG8A 2A7SA 5DTWA 2J5IA 4JWVA 3R0OA 4JCRA 4K2NA 4K29A 3HLN1 2UZFA 1O8UA 3RSTA 1XNYA 4FNDA 4B3IA 1PIXA 1DCIA 5E0SH 1FCFA 2W3PA 2ZQRA 5DUFA 3M6NA 3KTKA 4MOUA 3H0QA 4QIIA 2J5SA 4GM2A 4YLHA 5DL1A 3Q0JA 3PE8A 3Q0GA 1UIYA 4ELXA 5DU4A 2WTBA 2HW5A 3PGQA 2VREA 1K39A 4L6WA 3KTHA 4ASIA 1RJNA 3R9SA 5KJPA 4Q0GA 2BZRA 3ISAA 4HDTA 3K50A 1FC6A 2X58A 1XNWA 4RCNA 4KWBA 4FN7A 2F9YA 5DU8A 5FIFA 3ZW9A 4JFCA 1WZ8A 1HNOA 1Q52A 4LK5A 3SWXA 3R9TA 4EMMA 2NP9A 2YJGA 1TYFA 1W2XA 4ZDFA 3RRVA 1WDKA 3G64A 4U0GH 3M6MA 3LKEA 3HE2A 5MGBA 1ON3A 3MOYA 2F9IA 3V5EA 2J5GA 4WYOB 4ZU2A 4I4ZA 4HC8A 3I47A 3T89A 3N6RB 3T88A 3IAVA 3DORA 3V5IA 4U19A 1UYTA 3KQFA 4FZWA 5E0NX 4U18A 3Q1TA 5HUQA 4L8KA 2VX2A 5G1SA 1X0UA 4OMRA 2Q35A 3VIVA 1YG6A 3TVUA 4FB8A 1ON9A 4MI2A 1XO6A 3DJAA 3BPPA 3STAA 4KD6A 2ZL3A 3T8AA 4Q1IA 2A81A 4FZWC 5DKPA 3BEZA 4IZCA 3TRRA 1Y7OA 1SG4A 4K3WA 3KTGA 4U1AA 4I42A 4DI1A 3BF0A 3NJBA 1Q51A 5IKLB 3TDCA 1NZYB 4ZDBA 1OD4A 1VRGA 1HZDA 3GF7A 3PEAA 3QXZA 3TLFA 3HP0A 1TG6A 2FZSA 1N6DA 2J5II 3QK8A 3GF3A 2DEOA 2VSUC 4QFEA 2FBMA 3WG5A 3U9RB 4ELWA 4GHNA 4FJWD 5JBXA 4EMLA 3IB9A 2D3TA 3H0UA 3Q7HA 1J7XA 3MFMA 4JCSA 1UYRA 4RYFH 3BPTA 3H0SA 2PBPA 4JOTA 4EMPA 5INGA 3K8XA 2X24A 3OC7A 5DTPA 4F47A 1DUBA 3ZWAA 1JXZA 2VSSE 1FC9A 3P2LA 1XX4A 4NEKA 4ZDDA 3SLLA 2QQ3A 1XNVA 4Z0MA 4JSBA 5DZKH 3ZW8A 4JCTA 2VSSA 2EJ5A 4OLQA 3NJDA 4FNBA 2A7KA 2IEXA 3MT6A 3PZKA 5KDRA 5KDRB 3ZWBA 5CTCA 4J2UA 4IZDA 1UYSA 1WDMA 2VSUE 3P85A 4ELSA 5FUSA 3HINA 5DU6A 2ZQQA 3GLMA 4NARA 4U0HA 3ZWCA 3QREA 5INFA 4JYJA 2FW2A 1N6FA 3TV5A 5E0SA 3P5MA 4FN8A 3R6HA 5CTBA 1EY3A 2VSUA 3FDUA 2J5IB 2VSSF 2J5GD 3OMEA 1UYVA 4JCQA 3HRXA 1EF8A 3KTIA 4G2RA 4JYLA 5INIA 1EF9A 3KTJA 4I52A 2DUBA 3H81A 3QMJA 1HNUA 1SZOA 1NZYA 4JVTA 2ZL4A 1N6EA 2Q34A 4HNKA 3QKAA 4ZDEA 3U9SB 2ZL0A 3QXIA 1WDLA 2VSUF 4OG1A 2CBYA 3JU1A 1K32A 3RSIA 2Q2XA 4QIJA 3R9QA 4MXIA 4KPKA 3IBBA 3ST9A 3L3SA 3MYBA 1MJ3A 4RYFA 5G1RA 4U0GA 3TVWA 2F9YB 4KNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWD A;  4JJT A;  1OD2 A;  2F6Q A;  4IZB A;  2C8T A;  2F6I A;  5G1Q A;  3LAO A;  4B3J A;  5DZK A;  4ZDC A;  4B3H A;  1FC7 A;  3GMA A;  2F9I B;  5DUC A;  3QYR A;  3H02 A;  3T8B A;  4NNQ A;  3H0J A;  4WZ8 B;  2CE3 A;  5JBW A;  3GKB A;  1RJM A;  3FF6 A;  3OT6 A;  5C9G A;  2GTR A;  3TT7 A;  1PJH A;  3U9T B;  5C90 A;  4WCZ A;  2ZL2 A;  3TT6 A;  2PG8 A;  2PPY A;  3TZ3 A;  3T3W A;  1YG8 A;  2A7S A;  5DTW A;  2J5I A;  4JWV A;  3R0O A;  4JCR A;  4K2N A;  4K29 A;  3HLN 1;  2UZF A;  1O8U A;  3RST A;  1XNY A;  4FND A;  4B3I A;  1PIX A;  1DCI A;  5E0S H;  1FCF A;  2W3P A;  2ZQR A;  5DUF A;  3M6N A;  3KTK A;  4MOU A;  3H0Q A;  4QII A;  2J5S A;  4GM2 A;  4YLH A;  5DL1 A;  3Q0J A;  3PE8 A;  3Q0G A;  1UIY A;  4ELX A;  5DU4 A;  2WTB A;  2HW5 A;  3PGQ A;  2VRE A;  1K39 A;  4L6W A;  3KTH A;  4ASI A;  1RJN A;  3R9S A;  5KJP A;  4Q0G A;  2BZR A;  3ISA A;  3K50 A;  1FC6 A;  2X58 A;  1XNW A;  4RCN A;  4KWB A;  4FN7 A;  2F9Y A;  5DU8 A;  5FIF A;  3ZW9 A;  4JFC A;  1WZ8 A;  1HNO A;  1Q52 A;  4LK5 A;  3SWX A;  3R9T A;  4EMM A;  2NP9 A;  1TYF A;  1W2X A;  4ZDF A;  3RRV A;  1WDK A;  3G64 A;  4U0G H;  3M6M A;  3LKE A;  3HE2 A;  5MGB A;  1ON3 A;  3MOY A;  2F9I A;  3V5E A;  2J5G A;  4WYO B;  4ZU2 A;  4I4Z A;  4HC8 A;  3I47 A;  3T89 A;  3N6R B;  3T88 A;  3IAV A;  3DOR A;  3V5I A;  4U19 A;  1UYT A;  3KQF A;  4FZW A;  5E0N X;  4U18 A;  3Q1T A;  4L8K A;  2VX2 A;  5G1S A;  1X0U A;  4OMR A;  2Q35 A;  3VIV A;  1YG6 A;  3TVU A;  4FB8 A;  1ON9 A;  4MI2 A;  1XO6 A;  3DJA A;  3BPP A;  3STA A;  4KD6 A;  2ZL3 A;  3T8A A;  4Q1I A;  2A81 A;  4FZW C;  5DKP A;  3BEZ A;  4IZC A;  3TRR A;  1Y7O A;  1SG4 A;  4K3W A;  3KTG A;  4U1A A;  4I42 A;  4DI1 A;  3BF0 A;  3NJB A;  1Q51 A;  5IKL B;  3TDC A;  1NZY B;  4ZDB A;  1OD4 A;  1VRG A;  1HZD A;  3GF7 A;  3PEA A;  3QXZ A;  3TLF A;  3HP0 A;  1TG6 A;  2FZS A;  1N6D A;  2J5I I;  3QK8 A;  3GF3 A;  2DEO A;  2VSU C;  4QFE A;  2FBM A;  3WG5 A;  3U9R B;  4ELW A;  4GHN A;  4FJW D;  5JBX A;  4EML A;  3IB9 A;  2D3T A;  3H0U A;  3Q7H A;  1J7X A;  3MFM A;  4JCS A;  1UYR A;  4RYF H;  3H0S A;  2PBP A;  4JOT A;  4EMP A;  5ING A;  3K8X A;  2X24 A;  3OC7 A;  5DTP A;  4F47 A;  1DUB A;  3ZWA A;  1JXZ A;  2VSS E;  1FC9 A;  3P2L A;  1XX4 A;  4NEK A;  4ZDD A;  3SLL A;  2QQ3 A;  1XNV A;  4Z0M A;  4JSB A;  5DZK H;  3ZW8 A;  4JCT A;  2VSS A;  2EJ5 A;  4OLQ A;  3NJD A;  4FNB A;  2A7K A;  2IEX A;  3MT6 A;  3PZK A;  5KDR A;  5KDR B;  3ZWB A;  5CTC A;  4IZD A;  1UYS A;  1WDM A;  2VSU E;  3P85 A;  4ELS A;  5FUS A;  3HIN A;  5DU6 A;  2ZQQ A;  3GLM A;  4U0H A;  3ZWC A;  3QRE A;  5INF A;  4JYJ A;  2FW2 A;  1N6F A;  3TV5 A;  5E0S A;  3P5M A;  4FN8 A;  3R6H A;  5CTB A;  1EY3 A;  2VSU A;  3FDU A;  2J5I B;  2VSS F;  2J5G D;  3OME A;  1UYV A;  4JCQ A;  3HRX A;  1EF8 A;  3KTI A;  4G2R A;  4JYL A;  5INI A;  1EF9 A;  3KTJ A;  4I52 A;  2DUB A;  3H81 A;  3QMJ A;  1HNU A;  1SZO A;  1NZY A;  4JVT A;  2ZL4 A;  1N6E A;  2Q34 A;  4HNK A;  3QKA A;  4ZDE A;  3U9S B;  2ZL0 A;  3QXI A;  1WDL A;  2VSU F;  4OG1 A;  2CBY A;  3JU1 A;  1K32 A;  3RSI A;  2Q2X A;  4QIJ A;  3R9Q A;  4MXI A;  4KPK A;  3IBB A;  3ST9 A;  3L3S A;  3MYB A;  1MJ3 A;  4RYF A;  5G1R A;  4U0G A;  3TVW A;  2F9Y B;  4KNP A; 
#chains in the Genus database with same CATH topology
 3QWD A;  4JJT A;  1OD2 A;  2F6Q A;  4IZB A;  2C8T A;  2F6I A;  5G1Q A;  3LAO A;  4B3J A;  5DZK A;  4ZDC A;  4B3H A;  1FC7 A;  3GMA A;  2F9I B;  5DUC A;  3QYR A;  3H02 A;  3T8B A;  4NNQ A;  3H0J A;  4WZ8 B;  2CE3 A;  5JBW A;  3GKB A;  1RJM A;  3FF6 A;  3OT6 A;  5C9G A;  2GTR A;  3TT7 A;  1PJH A;  3U9T B;  5C90 A;  4WCZ A;  2ZL2 A;  3TT6 A;  2PG8 A;  2PPY A;  3TZ3 A;  3T3W A;  1YG8 A;  2A7S A;  5DTW A;  2J5I A;  4JWV A;  3R0O A;  4JCR A;  4K2N A;  4K29 A;  3HLN 1;  2UZF A;  1O8U A;  3RST A;  1XNY A;  4FND A;  4B3I A;  1PIX A;  1DCI A;  5E0S H;  1FCF A;  2W3P A;  2ZQR A;  5DUF A;  3M6N A;  3KTK A;  4MOU A;  3H0Q A;  4QII A;  2J5S A;  4GM2 A;  4YLH A;  5DL1 A;  3Q0J A;  3PE8 A;  3Q0G A;  1UIY A;  4ELX A;  5DU4 A;  2WTB A;  2HW5 A;  3PGQ A;  2VRE A;  1K39 A;  4L6W A;  3KTH A;  4ASI A;  1RJN A;  3R9S A;  5KJP A;  4Q0G A;  2BZR A;  3ISA A;  4HDT A;  3K50 A;  1FC6 A;  2X58 A;  1XNW A;  4RCN A;  4KWB A;  4FN7 A;  2F9Y A;  5DU8 A;  5FIF A;  3ZW9 A;  4JFC A;  1WZ8 A;  1HNO A;  1Q52 A;  4LK5 A;  3SWX A;  3R9T A;  4EMM A;  2NP9 A;  2YJG A;  1TYF A;  1W2X A;  4ZDF A;  3RRV A;  1WDK A;  3G64 A;  4U0G H;  3M6M A;  3LKE A;  3HE2 A;  5MGB A;  1ON3 A;  3MOY A;  2F9I A;  3V5E A;  2J5G A;  4WYO B;  4ZU2 A;  4I4Z A;  4HC8 A;  3I47 A;  3T89 A;  3N6R B;  3T88 A;  3IAV A;  3DOR A;  3V5I A;  4U19 A;  1UYT A;  3KQF A;  4FZW A;  5E0N X;  4U18 A;  3Q1T A;  5HUQ A;  4L8K A;  2VX2 A;  5G1S A;  1X0U A;  4OMR A;  2Q35 A;  3VIV A;  1YG6 A;  3TVU A;  4FB8 A;  1ON9 A;  4MI2 A;  1XO6 A;  3DJA A;  3BPP A;  3STA A;  4KD6 A;  2ZL3 A;  3T8A A;  4Q1I A;  2A81 A;  4FZW C;  5DKP A;  3BEZ A;  4IZC A;  3TRR A;  1Y7O A;  1SG4 A;  4K3W A;  3KTG A;  4U1A A;  4I42 A;  4DI1 A;  3BF0 A;  3NJB A;  1Q51 A;  5IKL B;  3TDC A;  1NZY B;  4ZDB A;  1OD4 A;  1VRG A;  1HZD A;  3GF7 A;  3PEA A;  3QXZ A;  3TLF A;  3HP0 A;  1TG6 A;  2FZS A;  1N6D A;  2J5I I;  3QK8 A;  3GF3 A;  2DEO A;  2VSU C;  4QFE A;  2FBM A;  3WG5 A;  3U9R B;  4ELW A;  4GHN A;  4FJW D;  5JBX A;  4EML A;  3IB9 A;  2D3T A;  3H0U A;  3Q7H A;  1J7X A;  3MFM A;  4JCS A;  1UYR A;  4RYF H;  3BPT A;  3H0S A;  2PBP A;  4JOT A;  4EMP A;  5ING A;  3K8X A;  2X24 A;  3OC7 A;  5DTP A;  4F47 A;  1DUB A;  3ZWA A;  1JXZ A;  2VSS E;  1FC9 A;  3P2L A;  1XX4 A;  4NEK A;  4ZDD A;  3SLL A;  2QQ3 A;  1XNV A;  4Z0M A;  4JSB A;  5DZK H;  3ZW8 A;  4JCT A;  2VSS A;  2EJ5 A;  4OLQ A;  3NJD A;  4FNB A;  2A7K A;  2IEX A;  3MT6 A;  3PZK A;  5KDR A;  5KDR B;  3ZWB A;  5CTC A;  4J2U A;  4IZD A;  1UYS A;  1WDM A;  2VSU E;  3P85 A;  4ELS A;  5FUS A;  3HIN A;  5DU6 A;  2ZQQ A;  3GLM A;  4NAR A;  4U0H A;  3ZWC A;  3QRE A;  5INF A;  4JYJ A;  2FW2 A;  1N6F A;  3TV5 A;  5E0S A;  3P5M A;  4FN8 A;  3R6H A;  5CTB A;  1EY3 A;  2VSU A;  3FDU A;  2J5I B;  2VSS F;  2J5G D;  3OME A;  1UYV A;  4JCQ A;  3HRX A;  1EF8 A;  3KTI A;  4G2R A;  4JYL A;  5INI A;  1EF9 A;  3KTJ A;  4I52 A;  2DUB A;  3H81 A;  3QMJ A;  1HNU A;  1SZO A;  1NZY A;  4JVT A;  2ZL4 A;  1N6E A;  2Q34 A;  4HNK A;  3QKA A;  4ZDE A;  3U9S B;  2ZL0 A;  3QXI A;  1WDL A;  2VSU F;  4OG1 A;  2CBY A;  3JU1 A;  1K32 A;  3RSI A;  2Q2X A;  4QIJ A;  3R9Q A;  4MXI A;  4KPK A;  3IBB A;  3ST9 A;  3L3S A;  3MYB A;  1MJ3 A;  4RYF A;  5G1R A;  4U0G A;  3TVW A;  2F9Y B;  4KNP A; 
#chains in the Genus database with same CATH homology
 3QWD A;  4JJT A;  1OD2 A;  2F6Q A;  4IZB A;  2C8T A;  2F6I A;  5G1Q A;  3LAO A;  4B3J A;  5DZK A;  4ZDC A;  4B3H A;  1FC7 A;  3GMA A;  2F9I B;  5DUC A;  3QYR A;  3H02 A;  3T8B A;  4NNQ A;  3H0J A;  4WZ8 B;  2CE3 A;  5JBW A;  3GKB A;  1RJM A;  3FF6 A;  3OT6 A;  5C9G A;  2GTR A;  3TT7 A;  1PJH A;  3U9T B;  5C90 A;  4WCZ A;  2ZL2 A;  3TT6 A;  2PG8 A;  2PPY A;  3TZ3 A;  3T3W A;  1YG8 A;  2A7S A;  5DTW A;  2J5I A;  4JWV A;  3R0O A;  4JCR A;  4K2N A;  4K29 A;  3HLN 1;  2UZF A;  1O8U A;  3RST A;  1XNY A;  4FND A;  4B3I A;  1PIX A;  1DCI A;  5E0S H;  1FCF A;  2W3P A;  2ZQR A;  5DUF A;  3M6N A;  3KTK A;  4MOU A;  3H0Q A;  4QII A;  2J5S A;  4GM2 A;  4YLH A;  5DL1 A;  3Q0J A;  3PE8 A;  3Q0G A;  1UIY A;  4ELX A;  5DU4 A;  2WTB A;  2HW5 A;  3PGQ A;  2VRE A;  1K39 A;  4L6W A;  3KTH A;  4ASI A;  1RJN A;  3R9S A;  5KJP A;  4Q0G A;  2BZR A;  3ISA A;  4HDT A;  3K50 A;  1FC6 A;  2X58 A;  1XNW A;  4RCN A;  4KWB A;  4FN7 A;  2F9Y A;  5DU8 A;  5FIF A;  3ZW9 A;  4JFC A;  1WZ8 A;  1HNO A;  1Q52 A;  4LK5 A;  3SWX A;  3R9T A;  4EMM A;  2NP9 A;  2YJG A;  1TYF A;  1W2X A;  4ZDF A;  3RRV A;  1WDK A;  3G64 A;  4U0G H;  3M6M A;  3LKE A;  3HE2 A;  5MGB A;  1ON3 A;  3MOY A;  2F9I A;  3V5E A;  2J5G A;  4WYO B;  4ZU2 A;  4I4Z A;  4HC8 A;  3I47 A;  3T89 A;  3N6R B;  3T88 A;  3IAV A;  3DOR A;  3V5I A;  4U19 A;  1UYT A;  3KQF A;  4FZW A;  5E0N X;  4U18 A;  3Q1T A;  5HUQ A;  4L8K A;  2VX2 A;  5G1S A;  1X0U A;  4OMR A;  2Q35 A;  3VIV A;  1YG6 A;  3TVU A;  4FB8 A;  1ON9 A;  4MI2 A;  1XO6 A;  3DJA A;  3BPP A;  3STA A;  4KD6 A;  2ZL3 A;  3T8A A;  4Q1I A;  2A81 A;  4FZW C;  5DKP A;  3BEZ A;  4IZC A;  3TRR A;  1Y7O A;  1SG4 A;  4K3W A;  3KTG A;  4U1A A;  4I42 A;  4DI1 A;  3BF0 A;  3NJB A;  1Q51 A;  5IKL B;  3TDC A;  1NZY B;  4ZDB A;  1OD4 A;  1VRG A;  1HZD A;  3GF7 A;  3PEA A;  3QXZ A;  3TLF A;  3HP0 A;  1TG6 A;  2FZS A;  1N6D A;  2J5I I;  3QK8 A;  3GF3 A;  2DEO A;  2VSU C;  4QFE A;  2FBM A;  3WG5 A;  3U9R B;  4ELW A;  4GHN A;  4FJW D;  5JBX A;  4EML A;  3IB9 A;  2D3T A;  3H0U A;  3Q7H A;  1J7X A;  3MFM A;  4JCS A;  1UYR A;  4RYF H;  3BPT A;  3H0S A;  2PBP A;  4JOT A;  4EMP A;  5ING A;  3K8X A;  2X24 A;  3OC7 A;  5DTP A;  4F47 A;  1DUB A;  3ZWA A;  1JXZ A;  2VSS E;  1FC9 A;  3P2L A;  1XX4 A;  4NEK A;  4ZDD A;  3SLL A;  2QQ3 A;  1XNV A;  4Z0M A;  4JSB A;  5DZK H;  3ZW8 A;  4JCT A;  2VSS A;  2EJ5 A;  4OLQ A;  3NJD A;  4FNB A;  2A7K A;  2IEX A;  3MT6 A;  3PZK A;  5KDR A;  5KDR B;  3ZWB A;  5CTC A;  4J2U A;  4IZD A;  1UYS A;  1WDM A;  2VSU E;  3P85 A;  4ELS A;  5FUS A;  3HIN A;  5DU6 A;  2ZQQ A;  3GLM A;  4NAR A;  4U0H A;  3ZWC A;  3QRE A;  5INF A;  4JYJ A;  2FW2 A;  1N6F A;  3TV5 A;  5E0S A;  3P5M A;  4FN8 A;  3R6H A;  5CTB A;  1EY3 A;  2VSU A;  3FDU A;  2J5I B;  2VSS F;  2J5G D;  3OME A;  1UYV A;  4JCQ A;  3HRX A;  1EF8 A;  3KTI A;  4G2R A;  4JYL A;  5INI A;  1EF9 A;  3KTJ A;  4I52 A;  2DUB A;  3H81 A;  3QMJ A;  1HNU A;  1SZO A;  1NZY A;  4JVT A;  2ZL4 A;  1N6E A;  2Q34 A;  4HNK A;  3QKA A;  4ZDE A;  3U9S B;  2ZL0 A;  3QXI A;  1WDL A;  2VSU F;  4OG1 A;  2CBY A;  3JU1 A;  1K32 A;  3RSI A;  2Q2X A;  4QIJ A;  3R9Q A;  4MXI A;  4KPK A;  3IBB A;  3ST9 A;  3L3S A;  3MYB A;  1MJ3 A;  4RYF A;  5G1R A;  4U0G A;  3TVW A;  2F9Y B;  4KNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...