5E0SH

Crystal structure of the active form of the proteolytic complex clpp1 and clpp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
MRSNSQGLSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Properties of the Active Form of the Proteolytic Complex, ClpP1P2, from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit 2
total genus 64
structure length 186
sequence length 186
chains with identical sequence I, J, K, L, M, N, h, i, j, k, l, m, n
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5e0sH00
3T3WA 5INIA 3LKEA 2F6IA 3MFMA 1WDLA 2ZQRA 3H81A 2VSSA 3SWXA 2A81A 3V5IA 2VSSF 1XNWA 4U19A 1J7XA 4ZDDA 4WCZA 3QYRA 3RRVA 2C8TA 2A7SA 3HINA 4MOUA 4NEKA 4K2NA 4DI1A 2FBMA 1EF9A 5E0SA 5E0NX 4RCNA 2PBPA 4EMMA 1RJNA 3GKBA 3SLLA 5FUSA 3H02A 4KPKA 3PE8A 3TVWA 4ZDBA 3K8XA 4GHNA 3M6MA 3FDUA 3MT6A 4JCSA 3R9SA 5FIFA 4ASIA 2VSUC 1HNOA 3PZKA 3TT6A 4I52A 4FNBA 4B3HA 3Q1TA 4I4ZA 2Q2XA 3T8BA 3BPPA 5DU4A 4FJWD 4EMLA 3NJDA 3L3SA 5G1SA 4U1AA 3MYBA 4B3IA 3T88A 5DU8A 3U9TB 3KTHA 1JXZA 5DTWA 3TT7A 4ZDEA 5DU6A 4YLHA 4FN8A 3HP0A 4RYFH 4JCRA 4G2RA 2VX2A 4ZDFA 3VIVA 4U0GH 3IBBA 3IAVA 1VRGA 5KDRB 1FC9A 3TVUA 4NNQA 3MOYA 1UIYA 4Z0MA 1O8UA 2J5IB 2J5SA 2F6QA 4FZWC 4U0HA 3I47A 2VSSE 1X0UA 1RJMA 4K3WA 3FF6A 3OMEA 2J5IA 1WDMA 4OMRA 4KWBA 2ZL2A 3ZW8A 4WYOB 4HNKA 4IZBA 1OD2A 3ZWAA 3GF7A 1PJHA 5G1RA 1UYTA 4JSBA 4OG1A 2F9IB 2ZL0A 3R9QA 2F9YA 2FW2A 4FZWA 3STAA 1SZOA 3PEAA 4L6WA 4ELXA 2VSUE 2ZQQA 3HLN1 1N6FA 3TDCA 1K39A 2GTRA 4Q1IA 1HNUA 3QKAA 2HW5A 5C90A 3QK8A 3T89A 3DORA 4JYLA 1NZYB 4WZ8B 2Q35A 3T8AA 3Q0JA 3WG5A 3H0UA 4I42A 4JVTA 3GMAA 3ISAA 2DUBA 3Q0GA 4FNDA 3KTGA 4KD6A 4IZDA 1WDKA 1UYVA 2Q34A 4JFCA 2CE3A 4QIIA 3KTJA 3G64A 5MGBA 3GLMA 1ON9A 4QIJA 2A7KA 5DZKH 5CTBA 2ZL4A 1PIXA 3ZWBA 4JOTA 4U0GA 4FN7A 2BZRA 4U18A 4FB8A 5DL1A 3KTKA 4JJTA 1W2XA 2X24A 5JBXA 4ZU2A 3OC7A 2J5II 1WZ8A 4IZCA 5CTCA 2NP9A 3NJBA 4GM2A 3U9RB 5E0SH 1MJ3A 2CBYA 4LK5A 4MXIA 1N6DA 2IEXA 4QFEA 3QXZA 3LAOA 4K29A 3KQFA 2UZFA 3QXIA 2D3TA 5DUCA 5G1QA 1SG4A 3TV5A 1ON3A 2J5GD 3TZ3A 3BF0A 4B3JA 2W3PA 3P85A 1XNVA 1TYFA 5JBWA 3QREA 1HZDA 1DUBA 3OT6A 1YG6A 4Q0GA 1FC7A 3H0QA 2WTBA 1FCFA 4ELWA 2J5GA 3RSIA 1OD4A 3GF3A 4KNPA 2X58A 3BEZA 3M6NA 4L8KA 2PG8A 4OLQA 4F47A 1UYSA 2F9IA 2F9YB 4JYJA 3R9TA 2VREA 3TRRA 3R6HA 3KTIA 1YG8A 1Q51A 3R0OA 3RSTA 3PGQA 1NZYA 3HE2A 3V5EA 2QQ3A 5DKPA 1N6EA 1TG6A 2PPYA 1EF8A 4ZDCA 1Q52A 3ZWCA 5KJPA 1FC6A 2VSUF 3H0JA 5INGA 3P2LA 2FZSA 3N6RB 5INFA 4JCQA 5DTPA 5IKLB 3TLFA 2ZL3A 1EY3A 4JWVA 4ELSA 4MI2A 5C9GA 1K32A 3DJAA 4HC8A 1XX4A 4EMPA 5KDRA 5DZKA 3K50A 3QMJA 3U9SB 3IB9A 4RYFA 1Y7OA 3HRXA 1XO6A 5DUFA 2EJ5A 2VSUA 3ST9A 1DCIA 3QWDA 3P5MA 1XNYA 2DEOA 4JCTA 3ZW9A 3JU1A 1UYRA 3H0SA 3Q7HA
chains in the Genus database with same CATH superfamily
3T3WA 5INIA 3LKEA 2F6IA 3MFMA 1WDLA 2ZQRA 3H81A 2VSSA 3SWXA 2A81A 3V5IA 2VSSF 1XNWA 5HUQA 4U19A 1J7XA 4ZDDA 4WCZA 3QYRA 3RRVA 2C8TA 2A7SA 3HINA 4MOUA 4NEKA 4K2NA 4DI1A 2FBMA 1EF9A 5E0SA 5E0NX 4RCNA 2PBPA 4EMMA 1RJNA 3GKBA 3SLLA 5FUSA 3H02A 4KPKA 3PE8A 3TVWA 4ZDBA 3K8XA 4GHNA 3M6MA 3FDUA 3MT6A 4JCSA 3R9SA 5FIFA 4ASIA 2VSUC 1HNOA 3PZKA 3TT6A 4I52A 4FNBA 4B3HA 3Q1TA 4I4ZA 2Q2XA 3T8BA 3BPPA 5DU4A 4FJWD 4EMLA 3NJDA 3L3SA 5G1SA 4U1AA 3MYBA 4B3IA 3T88A 5DU8A 3U9TB 3KTHA 1JXZA 5DTWA 3TT7A 4ZDEA 5DU6A 4YLHA 4FN8A 3HP0A 4RYFH 4JCRA 4G2RA 3BPTA 2VX2A 4ZDFA 3VIVA 4U0GH 3IBBA 3IAVA 1VRGA 5KDRB 1FC9A 3TVUA 4NNQA 3MOYA 1UIYA 4J2UA 1O8UA 4Z0MA 2J5IB 2J5SA 2F6QA 4FZWC 4U0HA 3I47A 2VSSE 1X0UA 1RJMA 4K3WA 3FF6A 3OMEA 2J5IA 1WDMA 4OMRA 4KWBA 2ZL2A 3ZW8A 4WYOB 4HNKA 4IZBA 1OD2A 3ZWAA 3GF7A 1PJHA 5G1RA 1UYTA 4JSBA 4OG1A 2F9IB 2ZL0A 3R9QA 2F9YA 2FW2A 4FZWA 3STAA 1SZOA 3PEAA 4L6WA 4ELXA 2VSUE 2ZQQA 3HLN1 1N6FA 3TDCA 1K39A 2GTRA 4Q1IA 1HNUA 3QKAA 2HW5A 5C90A 3QK8A 3T89A 3DORA 4JYLA 1NZYB 4WZ8B 2Q35A 3T8AA 3Q0JA 3WG5A 3H0UA 4I42A 4JVTA 3GMAA 3ISAA 2DUBA 3Q0GA 4FNDA 3KTGA 4KD6A 4IZDA 1WDKA 1UYVA 2Q34A 4JFCA 2CE3A 4QIIA 3KTJA 3G64A 5MGBA 3GLMA 1ON9A 4QIJA 2A7KA 5DZKH 5CTBA 2ZL4A 1PIXA 3ZWBA 4JOTA 4U0GA 4FN7A 2BZRA 4U18A 4FB8A 5DL1A 3KTKA 4JJTA 1W2XA 2X24A 5JBXA 4ZU2A 3OC7A 2J5II 1WZ8A 4NARA 4IZCA 5CTCA 2NP9A 3NJBA 4GM2A 3U9RB 5E0SH 1MJ3A 2CBYA 4LK5A 4MXIA 1N6DA 2IEXA 4QFEA 3QXZA 3LAOA 4K29A 3KQFA 2UZFA 3QXIA 2D3TA 5DUCA 5G1QA 1SG4A 3TV5A 1ON3A 2J5GD 3TZ3A 3BF0A 4B3JA 2W3PA 3P85A 1XNVA 1TYFA 5JBWA 3QREA 1HZDA 1DUBA 3OT6A 1YG6A 4Q0GA 1FC7A 3H0QA 2WTBA 1FCFA 4ELWA 2J5GA 3RSIA 1OD4A 3GF3A 2YJGA 4KNPA 2X58A 3BEZA 3M6NA 4L8KA 2PG8A 4OLQA 4F47A 1UYSA 2F9IA 2F9YB 4JYJA 3R9TA 2VREA 4HDTA 3TRRA 3R6HA 3KTIA 1YG8A 1Q51A 3R0OA 3RSTA 3PGQA 1NZYA 3HE2A 3V5EA 2QQ3A 5DKPA 1N6EA 1TG6A 2PPYA 1EF8A 4ZDCA 1Q52A 3ZWCA 5KJPA 1FC6A 2VSUF 3H0JA 5INGA 3P2LA 2FZSA 3N6RB 5INFA 4JCQA 5DTPA 5IKLB 3TLFA 2ZL3A 1EY3A 4JWVA 4ELSA 4MI2A 5C9GA 1K32A 3DJAA 4HC8A 1XX4A 4EMPA 5KDRA 5DZKA 3K50A 3QMJA 3U9SB 3IB9A 4RYFA 1Y7OA 3HRXA 1XO6A 5DUFA 2EJ5A 2VSUA 3ST9A 1DCIA 3QWDA 3P5MA 1XNYA 2DEOA 4JCTA 3ZW9A 3JU1A 1UYRA 3H0SA 3Q7HA
chains in the Genus database with same CATH topology
3T3WA 5INIA 3LKEA 2F6IA 3MFMA 1WDLA 2ZQRA 3H81A 2VSSA 3SWXA 2A81A 3V5IA 2VSSF 1XNWA 5HUQA 4U19A 1J7XA 4ZDDA 4WCZA 3QYRA 3RRVA 2C8TA 2A7SA 3HINA 4MOUA 4NEKA 4K2NA 4DI1A 2FBMA 1EF9A 5E0SA 5E0NX 4RCNA 2PBPA 4EMMA 1RJNA 3GKBA 3SLLA 5FUSA 3H02A 4KPKA 3PE8A 3TVWA 4ZDBA 3K8XA 4GHNA 3M6MA 3FDUA 3MT6A 4JCSA 3R9SA 5FIFA 4ASIA 2VSUC 1HNOA 3PZKA 3TT6A 4I52A 4FNBA 4B3HA 3Q1TA 4I4ZA 2Q2XA 3T8BA 3BPPA 5DU4A 4FJWD 4EMLA 3NJDA 3L3SA 5G1SA 4U1AA 3MYBA 4B3IA 3T88A 5DU8A 3U9TB 3KTHA 1JXZA 5DTWA 3TT7A 4ZDEA 5DU6A 4YLHA 4FN8A 3HP0A 4RYFH 4JCRA 4G2RA 3BPTA 2VX2A 4ZDFA 3VIVA 4U0GH 3IBBA 3IAVA 1VRGA 5KDRB 1FC9A 3TVUA 4NNQA 3MOYA 1UIYA 4J2UA 1O8UA 4Z0MA 2J5IB 2J5SA 2F6QA 4FZWC 4U0HA 3I47A 2VSSE 1X0UA 1RJMA 4K3WA 3FF6A 3OMEA 2J5IA 1WDMA 4OMRA 4KWBA 2ZL2A 3ZW8A 4WYOB 4HNKA 4IZBA 1OD2A 3ZWAA 3GF7A 1PJHA 5G1RA 1UYTA 4JSBA 4OG1A 2F9IB 2ZL0A 3R9QA 2F9YA 2FW2A 4FZWA 3STAA 1SZOA 3PEAA 4L6WA 4ELXA 2VSUE 2ZQQA 3HLN1 1N6FA 3TDCA 1K39A 2GTRA 4Q1IA 1HNUA 3QKAA 2HW5A 5C90A 3QK8A 3T89A 3DORA 4JYLA 1NZYB 4WZ8B 2Q35A 3T8AA 3Q0JA 3WG5A 3H0UA 4I42A 4JVTA 3GMAA 3ISAA 2DUBA 3Q0GA 4FNDA 3KTGA 4KD6A 4IZDA 1WDKA 1UYVA 2Q34A 4JFCA 2CE3A 4QIIA 3KTJA 3G64A 5MGBA 3GLMA 1ON9A 4QIJA 2A7KA 5DZKH 5CTBA 2ZL4A 1PIXA 3ZWBA 4JOTA 4U0GA 4FN7A 2BZRA 4U18A 4FB8A 5DL1A 3KTKA 4JJTA 1W2XA 2X24A 5JBXA 4ZU2A 3OC7A 2J5II 1WZ8A 4NARA 4IZCA 5CTCA 2NP9A 3NJBA 4GM2A 3U9RB 5E0SH 1MJ3A 2CBYA 4LK5A 4MXIA 1N6DA 2IEXA 4QFEA 3QXZA 3LAOA 4K29A 3KQFA 2UZFA 3QXIA 2D3TA 5DUCA 5G1QA 1SG4A 3TV5A 1ON3A 2J5GD 3TZ3A 3BF0A 4B3JA 2W3PA 3P85A 1XNVA 1TYFA 5JBWA 3QREA 1HZDA 1DUBA 3OT6A 1YG6A 4Q0GA 1FC7A 3H0QA 2WTBA 1FCFA 4ELWA 2J5GA 3RSIA 1OD4A 3GF3A 2YJGA 4KNPA 2X58A 3BEZA 3M6NA 4L8KA 2PG8A 4OLQA 4F47A 1UYSA 2F9IA 2F9YB 4JYJA 3R9TA 2VREA 4HDTA 3TRRA 3R6HA 3KTIA 1YG8A 1Q51A 3R0OA 3RSTA 3PGQA 1NZYA 3HE2A 3V5EA 2QQ3A 5DKPA 1N6EA 1TG6A 2PPYA 1EF8A 4ZDCA 1Q52A 3ZWCA 5KJPA 1FC6A 2VSUF 3H0JA 5INGA 3P2LA 2FZSA 3N6RB 5INFA 4JCQA 5DTPA 5IKLB 3TLFA 2ZL3A 1EY3A 4JWVA 4ELSA 4MI2A 5C9GA 1K32A 3DJAA 4HC8A 1XX4A 4EMPA 5KDRA 5DZKA 3K50A 3QMJA 3U9SB 3IB9A 4RYFA 1Y7OA 3HRXA 1XO6A 5DUFA 2EJ5A 2VSUA 3ST9A 1DCIA 3QWDA 3P5MA 1XNYA 2DEOA 4JCTA 3ZW9A 3JU1A 1UYRA 3H0SA 3Q7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3W A;  5INI A;  3LKE A;  2F6I A;  3MFM A;  1WDL A;  2ZQR A;  3H81 A;  2VSS A;  3SWX A;  2A81 A;  3V5I A;  2VSS F;  1XNW A;  4U19 A;  1J7X A;  4ZDD A;  4WCZ A;  3QYR A;  3RRV A;  2C8T A;  2A7S A;  3HIN A;  4MOU A;  4NEK A;  4K2N A;  4DI1 A;  2FBM A;  1EF9 A;  5E0S A;  5E0N X;  4RCN A;  2PBP A;  4EMM A;  1RJN A;  3GKB A;  3SLL A;  5FUS A;  3H02 A;  4KPK A;  3PE8 A;  3TVW A;  4ZDB A;  3K8X A;  4GHN A;  3M6M A;  3FDU A;  3MT6 A;  4JCS A;  3R9S A;  5FIF A;  4ASI A;  2VSU C;  1HNO A;  3PZK A;  3TT6 A;  4I52 A;  4FNB A;  4B3H A;  3Q1T A;  4I4Z A;  2Q2X A;  3T8B A;  3BPP A;  5DU4 A;  4FJW D;  4EML A;  3NJD A;  3L3S A;  5G1S A;  4U1A A;  3MYB A;  4B3I A;  3T88 A;  5DU8 A;  3U9T B;  3KTH A;  1JXZ A;  5DTW A;  3TT7 A;  4ZDE A;  5DU6 A;  4YLH A;  4FN8 A;  3HP0 A;  4RYF H;  4JCR A;  4G2R A;  2VX2 A;  4ZDF A;  3VIV A;  4U0G H;  3IBB A;  3IAV A;  1VRG A;  5KDR B;  1FC9 A;  3TVU A;  4NNQ A;  3MOY A;  1UIY A;  4Z0M A;  1O8U A;  2J5I B;  2J5S A;  2F6Q A;  4FZW C;  4U0H A;  3I47 A;  2VSS E;  1X0U A;  1RJM A;  4K3W A;  3FF6 A;  3OME A;  2J5I A;  1WDM A;  4OMR A;  4KWB A;  2ZL2 A;  3ZW8 A;  4WYO B;  4HNK A;  4IZB A;  1OD2 A;  3ZWA A;  3GF7 A;  1PJH A;  5G1R A;  1UYT A;  4JSB A;  4OG1 A;  2F9I B;  2ZL0 A;  3R9Q A;  2F9Y A;  2FW2 A;  4FZW A;  3STA A;  1SZO A;  3PEA A;  4L6W A;  4ELX A;  2VSU E;  2ZQQ A;  3HLN 1;  1N6F A;  3TDC A;  1K39 A;  2GTR A;  4Q1I A;  1HNU A;  3QKA A;  2HW5 A;  5C90 A;  3QK8 A;  3T89 A;  3DOR A;  4JYL A;  1NZY B;  4WZ8 B;  2Q35 A;  3T8A A;  3Q0J A;  3WG5 A;  3H0U A;  4I42 A;  4JVT A;  3GMA A;  3ISA A;  2DUB A;  3Q0G A;  4FND A;  3KTG A;  4KD6 A;  4IZD A;  1WDK A;  1UYV A;  2Q34 A;  4JFC A;  2CE3 A;  4QII A;  3KTJ A;  3G64 A;  5MGB A;  3GLM A;  1ON9 A;  4QIJ A;  2A7K A;  5DZK H;  5CTB A;  2ZL4 A;  1PIX A;  3ZWB A;  4JOT A;  4U0G A;  4FN7 A;  2BZR A;  4U18 A;  4FB8 A;  5DL1 A;  3KTK A;  4JJT A;  1W2X A;  2X24 A;  5JBX A;  4ZU2 A;  3OC7 A;  2J5I I;  1WZ8 A;  4IZC A;  5CTC A;  2NP9 A;  3NJB A;  4GM2 A;  3U9R B;  5E0S H;  1MJ3 A;  2CBY A;  4LK5 A;  4MXI A;  1N6D A;  2IEX A;  4QFE A;  3QXZ A;  3LAO A;  4K29 A;  3KQF A;  2UZF A;  3QXI A;  2D3T A;  5DUC A;  5G1Q A;  1SG4 A;  3TV5 A;  1ON3 A;  2J5G D;  3TZ3 A;  3BF0 A;  4B3J A;  2W3P A;  3P85 A;  1XNV A;  1TYF A;  5JBW A;  3QRE A;  1HZD A;  1DUB A;  3OT6 A;  1YG6 A;  4Q0G A;  1FC7 A;  3H0Q A;  2WTB A;  1FCF A;  4ELW A;  2J5G A;  3RSI A;  1OD4 A;  3GF3 A;  4KNP A;  2X58 A;  3BEZ A;  3M6N A;  4L8K A;  2PG8 A;  4OLQ A;  4F47 A;  1UYS A;  2F9I A;  2F9Y B;  4JYJ A;  3R9T A;  2VRE A;  3TRR A;  3R6H A;  3KTI A;  1YG8 A;  1Q51 A;  3R0O A;  3RST A;  3PGQ A;  1NZY A;  3HE2 A;  3V5E A;  2QQ3 A;  5DKP A;  1N6E A;  1TG6 A;  2PPY A;  1EF8 A;  4ZDC A;  1Q52 A;  3ZWC A;  5KJP A;  1FC6 A;  2VSU F;  3H0J A;  5ING A;  3P2L A;  2FZS A;  3N6R B;  5INF A;  4JCQ A;  5DTP A;  5IKL B;  3TLF A;  2ZL3 A;  1EY3 A;  4JWV A;  4ELS A;  4MI2 A;  5C9G A;  1K32 A;  3DJA A;  4HC8 A;  1XX4 A;  4EMP A;  5KDR A;  5DZK A;  3K50 A;  3QMJ A;  3U9S B;  3IB9 A;  4RYF A;  1Y7O A;  3HRX A;  1XO6 A;  5DUF A;  2EJ5 A;  2VSU A;  3ST9 A;  1DCI A;  3QWD A;  3P5M A;  1XNY A;  2DEO A;  4JCT A;  3ZW9 A;  3JU1 A;  1UYR A;  3H0S A;  3Q7H A; 
#chains in the Genus database with same CATH topology
 3T3W A;  5INI A;  3LKE A;  2F6I A;  3MFM A;  1WDL A;  2ZQR A;  3H81 A;  2VSS A;  3SWX A;  2A81 A;  3V5I A;  2VSS F;  1XNW A;  5HUQ A;  4U19 A;  1J7X A;  4ZDD A;  4WCZ A;  3QYR A;  3RRV A;  2C8T A;  2A7S A;  3HIN A;  4MOU A;  4NEK A;  4K2N A;  4DI1 A;  2FBM A;  1EF9 A;  5E0S A;  5E0N X;  4RCN A;  2PBP A;  4EMM A;  1RJN A;  3GKB A;  3SLL A;  5FUS A;  3H02 A;  4KPK A;  3PE8 A;  3TVW A;  4ZDB A;  3K8X A;  4GHN A;  3M6M A;  3FDU A;  3MT6 A;  4JCS A;  3R9S A;  5FIF A;  4ASI A;  2VSU C;  1HNO A;  3PZK A;  3TT6 A;  4I52 A;  4FNB A;  4B3H A;  3Q1T A;  4I4Z A;  2Q2X A;  3T8B A;  3BPP A;  5DU4 A;  4FJW D;  4EML A;  3NJD A;  3L3S A;  5G1S A;  4U1A A;  3MYB A;  4B3I A;  3T88 A;  5DU8 A;  3U9T B;  3KTH A;  1JXZ A;  5DTW A;  3TT7 A;  4ZDE A;  5DU6 A;  4YLH A;  4FN8 A;  3HP0 A;  4RYF H;  4JCR A;  4G2R A;  3BPT A;  2VX2 A;  4ZDF A;  3VIV A;  4U0G H;  3IBB A;  3IAV A;  1VRG A;  5KDR B;  1FC9 A;  3TVU A;  4NNQ A;  3MOY A;  1UIY A;  4J2U A;  1O8U A;  4Z0M A;  2J5I B;  2J5S A;  2F6Q A;  4FZW C;  4U0H A;  3I47 A;  2VSS E;  1X0U A;  1RJM A;  4K3W A;  3FF6 A;  3OME A;  2J5I A;  1WDM A;  4OMR A;  4KWB A;  2ZL2 A;  3ZW8 A;  4WYO B;  4HNK A;  4IZB A;  1OD2 A;  3ZWA A;  3GF7 A;  1PJH A;  5G1R A;  1UYT A;  4JSB A;  4OG1 A;  2F9I B;  2ZL0 A;  3R9Q A;  2F9Y A;  2FW2 A;  4FZW A;  3STA A;  1SZO A;  3PEA A;  4L6W A;  4ELX A;  2VSU E;  2ZQQ A;  3HLN 1;  1N6F A;  3TDC A;  1K39 A;  2GTR A;  4Q1I A;  1HNU A;  3QKA A;  2HW5 A;  5C90 A;  3QK8 A;  3T89 A;  3DOR A;  4JYL A;  1NZY B;  4WZ8 B;  2Q35 A;  3T8A A;  3Q0J A;  3WG5 A;  3H0U A;  4I42 A;  4JVT A;  3GMA A;  3ISA A;  2DUB A;  3Q0G A;  4FND A;  3KTG A;  4KD6 A;  4IZD A;  1WDK A;  1UYV A;  2Q34 A;  4JFC A;  2CE3 A;  4QII A;  3KTJ A;  3G64 A;  5MGB A;  3GLM A;  1ON9 A;  4QIJ A;  2A7K A;  5DZK H;  5CTB A;  2ZL4 A;  1PIX A;  3ZWB A;  4JOT A;  4U0G A;  4FN7 A;  2BZR A;  4U18 A;  4FB8 A;  5DL1 A;  3KTK A;  4JJT A;  1W2X A;  2X24 A;  5JBX A;  4ZU2 A;  3OC7 A;  2J5I I;  1WZ8 A;  4NAR A;  4IZC A;  5CTC A;  2NP9 A;  3NJB A;  4GM2 A;  3U9R B;  5E0S H;  1MJ3 A;  2CBY A;  4LK5 A;  4MXI A;  1N6D A;  2IEX A;  4QFE A;  3QXZ A;  3LAO A;  4K29 A;  3KQF A;  2UZF A;  3QXI A;  2D3T A;  5DUC A;  5G1Q A;  1SG4 A;  3TV5 A;  1ON3 A;  2J5G D;  3TZ3 A;  3BF0 A;  4B3J A;  2W3P A;  3P85 A;  1XNV A;  1TYF A;  5JBW A;  3QRE A;  1HZD A;  1DUB A;  3OT6 A;  1YG6 A;  4Q0G A;  1FC7 A;  3H0Q A;  2WTB A;  1FCF A;  4ELW A;  2J5G A;  3RSI A;  1OD4 A;  3GF3 A;  2YJG A;  4KNP A;  2X58 A;  3BEZ A;  3M6N A;  4L8K A;  2PG8 A;  4OLQ A;  4F47 A;  1UYS A;  2F9I A;  2F9Y B;  4JYJ A;  3R9T A;  2VRE A;  4HDT A;  3TRR A;  3R6H A;  3KTI A;  1YG8 A;  1Q51 A;  3R0O A;  3RST A;  3PGQ A;  1NZY A;  3HE2 A;  3V5E A;  2QQ3 A;  5DKP A;  1N6E A;  1TG6 A;  2PPY A;  1EF8 A;  4ZDC A;  1Q52 A;  3ZWC A;  5KJP A;  1FC6 A;  2VSU F;  3H0J A;  5ING A;  3P2L A;  2FZS A;  3N6R B;  5INF A;  4JCQ A;  5DTP A;  5IKL B;  3TLF A;  2ZL3 A;  1EY3 A;  4JWV A;  4ELS A;  4MI2 A;  5C9G A;  1K32 A;  3DJA A;  4HC8 A;  1XX4 A;  4EMP A;  5KDR A;  5DZK A;  3K50 A;  3QMJ A;  3U9S B;  3IB9 A;  4RYF A;  1Y7O A;  3HRX A;  1XO6 A;  5DUF A;  2EJ5 A;  2VSU A;  3ST9 A;  1DCI A;  3QWD A;  3P5M A;  1XNY A;  2DEO A;  4JCT A;  3ZW9 A;  3JU1 A;  1UYR A;  3H0S A;  3Q7H A; 
#chains in the Genus database with same CATH homology
 3T3W A;  5INI A;  3LKE A;  2F6I A;  3MFM A;  1WDL A;  2ZQR A;  3H81 A;  2VSS A;  3SWX A;  2A81 A;  3V5I A;  2VSS F;  1XNW A;  5HUQ A;  4U19 A;  1J7X A;  4ZDD A;  4WCZ A;  3QYR A;  3RRV A;  2C8T A;  2A7S A;  3HIN A;  4MOU A;  4NEK A;  4K2N A;  4DI1 A;  2FBM A;  1EF9 A;  5E0S A;  5E0N X;  4RCN A;  2PBP A;  4EMM A;  1RJN A;  3GKB A;  3SLL A;  5FUS A;  3H02 A;  4KPK A;  3PE8 A;  3TVW A;  4ZDB A;  3K8X A;  4GHN A;  3M6M A;  3FDU A;  3MT6 A;  4JCS A;  3R9S A;  5FIF A;  4ASI A;  2VSU C;  1HNO A;  3PZK A;  3TT6 A;  4I52 A;  4FNB A;  4B3H A;  3Q1T A;  4I4Z A;  2Q2X A;  3T8B A;  3BPP A;  5DU4 A;  4FJW D;  4EML A;  3NJD A;  3L3S A;  5G1S A;  4U1A A;  3MYB A;  4B3I A;  3T88 A;  5DU8 A;  3U9T B;  3KTH A;  1JXZ A;  5DTW A;  3TT7 A;  4ZDE A;  5DU6 A;  4YLH A;  4FN8 A;  3HP0 A;  4RYF H;  4JCR A;  4G2R A;  3BPT A;  2VX2 A;  4ZDF A;  3VIV A;  4U0G H;  3IBB A;  3IAV A;  1VRG A;  5KDR B;  1FC9 A;  3TVU A;  4NNQ A;  3MOY A;  1UIY A;  4J2U A;  1O8U A;  4Z0M A;  2J5I B;  2J5S A;  2F6Q A;  4FZW C;  4U0H A;  3I47 A;  2VSS E;  1X0U A;  1RJM A;  4K3W A;  3FF6 A;  3OME A;  2J5I A;  1WDM A;  4OMR A;  4KWB A;  2ZL2 A;  3ZW8 A;  4WYO B;  4HNK A;  4IZB A;  1OD2 A;  3ZWA A;  3GF7 A;  1PJH A;  5G1R A;  1UYT A;  4JSB A;  4OG1 A;  2F9I B;  2ZL0 A;  3R9Q A;  2F9Y A;  2FW2 A;  4FZW A;  3STA A;  1SZO A;  3PEA A;  4L6W A;  4ELX A;  2VSU E;  2ZQQ A;  3HLN 1;  1N6F A;  3TDC A;  1K39 A;  2GTR A;  4Q1I A;  1HNU A;  3QKA A;  2HW5 A;  5C90 A;  3QK8 A;  3T89 A;  3DOR A;  4JYL A;  1NZY B;  4WZ8 B;  2Q35 A;  3T8A A;  3Q0J A;  3WG5 A;  3H0U A;  4I42 A;  4JVT A;  3GMA A;  3ISA A;  2DUB A;  3Q0G A;  4FND A;  3KTG A;  4KD6 A;  4IZD A;  1WDK A;  1UYV A;  2Q34 A;  4JFC A;  2CE3 A;  4QII A;  3KTJ A;  3G64 A;  5MGB A;  3GLM A;  1ON9 A;  4QIJ A;  2A7K A;  5DZK H;  5CTB A;  2ZL4 A;  1PIX A;  3ZWB A;  4JOT A;  4U0G A;  4FN7 A;  2BZR A;  4U18 A;  4FB8 A;  5DL1 A;  3KTK A;  4JJT A;  1W2X A;  2X24 A;  5JBX A;  4ZU2 A;  3OC7 A;  2J5I I;  1WZ8 A;  4NAR A;  4IZC A;  5CTC A;  2NP9 A;  3NJB A;  4GM2 A;  3U9R B;  5E0S H;  1MJ3 A;  2CBY A;  4LK5 A;  4MXI A;  1N6D A;  2IEX A;  4QFE A;  3QXZ A;  3LAO A;  4K29 A;  3KQF A;  2UZF A;  3QXI A;  2D3T A;  5DUC A;  5G1Q A;  1SG4 A;  3TV5 A;  1ON3 A;  2J5G D;  3TZ3 A;  3BF0 A;  4B3J A;  2W3P A;  3P85 A;  1XNV A;  1TYF A;  5JBW A;  3QRE A;  1HZD A;  1DUB A;  3OT6 A;  1YG6 A;  4Q0G A;  1FC7 A;  3H0Q A;  2WTB A;  1FCF A;  4ELW A;  2J5G A;  3RSI A;  1OD4 A;  3GF3 A;  2YJG A;  4KNP A;  2X58 A;  3BEZ A;  3M6N A;  4L8K A;  2PG8 A;  4OLQ A;  4F47 A;  1UYS A;  2F9I A;  2F9Y B;  4JYJ A;  3R9T A;  2VRE A;  4HDT A;  3TRR A;  3R6H A;  3KTI A;  1YG8 A;  1Q51 A;  3R0O A;  3RST A;  3PGQ A;  1NZY A;  3HE2 A;  3V5E A;  2QQ3 A;  5DKP A;  1N6E A;  1TG6 A;  2PPY A;  1EF8 A;  4ZDC A;  1Q52 A;  3ZWC A;  5KJP A;  1FC6 A;  2VSU F;  3H0J A;  5ING A;  3P2L A;  2FZS A;  3N6R B;  5INF A;  4JCQ A;  5DTP A;  5IKL B;  3TLF A;  2ZL3 A;  1EY3 A;  4JWV A;  4ELS A;  4MI2 A;  5C9G A;  1K32 A;  3DJA A;  4HC8 A;  1XX4 A;  4EMP A;  5KDR A;  5DZK A;  3K50 A;  3QMJ A;  3U9S B;  3IB9 A;  4RYF A;  1Y7O A;  3HRX A;  1XO6 A;  5DUF A;  2EJ5 A;  2VSU A;  3ST9 A;  1DCI A;  3QWD A;  3P5M A;  1XNY A;  2DEO A;  4JCT A;  3ZW9 A;  3JU1 A;  1UYR A;  3H0S A;  3Q7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...