The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
68
|
structure length |
68
|
Chain Sequence |
NQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transferase
|
| molecule keywords |
Serine/threonine-protein kinase PknB
|
| publication title |
Structural and Genetic Analyses of the Mycobacterium tuberculosis Protein Kinase B Sensor Domain Identify a Potential Ligand-binding Site.
pubmed doi rcsb |
| source organism |
Mycobacterium tuberculosis
|
| total genus |
21
|
| structure length |
68
|
| sequence length |
68
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2015-09-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03793 | PASTA | PASTA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A |
#chains in the Genus database with same CATH superfamily 2KUF A; 2KUE A; 5E0Z A; 3PY9 A; 2MGV A; 5E0Y A; 2KUD A; 3OUV A; 5E10 A; 2KUI A; 3M9G A; #chains in the Genus database with same CATH topology 1TMG I; 1TEC I; 2SEC I; 1MIT A; 3RDZ C; 1CSE I; 5FBZ B; 1EGL A; 1TM7 I; 1HYM A; 1TM1 I; 3W0E A; 1DWM A; 1COA I; 4H4F B; 2KUE A; 1YPA I; 2KUF A; 1SIB I; 4B1T B; 1Y4D I; 1MEE I; 1Y3C I; 1Y48 I; 1Y3F I; 1Y3B I; 2KUD A; 4B2C B; 1ACB I; 1TIN A; 5E10 A; 1TM5 I; 1Y3D I; 4B2B B; 4B2A B; 1YPC I; 2SNI I; 1TM4 I; 1Y33 I; 1Y4A I; 1CIS A; 1Y34 I; 1TM3 I; 1VBW A; 3PY9 A; 5E0Y A; 5FFN I; 3OUV A; 2CI2 I; 1TO1 I; 1YPB I; 3RDY A; 2KUI A; 3CI2 A; 1SBN I; 1Y1K I; 3M9G A; 5E0Z A; 3TEC I; 2MGV A; 1LW6 I; 1TO2 I; 3W0D A; 2TEC I; #chains in the Genus database with same CATH homology 2KUF A; 2KUE A; 5E0Z A; 3PY9 A; 2MGV A; 5E0Y A; 2KUD A; 3OUV A; 5E10 A; 2KUI A; 3M9G A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
