5E0UA

Human pcna variant (s228i) complexed with p21 at 1.9 angstroms
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
255
structure length
255
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLIMSADVPLVVEYKIADMGHLKYYLAPKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Disease-Causing Variant in PCNA Disrupts a Promiscuous Protein Binding Site.
pubmed doi rcsb
molecule keywords Proliferating cell nuclear antigen
molecule tags Dna binding protein
source organism Homo sapiens
total genus 60
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 5e0uA00
3WGWA 3F1WA 2IZOB 3G65B 4HK1A 5B7OA 3V61B 1GE8A 1W60A 5IXAA 2IX2C 3U61F 1U7BA 3GGRC 4L60A 3GPMA 3GPNA 5H0TA 1B8HA 1ISQA 2ZVMA 3U5ZF 2IO4B 2AVTA 1SXJF 1CZDA 3A1JB 2ZVVA 1RWZA 2NTIB 3P87A 2HIKB 3I2MX 3P91A 1DMLA 3V62B 3G65A 5JNED 2HIIB 3VKXA 3U60F 4CS5A 5E0VA 1B77A 2IJXA 1U76A 4YHRA 4RJFA 4L6PA 1RXZA 4TR6A 3HSLX 2OD8A 2IX2B 2IO4A 5E0TA 1UD9A 1PLRA 3GGRB 2NTIA 1UL1A 3AIXB 3HI8A 5HACA 5IWDA 3G65C 2IZOC 1VYJA 3LX1A 2HIKA 1RXMA 3FDSC 3FDSD 5DA7A 5A6DA 2HIIA 5AUJA 3K4XA 1T6LA 4D2GA 1IZ4A 1VYMA 1IZ5A 3AIZC 3AIZA 3A1JC 5IY4A 3A1JA 2NTIC 2IX2A 2AWAA 2HIKC 3IFVA 3TBLA 3GGRA 3AIXA 3A2FB 5E0UA 2HIIC 2Z0LA 2ZVLA 3LX2A 1AXCA 5DAIA 5CFKA 3P83A 4ZTDA 1PLQA 2ZVKA 2ZVWA 3V60B 1YYPA
chains in the Genus database with same CATH superfamily
3WGWA 3F1WA 2IZOB 3G65B 4HK1A 5B7OA 3V61B 1GE8A 1W60A 5IXAA 2IX2C 3U61F 1U7BA 3GGRC 4L60A 3GPMA 3GPNA 5H0TA 1B8HA 1ISQA 2ZVMA 3U5ZF 2IO4B 2AVTA 1SXJF 1CZDA 3A1JB 2ZVVA 1RWZA 2NTIB 3P87A 2HIKB 3I2MX 3P91A 1DMLA 3V62B 3G65A 5JNED 2HIIB 3VKXA 3U60F 4CS5A 5E0VA 1B77A 2IJXA 1U76A 4YHRA 4RJFA 4L6PA 1RXZA 4TR6A 3HSLX 2OD8A 2IX2B 2IO4A 5E0TA 1UD9A 1PLRA 3GGRB 2NTIA 1UL1A 3AIXB 3HI8A 5HACA 5IWDA 3G65C 2IZOC 1VYJA 3LX1A 2HIKA 1RXMA 3FDSC 3FDSD 5DA7A 5A6DA 2HIIA 5AUJA 3K4XA 1T6LA 4D2GA 1IZ4A 1VYMA 1IZ5A 3AIZC 3AIZA 3A1JC 5IY4A 3A1JA 2NTIC 2IX2A 2AWAA 2HIKC 3IFVA 3TBLA 3GGRA 3AIXA 3A2FB 5E0UA 2HIIC 2Z0LA 2ZVLA 3LX2A 1AXCA 5DAIA 5CFKA 3P83A 4ZTDA 1PLQA 2ZVKA 2ZVWA 3V60B 1YYPA
chains in the Genus database with same CATH topology
3WGWA 3F1WA 2IZOB 3G65B 4HK1A 5B7OA 3V61B 1GE8A 1W60A 5IXAA 2IX2C 3U61F 1U7BA 3GGRC 4L60A 3GPMA 3GPNA 5H0TA 1B8HA 1ISQA 2ZVMA 3U5ZF 2IO4B 2AVTA 1SXJF 1CZDA 3A1JB 2ZVVA 1RWZA 2NTIB 3P87A 2HIKB 3I2MX 3P91A 1DMLA 3V62B 3G65A 5JNED 2HIIB 3VKXA 3U60F 4CS5A 5E0VA 1B77A 2IJXA 1U76A 4YHRA 4RJFA 4L6PA 1RXZA 4TR6A 3HSLX 2OD8A 2IX2B 2IO4A 5E0TA 1UD9A 1PLRA 3GGRB 2NTIA 1UL1A 3AIXB 3HI8A 5HACA 5IWDA 3G65C 2IZOC 1VYJA 3LX1A 2HIKA 1RXMA 3FDSC 3FDSD 5DA7A 5A6DA 2HIIA 5AUJA 3K4XA 1T6LA 4D2GA 1IZ4A 1VYMA 1IZ5A 3AIZC 3AIZA 3A1JC 5IY4A 3A1JA 2NTIC 2IX2A 2AWAA 2HIKC 3IFVA 3TBLA 3GGRA 3AIXA 3A2FB 5E0UA 2HIIC 2Z0LA 2ZVLA 3LX2A 1AXCA 5DAIA 5CFKA 3P83A 4ZTDA 1PLQA 2ZVKA 2ZVWA 3V60B 1YYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGW A;  3F1W A;  2IZO B;  3G65 B;  4HK1 A;  5B7O A;  3V61 B;  1GE8 A;  1W60 A;  5IXA A;  2IX2 C;  3U61 F;  1U7B A;  3GGR C;  4L60 A;  3GPM A;  3GPN A;  5H0T A;  1B8H A;  1ISQ A;  2ZVM A;  3U5Z F;  2IO4 B;  2AVT A;  1SXJ F;  1CZD A;  3A1J B;  2ZVV A;  1RWZ A;  2NTI B;  3P87 A;  2HIK B;  3I2M X;  3P91 A;  1DML A;  3V62 B;  3G65 A;  5JNE D;  2HII B;  3VKX A;  3U60 F;  4CS5 A;  5E0V A;  1B77 A;  2IJX A;  1U76 A;  4YHR A;  4RJF A;  4L6P A;  1RXZ A;  4TR6 A;  3HSL X;  2OD8 A;  2IX2 B;  2IO4 A;  5E0T A;  1UD9 A;  1PLR A;  3GGR B;  2NTI A;  1UL1 A;  3AIX B;  3HI8 A;  5HAC A;  5IWD A;  3G65 C;  2IZO C;  1VYJ A;  3LX1 A;  2HIK A;  1RXM A;  3FDS C;  3FDS D;  5DA7 A;  5A6D A;  2HII A;  5AUJ A;  3K4X A;  1T6L A;  4D2G A;  1IZ4 A;  1VYM A;  1IZ5 A;  3AIZ C;  3AIZ A;  3A1J C;  5IY4 A;  3A1J A;  2NTI C;  2IX2 A;  2AWA A;  2HIK C;  3IFV A;  3TBL A;  3GGR A;  3AIX A;  3A2F B;  5E0U A;  2HII C;  2Z0L A;  2ZVL A;  3LX2 A;  1AXC A;  5DAI A;  5CFK A;  3P83 A;  4ZTD A;  1PLQ A;  2ZVK A;  2ZVW A;  3V60 B;  1YYP A; 
#chains in the Genus database with same CATH topology
 3WGW A;  3F1W A;  2IZO B;  3G65 B;  4HK1 A;  5B7O A;  3V61 B;  1GE8 A;  1W60 A;  5IXA A;  2IX2 C;  3U61 F;  1U7B A;  3GGR C;  4L60 A;  3GPM A;  3GPN A;  5H0T A;  1B8H A;  1ISQ A;  2ZVM A;  3U5Z F;  2IO4 B;  2AVT A;  1SXJ F;  1CZD A;  3A1J B;  2ZVV A;  1RWZ A;  2NTI B;  3P87 A;  2HIK B;  3I2M X;  3P91 A;  1DML A;  3V62 B;  3G65 A;  5JNE D;  2HII B;  3VKX A;  3U60 F;  4CS5 A;  5E0V A;  1B77 A;  2IJX A;  1U76 A;  4YHR A;  4RJF A;  4L6P A;  1RXZ A;  4TR6 A;  3HSL X;  2OD8 A;  2IX2 B;  2IO4 A;  5E0T A;  1UD9 A;  1PLR A;  3GGR B;  2NTI A;  1UL1 A;  3AIX B;  3HI8 A;  5HAC A;  5IWD A;  3G65 C;  2IZO C;  1VYJ A;  3LX1 A;  2HIK A;  1RXM A;  3FDS C;  3FDS D;  5DA7 A;  5A6D A;  2HII A;  5AUJ A;  3K4X A;  1T6L A;  4D2G A;  1IZ4 A;  1VYM A;  1IZ5 A;  3AIZ C;  3AIZ A;  3A1J C;  5IY4 A;  3A1J A;  2NTI C;  2IX2 A;  2AWA A;  2HIK C;  3IFV A;  3TBL A;  3GGR A;  3AIX A;  3A2F B;  5E0U A;  2HII C;  2Z0L A;  2ZVL A;  3LX2 A;  1AXC A;  5DAI A;  5CFK A;  3P83 A;  4ZTD A;  1PLQ A;  2ZVK A;  2ZVW A;  3V60 B;  1YYP A; 
#chains in the Genus database with same CATH homology
 3WGW A;  3F1W A;  2IZO B;  3G65 B;  4HK1 A;  5B7O A;  3V61 B;  1GE8 A;  1W60 A;  5IXA A;  2IX2 C;  3U61 F;  1U7B A;  3GGR C;  4L60 A;  3GPM A;  3GPN A;  5H0T A;  1B8H A;  1ISQ A;  2ZVM A;  3U5Z F;  2IO4 B;  2AVT A;  1SXJ F;  1CZD A;  3A1J B;  2ZVV A;  1RWZ A;  2NTI B;  3P87 A;  2HIK B;  3I2M X;  3P91 A;  1DML A;  3V62 B;  3G65 A;  5JNE D;  2HII B;  3VKX A;  3U60 F;  4CS5 A;  5E0V A;  1B77 A;  2IJX A;  1U76 A;  4YHR A;  4RJF A;  4L6P A;  1RXZ A;  4TR6 A;  3HSL X;  2OD8 A;  2IX2 B;  2IO4 A;  5E0T A;  1UD9 A;  1PLR A;  3GGR B;  2NTI A;  1UL1 A;  3AIX B;  3HI8 A;  5HAC A;  5IWD A;  3G65 C;  2IZO C;  1VYJ A;  3LX1 A;  2HIK A;  1RXM A;  3FDS C;  3FDS D;  5DA7 A;  5A6D A;  2HII A;  5AUJ A;  3K4X A;  1T6L A;  4D2G A;  1IZ4 A;  1VYM A;  1IZ5 A;  3AIZ C;  3AIZ A;  3A1J C;  5IY4 A;  3A1J A;  2NTI C;  2IX2 A;  2AWA A;  2HIK C;  3IFV A;  3TBL A;  3GGR A;  3AIX A;  3A2F B;  5E0U A;  2HII C;  2Z0L A;  2ZVL A;  3LX2 A;  1AXC A;  5DAI A;  5CFK A;  3P83 A;  4ZTD A;  1PLQ A;  2ZVK A;  2ZVW A;  3V60 B;  1YYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...