5E0TA

Human pcna mutant - s228i
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
255
structure length
248
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Disease-Causing Variant in PCNA Disrupts a Promiscuous Protein Binding Site.
pubmed doi rcsb
molecule keywords Proliferating cell nuclear antigen
molecule tags Dna binding protein
source organism Homo sapiens
total genus 56
structure length 248
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5e0tA00
1YYPA 3U61F 4HK1A 5JNED 3P91A 5AUJA 4CS5A 3TBLA 5E0TA 3VKXA 1U76A 3AIZA 3A1JC 3AIXB 2HIKB 2NTIC 2IX2A 1DMLA 4D2GA 1B8HA 5CFKA 3AIZC 3GGRB 1IZ4A 5B7OA 2ZVWA 3GPMA 3HI8A 5E0VA 5IWDA 3HSLX 3A1JA 2IX2C 5HACA 2AWAA 3U5ZF 3P83A 2NTIA 1PLQA 3P87A 2IZOB 3U60F 1UD9A 3FDSD 1AXCA 1RXMA 2HIIB 3K4XA 2IO4B 3G65A 1SXJF 5IXAA 1ISQA 3V62B 1VYMA 5DA7A 2IJXA 2Z0LA 2ZVKA 5IY4A 1CZDA 2ZVVA 1W60A 2NTIB 1U7BA 3G65C 3V60B 3I2MX 2ZVMA 3WGWA 4L6PA 1UL1A 1T6LA 3GGRC 5DAIA 2IX2B 3LX1A 3LX2A 3AIXA 2HIKA 4L60A 3FDSC 2AVTA 3A1JB 1VYJA 1IZ5A 4TR6A 2OD8A 1PLRA 1RWZA 3IFVA 3GGRA 2HIIC 5H0TA 2HIKC 3A2FB 1GE8A 1RXZA 3G65B 3F1WA 5E0UA 2ZVLA 4ZTDA 1B77A 5A6DA 3GPNA 4YHRA 2HIIA 3V61B 2IO4A 4RJFA 2IZOC
chains in the Genus database with same CATH superfamily
1YYPA 3U61F 4HK1A 5JNED 3P91A 5AUJA 4CS5A 3TBLA 5E0TA 3VKXA 1U76A 3AIZA 3A1JC 3AIXB 2HIKB 2NTIC 2IX2A 1DMLA 4D2GA 1B8HA 5CFKA 3AIZC 3GGRB 1IZ4A 5B7OA 2ZVWA 3GPMA 3HI8A 5E0VA 5IWDA 3HSLX 3A1JA 2IX2C 5HACA 2AWAA 3U5ZF 3P83A 2NTIA 1PLQA 3P87A 2IZOB 3U60F 1UD9A 3FDSD 1AXCA 1RXMA 2HIIB 3K4XA 2IO4B 3G65A 1SXJF 5IXAA 1ISQA 3V62B 1VYMA 5DA7A 2IJXA 2Z0LA 2ZVKA 5IY4A 1CZDA 2ZVVA 1W60A 2NTIB 1U7BA 3G65C 3V60B 3I2MX 2ZVMA 3WGWA 4L6PA 1UL1A 1T6LA 3GGRC 5DAIA 2IX2B 3LX1A 3LX2A 3AIXA 2HIKA 4L60A 3FDSC 2AVTA 3A1JB 1VYJA 1IZ5A 4TR6A 2OD8A 1PLRA 1RWZA 3IFVA 3GGRA 2HIIC 5H0TA 2HIKC 3A2FB 1GE8A 1RXZA 3G65B 3F1WA 5E0UA 2ZVLA 4ZTDA 1B77A 5A6DA 3GPNA 4YHRA 2HIIA 3V61B 2IO4A 4RJFA 2IZOC
chains in the Genus database with same CATH topology
1YYPA 3U61F 4HK1A 5JNED 3P91A 5AUJA 4CS5A 3TBLA 5E0TA 3VKXA 1U76A 3AIZA 3A1JC 3AIXB 2HIKB 2NTIC 2IX2A 1DMLA 4D2GA 1B8HA 5CFKA 3AIZC 3GGRB 1IZ4A 5B7OA 2ZVWA 3GPMA 3HI8A 5E0VA 5IWDA 3HSLX 3A1JA 2IX2C 5HACA 2AWAA 3U5ZF 3P83A 2NTIA 1PLQA 3P87A 2IZOB 3U60F 1UD9A 3FDSD 1AXCA 1RXMA 2HIIB 3K4XA 2IO4B 3G65A 1SXJF 5IXAA 1ISQA 3V62B 1VYMA 5DA7A 2IJXA 2Z0LA 2ZVKA 5IY4A 1CZDA 2ZVVA 1W60A 2NTIB 1U7BA 3G65C 3V60B 3I2MX 2ZVMA 3WGWA 4L6PA 1UL1A 1T6LA 3GGRC 5DAIA 2IX2B 3LX1A 3LX2A 3AIXA 2HIKA 4L60A 3FDSC 2AVTA 3A1JB 1VYJA 1IZ5A 4TR6A 2OD8A 1PLRA 1RWZA 3IFVA 3GGRA 2HIIC 5H0TA 2HIKC 3A2FB 1GE8A 1RXZA 3G65B 3F1WA 5E0UA 2ZVLA 4ZTDA 1B77A 5A6DA 3GPNA 4YHRA 2HIIA 3V61B 2IO4A 4RJFA 2IZOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYP A;  3U61 F;  4HK1 A;  5JNE D;  3P91 A;  5AUJ A;  4CS5 A;  3TBL A;  5E0T A;  3VKX A;  1U76 A;  3AIZ A;  3A1J C;  3AIX B;  2HIK B;  2NTI C;  2IX2 A;  1DML A;  4D2G A;  1B8H A;  5CFK A;  3AIZ C;  3GGR B;  1IZ4 A;  5B7O A;  2ZVW A;  3GPM A;  3HI8 A;  5E0V A;  5IWD A;  3HSL X;  3A1J A;  2IX2 C;  5HAC A;  2AWA A;  3U5Z F;  3P83 A;  2NTI A;  1PLQ A;  3P87 A;  2IZO B;  3U60 F;  1UD9 A;  3FDS D;  1AXC A;  1RXM A;  2HII B;  3K4X A;  2IO4 B;  3G65 A;  1SXJ F;  5IXA A;  1ISQ A;  3V62 B;  1VYM A;  5DA7 A;  2IJX A;  2Z0L A;  2ZVK A;  5IY4 A;  1CZD A;  2ZVV A;  1W60 A;  2NTI B;  1U7B A;  3G65 C;  3V60 B;  3I2M X;  2ZVM A;  3WGW A;  4L6P A;  1UL1 A;  1T6L A;  3GGR C;  5DAI A;  2IX2 B;  3LX1 A;  3LX2 A;  3AIX A;  2HIK A;  4L60 A;  3FDS C;  2AVT A;  3A1J B;  1VYJ A;  1IZ5 A;  4TR6 A;  2OD8 A;  1PLR A;  1RWZ A;  3IFV A;  3GGR A;  2HII C;  5H0T A;  2HIK C;  3A2F B;  1GE8 A;  1RXZ A;  3G65 B;  3F1W A;  5E0U A;  2ZVL A;  4ZTD A;  1B77 A;  5A6D A;  3GPN A;  4YHR A;  2HII A;  3V61 B;  2IO4 A;  4RJF A;  2IZO C; 
#chains in the Genus database with same CATH topology
 1YYP A;  3U61 F;  4HK1 A;  5JNE D;  3P91 A;  5AUJ A;  4CS5 A;  3TBL A;  5E0T A;  3VKX A;  1U76 A;  3AIZ A;  3A1J C;  3AIX B;  2HIK B;  2NTI C;  2IX2 A;  1DML A;  4D2G A;  1B8H A;  5CFK A;  3AIZ C;  3GGR B;  1IZ4 A;  5B7O A;  2ZVW A;  3GPM A;  3HI8 A;  5E0V A;  5IWD A;  3HSL X;  3A1J A;  2IX2 C;  5HAC A;  2AWA A;  3U5Z F;  3P83 A;  2NTI A;  1PLQ A;  3P87 A;  2IZO B;  3U60 F;  1UD9 A;  3FDS D;  1AXC A;  1RXM A;  2HII B;  3K4X A;  2IO4 B;  3G65 A;  1SXJ F;  5IXA A;  1ISQ A;  3V62 B;  1VYM A;  5DA7 A;  2IJX A;  2Z0L A;  2ZVK A;  5IY4 A;  1CZD A;  2ZVV A;  1W60 A;  2NTI B;  1U7B A;  3G65 C;  3V60 B;  3I2M X;  2ZVM A;  3WGW A;  4L6P A;  1UL1 A;  1T6L A;  3GGR C;  5DAI A;  2IX2 B;  3LX1 A;  3LX2 A;  3AIX A;  2HIK A;  4L60 A;  3FDS C;  2AVT A;  3A1J B;  1VYJ A;  1IZ5 A;  4TR6 A;  2OD8 A;  1PLR A;  1RWZ A;  3IFV A;  3GGR A;  2HII C;  5H0T A;  2HIK C;  3A2F B;  1GE8 A;  1RXZ A;  3G65 B;  3F1W A;  5E0U A;  2ZVL A;  4ZTD A;  1B77 A;  5A6D A;  3GPN A;  4YHR A;  2HII A;  3V61 B;  2IO4 A;  4RJF A;  2IZO C; 
#chains in the Genus database with same CATH homology
 1YYP A;  3U61 F;  4HK1 A;  5JNE D;  3P91 A;  5AUJ A;  4CS5 A;  3TBL A;  5E0T A;  3VKX A;  1U76 A;  3AIZ A;  3A1J C;  3AIX B;  2HIK B;  2NTI C;  2IX2 A;  1DML A;  4D2G A;  1B8H A;  5CFK A;  3AIZ C;  3GGR B;  1IZ4 A;  5B7O A;  2ZVW A;  3GPM A;  3HI8 A;  5E0V A;  5IWD A;  3HSL X;  3A1J A;  2IX2 C;  5HAC A;  2AWA A;  3U5Z F;  3P83 A;  2NTI A;  1PLQ A;  3P87 A;  2IZO B;  3U60 F;  1UD9 A;  3FDS D;  1AXC A;  1RXM A;  2HII B;  3K4X A;  2IO4 B;  3G65 A;  1SXJ F;  5IXA A;  1ISQ A;  3V62 B;  1VYM A;  5DA7 A;  2IJX A;  2Z0L A;  2ZVK A;  5IY4 A;  1CZD A;  2ZVV A;  1W60 A;  2NTI B;  1U7B A;  3G65 C;  3V60 B;  3I2M X;  2ZVM A;  3WGW A;  4L6P A;  1UL1 A;  1T6L A;  3GGR C;  5DAI A;  2IX2 B;  3LX1 A;  3LX2 A;  3AIX A;  2HIK A;  4L60 A;  3FDS C;  2AVT A;  3A1J B;  1VYJ A;  1IZ5 A;  4TR6 A;  2OD8 A;  1PLR A;  1RWZ A;  3IFV A;  3GGR A;  2HII C;  5H0T A;  2HIK C;  3A2F B;  1GE8 A;  1RXZ A;  3G65 B;  3F1W A;  5E0U A;  2ZVL A;  4ZTD A;  1B77 A;  5A6D A;  3GPN A;  4YHR A;  2HII A;  3V61 B;  2IO4 A;  4RJF A;  2IZO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...