5E16A

Co-crystal structure of the n-termial cgmp binding domain of plasmodium falciparum pkg with cgmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
SNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCSTLNDNEILTLSNYMQFFVFKSGNLVIKQGEKGSYFFIINSGKFDVYVNDKKVKTMGKGSSFGEAALIHNTQRSATIIAETDGTLWGVQRSTFRATLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CGMP-dependent protein kinase
publication title Co-crystal structure of the N-termial cGMP binding domain of Plasmodium falciparum PKG with cGMP
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5e16A00
2D5FA 2IXJA 2D93A 2GC2A 2VQAA 3D0JA 4ONUA 1U12A 3CO2A 1DZTA 4LLOA 4JVAA 2XLFA 4Q0QA 4IESA 4F7ZA 4XFIA 3RNSA 4EV0A 4YSFA 1ZZ8A 4XFHA 2IXKA 4H7LA 1OFNA 1CAWA 2H0VA 4B29A 1RGSA 4HN1A 2I45A 4IEOA 5BPXA 5FDBA 5I0RA 1X8MA 3ACLA 1DZRA 3HIFA 5EZWA 4P9GA 1SFNA 2KXLA 4BYYA 5HI0A 2OYZA 5KHKA 4QMAA 5JSOA 4L2NA 4MH0E 1UCXA 2UY9A 2ZKLA 4MX3A 3ETQA 3S0MA 1X82A 3NKTA 4LUMA 2IXHA 1ZZ7A 3RZZA 3LOIA 4X6RB 4EROA 4D7TA 4L11A 2ZCWA 3VHRA 4MV2A 2B8MA 5KHJA 3BU7A 3U11A 3PVBB 2D40A 1UW8A 2XLGA 3I59A 1UIKA 3I7DA 4GULA 4UBHA 3C3VA 1SEFA 5AVPA 1Y3TA 2OZJA 4WVZA 3LA2A 3TNPB 5FQ0B 4XF1A 1UPIA 3NVCA 4AVCA 1FXZA 4META 1LKNA 1CAXA 3S7IA 4Q0PA 1PMIA 1XRUA 2BNOA 1NYWA 5KHGA 3ROUA 2UY8A 5JSPA 4J1WA 4HVQA 5LEJA 2HKXA 4IETA 3ELNA 4AVAA 2H6CA 3RYKA 1ZZ9A 1J3RA 5F1RA 5JCTA 3MZHA 4LULA 5LRSA 1QXRA 1XE8A 3IWZA 3MYXA 1UIJA 4J1XA 3D0SA 4LA2A 3BALA 1CAXB 1Q43A 3H7YA 3S7EA 1JUHA 4QGMA 1VJ2A 4ZU7A 4YRDA 4IEZA 3ZDSA 4DINB 1RL3A 3KCCA 3RPQA 3M70A 4N9HA 4WZCA 3E5UA 3H7JA 2Y0OA 3KSCA 4OLLA 3H8UA 2K9ZA 4EWAA 3H3ZA 3OGJA 2QJVA 3LZZA 2C0ZA 3OTFA 4UXAA 1FT9A 4TLFA 4I3PA 1YHFA 4JTNA 4K8FA 3D82A 3WW4A 3N4MA 1CAUA 2O1QA 3GYDA 3JZVA 2ATFA 4ZU5A 1YUDA 1O4TA 2Q30A 3LA7A 2HJIA 4PIXA 4LTAA 1EP0A 4XETA 4LA3A 1YFYA 4KL1A 1G6NA 5JR7B 2PAKA 2WC2A 4EWEA 2K0GA 3OF1A 2EA7A 1IPKA 2QVSB 2PAEA 4KWLA 3KGLA 1Q5OA 2GC0A 1NE4A 1DGRA 1ZZCA 1CAVA 2XKOA 1IPJA 5I0UA 3IBMA 4A2UA 5I8TA 4HBNA 1LR5A 5LRRA 4EWDA 2XGXA 2GAUA 2CAVA 2B5HA 4Z82A 4ORFA 5EFUA 2F4PA 3LWCA 3FE5A 1QWRA 4KU8A 2BYVE 3H1YA 1CAWB 3FFQA 1ZNPA 4RD7A 1WGPA 4Q0UA 1LRHA 3NL1A 2PA7A 4MGYE 1ZX5A 3HT2A 1J3PA 4IEYA 3KMHA 3DKWA 3IIAA 3CJXA 3FHIB 4AXOA 3H3UA 2DCTA 3WW2A 1EY2A 1YFWA 2D5HA 1FI2A 4N9IA 3QOPA 4AVBA 4YYOA 1NXMA 3ES4A 4X6QB 4R52A 2E9QA 3NSTA 1OI6A 3DV8A 4HLTA 2PYTA 5BUVA 5C6CA 2XKPA 1OMIA 5FLJA 2CAUA 2Q0AA 2PFWA 4MGKE 1DGWA 4KWJA 5FPZA 3EJKA 4BHPA 2Z69A 1ZVFA 1I6XA 1O3QA 3I59B 3H9AA 1LB2A 2ET7A 3MPBA 4HVRA 4HN0A 4IEXA 5BV6A 1VP6A 4NVPA 1WA4A 5LEKA 1UD1A 5J48A 3DN7A 4O9EA 4YARA 1RUOA 2ET1A 2IXIA 4MZUA 3SCFA 4XFFA 1H1IA 4XEZA 4CYDA 1J58A 5KBFA 3E6CC 1WLTA 4ZU4A 1O3SA 2BGCA 3FZ3A 4FBFA 1RUNA 3NW4A 1O3RA 4LUKA 2EAAA 2MHFA 2PHLA 3SXWA 2V09A 4OFGA 3SMHA 3OD0A 4PIYA 2XL7A 4HVOA 1TQ5A 1O5UA 4WBBA 5CADA 3R6SA 5FCCA 4BIFA 3LA3A 5J3UA 3ES1A 5BY5A 3RYPA 2GH2A 4HSLA 5D1IA 1ZRCA 3WW3A 3DL3A 3ST7A 4UBGA 4XFAA 4KWKA 5FLIA 5I91A 3MDPA 2BNNA 1EPZA 3RDIA 4HZFA 2MPFA 3BB6A 4XFGA 4XF4A 5BXXA 1HW5A 2OZ6A 2OPKA 2VECA 5KHIA 3PNAA 3CLPA 4I09A 4JTOA 4MUVA 5C8WA 2ETEA 4Q0SA 3HQXA 1O3TA 4IEVA 3EBRA 3O14A 3QACA 2Z2SB 1XE7A 3LAGA 4IEWA 1RC6A 2OA2A 1CAUB 3SHRA 3USSA 1NZCA 2H6BA 4R8HA 1ZRRA 1QY4A 4QM9A 5E16A 1VR3A 2IXCA 2XHKA 1YFUA 4O9GA 4XFCA 4KU7A 1GQGA 4I02A 3BPZA 2PAMA 1V70A 3E6BA 5FQ0A 5I0SA 3E5XA 5JAXA 2O8QA 1ZRFA 3EQEA 1RTVA 2UYBA 5CU1A 4IEUA 5FLHA 4Z07A 4JV4A 3EHKA 4I01A 1CAVB 2FQPA 3FJSA 5E1RA 4QGNA 1X7NA 2FMYA 5I8YA 1J1LA 1PM7A 1Q3EA 2GU9A 1CGPA 3TNQA 4E2QA 1H1MA 4E2GA 5K8SA 4E2SA 1J3QA 3UKNA 4F8AA 3FWEA 3E6DA 3H1WA 3CL1A 2XLAA 2MNGA 4Q29A 2GC3A 4BH9A 4I0AA 1GQHA 1EYBA 4I2OA 2P17A 4I0BA 5KHHA 1ZREA 1YFXA 2WFPA 3H1MA 3OCPA 1NE6A 4IEPA 5I0TA 5J7MA 5I8SA 4FT8A 2QDRA 2BEOA 2B9UA 3WW1A 1ZZBA 3GBFA 4FAHA 3SCHA 3CEWA 2Q1ZB 4PIZA 5FPXA 2PHDA 3CF6E 3U0ZA 1ZZ6A 4D7SA 4YNIA 1ZRDA 3HT1A 1CX4A 4MGZE 3H50A 4QM8A 5I93A 1YWKA 2UYAA 1J59A 3FX3A 1L3JA 2QNKA 2BNMA 2VPVA 1YLLA 1QXJA 3BCWA 2XL9A 1SQ4A 1I5ZA 2GZWA 3E97A 2IC1A 3IDBB 4QGLA 4XF9A 3PLQA 4IERA 4HMZA 3IDCB 2PTMA 5CVRA 4Q0VA 2Q4SA 1OD5A 5JSRA 1O7FA 2CGPA 3B02A 3EO6A 1X8EA 3UKVA 3KGZA 4AQ6A 2QCSB 4XFBA 2PQQA 4PJYA 4QX5A 3RYRA 4XF3A 1O5LA 4IEQA 5T3NA 4XF0A 2CV6A 3SCGA 3UKTA 2N7GA 3E5QA 4AQ2A 3I54A 4HSJA 4QXKA 1Y9QA 3L2HA 2EVXA 3M3IA 3U10A 4FAGA 2IXLA 3G7DA 4LEJA 3NJZA 4MGIE 2GC1A
chains in the Genus database with same CATH superfamily
4NO4A 2IXJA 2W5FA 4ONUA 2VQAA 4QPYA 1IG3A 4AFBA 1RMU1 2G19A 3LPFA 4ATFA 4BDVB 1TMF3 2DVGA 4YVSC 4LT5A 1DZTA 1W90A 1RMU2 5FY1A 5FY8A 4JVAA 5DMYA 5JXHA 4XYXA 3HBKA 1S0DA 1ZA4A 5IVCA 1QHDA 5C9AA 1OLMA 2BW8A 3J7LA 2ZZJA 1QOOA 2BDRA 2R30A 1CAWA 1WA6X 4H7LA 3ATGA 5FP8A 4BIOA 2W0XA 3VBHC 4NOTA 1KS5A 5ANNA 3DCQA 3T0DA 3ZFEB 1W6NA 1AJKA 4EZ4A 4P9YA 3AKPA 4ZPIA 1XE0A 4A6SA 4IEOA 1UYYA 2DVAA 1DQ0A 3VD9A 4D6QA 4YLZA 1MEC1 1RXFA 1RUH1 3VBFB 1MEC2 4S2DA 3EXUA 1R093 2VW0A 1AR61 1RUH2 2X5IA 4EJRA 1DZRA 2FZ1A 1G9CA 5A33B 3J26N 1SFNA 3LDRA 4YGDA 5DG2A 3WHTA 5HI0A 1AR62 1V6NA 3B3QE 1PO11 4XJAA 3VZNA 4AE2A 3NNMA 4P9XA 4CCCA 5JLVA 5AFEA 3ETQA 3MV11 2RDSA 3M7AA 2IXHA 3MLJA 1ZZ7A 4JX0A 4K7JA 1DP0A 2VNOA 1A34A 1E5SA 3HMYA 3RZMA 2E26A 2BTVC 4B4PA 1AR81 1BBT1 3FHAA 1WLCA 1UNBA 1YXWA 4Y22A 1K45A 1W8HA 3VHRA 4MV2A 3H8OA 3JD71 4BISA 4HPKA 2J1RA 3APBA 3JBG1 1SFPA 5FUPA 1PIV2 2RR13 4LR4A 4AF9A 2WNUC 1XU2A 1H4HA 3VBRB 4CPBD 4QX7A 3ENRA 2WZPP 4Y4RA 2VVEA 1QDOA 1UMZA 1Y3TA 2OZJA 2PN5A 2Z42A 5FQ0B 4XF1A 3MEPA 1H6YA 4DEVA 4AVCA 1BKZA 4CCDA 4FPJA 1BLZA 1X9TA 2EALA 1F31A 3S7IA 4CRQA 1PMIA 1YI7A 3DYPA 2WRAA 1XRUA 3I3EA 1JH5A 2X8KA 2VOWA 3WG4A 2BNOA 1NZIA 2VW1A 2ZEWA 3DUIA 4JHZA 1W2UA 5FZFA 1ND3A 2CWSA 1M4WA 2RS51 2VZVA 5CEHA 2VMCA 1RJ8A 3QBQA 4FOVA 4Y22B 4ZZ8A 3V0AA 4CCEA 4HVQA 1DG6A 3H3LA 5FP7A 3QH6A 1RUD3 4IETA 1DFQA 1XBFA 5FZ9A 1F15A 2P6HA 3THDA 1WKYA 2BVVA 1KITA 4XXAA 4Q4W1 4EYUA 1PK6B 1KQRA 2HWB1 4A7KA 2V5YA 1SFYA 3BYWA 2X09A 1N47A 1QXRA 1HJFA 4J1XA 5DZFA 2Y6HA 3POSA 3BALA 1RUE3 1BXHA 1SCSA 3OEAA 3OY8A 4QQOA 3WQ7A 3BTAA 2I2SA 5FXXA 4JAAA 4QGMA 5CNAA 2DCJA 2PELA 2Y6LA 4B4QA 3SC7X 4FPEA 4IEZA 3NQHA 4N53B 2W2IA 1VBE3 1WD4A 4DINB 3KCCA 4CPBA 2FDKA 3M70A 4XQWA 4N9HA 4WZCA 5IATA 1WCQA 4L9BA 3V0AB 3KWVA 1GICA 3H7JA 1KDKA 4AI0A 3VZOA 1VBC3 2K9ZA 1TVGA 1PGW1 4EWAA 4TN7A 1ST8A 3DECA 3HN1A 1LEDA 4ZS3A 2B4KA 5FP3A 3P3NA 4ARXA 4JKLA 2C5DA 4F83A 1C4RA 1R1ZA 1VAVA 1XXNA 4HANA 4LIVA 2C0ZA 4NR1A 4OHVA 3KLSA 1RXGA 3TWIA 3DYOA 2GN7A 1GU3A 2RM23 4QX8A 1HX6A 3MIGA 4ZY9A 5LATA 3WNXA 3AP5A 3HNMA 3N4MA 2JDZA 4C90A 1NOVA 1UOJA 2VW2A 5F3GA 3HN3A 2YGLA 3JZVA 2ATFA 2C9KA 5G05L 2A73B 5FZOA 4QD2A 4AAPA 2WKKA 1OLME 1ZBE3 1QMJA 5EIYB 4AQTA 2DUPA 4QQHA 5A6ZA 2YU1A 4AEKA 3L9JT 2LTNA 1YEWA 3L2YA 5ABJB 1SLAA 2WC2A 3FFZA 3W58A 2A5ZA 4UF0B 3RSJA 4DB5A 4NRQA 4JGYC 2Q8CA 3M4FA 3W21A 1BCXA 4QXBA 5C8CB 1YQ6A 4FI9A 3QCWA 1VRH2 4YVSA 4D69A 4KWLA 1EV12 3KGLA 3X29B 5DAXA 4ASLA 1W05A 2ADDA 1GZWA 1QNYA 1L7LA 1DGRA 3WCSA 5LBFA 1HV1A 1V9U1 1JOJA 2XKOA 4A2UA 1H2KA 3LIHA 5IW0A 5HCBA 3RZHA 3OPWA 3GGLA 2ARCA 3OPZA 5IYYA 1OVPA 3VBHA 2A70A 5LASA 1S0IA 4NHLA 4AOCA 3ZYJB 1NCRA 1HKDA 3O1VA 3ZXKA 2IWGB 4Y1XA 3POBA 4Y33A 2QUOA 1FOD3 2XUEA 1RUC2 2A3XA 2ZTNA 3FFQA 5LY1A 3SITA 2GMPA 1WGPA 4QT6A 3NL1A 2PA7A 4LO4B 1ZX5A 4COWA 3HT2A 1D4M3 3CDZB 1XC6A 2Y0IA 2YZ4A 1STMA 1W6QB 1C8M3 1PM4A 2DCTA 4LO5B 3TN91 1H6XA 2X29A 3CJIA 1V6MA 4JKKA 5L7OC 4DXRA 4YYOA 1O91A 1QEXA 1AX1A 3ZFFA 4BQ3A 5A3MA 1YJKA 2P34A 4IE5A 1IS5A 5CFDA 1PVC3 4X6QB 3WR0A 1DIWA 5FUNA 1NXD1 4R52A 4CCLA 1OD3A 4CEWC 2ZHMA 1OI6A 4XHBA 2P6CA 3DV8A 3BTZA 2EICA 1NCRB 3PHMA 4RGGA 3UV9A 3O0XA 2EXJA 4UT5A 5FLJA 2P3IA 2DVDA 3O0VA 3MW2A 2LALA 4QKBA 1POV0 3B9IA 4BLIA 4BQXA 5AFBA 2Q0AA 2R041 2WNUA 4TXWA 3RWKX 4DIQA 2Q1MA 4TTGA 2R042 3AKSA 4C1XA 2VZRA 3BTYA 2FBEA 1W6PB 3TEWA 4QXCA 4DO0A 2A71A 4AHXA 2WFF1 2ZEYA 2VCAA 1O3QA 3I59B 1S0FA 1T6BX 2JDUA 3CJIB 4UW6A 1G8WA 3DEMA 3ZFGC 1LB2A 1OLQA 1MZFA 1S2KA 4OCTA 4HN0A 1VP6A 2BBVA 1SLTA 4XQ4A 5CFDB 2XONA 2Y6KA 1HXS3 1VMFA 3DN7A 4O9EA 2JJ6A 1UOFA 3BODA 4A3ZA 4GALA 2CU5A 5EV7A 5K4LA 1LGCA 3RZGA 4FP2A 4LK6A 4PQ9A 2RS11 5FYSA 1O8SA 1LENA 2DF7A 5ACA3 5C3SA 3NAPB 3AYCA 4XXPA 1NA1C 2BP6A 4P02B 4XFFA 4M3CF 5T5LA 1OH4A 2VM9A 1SACA 1K5MA 1NX9A 5FPBA 4BQWA 2WWJA 3V0BA 1WLTA 2VE1A 3VZLA 3ILNA 4OHWA 5A6XA 3KV4A 3FZ3A 3H42B 3IM0A 1AR71 5CYYA 3BIWE 2PHLA 4NWVA 1UY2A 2W1WA 3V65A 1NAEA 4BOWA 4UI9L 4E4DX 4OFGA 5F3IA 4Q4Y1 3SMHA 3LSEA 2LM3A 1RMU3 4YVWC 1O5UA 3MICA 5APAA 3J8F1 5IUQA 1X9PA 3JB4C 3J8F2 2VJXA 3RYPA 4CDXB 2XUMA 3OBRA 1RUJ2 2B42B 3J7HA 4V2VA 2FDIA 4INDA 4UFIA 2E7QA 2P3JA 1AXZA 1JU4A 4XDOA 4FO9A 5BNPB 1ENXA 3ZXLA 2XHNA 2E33A 1UYXA 3AFKA 4WM7B 4JDNA 1K5MB 1ULFA 4COYA 4YGBA 4XFGA 5FZ8A 1UY0A 4A42A 2KM2A 1O8PA 2CTVA 4WM8B 2L9LA 1MEC3 4AGGA 1UY3A 3SKVA 3I2KA 1G9DA 1RUH3 2OPKA 2R0HA 4NAMA 4XUPA 2VECA 3WF0A 4CU8A 5KHIA 1AR63 4BMEA 2YV8A 2AH2A 4Y5SA 3A0KA 3GXUA 1W2AX 4Q0SA 1O3TA 1J83A 3NRUA 3PUHA 2VQTA 2JB4A 3AC0A 5A7PA 1XE7A 3U14A 3F2ZA 3LAGA 2A6YA 4IEWA 4YZ2A 4BA6A 2WUHA 3PURA 4GWIA 2H6BA 3A7QA 4R8HA 2JDMA 1ZRRA 1AR83 3POJA 5A7OA 5EWSA 4QM9A 4XPVA 1LHUA 3AP6A 1W06A 2ZOEB 1ULEA 2IXCA 2AGSA 3WF3A 1PIV3 2WT2A 3JD73 2JDNA 4KU7A 3JBG3 3BPZA 1R64A 1FNZA 1V70A 4NJ4A 1CVNA 2WLPA 3D8CA 3WDXA 3E6BA 1KJLA 3T2TA 3GCWA 5FWEA 1CZVA 2HWF1 3GZUC 1R092 1LESA 4LXLA 5FZLA 5FY7A 4CCKA 2E7AA 3ITQA 1S0BA 4XOGA 3I3BA 5BYNA 3KCYA 2NN8A 5A1LA 4I01A 1CAVB 2BWCA 5E1RA 2VZQA 5KC5A 1X7NA 1COV1 3CMGA 4B7KA 2FMYA 1ZM1A 1H8VA 2O0OA 3U4XA 1OA4A 4QPGC 4U36A 3ACHA 3URFA 1CGPA 1JYCA 3WF1A 4E2QA 3RJ2X 5CKQA 5K8SA 4EN0A 3GCXA 2A6XA 4YFWA 3USUB 4FPOB 5FZ7A 3ME2A 4AFAA 3WOGA 5IVEA 3FWEA 4GIQA 3H1WA 4LLFA 4Y24A 3VBOC 2NM1A 2A3YA 5CAZA 5K9YA 2VMEA 2GC3A 5DQ0A 4I0AA 1GQHA 4I2OA 3LFIA 4NHXA 1VAKA 2BERA 5L7OA 1SZBA 2RR12 1FNYA 5A32A 1JHJA 1AR91 5D8AA 3I2OA 5J7MA 3N3HA 2C9AA 2YGMA 5I8SA 4LBMA 1W6MB 2B9UA 1HN0A 2LW8A 1TZOA 2VNRA 4K9SA 4TLGA 3WDUA 4CEWA 5FV3A 1GNZA 3GBFA 4B1MA 1DU3D 3CEWA 4BLJA 5CFCB 2ZXQA 1H4GA 2FCTA 4IXLA 5FTTC 2VBDA 4Y1UA 4ARYA 1HB1A 1YC61 5FUIA 4M3CA 1VMJA 4YM1A 1DZQA 3KM5A 5HCAA 1Y4WA 3HT1A 4GD4A 2WLQA 4MXWA 5FPAA 3N7KA 4NIDA 2VZUA 4MXVA 1P8JA 2B45X 2RDNA 4N43B 4RQPC 3FX3A 3FBYA 2QNKA 1GLHA 2VPVA 4QQPA 1YLLA 4K1ZA 5FZ1A 1RUG1 4XBNA 3VDDA 3WUDA 2D43A 4UW3A 2R061 3HNBM 2Y38A 1RUG2 3THPA 5A32B 3IDBB 3VB9A 2A75A 1GBGA 3PLQA 1XJAA 4CEYC 2Y6JA 2ZEXA 4C8DA 2R072 4LBQA 5JOYA 5JXGA 2YFUA 3T1MA 4RHV1 1S0GA 3THTA 2QCSB 1OT5A 2P1BA 5EHDA 3WEZA 1DDLA 1BJQA 4XFBA 3AMMA 4EN8B 3B5LB 1TE1B 1TNFA 4XF3A 4YM0A 1QNWA 2V4VA 3GALA 2V4AA 1MS0A 4XF0A 1DCSA 3H0OA 5FYHA 4XHXA 3NKGA 4B8EA 1DGLA 1HRI1 3E5QA 3RGBA 4AQ2A 4NIHA 4HSJA 4QXKA 2ZZQA 5B4NA 5TSWA 4G9SB 1B35A 4QHBA 3VDDB 3U10A 3EMRA 3AMPA 1GZCA 1VRH3 3ZVXA 1YIFA 3G7DA 4LEJA 4NRMA 2J1UA 4YVWA 4NHYA 1H8TB 3ZYFA 3I3QA 2JD4A 2GC2A 2VG9A 3OD4A 4RYDA 4XJUA 3CO2A 3DPRA 3I2IA 4FOYA 3TEXA 4Q27A 3VL9A 3EYPA 4LBQB 1V9U3 4LPLA 2W92A 2XLFA 5FKBA 2AC1A 4A4AA 4CE8A 4F7ZA 4XFIA 4EV0A 4W8JA 1MACA 4CP9A 2HH9A 1LEMA 4CCOA 2E53A 5G04L 1QQP2 2H0VA 1AHSA 1LOFC 4B29A 4Q4X1 1RGSA 1Y43B 5ERLA 1VAMA 3W59A 1KFXL 1VBB1 4Q4X2 2VOVA 1G9AA 2VOXA 2DVFA 3VBSB 1CIWA 5JUVA 1N1VA 2XVLA 4JKMA 4OHZA 1CD3G 1NT0A 3VBRC 1B35B 2RV9A 3BTXA 1JODA 4LO6B 5FDBA 5I0RA 4CP1A 4OHXA 1X8MA 3ACLA 3BUCA 4P9GA 3FN9A 5KHKA 4IV3B 4AI3A 1OUSA 4COZA 4S2GA 1F5FA 1MQTC 1CZTA 3DPRB 3WHUA 5L9VA 1GQPA 4WVWA 3RI9A 1X82A 2HEVF 2ZGSA 4FXGB 3B00A 3K77A 2DURA 5T52A 3ZYHA 1NCQB 4E8DA 3T3YA 4CP9B 3ZLIA 4SBVA 5HV4A 3LOIA 2VZSA 3D6EA 4HOOA 3WZ1A 4BK5A 4AVSA 1VBA1 3KT7A 4XABA 1KXGA 2K46A 2CDOA 4AG4A 4D7TA 4C0BA 4MHUA 2B8MA 4CDQB 2WNVC 1RVF1 2R043 5SV8A 4RN5A 3UESA 1RIRA 1BZWA 1V0AA 1FOD2 2ID4A 3PVBB 4RFT0 4UFKA 3U11A 2XLGA 3ZYIB 2E6VA 4Z1VA 2R49A 2JG8C 4IUGA 1JBCA 2ZACA 1JYWA 4H55A 4JHTA 3IMNA 3HBZA 3KB5A 1OQDA 5AC91 3W5NA 1ONAA 2WQ8A 5A70A 3MO4A 5LBBA 3HR9A 1UZZA 1C8M2 3GHMA 4PF5A 4XW3A 4E4SA 3NMBA 3NVCA 4MG2A 3NNJA 2XMLA 3OGRA 2C6SA 2JE7A 4Q1PA 4META 1CAXA 2ZKNA 4ZHNA 1CPMA 4FPHA 1ND2B 1BMV1 2RS13 3KT4A 1QGLA 2EAKA 1HN1A 4XDPA 5DAWA 4NIAA 1HB3A 1IZ3A 3ROUA 4XUOA 2B39A 3ECQA 3PDQA 3LEKA 2VQUA 5A3UA 2QQMA 5LK7B 5IVJA 2C26A 1PGL1 1POQA 2PLV1 3R0RA 4QDSA 5EJZB 5A1AA 2IVJA 2PLV2 4E4HA 5CBLA 4LULA 3T1LA 1XE8A 3MYXA 1SCRA 1L7RA 1WBLA 4Q4Y3 3VDBA 1X33A 3D0SA 4CA9A 4QX0A 2RVAA 4LA2A 1CAXB 5FMOS 3J8F3 2W47A 4RS5C 4D7YA 5DPNA 1RUJ3 1I1EA 3GJBA 5FZGA 2RS31 1NG0A 4M0NA 4CDUC 5KC6A 1S0CA 5HXVA 5KXBA 4ZU7A 2D6NA 3AVSA 2OW4A 4RQPA 1U5XA 5A3NA 4W65A 4BZ4A 1E5IA 3C7HA 5FP9A 5FZ6A 3T0BA 2Y0OA 4GMP0 2ORZA 1C1FA 1BK0A 2G1MA 5FO7B 5FYVA 1SPPA 1GFF2 3RI8A 2FDHA 3ZMNA 3IPVA 2BFUL 3OGJA 1ZBA1 3OBTA 4CEYA 3LZZA 1OQ1A 2XQXA 2HWD1 1HRV1 4XVHA 3CNAA 4P5YA 2TNFA 2J42A 3ILFA 1FT9A 4OHYA 4G3YC 5IWFA 4CSWA 4OZXA 1YHFA 4TSVA 3WNMA 4D3WA 4K8FA 4JDMA 4CUAA 2CYFA 3O7OA 2RHPA 4AEDA 1CAUA 2O1QA 3N9PA 2DFBA 3OYWB 1YUDA 5H9SA 3I8TA 2Q30A 4EN7B 4COVA 5FY9A 4QB1A 5FJHA 1VLNA 1D4VB 1W3XA 3SKJE 2OT7A 2QQWA 4YZ5A 2DFCA 2Q8OA 1MZ6A 3HVDA 3PU8A 4KL1A 4MOAA 1G6NA 5JOXA 5JR7B 4AHWA 2YBSA 3RZJA 2PAKA 3N7LA 2R0FA 3LDKA 3ZX7A 3CU7A 1CR7A 3LEIA 5GZEA 4CVUA 3SEPA 3WG3A 3JQXA 3IPVB 3KHBA 2D3RA 2VR4A 3T2QA 5FY0A 3MW4A 4S2HA 4Y1ZA 3VDCA 2IVIB 2ILMA 4W6XA 1WW6A 4YW6A 1LOGA 2R7EB 5FRAA 3K4ZA 2DVBA 2HWF3 4CUGA 2GC0A 1NE4A 2P37A 4HK9A 3WV6A 1ZZCA 4DMIA 5FWJA 3K51A 4BU2A 1IPJA 3WG2A 5I8TA 4H3WA 2VNVA 3I2FA 5DUVA 4YW7A 4EWDA 1PO12 4AEDB 4I0WB 4UFHA 4RL7A 4WVMA 3ZDVA 5LB6A 3BIEA 5C4WC 1EUTA 5JPMB 3Q8FA 5FZ0A 4IE0A 5C9AB 3ZN4A 5JOZA 2NP0A 4KU8A 2ZGTA 1OBNA 3H1YA 1CAWB 3SH3A 2WR9A 4PLNA 5JVVA 3A23A 4Q0UA 1LRHA 1AR82 1BBT2 1W6NB 1W99A 4YG6A 3KF3A 4FPFA 5GLUA 1V6JA 2JD9A 4JRLA 4NWWA 3IMMA 3B93A 1ULDA 1F4HA 5AVAA 1IHMA 4GZ9A 5LA1A 1XYPA 3V56A 2RMU1 3H3UA 3JD72 4FPKA 3WW2A 2IFWA 5DAPA 2YU2A 3JBG2 2VZPA 2P4EA 1UPSA 1MQTA 1PMJX 5FAXA 2JDAA 2CGNA 3HWJA 3O0WA 1H0BA 1JS9A 1UMHA 2X5IB 1AR93 1NXMA 3HD8B 3IAPA 2PHWA 1XNTA 3J7MA 3AP7A 5FYIA 3VL8A 2E9QA 3WP4A 3QD6A 2JENA 2PYTA 4WVMB 4CXWA 5B2GB 2OPWA 3NAPC 4GMP1 3DXTA 1O59A 2OUHA 2ZMKA 3I97A 2P5BA 4YGCA 1JW6A 2JG8A 4MGKE 2MEV1 2ZS6B 3VGIA 3ZYGA 5GLZA 1DGWA 1UKGA 2RS52 4RR3C 4NPRA 2MEV2 1HDKA 5FFOC 2E31A 3PU3A 2Z69A 1W8NA 2GMMA 4HPKB 3KF5A 4M4RA 4AHYA 3OPTA 1RUG3 1DF0A 4EN6B 2ERFA 1SBEA 4CCMA 2R063 4XC9A 4XBQA 3ZN5A 1Z0HA 2JEMA 3THCA 1UXXX 3WT3A 4HVRA 5FPVA 1PMHX 2R073 4M0HA 2HWB2 4Q4W2 5IK4A 4XUQA 4NVPA 1WA4A 2P2KA 4OQ9A 2HBTA 3O5SA 1D0GA 2WAAA 4RHV3 4YARA 1RUOA 1OXCA 1OURA 3TAYA 2IXIA 3T2OA 3SCFA 2VOTA 2OVUA 1YO8A 1US3A 3W20A 1O4YA 2RG4A 3PUAA 5FK8A 1EAH1 3KV9A 4XMIA 5J98B 5BNOA 1ND3B 2QQIA 3UGHA 1WCKA 1QJU1 4ZU4A 5FYZA 2BGCA 1IQDC 1HRI3 3JQWA 2VUJA 5CISA 3CKHA 1GP6A 3PJYA 3ZYBA 4FBFA 3JCIA 1RUNA 4CDWC 2EAAA 2VCBA 4YZ4A 4P9WA 4HT1T 2D7FA 4IDZA 4Q1RA 2WZEA 4QPIA 1KGYA 1PGW2 1QJY1 4SLIA 3ON7A 5IVBA 4RS5A 4LO7A 1W0PA 4HVOA 5HXMA 1LU2A 4PQQA 4HETA 4YW1A 2JG9A 4UFMA 1FPN1 5FCCA 5GM0A 5LBCA 3MF6A 2JDHA 5BY5A 2XJUA 4QKDA 4HSLA 5DN2A 5IVFA 2ARXA 3OY8B 1QQP3 5EJ1B 3IZOA 5JZGC 1IOAA 4LKFA 4NRPA 4RSUA 3RWNA 2NZ9A 3ACGA 1Z7S1 2GMEA 2WO1A 4AFCA 5DUUA 4Q4X3 4P00B 4LBOA 3ZXFA 3MDPA 5BNOB 1VBB3 2XWJB 3RDIA 3O12A 4XF4A 2JDPA 2J22A 1HW5A 5BXXA 3WD5A 3M1HA 2NMNA 2FD8A 3MUZ1 1VBD1 5IVYA 3WXPA 2VY0A 4MLOA 3PNAA 2PXJA 5H9PA 4I09A 4IGOA 4MUVA 4QPIB 3B94A 1VBD2 3RRDA 4PCRA 2LS6A 4Q2FA 4N90A 3ALQA 3OUIA 4MADA 1UZ0A 3QACA 4Y4YA 1LOAA 4Z2WA 4JRAA 2JG9B 3BN6A 4V2WA 3WVJA 3VD4A 5IK8A 1S55A 1KFUL 2XJRA 2RJ2A 2XPJA 4FXKB 1V9U2 2JWPA 1UQXA 3USSA 3B9CA 1NZCA 4KGGA 5FZOB 2QQLA 5F5QA 2BQPA 2R32A 2ZHKA 1VBA3 2QQOA 5FZAA 5E16A 1HQLA 3LD8A 1RVF3 1AVBA 1FYUA 1YFUA 3PVOA 4XFCA 5LEKA 1LCLA 2HYXA 4GH4C 3VHOA 2XWBB 1OF4A 1BQPA 3UT0A 1WMFA 2YY1A 3OSDA 4KMQA 2VD7A 2AUYA 3KZ4C 4GWNA 5BNQA 2DU0A 5LA0A 3BU0A 3TEZA 1RTVA 3U1XA 5CU1A 3RZKA 4YVSB 3KD4A 1HIXA 3TN92 4TYSA 1IS3A 1DBNA 4BPZA 1GZWB 3WF2A 5CFCC 5C4WA 1M06G 4QGNA 2D98A 2EIGA 2XJVA 1Q3EA 1JXNA 5JMCA 3VD3A 1AZDA 4N8MA 4NN0A 3VBHB 3KCXA 3P1IA 3MHZA 1UU6A 2YG0A 4E2SA 5FZ4A 1S0EA 3WQ1A 3N36A 3K48A 1XNAA 3E6DA 1CIYA 3MLLA 3VUOA 4XJWA 3CL1A 1CZSA 3KQRA 3M3EA 1WMXA 2A3WA 2WAOA 3IDAA 2MNGA 3JU9A 1NUKA 4Q29A 4AL9A 4BH9A 1W9SA 1EYBA 2P17A 4I0BA 5A3WA 3I4IA 1ZREA 1FMD1 2B46X 4QKNA 4B7EA 2PLV3 5J1XA 3ORJA 4RFRB 3GBWA 4QX2A 4LMFA 4YFZA 5DG1A 2WFF2 1ENRA 1QJX1 5B4XA 2BEOA 1LNSA 3WQBA 1ENSA 1QJX2 3AZYA 3T09A 3ZFFB 3DKQA 3ZXJA 4LKSA 1F35A 1C5IA 2W1UA 2IUWA 4GKXA 2D97A 5T5OA 4YNIA 4MSVA 5HCFA 4MGZE 3VBUC 1OUXA 4RR3A 4XE9A 2R6QA 2JKBA 3WUCA 1D2QA 2RS12 3KHCA 1GOFA 1IG0A 4Z8BA 1OOPC 2UYAA 2WS91 5A3OA 5C33A 2WNUB 1ACCA 1L3JA 5GALA 2WS92 2YPJA 3LQCA 4XUTA 4DNYA 3VHNA 1W9YA 1ZBA3 1SQ4A 5D21A 4YG0A 4QGLA 4XF9A 1AR72 2E51A 2GNMA 1W8ZA 1HRV3 2WA4A 2QZ2A 3IDCB 5FK7A 4CUBA 1C1LA 5CVRA 5LW9A 5FMCA 1O7FA 1JZ5A 4KI5M 1SMVA 4UFLA 3GM8A 2D6MA 4AVTA 4DXZA 2CGPA 1X8EA 4Q4Y2 1QJZA 1ZRIA 3MIHA 4M4PA 4E9KA 2WZR1 4Q4V1 1VB2A 4PJYA 4KG0A 1RUF1 3WLUA 3WNOA 4QX5A 1UU4A 1B09A 4FOQA 1O5LA 4HL0A 4IEQA 4Q4V2 3BOPA 3K3NA 5FYYA 2HWC1 3HNYM 5DZEA 2N7GA 1I5PA 4Q5OA 4CDWA 2HWC2 4ET7A 3I54A 2Y26A 1PVXA 4GAZA 1RHI1 4HONA 1E5RA 2EVXA 4YW5A 1OKOA 1JZ6A 4OYUA 4FAGA 3KS7A 3V0BB 3OUJA 2YUEA 4ZZ5A 4HKLA 1QF3A 2HWE1 2IXLA 3HQUA 3LF7A 4JZRA 4NMIA 4UOJA 2I45A 4MGIE 2HYKA 4IV3C 3I49A 1FATA 1WMDA 1JZ7A 3KV6A 1ULGA 3TBDA 2QKDA 3D3AA 2C24A 4QU1A 1W6OA 2AENA 3AL5A 4YWAA 5DDJ1 3LEMA 5T50A 4CP0A 1WLWA 3N9OA 1PO13 5DDJ2 3FLTA 4IESA 1NCQC 5A3TA 3O1MA 3ZXEA 3N9MA 5E88A 4XFHA 5EP9A 5FMBA 1SDDB 3FLPA 5LA2A 5HBAA 2IXKA 5J09A 4D8MA 3ZYPA 1POV1 5JXJA 1GWLA 3S5QA 1LULA 2QE3A 4GWMA 4A7ZA 4QU2A 4LIUA 4UFJA 1UZWA 3ACIA 1FAYA 1NLQA 3MF9A 1UY4A 1PZ9A 2FHRA 4K8RB 1BBT3 4ASKA 5L19A 4CU7A 4JGYA 1HB4A 4H7MA 5A7QA 1LJ7A 4WV8A 4JGZC 3PJQA 1H2LA 2J7MA 3PVNA 2VZ3A 5BPXA 3MIBA 5EJ3A 2RMU3 1F9KA 1CONA 4K20A 4Y20A 1W04A 2BV4A 3AZZA 3P5BA 2KXLA 5IAXA 4PDWC 4BYYA 4A3XA 3POFA 5JSOA 4L2NA 4MH0E 1UCXA 2J1SA 2ZKLA 3RJRA 1OH3A 3VKNA 2HWF2 2WYSA 1DHKB 2BWAA 2VMIA 3FUOA 3NKTA 4QWNA 4W6YA 1NLRA 4ZXEA 3O1UA 5T55A 4MO3M 1DYPA 1E5HA 4A6OA 1COV2 3AXEA 4R9DA 4X6RB 2A7AA 1CX1A 4EROA 3WG1A 4L11A 1YQ5A 5KHJA 2P3KA 3BU7A 3M3QA 2DCYA 1VE0A 1YJLA 2RS53 1W03A 2CL2A 2XDVA 2MEV3 4JGYB 4MVTA 2PMWB 2D40A 4HFSA 4FPCA 3TEYA 3PTRB 2FDFA 5JOWA 4IV1C 4JQTA 2XJPA 4IW3A 4UBHA 3VD5A 3C3VA 3RG0A 1SEFA 1NY71 1UX6A 1IS6A 3POEA 4ISRA 4XZUG 3VD7A 4A44A 4ASMB 2B9VA 5EPAA 3FL7A 3LA2A 1GP5A 2HWB3 2BUKA 4Q4W3 3ZXDA 2DU1A 1CPNA 1FXZA 2Z5WA 4BXSV 1LKNA 1AR92 3QLQA 3BI3A 3UGGA 3Q8BA 3IIIA 2AREA 4PI0A 5C71A 5FJKA 3VKFC 4Q8KA 3WINE 4LITA 3LSDA 1N3OA 2SLIA 1Q8PA 1NYWA 1UY1A 4O65A 2XBO1 5A3PA 5F32A 4WZFA 2G9ZA 2OX0A 1OPOA 4RA0A 5CB7A 5KHGA 5K0UC 2XBO2 1REDA 1W39A 1F5JA 2UY8A 1EAH3 3WX5A 4DRVA 4Z92B 2ZX4A 3TYJA 5BNNC 1OLRA 5CA6A 5LEJA 2YBPA 3N9NA 4DY3A 4OMDA 2OUJA 1GNHA 1N3PA 2DTYA 2Q5TA 1GOHA 2VU9A 3ELNA 4AVAA 5J96B 1TNRA 2H6CA 2OKXA 1W9WA 2E63A 3RYKA 3C7FA 1RITA 2DBIA 2QBXA 4L99A 1AYM1 1WCDJ 2SBAA 4QB6A 3KVBA 2YMZA 3ZFGA 5K7PA 3AK0A 4OUMA 1JN2P 5JCTA 1AYM2 5L7OB 5IJRA 1PX4A 3V64A 3D4KA 3U78A 3IWZA 4XQDA 1UIJA 2R062 3BGAA 5D8AB 2LUWA 3ZMOA 5E6HA 1KD7A 4CEWB 5DZGA 5SV5A 3S7EA 1JUHA 1FV3A 3C2UA 3VBUA 2DUOA 4BMBA 2GNDA 1CWPA 1MPXA 3AJZA 3FC0A 4RHV2 2CDPA 1DQ5A 1YNAA 4R9AA 1NA1A 1OOPA 3ZDSA 5H9QA 1LOEA 4M3CB 3RPQA 3MI8A 4DUXA 5FOJB 3SH5A 1REFA 3ZFEC 1MZEA 1S2BA 4MXWB 3E5UA 3KSCA 1XNDA 3N7JA 4OLLA 4YPJA 3H8UA 2BGPA 3H3ZA 4PLOA 3VBFC 1HRI2 4AI8A 4IGQA 3ZFGB 3DF0A 1VBD3 4Y1YA 4GWJA 4E4ZA 2VCCA 2Y33A 3OTFA 4AGVA 5HV0A 4UXAA 1RUE1 5C5TA 1LGBA 4BE3A 4HXCA 4I3PA 4JTNA 4V1PA 2ARAA 2AZ5A 1OF3A 4OUSA 1XNBA 1XYNA 2D6LX 2FMDA 2VQ0A 3RMXA 5EXOA 1VBE1 5CIRA 4M00A 1O4TA 1G86A 2HJIA 2Q1FA 1N1TA 1S4CA 2I74A 4KBBA 2YB7A 4XETA 5GLWA 1DLLA 1YFYA 1VBC1 3IKWA 4ATEA 2H0BA 2UU8A 4HKWA 4LO8A 1U5ZA 4EWEA 1D2SA 2DBNA 1KEXA 2K0GA 1VBB2 2YC4A 5FPLA 3WDVA 1LODA 2W1SA 5GZCA 4LOTA 2EA7A 4ITCA 1JYXA 4IE6A 5CKMA 4BXFA 2RM21 2PAEA 4NE9A 5DUXA 1A8MA 3WY6A 2V73A 1WW4A 1Q5OA 3TN93 4W6WA 4YVWB 3J7NA 3CQOA 2QFEA 5I0UA 4UAPA 4HBNA 1HQWA 5E89A 1UOBA 5LRRA 3LOBA 1IGOA 2NLRA 3BKZA 3ZKUA 2GAUA 2B5HA 2VO5A 4XCBA 4Z82A 5LY2A 4XJ8A 3T2PA 4PBOA 4URTA 3GNEA 5EFUA 1UZVA 2F4PA 1QOSA 3CZJA 1QXPA 3LWCA 4H14A 4WVVA 1XPWA 5FZ3A 4ZXKA 1URXA 2AACA 2D6KA 4JGZA 3GDBA 1V6IA 5L73A 1XU1A 1ZNPA 4RD7A 3OUHA 3UK9A 4OI0A 4L0PA 1ULCA 3B01A 3GZAA 1VBA2 4B1LA 4IEYA 3WP6A 3DKWA 1RVF2 3FHIB 4PDWA 1LTEA 1EY2A 1MS8A 3H8RA 1GV9A 1YFWA 1PK6C 3R4SA 1AUYA 1Q8VA 2XJTA 2WFF3 4RGKA 1IKPA 2EF6A 2O8OA 2WNOA 3AKTA 3ZN6A 4GJZA 5AC92 1QJX3 3OOXA 1JZ2A 2WIIB 2ZPXA 2PQSA 4NAOA 2AEZA 3Q8CA 2PHXA 4N7IA 4QPGA 2ZGQA 3MIFA 3F95A 3K2OA 5IK7A 2YFZA 1KJRA 1OMIA 2WABA 2XKPA 3CBNA 3EB7A 5FBJA 5T54A 4K1YA 4N53C 1ND3C 3GJAA 3MBWA 1BMV2 4LHLA 4M3CE 3VBOA 4LHNA 4P14A 1Q8OA 4KWUA 5DUWA 3AMHA 5F39A 4ES9A 2WS93 2RDQA 4AI1A 3EJKA 3AZXA 2QQUA 1ZVFA 4JC1A 5LA9A 3AMQA 4DXTA 4D94A 5JIAA 2K2SA 4LKDA 5T5PA 1V6OA 2C1FA 3AL6A 1AR73 2UWAA 1PGL2 5FR3A 1E57A 2YYOA 1GYKA 2R1DA 5FZKA 5J37A 4IEXA 3VDAA 5F3CA 3ZOIA 3PUQA 3NO8A 1RUI1 4GB31 1GSLA 4CP2A 2LROA 1T6GC 1PO21 2ZHLA 1R1A1 3LE0A 3NNFA 4GB32 2X53S 4KBZA 5FXWA 5J48A 2YBKA 1PO22 1R1A2 4OMCA 2HEWF 4AW7A 4QPGB 2ET1A 4B3NA 1BHGA 5K0UA 2BRTA 4X8PA 2W95A 4JDOA 3AKRA 4MZUA 4Q4V3 4CXYA 5BNNA 3BVCA 1DGRN 3M8LA 2QQKA 2RS32 3PUSA 1H1IA 4AVVA 2HWC3 3VBOB 4CYDA 5GZGA 1U0AA 2CNAA 5ABJC 3E6CC 4XJ9A 2VL4A 3DGTA 1YQ8A 2CSGA 1H30A 3HJRA 1MZ5A 1O3RA 4LUKA 1UF2C 2D6OX 5C8CC 2Y60A 2MHFA 4DOUA 1W0NA 2V09A 1H2NA 4O61A 1MS9A 1HXS1 1ZBA2 4PIYA 3PTYA 1Q56A 5DDJ3 3S5AA 4WBBA 5LWBA 1BK1A 1HRV2 2HWD2 3WNLA 4BIFA 3LA3A 3NJVA 3ES1A 2QQVA 2GH2A 5D1IA 5LK5A 1I3HA 2J1EA 2VOKA 3SLIA 5IFPA 1ZRCA 4IE7A 4FFFA 3WW3A 5DAQA 3TB0A 1HJGA 3ST7A 4CXXA 1LHVA 4XFAA 3UYJA 4KWKA 3N7MA 5FLIA 1BYHA 4NPLA 1WCUA 5I91A 1EPZA 2VUDA 4RQPB 3WSOA 1WW5A 2VXJA 5GZFA 3M3CA 4KH9A 3VBFA 2TEPA 2KR2A 2GN3A 3ACFA 2W94A 2PHTA 3PL0A 5EYYA 5C70A 1JYNA 3CZUA 5GJ6A 1QJEA 4PLMA 4YM3A 1SPPB 4TWTA 1PNFA 2JIGA 3PMSA 4JTOA 5F6KA 1VB4A 1N3QA 4A41A 4CEYB 4CU6A 2A6VA 1CESA 2ZGKA 3E1F1 1GP4A 3RVHA 2F17A 3W9AA 4IEVA 4P9LA 3EBRA 5GKAC 4LHSA 4Y1VA 1WWYA 4BK4A 1JMUB 3WNNA 4AFMA 1IPSA 3VZMA 5FXVA 4DXSA 2BOJA 3JXSA 1RC6A 3SQOA 3JUUA 2NQYA 1CAUB 4QPWA 1COV3 1K3IA 1LOFA 5FIXA 1NCRC 4AHZA 3WDTA 1A8DA 3WQ0A 3OB8A 5C3QA 1XOYA 3MW3A 2WYFA 1VR3A 2CWMA 3NJXA 3VBRA 2ZEZA 3A4UA 3C7GA 4I02A 2PAMA 4XILA 5C3PA 5FKCA 5FQ0A 4PHZA 5I0SA 5GZDA 3ZSEA 2O8QA 3POYA 5JAXA 3CJIC 4QQ2A 1YIPA 1TME1 2RMU2 3C7OA 4Z07A 5FLHA 3T30A 4JV4A 1ENQA 2XJQA 5JIUA 1TME2 3ZFFC 1XSQA 4NUBA 5CFDC 2Y34A 2VVFA 3HPNA 5CKNA 1GWKA 1SLBA 1PM7A 4LK7A 1ODMA 3GF6A 3O1OA 1OVSA 2YC2A 3TNQA 5JMOA 2JB8A 1I9RA 3RS6A 2XBO3 3SISA 3IAQA 4B4RA 1PIV1 1KDMA 2WNVA 3MV01 5F37A 1XNCA 2ORXA 2VBPA 4MGTA 1VIWB 2W9XA 5LZ6A 1PK6A 5ISLA 3SH4A 1OA3A 1H2MA 5KHHA 2BGOA 1YFXA 2RJLA 2WFPA 4H2AA 4FVVA 4AFDA 2TBVA 3FHQA 1JUIA 1AYM3 4QKFA 5F2WA 4IEPA 1XNKA 5I0TA 1F2NA 2WT1A 2X10A 2WWSA 1K5JA 4L8QA 3K4DA 2QDRA 1MQTB 2VZ1A 5L9RA 1ZZBA 2G9FA 5L9BA 3POIA 4YG3A 3NV3A 3SCHA 1WUVA 5FPXA 3ZXAC 3MLKA 4FTBA 2PHDA 4DUVA 3CF6E 4N53A 4CDXC 4PF1A 1JHNA 1EUUA 1REEA 1OFSA 5L36A 1SLCA 4D7SA 4HG6B 5C3OA 1NQJA 2DYCA 2QQNA 4Y26A 2F4LA 3WNKA 4BJ0A 3H50A 4GXLA 4QM8A 5BNPC 2WNVB 3ZIXA 4WM7C 4DY5A 2EIBA 2CHHA 1K5MC 1LHWA 2RE9A 2A6ZA 2O14A 4A7YA 4CU9A 3U75A 1J59A 1K42A 2JG8B 1EAH2 2VXRA 4BB3A 2BNMA 4WM8C 1ASJ1 3AVRA 1QXJA 3BCWA 3I2GA 3C7EA 2Y8KA 1QJU2 2XL9A 3LB9A 3ZKYA 1ASJ2 2ZAAA 3E97A 3FLRA 4P08A 1DLCA 2V72A 2HEYF 5H9RA 2BVBA 4IERA 3AMNA 1DQ2A 1CJPA 1AYN1 4LBKA 4Q0VA 3K46A 1OD5A 5LBEA 4NIGA 2ADEA 2JXAA 5IFTA 4FTEA 5FXZA 4LBLA 1AYN2 1QJY2 1SG3A 1EPWA 3B02A 3EO6A 3I2JA 3KGZA 4KGQA 3UKVA 4AQ6A 4CDUA 1RINA 1WMEA 3AP4A 4PBPA 3OG2A 1UU5A 3IT8A 1JZ8A 1Q8SA 1ZA7A 2FCVA 2ZABA 2VUCA 1FPN2 2VMFA 3AX4A 4UW4A 5T5JA 3RYRA 5FZIA 3PMEA 3AYAA 4GKYA 2JECA 1MVEA 4COUA 5ABJA 5T3NA 5KXCA 4QXHA 4UF0A 3SCGA 2DUQA 1HB2A 3UKTA 4UW5A 2XB6C 5C8CA 2VAUA 1Z7S2 2Q8DA 4CTEA 1Y9QA 4CZSA 2Z79A 3L2HA 1H9PA 3KVAA 3M3IA 3VZKA 3O1TA 3U07A 4CCNA 5F6LB 4LORA 2A1XA 3IDEA 1OHFA 1W0OA 3NJZA 3ZSJA 2GC1A 2ZGLA 5FY5A 2D5FA 1VALA 1W8FA 2D93A 1WD3A 5IHRA 1W8WA 3D0JA 2VMGA 1U12A 3UJOA 4E8CA 1W2TA 4FQZA 4JCKA 1JYVA 3ETPA 1FX5A 1VPHA 4LLOA 1UWWA 2PHUA 1AX2A 4RS5B 2XG3A 4Q0QA 3A22A 3RNSA 4CDUB 1HQNA 4YSFA 3S57A 1ZZ8A 3IN9A 1GNYA 3KT1A 4R4XA 5IAVA 1OFNA 3WDYA 5FY4A 2OQ6A 1SBDA 4C0HA 5IT6A 4NHKA 2Z4FA 3FBMA 1R081 1MS1A 3ZO0B 1X50A 2Q8EA 2AYHA 4CUCA 1ZYBA 4HN1A 5DABA 1OSGA 4G4FA 1R082 1HLCA 1RYYA 3BPSA 1AXKA 1VRH1 1W6QA 1W9TA 1EV11 2DTWA 1JTZX 4QQLA 5FZEA 4MYEA 2JE8A 2WT0A 4YW2A 2J1AA 3POWA 3HIFA 5EZWA 2RJKA 1C28A 2WINB 2OYZA 5AC93 4QMAA 3R4UA 2VUAA 4I3GA 5F5CA 2UY9A 2WSVA 1JZ4A 4MX3A 4GA9A 4U2AA 3S0MA 1US2A 1PZ7A 4P9JA 4LUMA 2W1QA 4AAXA 3RZZA 4XIKA 1RUC1 2FZ2A 1YCIA 1S1AA 3JB8A 4KNCA 1S0JA 3MPPG 2JDKA 1JU3A 3B69A 1LU1A 2BPA2 2WO7A 1QDCA 2ZCWA 1DYOA 1W6PA 2OXBA 4BQ1A 3PIJA 5F7UA 1GZTA 4LE4A 2FCUA 1GOGA 1TEIA 1UW8A 3P6BA 3I59A 4N43C 2VNGA 1UIKA 1LECA 2WN2A 3KV5A 1IS4A 3SNMA 4C91A 4ES8A 3I7DA 4GULA 5F8PA 2VVDA 1QH7A 4FFGA 4AZZA 1A78A 2Y64A 4OI1A 5IVVA 1K12A 2ZX1A 3GBGA 5AVPA 2G4IA 1IQAA 2IZWA 1VRBA 4WVZA 3TNPB 1UPIA 3MIDA 4JQRA 1NKGA 4MGQA 1FMD2 5D8AC 4Y5Z0 5E8AA 3ZYRA 4DRRA 2WO2A 1RUI3 4GB33 3RFRA 1MVQA 1PO23 2OIIA 1R1A3 1U5IA 4Q0PA 2QQJA 1AX0A 4TZDA 2HLEA 1JYIA 2ZGRA 4XMAA 1NLSA 2UWCA 2W08A 3POGA 3PVEA 1Z78A 3ZSLA 3AJYA 2JIJA 3CIHA 3NAPA 5C4WB 3ZXGA 3WF4A 1C57A 4P5HA 5JI7A 2RS33 5KR7A 1MS4A 3K3OA 1X36A 1FV2A 3ZSKA 5JSPA 4J1WA 5DAVA 2HKXA 1F8VA 4XACA 4QX1A 1W8TA 5FYCA 4J6GA 1WBFA 1ZZ9A 4YZ3A 3VDDC 1J3RA 4DUWA 5F1RA 1AXYA 3MZHA 2BFUS 1H8TC 5FOBB 5LRSA 3HAGA 3ZM8A 2WNEA 4QHZA 1PGSA 2ZGPA 5FREA 2PHRA 2HWD3 1DQ1A 1J84A 4ISQA 4CDXA 1SHWB 5FYUA 1Q43A 3AP9A 3GZEA 3H7YA 3ZR6A 4DPNA 3BOWA 2QZ3A 1BEV1 1UL9A 1UYZA 4AEMA 5BNPA 1AJOA 1W8OA 4P9IA 5KXDA 1VJ2A 3R4DB 4YRDA 1BEV2 5EQUA 4WM7A 2ARBA 3WCRA 1OA2A 2BU9A 1RL3A 2WZR2 4LE3A 3TOJA 3ZPYA 3Q8EA 1A6CA 1RUF2 4WM8A 4RR3B 4FTSA 2WQZC 4XZPA 1V6KA 3OGSA 2JICA 2JKXA 4NROA 4XJZA 3ABZA 5FZCA 4L97A 3VBSC 4K6BA 3RMYA 2Y6GA 4YGEA 1B35C 2FDGA 2QJVA 2R16A 5F2SA 1O6UA 1UKRA 3G6JB 1G9BA 4OQ8A 1RHI2 1WZXA 5FMOL 2ZJCA 1XB9A 2HWE2 4TLFA 4D6SA 1RUJ1 4XTPA 2GNBA 3D82A 4FOWA 1QIQA 1YRZA 2ZX2A 3DPRC 3WW4A 1XYOA 1G9FA 3GYDA 4W4ZA 5DXDA 5F9TA 1GMMA 2E7TA 4QB2A 4ZU5A 5GLVA 5JZGA 1Y9MA 2NPIA 3LA7A 2W68A 4PIXA 4LTAA 1EP0A 2BBAA 4LA3A 4NIIA 2ZMLA 4CDQC 2W91A 4NHMA 1AL21 2XOMA 1GWMA 3P3PA 1RB8G 1T2XA 3OF1A 1AL22 1PX3A 4CDWB 4S2FA 5FZDA 1QU0A 3K75B 3VKOA 4DS0A 5FO9B 4XTMA 2VMHA 1IPKA 1MR5A 1PNGA 2QVSB 1N1SA 4O7XA 2BOIA 2WDBA 4UYBA 4AEJA 4OI4A 1LHNA 4XCAA 1TMF1 1TME3 3T08A 4DQAA 1CAVA 2A6WA 3OGGA 5A6QA 1A3KA 2XVKA 1TMF2 3IBMA 1LR5A 2OQ7A 3NV1A 5A80A 1W6OB 2VH9A 2XGXA 2CAVA 1C3HA 2RDRA 4LNVA 2YPDA 3J9SA 5J36A 1YQ2A 1OPMA 2KD7A 2VZTA 5JZGB 2CY6A 3USUA 1ND2C 4ORFA 2GH8A 1C8NA 3AXDA 4FQ4A 3FE5A 1XSRA 1QWRA 1W8UA 3RQ0A 1LGNA 2EIEA 1O4ZA 2BYVE 2W39A 2UWBA 3T0AA 4EN9B 4GMP3 2ZGOA 4AWDA 4LKEA 3K4AA 3INAA 5F5IA 5LCWL 4GH4A 4XUNA 4MGYE 1J3PA 1UMIA 3KMHA 3IIAA 3CJXA 1R091 4AXOA 2X05A 5JR2A 4KG8A 3AZVA 2GALA 4HKOA 4IE4A 4Y5TA 5FMDA 1V00A 2WL1A 1W6MA 2YHJA 3ASIA 2D5HA 1FI2A 1H1AA 3QOPA 4N9IA 1QJFA 2UURA 4R4ZA 3SEEA 4AVBA 4C1WA 3VN4A 4N7UA 4Y20B 2CGOA 1NY72 3C8XA 3ES4A 2GNTA 4NPMA 5CFCA 1ALYA 5KWRA 3NSTA 1UZYA 4LBQD 5C7GA 5F5AA 1JYTA 4HLTA 4MHRA 4AQSA 5BUVA 5C6CA 3RZLA 1CN1A 1UYPA 4EZHA 4LQRA 3LPGA 2CAUA 3AYEA 3VV1A 4N43A 5JI9A 2PFWA 5CZKA 1MS3A 2GDFA 3HEIA 4KWJA 2RR11 2W87A 4IGPA 1DGWX 2WJSA 5FPZA 2DDUA 2ZGMA 1LOBA 3PIGA 4FPLA 4GH4B 5A7WA 4BHPA 2WBKA 5HCHA 5JDBA 1QJU3 4BCUA 1I6XA 1ASJ3 3OBAA 2XXZA 3MFAA 2D3PA 3H9AA 2ZMNA 2ET7A 3NV4A 2XJSA 4BWOA 3MPBA 2WQ4A 2F6BA 4Y3OA 5FZHA 5BV6A 2EIDA 4A45A 2E32A 1ODNA 1AYN3 1JOBA 1QJY3 1GKBA 2I07B 3LEGA 3UL2A 1UD1A 4OULA 4ZS2A 1CJDA 3ZR5A 5FBZA 4AR2A 4BQ2A 4XIOA 3UETA 1PZ8A 3DYMA 5I0DA 1UX7A 1DQ6A 1FPN3 2VMDA 4OUEA 5FZBA 2V5DA 2FDJA 2VTXJ 1JOPA 1W2NA 4DEQA 3AFGA 1PHMA 3N35A 4XEZA 4FSJA 1OQEA 3HQRA 3ZSMA 1RUD1 1J58A 5M0TA 1Z7S3 3GZTB 4OI2A 5KBFA 2BZDA 1J1TA 4XBLA 1O3SA 1RUD2 4J25A 5A7WB 1UOGA 2VGDA 2XR4A 3N9QA 3NW4A 1H8TA 2J1VA 3H8XA 2WN3A 1KS4A 2VTXA 3SXWA 2R071 5C5UA 5IK5A 2NYYA 1WW7A 4PT6A 2ZX3A 3UNPA 5HPOA 4EQVA 1SBFA 1V6LA 3A21A 3OD0A 3FMGA 4XURA 2XL7A 3AB0A 1TQ5A 1UAIA 4DZGA 5CADA 2J1TA 1Q8QA 3R6SA 3O1RA 3LGRA 1RUE2 3VKMA 5J3UA 5FYBA 3A0NA 3AM2A 4AEDC 5JXIA 4FFIA 4BQ5A 1LAJA 3S30A 1JI6A 1NQDA 3I2HA 3DL3A 3VBUB 3I3DA 4FPGA 3NWKA 1N1YA 5FYMA 5C9AC 3Q9OA 1VBE2 4UBGA 3VBSA 3WNPA 4Q26A 1NA1B 1OOPB 1R083 2GSYA 2BNNA 4Z2AA 1LOCA 2XVGA 4K3UA 4HZFA 2MPFA 4KQ7A 1F4AA 3BB6A 3HOBA 5JWPA 4QAWA 4PI2A 4XAEA 1UN1A 3O1PA 2OZ6A 1VBC2 1EV13 1L7QA 4LBNA 4YM2A 4IV3A 2G9GA 2ENRA 1QOTA 3CLPA 1C5HA 2ZGUA 5C8WA 2ETEA 1HV0A 4BM8A 3HQXA 4UWDA 2X5IC 1VMHA 3NNGA 2RM22 3O14A 1NCQA 2DCKA 2Z2SB 1GUIA 1XQNA 1QQP1 4K40A 1UO9A 3LDBA 3UGFA 2OA2A 3KQ4B 1WLDA 1MS5A 1ZBE1 5FYTA 3SHRA 3WP5A 5A1FA 1RUC3 2D44A 4L92A 4W50A 4CDQA 1ZBE2 2YC0A 4HK8A 1Y7BA 1QY4A 4DFSA 3LFMA 3OGVA 4QDQA 4M01A 5F3EA 1D7PM 3QH7A 1BVVA 2XHKA 4O9GA 3LCPA 2LRPA 2QTWB 4LOSA 4YW4A 1GQGA 5A7NA 2P3YA 4IQPA 2C4XA 1CQ9A 2YDEA 1D0HA 2B7YA 2NMOA 3OJBA 4OZOA 4GJYA 4I30A 2EXHA 2GP3A 4BQYA 5FP4A 2VBBA 3E5XA 1ZRFA 2DWRA 2KA3A 3AKQA 3EQEA 4FFHA 2UYBA 2WSUA 1Y9GA 3MGUA 1FMD3 1ULOA 4IEUA 4XDQA 5GLTA 4D6RA 2QDNA 4MGSA 3M3OA 3S6PA 1W3VA 3EHKA 5JPNB 3ZIWA 1OKQA 1ND2A 2FQPA 3FJSA 4ZONA 4FCAA 4EE2A 3NV2A 2WWUA 4K21A 2EXKA 2W52A 1SLLA 5I8YA 1J1LA 2D6PA 2GU9A 1LHOA 3VZJA 5FPUA 1H1MA 2YXSA 4E2GA 2WZ8A 1QKQA 1FOD1 1H9WA 1ULPA 2QQPA 1J3QA 3UKNA 3OEBA 4FP3A 4F8AA 5ANQA 2Y6FA 4IV1A 2XQRA 4JGZB 1W9FA 2ZHNA 1D4M1 2XLAA 5FO8B 2ZA9A 3AYDA 2BJSA 1C8M1 3MUY1 1JZ3A 1D4M2 4LJHA 2JDYA 3W5MA 3R05A 4OVEA 3H1MA 3OCPA 4PDWB 1NE6A 4D0QA 4FT8A 3LKJA 3VKLA 4BQ4A 1W28A 2VCMA 2AR6A 1PVC1 1OC1A 4R9CA 1AL0G 3WW1A 5CG8A 1S2EA 2ZX0A 3FUQA 4FAHA 1PVC2 3ZN6B 4R9BA 2Q1ZB 4PIZA 1RUI2 1U5YA 3U0ZA 2D3SA 1DQ4A 1ZZ6A 1BEV3 5FZMA 1ZRDA 2ZBJA 2VC9A 3IB3A 1CX4A 1IKQA 2WZR3 4FPYA 5D2AA 2ZAHA 3TRSB 3CHXA 4LBJA 5I93A 2EXIA 1RUF3 1YWKA 3WDWA 3ZPOA 4AGRA 4LHKA 3O1SA 5A7SA 3WP3A 5BNOC 3B7MA 1BVP1 2WA3A 3GHNA 3PUIA 4IV1B 3I3MA 5CG9A 4RGAA 2YROA 2ZGNA 3J4UH 4IL7A 2PHFA 3D5OA 3T4HB 2TUNA 2VTFA 4QDRA 3ILRA 3NJYA 3VLBB 1RHI3 4F3JA 4AYUA 1I5ZA 2GP5A 2GZWA 5EYXA 1YQCA 2IC1A 2ES3A 1YYNA 3NNLA 3Q8AA 4AI2A 4QPIC 4AI9A 4HMZA 2DCZA 2HWE3 2WO3A 2PTMA 2XH6A 4URAA 5C3RA 2Q4SA 5A3LA 5JSRA 1GZ9A 1W2OA 4GQ7A 4AK3A 4QX3A 3MFCA 3OYWA 2W46A 5A6YA 1HXS2 2AEYA 1AF9A 2JG9C 3U37A 1G7YA 3AZWA 2JE9A 3LIGA 3M2MA 1TG7A 3T4VA 2PQQA 2VULA 5ACA1 3N9LA 1GANA 1KRIA 4YW3A 5K0UB 5ACA2 4YZ1A 4X8NA 3DXUA 2W3JA 3ZFEA 1POV3 4E27A 2IFRA 2CV6A 5BNNB 1RJ7A 2JX9A 2VZOA 1APNA 4XAAA 3UJQA 2DV9A 4CCJA 3I2DA 5KXEA 4ZKTB 1AL23 3VHPA 1UXZA 1QH6A 2OS2A 3MIEA 3U4SA 2R1BA 3OBZA 4QHOA 1DYKA 1GR3A 1SDWA 1WCSA 1SLIA 4Q8LA 1YI9A 2HBUA 5A33A
chains in the Genus database with same CATH topology
4NO4A 2IXJA 4ONUA 2VQAA 4QPYA 4AFBA 1RMU1 4ATFA 1TMF3 2DVGA 4YVSC 4LT5A 1DZTA 1RMU2 4JVAA 4XYXA 1S0DA 1ZA4A 1QHDA 5C9AA 2BW8A 2ZZJA 1QOOA 2R30A 4H7LA 1CAWA 4BIOA 3ATGA 2W0XA 3VBHC 4NOTA 1KS5A 3ZFEB 1W6NA 1AJKA 4P9YA 3AKPA 4IEOA 2DVAA 1DQ0A 4YLZA 1MEC1 1RUH1 3VBFB 1MEC2 4S2DA 3EXUA 1R093 2VW0A 1AR61 1RUH2 2X5IA 4EJRA 1DZRA 2FZ1A 1G9CA 5A33B 3J26N 1SFNA 4YGDA 5DG2A 3WHTA 5HI0A 1AR62 1V6NA 3B3QE 1PO11 4XJAA 3VZNA 4AE2A 4P9XA 5JLVA 5AFEA 3ETQA 3M7AA 2IXHA 3MLJA 1ZZ7A 4K7JA 2VNOA 3HMYA 2BTVC 4B4PA 1AR81 1BBT1 1WLCA 1YXWA 4Y22A 3VHRA 4MV2A 3JD71 4HPKA 3APBA 3JBG1 1PIV2 2RR13 4LR4A 4AF9A 2WNUC 1XU2A 1H4HA 3VBRB 3ENRA 2WZPP 2VVEA 1QDOA 1UMZA 1Y3TA 2OZJA 2PN5A 2Z42A 5FQ0B 4XF1A 3MEPA 4AVCA 1BKZA 4FPJA 2EALA 1F31A 3S7IA 4CRQA 1PMIA 1YI7A 1XRUA 1JH5A 2X8KA 2VOWA 3WG4A 2BNOA 2VW1A 3DUIA 1W2UA 1ND3A 2CWSA 1M4WA 2RS51 3QBQA 1RJ8A 4FOVA 4Y22B 3V0AA 4HVQA 1DG6A 3QH6A 1RUD3 4IETA 1DFQA 2BVVA 1KITA 4XXAA 4Q4W1 1PK6B 1KQRA 2HWB1 4A7KA 2V5YA 1SFYA 1N47A 1QXRA 4J1XA 5DZFA 3POSA 3BALA 1RUE3 1BXHA 1SCSA 3OY8A 4QQOA 3WQ7A 3BTAA 2I2SA 4JAAA 4QGMA 5CNAA 2DCJA 2PELA 4B4QA 4FPEA 4IEZA 4N53B 1VBE3 1WD4A 4DINB 3KCCA 3M70A 4XQWA 4N9HA 4WZCA 4L9BA 3V0AB 1GICA 3H7JA 1KDKA 4AI0A 3VZOA 1VBC3 2K9ZA 4EWAA 1PGW1 3HN1A 1LEDA 3P3NA 2C5DA 1C4RA 1R1ZA 1VAVA 1XXNA 4HANA 4NR1A 2C0ZA 4OHVA 3KLSA 3TWIA 2GN7A 2RM23 1HX6A 3MIGA 3WNXA 3AP5A 3N4MA 2JDZA 4C90A 1NOVA 2VW2A 2YGLA 3JZVA 2ATFA 2A73B 4QD2A 2WKKA 1ZBE3 1QMJA 4AQTA 2DUPA 4QQHA 4AEKA 3L9JT 2LTNA 3L2YA 5ABJB 1SLAA 2WC2A 3FFZA 3W58A 2A5ZA 3RSJA 4DB5A 4JGYC 3M4FA 1BCXA 5C8CB 3QCWA 1VRH2 4YVSA 4D69A 4KWLA 1EV12 3KGLA 3X29B 4ASLA 1GZWA 1QNYA 3WCSA 1DGRA 1HV1A 1V9U1 1JOJA 2XKOA 4A2UA 1H2KA 5HCBA 3OPZA 3VBHA 2A70A 1S0IA 4NHLA 3ZYJB 1NCRA 1HKDA 3ZXKA 2IWGB 4Y1XA 2QUOA 1FOD3 1RUC2 2A3XA 2ZTNA 3FFQA 3SITA 2GMPA 1WGPA 4QT6A 3NL1A 2PA7A 4LO4B 1ZX5A 4COWA 3HT2A 1D4M3 2Y0IA 2YZ4A 1W6QB 1C8M3 2DCTA 4LO5B 3TN91 2X29A 3CJIA 1V6MA 5L7OC 4YYOA 1O91A 3ZFFA 1AX1A 5A3MA 1YJKA 2P34A 1IS5A 5CFDA 1PVC3 4X6QB 3WR0A 1DIWA 1NXD1 4R52A 4CEWC 2ZHMA 1OI6A 4XHBA 3DV8A 1NCRB 3PHMA 4RGGA 3UV9A 3O0XA 2EXJA 5FLJA 2P3IA 2DVDA 3O0VA 3MW2A 2LALA 1POV0 3B9IA 4BLIA 5AFBA 2Q0AA 2R041 2WNUA 2Q1MA 2R042 3AKSA 4C1XA 2FBEA 1W6PB 2A71A 4AHXA 2WFF1 1O3QA 3I59B 1S0FA 3CJIB 4UW6A 1G8WA 3ZFGC 1LB2A 1OLQA 1MZFA 1S2KA 4HN0A 1VP6A 2BBVA 1SLTA 4XQ4A 5CFDB 1HXS3 3DN7A 4O9EA 2JJ6A 3BODA 4GALA 5EV7A 1LGCA 4FP2A 4PQ9A 2RS11 2DF7A 1LENA 5ACA3 3NAPB 3AYCA 4XXPA 1NA1C 4XFFA 4M3CF 5T5LA 1SACA 1K5MA 3V0BA 1WLTA 3VZLA 3ILNA 4OHWA 3FZ3A 3IM0A 1AR71 3BIWE 2PHLA 4NWVA 3V65A 4BOWA 4E4DX 4OFGA 4Q4Y1 3SMHA 3LSEA 2LM3A 1RMU3 4YVWC 1O5UA 3MICA 3J8F1 5IUQA 3JB4C 3J8F2 3RYPA 4CDXB 2XUMA 3OBRA 1RUJ2 2B42B 4INDA 2E7QA 2P3JA 1AXZA 4FO9A 5BNPB 1ENXA 3ZXLA 3AFKA 4WM7B 4JDNA 1K5MB 1ULFA 4COYA 4YGBA 4XFGA 2KM2A 2CTVA 4WM8B 1MEC3 4AGGA 1G9DA 1RUH3 2OPKA 2R0HA 2VECA 5KHIA 1AR63 4BMEA 2YV8A 2AH2A 3A0KA 4Q0SA 1O3TA 1XE7A 3LAGA 2A6YA 4IEWA 4YZ2A 4BA6A 2H6BA 4R8HA 1ZRRA 1AR83 5EWSA 4QM9A 4XPVA 1LHUA 3AP6A 2ZOEB 1ULEA 2IXCA 2AGSA 1PIV3 2WT2A 3JD73 4KU7A 3JBG3 3BPZA 1FNZA 1V70A 1CVNA 2WLPA 3D8CA 3WDXA 3E6BA 1KJLA 3T2TA 2HWF1 3GZUC 1R092 1LESA 2E7AA 1S0BA 4XOGA 5BYNA 3KCYA 2NN8A 4I01A 1CAVB 2BWCA 5E1RA 5KC5A 1X7NA 1COV1 4B7KA 2FMYA 1ZM1A 2O0OA 1H8VA 3U4XA 1OA4A 4QPGC 4U36A 1CGPA 3URFA 1JYCA 4E2QA 3RJ2X 5K8SA 4EN0A 2A6XA 4YFWA 3USUB 4FPOB 3ME2A 4AFAA 3WOGA 3FWEA 4GIQA 3H1WA 4LLFA 4Y24A 3VBOC 2NM1A 2A3YA 5CAZA 5K9YA 2GC3A 4I0AA 1GQHA 4I2OA 1VAKA 5L7OA 2RR12 1FNYA 5A32A 1AR91 5D8AA 5J7MA 3N3HA 2C9AA 2YGMA 5I8SA 4LBMA 1W6MB 2B9UA 3WDUA 2VNRA 4K9SA 4CEWA 1GNZA 3GBFA 1DU3D 3CEWA 4BLJA 5CFCB 1H4GA 4IXLA 5FTTC 4Y1UA 4M3CA 4YM1A 1DZQA 3KM5A 5HCAA 3HT1A 2WLQA 4MXWA 3N7KA 4MXVA 2B45X 4N43B 4RQPC 3FX3A 3FBYA 2QNKA 1GLHA 2VPVA 4QQPA 1YLLA 4K1ZA 3VDDA 1RUG1 4XBNA 3WUDA 2D43A 4UW3A 2R061 2Y38A 1RUG2 3THPA 5A32B 3IDBB 2A75A 1GBGA 3PLQA 4CEYC 2R072 4LBQA 5JOYA 3T1MA 4RHV1 1S0GA 3THTA 2QCSB 1DDLA 1BJQA 4XFBA 3AMMA 4EN8B 3B5LB 1TE1B 1TNFA 4XF3A 4YM0A 1QNWA 3GALA 4XF0A 1MS0A 3H0OA 4XHXA 3NKGA 4B8EA 1DGLA 1HRI1 3E5QA 4AQ2A 4HSJA 4QXKA 2ZZQA 5TSWA 4G9SB 1B35A 4QHBA 3VDDB 3U10A 3AMPA 1GZCA 1VRH3 3ZVXA 1YIFA 3G7DA 4LEJA 4YVWA 1H8TB 2JD4A 2GC2A 2VG9A 3OD4A 4XJUA 3CO2A 3DPRA 4FOYA 3VL9A 4Q27A 4LBQB 1V9U3 2XLFA 4F7ZA 4XFIA 4EV0A 1MACA 1LEMA 2E53A 1QQP2 2H0VA 1AHSA 1LOFC 4B29A 4Q4X1 1RGSA 1Y43B 1VAMA 3W59A 1KFXL 1VBB1 4Q4X2 2VOVA 1G9AA 2VOXA 2DVFA 3VBSB 1CIWA 1N1VA 2XVLA 4OHZA 1CD3G 3VBRC 1B35B 4LO6B 5FDBA 5I0RA 4CP1A 4OHXA 1X8MA 3ACLA 4P9GA 5KHKA 4IV3B 4AI3A 4COZA 4S2GA 1F5FA 1MQTC 3WHUA 3DPRB 4WVWA 3RI9A 1X82A 2HEVF 2ZGSA 4FXGB 3B00A 2DURA 5T52A 1NCQB 4SBVA 3LOIA 3D6EA 3WZ1A 4AVSA 1VBA1 3KT7A 4D7TA 1KXGA 4AG4A 4C0BA 2B8MA 4CDQB 2WNVC 1RVF1 2R043 5SV8A 1RIRA 1BZWA 3PVBB 1FOD2 4RFT0 3U11A 3ZYIB 2XLGA 4Z1VA 2E6VA 2R49A 2JG8C 1JBCA 2ZACA 4H55A 3IMNA 3HBZA 3KB5A 1OQDA 5AC91 1ONAA 3HR9A 1UZZA 1C8M2 3GHMA 4PF5A 4XW3A 4E4SA 3NVCA 2JE7A 4Q1PA 4META 1CAXA 2ZKNA 1CPMA 4FPHA 1ND2B 1BMV1 2RS13 3KT4A 1QGLA 2EAKA 1IZ3A 3ROUA 2B39A 3ECQA 5LK7B 1PGL1 2PLV1 3R0RA 2PLV2 5CBLA 4LULA 3T1LA 1XE8A 3MYXA 1SCRA 4Q4Y3 1WBLA 1X33A 3D0SA 4LA2A 1CAXB 5FMOS 3J8F3 4RS5C 4D7YA 1RUJ3 1I1EA 2RS31 1NG0A 4M0NA 4CDUC 5KC6A 1S0CA 5HXVA 5KXBA 4ZU7A 2D6NA 2OW4A 4RQPA 1U5XA 4W65A 4BZ4A 2Y0OA 4GMP0 1C1FA 5FO7B 3RI8A 1GFF2 3ZMNA 3IPVA 2BFUL 3OGJA 1ZBA1 3OBTA 4CEYA 3LZZA 1OQ1A 2HWD1 1HRV1 3CNAA 2TNFA 3ILFA 1FT9A 4OHYA 4G3YC 4OZXA 1YHFA 4TSVA 4D3WA 4K8FA 4JDMA 2CYFA 3O7OA 2RHPA 4AEDA 1CAUA 2O1QA 2DFBA 3OYWB 1YUDA 5H9SA 3I8TA 2Q30A 4EN7B 4COVA 1VLNA 1D4VB 4YZ5A 2DFCA 2Q8OA 1MZ6A 4KL1A 5JOXA 1G6NA 5JR7B 4AHWA 2PAKA 3N7LA 2R0FA 3ZX7A 3CU7A 1CR7A 5GZEA 3WG3A 3JQXA 3IPVB 2D3RA 3MW4A 4S2HA 4Y1ZA 2ILMA 4W6XA 1WW6A 1LOGA 5FRAA 2DVBA 2HWF3 4DMIA 2P37A 1NE4A 2GC0A 4HK9A 3WV6A 1ZZCA 3K51A 1IPJA 3WG2A 5I8TA 4H3WA 5DUVA 4EWDA 1PO12 4AEDB 4I0WB 4RL7A 4WVMA 5C4WC 5JPMB 5C9AB 2NP0A 3ZN4A 4KU8A 2ZGTA 3H1YA 1CAWB 3SH3A 4PLNA 5JVVA 4Q0UA 1LRHA 1AR82 1BBT2 1W6NB 5GLUA 4YG6A 4FPFA 5FO9B 1V6JA 4JRLA 4NWWA 3B93A 1ULDA 5AVAA 1IHMA 1XYPA 3V56A 2RMU1 3H3UA 3JD72 4FPKA 3WW2A 2IFWA 4F83A 3JBG2 1UPSA 1MQTA 5FAXA 3HWJA 2CGNA 3O0WA 1H0BA 2X5IB 1AR93 1NXMA 3HD8B 2PHWA 3AP7A 3VL8A 2E9QA 3WP4A 3QD6A 2JENA 2PYTA 4WVMB 5B2GB 3NAPC 4GMP1 2OUHA 2ZMKA 4YGCA 1JW6A 2JG8A 4MGKE 2MEV1 2ZS6B 3VGIA 3ZYGA 5GLZA 1DGWA 1UKGA 2RS52 4RR3C 4NPRA 2MEV2 1HDKA 5FFOC 2Z69A 2GMMA 4HPKB 4AHYA 1RUG3 1DF0A 4EN6B 2ERFA 1SBEA 2R063 4XBQA 3ZN5A 1Z0HA 2JEMA 3WT3A 4HVRA 4Q4W2 2R073 4M0HA 2HWB2 5IK4A 4NVPA 1WA4A 2P2KA 3O5SA 1D0GA 4RHV3 4YARA 1RUOA 3TAYA 2IXIA 3SCFA 2OVUA 1YO8A 1O4YA 1EAH1 4XMIA 5J98B 5BNOA 1ND3B 1WCKA 1QJU1 4ZU4A 2BGCA 1HRI3 3JQWA 2VUJA 3PJYA 4FBFA 1RUNA 3JCIA 4CDWC 2EAAA 4YZ4A 4P9WA 4HT1T 2D7FA 4Q1RA 4QPIA 1PGW2 1QJY1 4SLIA 4RS5A 4LO7A 1W0PA 4HVOA 1LU2A 4HETA 4YW1A 2JG9A 1FPN1 5FCCA 5GM0A 3MF6A 5BY5A 2XJUA 4HSLA 2ARXA 3OY8B 1QQP3 5JZGC 1IOAA 3RWNA 4RSUA 2NZ9A 1Z7S1 2GMEA 4AFCA 5DUUA 4Q4X3 4LBOA 3ZXFA 3MDPA 5BNOB 1VBB3 2XWJB 3RDIA 3O12A 4XF4A 5BXXA 1HW5A 3WD5A 3M1HA 2NMNA 1VBD1 3WXPA 2VY0A 4MLOA 3PNAA 5H9PA 4I09A 4QPIB 4MUVA 3RRDA 3B94A 1VBD2 4PCRA 4Q2FA 4N90A 3ALQA 3QACA 4Y4YA 1LOAA 4Z2WA 4JRAA 2JG9B 3WVJA 2XPJA 5IK8A 1S55A 1KFUL 2XJRA 4FXKB 1V9U2 3USSA 3B9CA 1NZCA 4KGGA 5F5QA 2BQPA 2R32A 2ZHKA 1VBA3 5E16A 1HQLA 1RVF3 1AVBA 1FYUA 1YFUA 3PVOA 4XFCA 1LCLA 4GH4C 3VHOA 2XWBB 1BQPA 1WMFA 2YY1A 4GWNA 2AUYA 3KZ4C 5BNQA 2DU0A 1RTVA 5CU1A 4YVSB 3KD4A 1HIXA 3TN92 4TYSA 1IS3A 1DBNA 4BPZA 1GZWB 5CFCC 5C4WA 1M06G 4QGNA 2D98A 2EIGA 2XJVA 1Q3EA 1JXNA 5JMCA 1AZDA 4NN0A 3VBHB 3KCXA 4E2SA 1UU6A 1S0EA 3WQ1A 3N36A 3K48A 3E6DA 3MLLA 3VUOA 4XJWA 3CL1A 3KQRA 3M3EA 2A3WA 2MNGA 3JU9A 4Q29A 4BH9A 1EYBA 2P17A 4I0BA 3I4IA 1ZREA 1FMD1 2B46X 4B7EA 2PLV3 3GBWA 4YFZA 5DG1A 2WFF2 1ENRA 1QJX1 2BEOA 1ENSA 1QJX2 3AZYA 3ZFFB 3ZXJA 1C5IA 4GKXA 2D97A 5T5OA 4YNIA 4MSVA 5HCFA 4MGZE 3VBUC 4RR3A 4XE9A 2R6QA 2JKBA 3WUCA 1D2QA 2RS12 4Z8BA 1OOPC 2UYAA 2WS91 5C33A 2WNUB 1L3JA 5GALA 2WS92 2YPJA 4DNYA 3VHNA 1ZBA3 1SQ4A 4YG0A 4QGLA 4XF9A 1AR72 2E51A 2GNMA 1HRV3 2WA4A 2QZ2A 3IDCB 1C1LA 5CVRA 1O7FA 1SMVA 4AVTA 2CGPA 2D6MA 4DXZA 1X8EA 4Q4Y2 1QJZA 4E9KA 3MIHA 2WZR1 4Q4V1 1VB2A 4PJYA 4KG0A 1RUF1 3WLUA 4QX5A 1UU4A 1B09A 4FOQA 1O5LA 4HL0A 4IEQA 4Q4V2 3BOPA 2HWC1 5DZEA 2N7GA 4CDWA 2HWC2 3I54A 2Y26A 1PVXA 1RHI1 2EVXA 4YW5A 3V0BB 4FAGA 3KS7A 2YUEA 4HKLA 1QF3A 2HWE1 2IXLA 2I45A 4MGIE 2HYKA 4IV3C 1FATA 1WMDA 3TBDA 1ULGA 2QKDA 1W6OA 2AENA 5DDJ1 5T50A 4CP0A 1WLWA 1PO13 5DDJ2 3FLTA 4IESA 1NCQC 3ZXEA 5E88A 4XFHA 5J09A 3FLPA 5HBAA 2IXKA 3ZYPA 1POV1 1LULA 2QE3A 4GWMA 4A7ZA 4QU2A 1FAYA 3MF9A 2FHRA 1PZ9A 1BBT3 5L19A 4JGYA 4H7MA 1LJ7A 4WV8A 4JGZC 3PJQA 1H2LA 3PVNA 5BPXA 3MIBA 5EJ3A 2RMU3 1F9KA 1CONA 4K20A 4Y20A 3AZZA 2KXLA 4PDWC 4BYYA 4A3XA 5JSOA 4L2NA 4MH0E 1UCXA 2ZKLA 3RJRA 3VKNA 2HWF2 1DHKB 2BWAA 2VMIA 3FUOA 3NKTA 4W6YA 1NLRA 5T55A 1DYPA 1COV2 3AXEA 4R9DA 4X6RB 2A7AA 4EROA 3WG1A 4L11A 5KHJA 2P3KA 3BU7A 3M3QA 2DCYA 1YJLA 2RS53 2CL2A 4MVTA 2MEV3 4JGYB 2D40A 4HFSA 4FPCA 5JOWA 4IV1C 2XJPA 4UBHA 3C3VA 3RG0A 1SEFA 1NY71 1UX6A 1IS6A 4ASMB 4ISRA 3LA2A 4Q4W3 3ZXDA 2HWB3 2BUKA 2DU1A 1CPNA 1FXZA 2Z5WA 1LKNA 1AR92 3QLQA 2AREA 3VKFC 4Q8KA 3WINE 3LSDA 1N3OA 2SLIA 1Q8PA 1NYWA 2XBO1 4WZFA 1OPOA 4RA0A 5CB7A 5KHGA 5K0UC 2XBO2 1REDA 1W39A 1F5JA 2UY8A 1EAH3 3WX5A 4DRVA 2ZX4A 3TYJA 5BNNC 1OLRA 5CA6A 5LEJA 4DY3A 2OUJA 1GNHA 1N3PA 2DTYA 2Q5TA 2VU9A 3ELNA 4AVAA 5J96B 1TNRA 2H6CA 2E63A 3RYKA 1RITA 4L99A 3ZFGA 1AYM1 1WCDJ 2SBAA 5K7PA 2YMZA 3AK0A 4OUMA 1JN2P 5JCTA 1AYM2 5L7OB 3V64A 3D4KA 3IWZA 4XQDA 1UIJA 2R062 5D8AB 2LUWA 3ZMOA 1KD7A 4CEWB 5DZGA 5SV5A 3S7EA 1JUHA 1FV3A 3C2UA 3VBUA 2DUOA 4BMBA 2GNDA 3AJZA 3FC0A 4RHV2 1DQ5A 1YNAA 4R9AA 1NA1A 1OOPA 3ZDSA 5H9QA 1LOEA 4M3CB 3RPQA 3MI8A 5FOJB 3SH5A 1REFA 3ZFEC 1MZEA 1S2BA 4MXWB 3E5UA 3KSCA 1XNDA 3N7JA 4OLLA 3H8UA 3H3ZA 4PLOA 3VBFC 1HRI2 4AI8A 3ZFGB 3DF0A 1VBD3 4Y1YA 4E4ZA 3OTFA 4AGVA 4UXAA 1RUE1 1LGBA 4BE3A 4I3PA 4JTNA 4V1PA 2AZ5A 4OUSA 1XNBA 1XYNA 2D6LX 2FMDA 2VQ0A 3RMXA 5EXOA 1VBE1 5CIRA 4M00A 1O4TA 1G86A 2HJIA 1N1TA 2I74A 4KBBA 4XETA 5GLWA 1DLLA 1YFYA 1VBC1 3IKWA 4ATEA 2H0BA