5E16A

Co-crystal structure of the n-termial cgmp binding domain of plasmodium falciparum pkg with cgmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
SNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCSTLNDNEILTLSNYMQFFVFKSGNLVIKQGEKGSYFFIINSGKFDVYVNDKKVKTMGKGSSFGEAALIHNTQRSATIIAETDGTLWGVQRSTFRATLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CGMP-dependent protein kinase
publication title Co-crystal structure of the N-termial cGMP binding domain of Plasmodium falciparum PKG with cGMP
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5e16A00
3DN7A 3MPBA 3SCFA 5I8YA 5K8SA 2Q30A 1YFWA 4XFGA 3H1WA 5BV6A 3N4MA 1ZRRA 5JSOA 1J3PA 4XFHA 4AVAA 3WW4A 2UY8A 1I6XA 3WW3A 1Y9QA 4BYYA 2BYVE 4E2GA 4I3PA 4QGNA 2QCSB 4I0BA 2FMYA 5C8WA 3UKNA 4A2UA 2UYBA 3UKTA 3NKTA 4TLFA 3HQXA 2B8MA 3NW4A 4IEZA 4NVPA 3H1YA 4BH9A 3S7IA 3BU7A 4R52A 4KU8A 1J3RA 1ZZCA 3IWZA 4D7TA 1JUHA 4UBGA 4IEQA 3TNPB 1XE7A 3I59A 2OYZA 1NE4A 2F4PA 1ZRCA 4QM9A 1OI6A 4EWDA 5KHJA 1CGPA 5I91A 1RC6A 1IPJA 4YSFA 1UCXA 4EROA 1CAVB 5EFUA 4XFFA 1ZRFA 5BPXA 1LKNA 1CAWB 1CAUA 5FLHA 1QY4A 1U12A 3KSCA 4AQ2A 2HKXA 2QJVA 3KGLA 3C3VA 3CL1A 5LEKA 2QNKA 4UBHA 2O8QA 4XF0A 2K0GA 4XF4A 3DV8A 4IEYA 4AVBA 2BNNA 4ZU4A 1DZTA 1VJ2A 4XFBA 2GC1A 3S7EA 3H50A 3FZ3A 3GBFA 1WGPA 1Y3TA 4E2SA 4F7ZA 4LTAA 3RPQA 3D82A 4HVQA 1SEFA 5KHHA 3EQEA 2GC0A 5FQ0B 4J1XA 1YFYA 4MV2A 4ZU7A 4HN0A 1NZCA 2OPKA 3H3UA 2DCTA 4ONUA 1RUNA 4MGZE 3MDPA 4OFGA 4ZU5A 1ZZ9A 3NL1A 5I0SA 2OA2A 3FE5A 4KU7A 3FJSA 3KGZA 5J48A 3WW2A 1DZRA 3SCGA 2D5HA 1HW5A 4AQ6A 4XFAA 3D0SA 4HN1A 4KWJA 3S0MA 5KBFA 4HSLA 1CAXA 5CVRA 3SHRA 4IEWA 5I8SA 4Q0QA 1RGSA 1EYBA 4MGYE 3WW1A 3EBRA 5I93A 3E6CC 1QWRA 4D7SA 2N7GA 4LA2A 2PHDA 4QXKA 1UW8A 1VP6A 4XF3A 5J7MA 3MZHA 3LZZA 3OTFA 3EHKA 2GC2A 4DINB 1UD1A 4HLTA 4EWEA 3I7DA 4JV4A 1Q43A 4E2QA 4HMZA 5I0RA 1OFNA 2HJIA 4J1WA 2IXCA 4IERA 4LA3A 3BCWA 4IEUA 3E6DA 4XFCA 4PIXA 1FI2A 1LB2A 1ZZBA 1EP0A 2UY9A 1RL3A 2GH2A 4N9HA 1QXJA 5LRSA 1CAUB 5CADA 2VQAA 2GAUA 2IXHA 3HT2A 1PMIA 2QVSB 3H3ZA 4HZFA 3DKWA 3LA3A 2ATFA 2MPFA 3EO6A 2QDRA 2PAEA 2PAMA 4EWAA 1J59A 3LA2A 1YFUA 1XRUA 1O3TA 2PQQA 4FT8A 5FLIA 4GULA 4LUMA 5BUVA 2B9UA 3H7YA 1DGWA 4FAGA 5JR7B 4FBFA 2PHLA 2Q1ZB 3IDCB 2Q4SA 4KL1A 5KHKA 2IXLA 2OZ6A 4HVOA 2CAVA 5JSRA 1ZREA 4KWKA 4FAHA 4LUKA 2PTMA 1GQGA 1X8MA 5D1IA 3KMHA 4XETA 2WFPA 1GQHA 2PA7A 1ZZ8A 5FPZA 2WC2A 2XLGA 3E5UA 3E5XA 4O9EA 5C6CA 2C0ZA 5I0TA 3ETQA 3RYPA 3IIAA 4Q0PA 5T3NA 3ROUA 2ET7A 3M3IA 3M70A 2ET1A 4N9IA 4Z82A 1X7NA 3KCCA 4Q0VA 1ZX5A 1J3QA 1IPKA 2XLFA 2BNOA 1UIJA 1RUOA 4X6RB 1TQ5A 1YLLA 3MYXA 4I09A 4QMAA 1X82A 5KHGA 4MZUA 3JZVA 3RDIA 3BB6A 2KXLA 3IBMA 4IEOA 2VPVA 2V09A 5KHIA 3RYRA 1CAVA 2H6CA 4QX5A 4ORFA 3IDBB 4MH0E 2GC3A 1Q3EA 1ZVFA 4LULA 1CAWA 1J1LA 4Z07A 4P9GA 4BHPA 4YYOA 5J3UA 2CV6A 2BNMA 3I54A 3LWCA 2FQPA 2Z2SB 1L3JA 2Y0OA 4EV0A 3LAGA 4IEVA 2ETEA 1SQ4A 4I0AA 3ES4A 1NE6A 1O5UA 3SMHA 1FXZA 1PM7A 2I45A 4XF9A 3H1MA 5E16A 4MGIE 5HI0A 3CLPA 3GYDA 1ZZ6A 3H9AA 2D93A 5EZWA 4IEXA 1I5ZA 4META 5BXXA 1LR5A 4H7LA 3H8UA 3CF6E 4HBNA 5E1RA 3I59B 2PAKA 3NSTA 2OZJA 3E5QA 2BEOA 3ACLA 5FQ0A 1LRHA 4IEPA 3RYKA 2B5HA 4I2OA 2GZWA 2PFWA 4RD7A 3TNQA 4UXAA 1UIKA 3FHIB 4WZCA 3FWEA 1UPIA 2EVXA 5BY5A 3D0JA 3HIFA 3EJKA 3PVBB 4HVRA 3QOPA 2O1QA 3BPZA 3SCHA 1H1IA 4LLOA 4F8AA 2XL7A 3PNAA 4X6QB 3ZDSA 3CJXA 3ST7A 3ELNA 2E9QA 4KWLA 1J58A 2ZCWA 2EA7A 3B02A 2CAUA 1H1MA 2ZKLA 2BGCA 1NYWA 3OF1A 3R6SA 3U11A 3U0ZA 3RZZA 2K9ZA 4R8HA 2D40A 1CX4A 2PYTA 3L2HA 5I8TA 4JVAA 2XL9A 2EAAA 2H6BA 4WBBA 4YARA 1OMIA 1OD5A 2P17A 5FPXA 1YWKA 2IC1A 4MUVA 3OD0A 4OLLA 1EY2A 4CYDA 3U10A 4Q0UA 3HT1A 1VR3A 3ES1A 3UKVA 3CEWA 1O4TA 2Q0AA 5JAXA 3CO2A 5F1RA 3LOIA 4HSJA 4XFIA 4I01A 3USSA 1YHFA 4PIZA 1ZZ7A 4XF1A 3VHRA 3RNSA 2Z69A 5AVPA 2XGXA 1CAXB 2GU9A 2XLAA 4WVZA 4O9GA 3DL3A 2IXKA 4AVCA 5FDBA 3NVCA 1NXMA 3E97A 5LRRA 4B29A 4QGMA 1DGRA 1ZRDA 1G6NA 5I0UA 3G7DA 1FT9A 3OCPA 1O3SA 1O3QA 2CGPA 1EPZA 3E6BA 5FCCA 1ZNPA 3O14A 1SFNA 2XHKA 3NJZA 4LEJA 4PJYA 3PLQA 4Q0SA 4Q29A 4XEZA 1XE8A 3BALA 4L2NA 1X8EA 2IXJA 2XKOA 1O3RA 5FLJA 3LA7A 4K8FA 3OGJA 2UYAA 4PIYA 4L11A 3FFQA 1YFXA 5JSPA 1WA4A 2XKPA 4YRDA 4MX3A 3QACA 2IXIA 5LEJA 4QM8A 3FX3A 3H7JA 4QGLA 1QXRA 4IESA 4YNIA 4IETA 1WLTA 1YUDA 5JCTA 1Q5OA 1V70A 2H0VA 5CU1A 4BIFA 1O7FA 4I02A 2MNGA 1O5LA 2VECA 4MGKE 2MHFA 4AXOA 1RTVA 4JTNA 4JTOA 3SXWA 2D5FA
chains in the Genus database with same CATH superfamily
2LUWA 4OHXA 4JX0A 1PVC1 1LHOA 4RQPB 2ZEZA 1BXHA 5I8YA 2VMCA 4XFGA 4LHLA 2VUDA 3T08A 2PN5A 4R4ZA 3N4MA 4ZZ8A 4CE8A 4P9LA 4JKKA 1C5IA 2ARCA 3BTZA 2DBNA 2ZX0A 2W87A 2AYHA 4FFGA 1S0GA 3N7JA 3TOJA 4RS5C 2X10A 2Y0IA 4QHBA 5C9AC 3S57A 3U1XA 1NCRB 1Y9QA 3M2MA 4BYYA 3ZXAC 3IMMA 3ZMNA 5CG8A 3OPTA 3NMBA 4QGNA 3MUZ1 3K75B 3WF0A 2Q8DA 4EN7B 1C1LA 3OEBA 3OPWA 4Q4X3 2WZ8A 4FOQA 4NN0A 1H8TC 2BRTA 4C8DA 1R091 4DY3A 1QJFA 1SLIA 3NW4A 4BM8A 5IT6A 3ME2A 2FMDA 5D2AA 2WABA 4ZKTB 5IFTA 1OBNA 2VTXJ 2VOWA 4KU8A 2RJLA 1W0OA 4N90A 3SKVA 3CU7A 1A8MA 1UYPA 1JUHA 2JECA 1K42A 1LAJA 1X9TA 4IEQA 3LE0A 2OYZA 1Z78A 2R16A 4Z92B 4QM9A 2ZGLA 4YG6A 3I2DA 1LOGA 1RC6A 3DGTA 2PHWA 1V6OA 5FYBA 4BQ5A 1UCXA 5EYYA 1RYYA 2VMDA 1XJAA 1GUIA 5BNNA 1UMZA 4H55A 4IV3C 2WAAA 4UFJA 2DVDA 1LGNA 4Y1UA 5FZ6A 1QY4A 2XJVA 2ZBJA 1V00A 3KGLA 3WEZA 1AR81 4AHYA 2XBO2 5CISA 3LGRA 5C3RA 5FPLA 4XAAA 1HXS1 4XJUA 2HLEA 3LDKA 2AUYA 4IEYA 2XUEA 4FP2A 3AKQA 4AI2A 4URTA 1DZTA 1TMF3 1VJ2A 4B1MA 1OHFA 5A3PA 3S7EA 3N7KA 1F15A 1JU3A 1NCQC 3MV11 1Y3TA 3WCSA 2E7TA 5FYVA 4F7ZA 1KITA 2GP3A 5LEKA 1VBE3 2QZ2A 1BHGA 4FPYA 1OA2A 3D82A 4LTAA 2GMMA 2J1UA 2DCZA 4QPGC 3I3MA 4LT5A 4N43A 5JZGB 3IKWA 5A80A 2V5YA 4AE2A 1QH7A 1A34A 5FBJA 4D6RA 3WF2A 3NRUA 5FZOA 1HV0A 2DCTA 1UY3A 3PJQA 4N7IA 1ZA7A 4DPNA 1RUNA 2D44A 2E7QA 2VNVA 1ZZ9A 4UW5A 1FPN2 2OA2A 5FZFA 1GR3A 1VRBA 2QQMA 3WDYA 4CU9A 1YQCA 1D7PM 3PU3A 3GDBA 2B9VA 3NAPA 2X05A 4N53C 4TYSA 1DZRA 3SCGA 3WW2A 1RUC2 3WG4A 3WT3A 5K9YA 2FBEA 1SBFA 3VD7A 4XFAA 4AQ6A 2RJ2A 1W04A 3D0SA 1OLMA 3AP9A 5FY9A 5M0TA 4AEDC 3S0MA 1B35A 1W05A 2ZAAA 3D6EA 3HOBA 4LMFA 3ZYBA 3VBSA 5T50A 1AR62 3VKMA 3JXSA 4IEWA 2JG8C 4MHRA 1JS9A 4CEYC 3WW1A 4WVWA 4RGGA 1JBCA 3WNXA 5I93A 1QF3A 2B45X 5FXVA 2JDMA 3IT8A 1YQ6A 3MO4A 5FYHA 4YVWB 2RDRA 2N7GA 4QXKA 2PHDA 1OQ1A 4XJAA 1NY71 3JB8A 4YWAA 2D6MA 2RR11 5FPVA 4XF3A 4SLIA 3POGA 1Q56A 2HWB2 3LZZA 3MZHA 3BGAA 3OSDA 1OLRA 1WCUA 2IWGB 4COWA 5A3TA 5C9AA 3MLLA 4BA6A 2ZMLA 1ZRIA 4LBLA 4QQPA 1KJRA 1PX4A 4DXTA 1MPXA 4GKYA 4HLTA 3ACFA 4Y4RA 1IQAA 1V0AA 2FDHA 3GBGA 3T2TA 4AVVA 3P3PA 1RUE1 4HMZA 2DUPA 1HQLA 4J1WA 4QX3A 1TEIA 4IERA 4LA3A 3BCWA 4IEUA 1H8TA 4QWNA 1N3PA 3PDQA 4R9AA 4XFCA 1C57A 1U0AA 1PO21 4OQ9A 1VB4A 1PGSA 3I3DA 2YYOA 3PU8A 4RHV3 3KB5A 4KG8A 2UY9A 3EMRA 4G9SB 4CDXB 5FMDA 4CP1A 1H8VA 4N9HA 1QXJA 5LRSA 5CADA 2VQAA 2GAUA 5LZ6A 4GB31 1C8M2 5CBLA 1PMIA 3H3ZA 2Q8CA 1DP0A 1N1SA 2XVGA 1POV1 2ATFA 2MPFA 4QX0A 4UF0B 1HRV2 1PGL1 4ZPIA 1Q8VA 3EO6A 2P37A 2QDRA 2VR4A 1XNDA 2PAEA 2QFEA 3ZR6A 5JIUA 1J59A 3LA2A 1W3VA 2VQTA 3AMMA 1JZ6A 4IV3A 4FT8A 2W1SA 5FZEA 3MBWA 4M4RA 2R043 1N1TA 1RXGA 4A7KA 3VDDB 4XUOA 2VUJA 3ZFFB 5CEHA 2WNVC 3H7YA 5FZ9A 4YW2A 4IE6A 1ASJ2 3MLKA 3POSA 4JQTA 4LXLA 1CWPA 4WVMB 2XB6C 1TNRA 2XHNA 4Z2AA 1MZ5A 3INAA 4RGAA 1N3OA 2GNMA 2DURA 2DDUA 4KL1A 1UXXX 4N43B 3X29B 4DOUA 3RZJA 1AR92 2IXLA 5FPBA 2JXAA 3CJIC 5A6QA 2C1FA 5F3GA 1H6YA 1ZBE2 4K1ZA 2QTWB 1ZREA 3GCWA 1PM4A 1UMIA 4LUKA 3POYA 2PTMA 4LE4A 3URFA 1VMHA 2JWPA 4B4RA 5CAZA 4CPBA 4M01A 1YCIA 3KMHA 4PHZA 2WSUA 4Q4Y3 1QJZA 4R9DA 3WF1A 1XYPA 4OHZA 4DO0A 1GQHA 1ONAA 4Q4X1 4DB5A 4ZXEA 3SNMA 5LBFA 1S4CA 5A6YA 3V56A 1D2QA 1C8NA 1DQ5A 2C0ZA 1CJDA 1MS5A 3ETQA 2BTVC 5K7PA 1QDOA 1RUC3 3IIAA 4Q0PA 1B35B 4BU2A 3WCRA 4COVA 1F9KA 1AL22 3PUAA 2EF6A 2ET7A 2HEVF 2JB4A 4NAOA 1TVGA 2YXSA 1UZ0A 2L9LA 3OB8A 3M3EA 4S2GA 2ET1A 1C5HA 4TN7A 3JQWA 1TG7A 4Z82A 2KD7A 5JOYA 3A0KA 3C2UA 3KLSA 4IE5A 1UQXA 5H9QA 1JYWA 3UV9A 1RUD3 2VBPA 4AWDA 1SBDA 1W8FA 3B00A 2CDOA 3TB0A 4RR3C 4B4PA 1COV1 2WZR2 5FZMA 1OF4A 1UAIA 1YQ2A 2P34A 1YQ5A 3DEMA 4RS5B 4YGDA 4C0BA 3MYXA 4J6GA 5F32A 5FYSA 1AJOA 1DQ2A 4AEDA 5C9AB 1EPWA 2EALA 3AYEA 5KHGA 3N9LA 3PHMA 2DVGA 1RUH1 3MW4A 2VPVA 2V09A 2G9GA 3ZVXA 4GWIA 4B7EA 4HKOA 5FUIA 1CAVA 2H6CA 4BB3A 4CEYA 5LCWL 5J36A 1GLHA 5FK7A 3AKSA 1OPOA 1ZVFA 1XNAA 1CAWA 3OYWA 4CUCA 4YFWA 4BHPA 4LHNA 5J3UA 1XNTA 4LBQB 2DVBA 1VAVA 2QQNA 3NJYA 2VL4A 2VO5A 3ZYHA 4AI8A 2BNMA 3LWCA 3THPA 4BWOA 4XQ4A 3KT4A 1WLDA 1L3JA 2Z4FA 4QKNA 4FFIA 2GNBA 4PDWB 2WT1A 1GZWB 1RUJ3 1NE6A 4MXWA 2R063 1S0DA 1ULCA 3MUY1 1TMF1 5A6ZA 1FXZA 1OOPC 1PM7A 4CCKA 3I97A 4JGZC 4XF9A 4GWMA 4IUGA 2YG0A 5E16A 3VHNA 5FP4A 3GYDA 5DUWA 5FO9B 2D6OX 5EJ1B 5CFDB 5FXZA 5CG9A 4IEXA 1I5ZA 4U36A 2YROA 1LR5A 4S2FA 3VBFC 3ITQA 1CQ9A 2QQUA 2XQXA 3N9NA 5FZDA 3K46A 3T4HB 2ARAA 2GDFA 2ZZQA 3I2KA 5E1RA 2BU9A 4CDWC 2P3IA 1KFUL 4ZY9A 1S2BA 1WWYA 4G3YC 3J8F2 1GSLA 1BVVA 1PMJX 4XYXA 2ILMA 2P3YA 2W47A 2BERA 1FOD2 1RUI3 2H0BA 1ULGA 2BEOA 2KA3A 4A7YA 1D4VB 5FZBA 2W3JA 2WN2A 4IEPA 3RYKA 3O1TA 3MIEA 2PFWA 2WBKA 2YDEA 2UWCA 1UPIA 1DIWA 1CJPA 1ASJ3 1V9U2 1X36A 5CNAA 3FHQA 1XYOA 2ZGOA 5GKAC 3U07A 3WQ0A 4HVRA 2LRPA 4O61A 4PT6A 2WZPP 2O1QA 1IS3A 3BPZA 1H4HA 4WM8C 3NV1A 2R073 4TSVA 2ZABA 5DAVA 4OI1A 4FPCA 1B09A 1UY1A 1JTZX 2J1VA 3PNAA 4CU8A 1O8PA 3KM5A 1REDA 1T2XA 3V65A 4AW7A 1OT5A 3OEAA 1S0IA 1NCQB 3AMQA 3M4FA 5A32B 3SEEA 2G1MA 1OKOA 5EWSA 2ZCWA 2EA7A 3DXUA 4GQ7A 4PI0A 4CSWA 1H1MA 2ZKLA 1RUG2 4QPGB 1HN0A 2EIGA 4OMCA 3ZSKA 2P3JA 5FZ1A 5LATA 3OF1A 4IW3A 3TEZA 2RMU2 4P5YA 3CJIA 4XIKA 1BCXA 3VL9A 4HKWA 1H6XA 1ST8A 4CXYA 1GV9A 4A6SA 1AYN2 2K9ZA 4XBQA 2YY1A 1AJKA 4XJ8A 4CPBD 5HXMA 1SDDB 2DU1A 5JUVA 2EXHA 2IZWA 1Y4WA 5JMOA 2BQPA 5FMOL 5C5UA 4WBBA 2XL9A 5FPXA 2A3YA 1H2KA 1QQP2 1O8SA 1STMA 4N53B 4BJ0A 2UWBA 1WW6A 3D8CA 2X53S 2ES3A 4JGYA 4XXAA 3AFGA 4UFMA 4FSJA 2CHHA 1HQNA 2E7AA 1C4RA 2SLIA 2VW0A 1VBB2 3J4UH 3CEWA 2JG8B 2Q0AA 3N36A 3USUA 5F1RA 4CEYB 5F7UA 3USSA 1NXD1 5ANQA 4GZ9A 1ZZ7A 4OHVA 5ISLA 1QEXA 1KD7A 1QMJA 3VZLA 1OQEA 1QNYA 4FXGB 1NZIA 4A44A 5JXIA 2F4LA 5FYYA 1A6CA 2PHUA 1AR73 2BGOA 5IVVA 4YZ2A 4WVZA 1GKBA 4O9GA 2CNAA 2IXKA 4UW3A 2YPJA 5FDBA 1US2A 2BGPA 1E5SA 2XBO1 4L8QA 3C7OA 3GCXA 3WDTA 3HWJA 2VVFA 3WUDA 2W39A 4QGMA 2VVEA 2Q1FA 1IKPA 1ZRDA 1G6NA 2ZOEB 3Q9OA 3ZX7A 4E8CA 3PUIA 4OHYA 4DIQA 4PQ9A 4BLIA 4UFIA 5JWPA 5LA0A 1O3QA 1DYOA 2BW8A 2CGPA 2JDNA 3FMGA 4ATFA 5CFCA 2WS92 2YBPA 4M3CE 2RDSA 1RVF3 4CZSA 5GZFA 2FHRA 1ZNPA 3O14A 4Q29A 3O1VA 1PVC3 4Q5OA 1H1AA 2JKBA 4WV8A 3PURA 4CUAA 4Y22B 3W5MA 4BDVB 1WW4A 2XG3A 3MW3A 2D43A 3CBNA 3I2FA 4XTPA 2TBVA 1UXZA 3J8F3 5A7WA 1DQ4A 1NA1C 4IV1C 1LHWA 4JGZA 3RZLA 1OVSA 5BNPA 3DPRA 2R0HA 2WLQA 2E63A 2CTVA 1SZBA 4Q27A 5FZIA 2HWE2 1WA4A 1WW7A 4YM2A 3WOGA 3CMGA 1D4M2 1ZA4A 5KXEA 4K1YA 5C3QA 2FDKA 5LEJA 3H7JA 1RUC1 2JDPA 1V6KA 2RG4A 4IESA 1HJFA 4MGQA 1H0BA 4CCCA 2WNVB 4FPKA 4XAEA 1Z7S2 1AR61 1Y43B 2JJ6A 4J25A 1W6OA 1GNZA 3D5OA 1Q5OA 3FBYA 4YVSC 4AF9A 4CDUC 5IVEA 2I07B 4E4HA 3RG0A 4JRAA 2X5IC 4QB6A 5CU1A 3JBG3 4BIFA 1LHNA 1MZFA 4CDQC 2CWSA 1O5LA 2VECA 1ND3A 1ZM1A 4MGKE 4JQRA 5ABJC 1JZ5A 2BUKA 3AVSA 3SXWA 4QX7A 3T09A 1MEC2 2XVLA 1KJLA 3WZ1A 2VQUA 2XPJA 1FYUA 1WD3A 4XW3A 5K8SA 2Q30A 4EJRA 2WO2A 5BV6A 1SPPA 2E6VA 3IMNA 3J7LA 4P14A 4B7KA 3AL6A 1ZRRA 4GAZA 1L7LA 4A45A 3VD3A 2QQVA 3WNPA 5JSOA 1MS0A 3LIGA 4XHXA 3ZSJA 1W9YA 2XJQA 3UESA 3WP3A 4DUVA 1AR83 1BJQA 1TME2 1WCDJ 3MIDA 2UY8A 1I6XA 1Y9GA 1N1VA 2WL1A 4K7JA 5F6LB 2JENA 1MS1A 3AP7A 4ZXKA 4AVSA 5JXHA 1VBB3 2QQPA 1OUSA 3U4XA 2YC0A 1HXS3 2YGMA 2WT2A 2D98A 3UGHA 2XUMA 3UJQA 4I0BA 2NM1A 2FMYA 1ULEA 3RS6A 2UYBA 4RR3B 3UKTA 3LB9A 5LA2A 3I3QA 4XJ9A 3S6PA 3KT7A 4IEZA 5AC92 1HRV1 5C8CA 4NVPA 3O1PA 2CYFA 3H1YA 4BH9A 5FKCA 3S7IA 4XOGA 4R52A 5T55A 4CEWB 1GWKA 3ZFEA 5EXOA 1ZZCA 4R9BA 1NT0A 1RUI1 1KXGA 1XE7A 5E88A 2F4PA 2GMPA 1ZRCA 1FV2A 5KHJA 3JB4C 3J7HA 4GMP1 4FTEA 5I91A 3NV2A 4DXZA 3IZOA 1VPHA 3NNLA 4YW7A 3RWKX 4YSFA 1ASJ1 3ATGA 4P9XA 5FV3A 4EROA 1W99A 2QUOA 5LK7B 4YW1A 3ZXKA 4DNYA 4PBOA 5T5JA 5JVVA 4NPRA 4M3CF 4DEQA 3A4UA 5DUVA 2DWRA 2YU2A 1OOPB 1ZBE1 3HMYA 4DMIA 2QJVA 2P3KA 2EXIA 3DF0A 1YEWA 3VN4A 4B8EA 4CTEA 3PMEA 4PI2A 2QNKA 5G04L 3VBFB 1S0BA 2ZKNA 4QQLA 3VBUA 3ZDVA 5A7QA 4ET7A 3AXDA 3VZKA 4XF0A 5F5CA 4EZ4A 2XQRA 4BXFA 5GLVA 2YPDA 2JE8A 4CDWB 2WQ8A 1UN1A 1UYYA 2EIDA 5FZ0A 3WQBA 3FN9A 4AVBA 4Q1RA 2VE1A 4BZ4A 4Q4W2 5IJRA 5K4LA 1O59A 2BNNA 4LBJA 4ZU4A 5L73A 2FD8A 1GBGA 1W8UA 2ZX2A 4LOSA 5DPNA 5A3UA 5FZ7A 4IV1A 1AL21 5JMCA 2XJSA 1R1A3 3ETPA 2RR13 1MS4A 2LW8A 3M3CA 4LNVA 1F35A 3H50A 3DKQA 4FXKB 2Y6HA 3CHXA 1JYVA 2VTFA 3FZ3A 2WWJA 3WG1A 3TN92 3WG2A 3NNMA 4M3CA 5HPOA 4OUSA 3V64A 5FPAA 1UMHA 5FKBA 2NP0A 4NIGA 4WM8B 3OGSA 3PVOA 5FP3A 5FQ0B 4MV2A 4PBPA 3OD4A 3N9OA 2VOTA 2OPKA 2WZR1 1PGW1 3H3UA 1AVBA 4Q8KA 3MDPA 4OFGA 4N7UA 4AR2A 3VD4A 1PO23 2EIEA 3A22A 5GZDA 4YVSA 1HB4A 4CDUA 2JE9A 3QLQA 1DQ1A 4EZHA 1HB3A 3VKOA 4LIVA 5J48A 5FYMA 5A33A 3AZVA 4CCEA 1F4AA 2B39A 3AP5A 5GLTA 5J09A 1I1EA 1HW5A 3KV5A 1O91A 5KBFA 1POV3 5FFOC 2YUEA 4HSLA 1PO12 1XB9A 2CGOA 2WIIB 2YFZA 4R9CA 1YI9A 1UL9A 1TME3 3HBZA 3NAPC 1RGSA 2OUJA 3HNMA 4GIQA 1EYBA 2ZGPA 4GJYA 3R4UA 1S0JA 3MFAA 3OUIA 1UYXA 2OUHA 2VZVA 3J7MA 2XDVA 3AX4A 3RFRA 4XZPA 4XUPA 5L19A 4LA2A 3GZEA 1E5RA 5FZCA 4MXVA 4AGGA 4COZA 1W3XA 3C8XA 2NLRA 2VMGA 4MADA 1Q8QA 2EAKA 1UZZA 2W95A 2WJSA 2ZMNA 2QQIA 1POQA 4XCBA 3VBSC 5LY1A 1LHVA 4OMDA 1CD3G 1LOAA 3EHKA 4HK8A 1NX9A 4QPYA 2W5FA 4XABA 5LA1A 2LM3A 2W2IA 3AJZA 5BNNC 2QZ3A 2AACA 4NE9A 1OA3A 3I7DA 4Z2WA 1J83A 3S5AA 2VAUA 3J8F1 4E2QA 1XE0A 3A0NA 1OPMA 2PLV2 4GA9A 1PK6A 1OUXA 2IXCA 3IDEA 4U2AA 1W2OA 4QXCA 4Y4YA 2RM22 3RSJA 4MYEA 3VKNA 1RINA 2VJXA 2QDNA 3M8LA 4PIXA 4E8DA 2G9ZA 1FI2A 5KWRA 2A71A 5DDJ2 1ALYA 1G9DA 4QDRA 1V9U1 1EP0A 4W6YA 2GH2A 5JPNB 1V6LA 2WQ4A 2ZHLA 3H8OA 2R7EB 1NUKA 3TWIA 3V0AB 4YM1A 4P08A 3PTRB 5H9SA 1IS4A 2QVSB 1GP4A 1REEA 3HJRA 3LA3A 4ISQA 3OUHA 5ACA3 3AK0A 1K5MA 2VCCA 1EAH3 2ZX4A 1GP5A 3ZXDA 4FCAA 3JBG1 1CZTA 1RHI3 1CN1A 1RUG1 2PAMA 2XJRA 3VBOA 4EWAA 1XRUA 4E27A 2ZGMA 3PJYA 2R6QA 2LTNA 2RVAA 1G7YA 2RMU1 4OI0A 2QQWA 4MSVA 5FLIA 1SLCA 1WW5A 3AKRA 3PL0A 4DQAA 4IV1B 1NA1B 4PCRA 2WAOA 4C1WA 1ODMA 1AYN1 3MIFA 4LUMA 2RS32 5A3MA 1COV3 2B9UA 3B01A 5BUVA 2ZGKA 4A3ZA 4QDSA 5JR7B 4HONA 4FBFA 1GZTA 4M3CB 1UY4A 3KT1A 2Q4SA 5LASA 4DXSA 4P9YA 1RUH3 4Y26A 3NV3A 1QQP1 5F3IA 3KCXA 1AYM2 4GD4A 5F8PA 1FMD2 2OZ6A 1ZBA3 4HVOA 4NR1A 3T1MA 2CAVA 3ALQA 4QKFA 4URAA 3VD9A 4LO6B 1F31A 2BBAA 5D21A 4KWKA 3WINE 4GXLA 2VMIA 5L9BA 3I2HA 2VCMA 2EIBA 1GQGA 5FO8B 3O1SA 3NWKA 4PLMA 2HWF2 5D1IA 4CDUB 1VBB1 3LOBA 3HVDA 1MR5A 3MF9A 2WFPA 4LE3A 1D0GA 2X5IB 3AMNA 1ZZ8A 5DZEA 4R4XA 4CDQB 1LU2A 2XLGA 2WQZC 2Y8KA 2XOMA 3E5XA 4A42A 5I0TA 1BKZA 1UPSA 5ABJB 4Y33A 3ZN5A 3ROUA 2ENRA 2I2SA 1CPNA 2WLPA 4YLZA 3AFKA 3J7NA 3BTXA 3NJXA 3C7FA 1PO13 5EPAA 3WDUA 4HPKA 1JZ4A 1UX7A 3OOXA 3ZKUA 1X7NA 2JDUA 4UFHA 2QBXA 3UGGA 4B4QA 4NIIA 3OJBA 2B46X 1F8VA 3E1F1 1UIJA 2NMOA 1RUOA 4YPJA 1TQ5A 1DHKB 3HN1A 3WUCA 2VUCA 2WS91 1X82A 3CDZB 2FCVA 1BBT2 2IVIB 5JLVA 3IBMA 3BODA 4QX8A 5KHIA 1Q8PA 5F2SA 4ORFA 3FUOA 5T5PA 2P6HA 3N35A 3MHZA 3UGFA 2WFF2 3WQ1A 2VG9A 4P9GA 4QXHA 2PLV3 5ERLA 5FZ4A 3ZIWA 4S2DA 1VRH2 2WDBA 3B3QE 4NWWA 4NRMA 3I54A 2CWMA 2FQPA 2Z2SB 2Y0OA 4EV0A 2R1BA 2RDNA 2HWE1 2DV9A 3LAGA 4IEVA 2YBKA 3O5SA 1D4M1 3PUSA 5DDJ3 1SQ4A 5EJ3A 3RZHA 1SACA 1JYCA 1QJY2 2G4IA 1ENRA 1PNFA 3SMHA 4COYA 2I45A 2CY6A 3H1MA 4MGIE 1R1A1 4NIHA 1V6MA 2VNRA 3R05A 5HI0A 3A23A 3CLPA 3H8RA 3H3LA 3RI9A 3ZPOA 4A4AA 3ZPYA 1WBFA 2A6WA 5BXXA 3LDRA 5JXGA 4H3WA 4H7LA 2W91A 5T54A 3BVCA 1A3KA 3CF6E 1O4YA 5H9PA 1GYKA 3BI3A 1QJX2 5AVAA 5GLWA 1LODA 3GHNA 4IGOA 2PAKA 5BNOA 2OXBA 5DAXA 3T0BA 4Y1VA 3SLIA 4CRQA 2OZJA 4NJ4A 2V4AA 1LRHA 4BQ1A 1JHNA 2GZWA 3POBA 4RD7A 3TEWA 2BVBA 4AG4A 3JD72 3D0JA 1FAYA 2RJKA 3T2OA 5HV4A 1SCRA 2CSGA 1WMXA 3H8XA 4XC9A 3QOPA 5BY5A 2DU0A 1AXZA 1IGOA 2ZX1A 3PMSA 2GNTA 2I74A 3U78A 3O1RA 3SH5A 1H2NA 4LBKA 2BFUL 5JR2A 5C33A 4KH9A 1TME1 2Y6KA 3KHBA 4KWLA 3ZKYA 3ZSEA 2XBO3 4D6QA 4RFT0 3B02A 4V1PA 1JI6A 3LFMA 1OA4A 1X9PA 1UO9A 1VAMA 1UY2A 1V6NA 2DVFA 3U11A 3F2ZA 3UETA 5FYUA 4OCTA 1K3IA 3OUJA 3U0ZA 4LITA 2AREA 3RZZA 4R8HA 2D40A 1D2SA 3C7EA 1GOGA 2PYTA 2YHJA 1V6JA 3K77A 3L2HA 4QU1A 2BPA2 5J1XA 2JDHA 3VZOA 4JVAA 2JICA 3ZXJA 5DG2A 1W90A 2X8KA 2F6BA 1LHUA 1M06G 1TNFA 1YWKA 4CU7A 2PHFA 1TE1B 3HBKA 4UFKA 5GLUA 4MO3M 4DFSA 2XJTA 4ZONA 4DRVA 2TEPA 1KDMA 2ADEA 5FZOB 4MGTA 2W9XA 3ILNA 3OD0A 2HEWF 2A6XA 2VOXA 3LFIA 1SDWA 4CYDA 4O65A 3VHOA 2A3WA 3KF3A 1YIFA 5CB7A 4CCJA 2RV9A 3R0RA 1VR3A 3ES1A 5IVCA 5GLZA 3VKLA 4AFBA 2BJSA 1H9PA 3Q8CA 3NAPB 1GOHA 4UI9L 4NHMA 1FPN3 4I01A 4WM7C 1VLNA 1AZDA 3VHRA 4JC1A 4JGYC 3RNSA 1AHSA 4FFHA 4ARYA 3KHCA 5ACA1 2XGXA 3W59A 4EQVA 1ENXA 1TZOA 4NRPA 3ZFGA 3K4ZA 1EAH1 1OSGA 2XLAA 3VBSB 5L7OA 2E51A 1PMHX 3I3BA 4QQOA 2ZEYA 4NRQA 3HNYM 4AVCA 1AR63 1NXMA 1RHI1 2WZEA 2JDYA 2OVUA 2W1UA 1OVPA 5FAXA 3ECQA 1RB8G 1QXPA 4YW6A 5BNNB 3VUOA 1DGRA 2JX9A 3G7DA 2DUOA 3WNLA 1UF2C 4K40A 5JI9A 1GFF2 5A7PA 3N7MA 2AGSA 1EUTA 1EPZA 4X8NA 5CYYA 4PF5A 2VZQA 1S1AA 2HWB3 3IDAA 3P6BA 3TN91 2R49A 3KF5A 3ENRA 3MEPA 2XHKA 4PJYA 4AI9A 3PLQA 1ZBA1 4CCNA 4P00B 4FQ4A 3ZLIA 2OT7A 3BALA 3RZMA 5J98B 1X8EA 3Q8AA 2WWSA 3KD4A 3U14A 1H8TB 3AMPA 4AQTA 5CFCC 1RUF2 1HKDA 4QPWA 1W9WA 1XU1A 4QHOA 4YM3A 3A21A 4QU2A 1BLZA 3ZXGA 4OULA 5IVBA 1C28A 1YFXA 1G9AA 1VAKA 4AHWA 5JSPA 2W0XA 1D0HA 2J1RA 1F5JA 2XMLA 1EV12 3QACA 1GICA 2VZ1A 3FX3A 2BVVA 3PVNA 4QGLA 4BK5A 5LW9A 1C8M3 4OUEA 3LQCA 4JHZA 5BNPC 3DPRC 1SFYA 1W9TA 4FO9A 3T30A 2CGNA 1A8DA 3KS7A 4FPEA 5JCTA 3RQ0A 1PO11 1HRV3 4CU6A 1C1FA 4QPIA 2YU1A 4C0HA 4M00A 4IV3B 1DGRN 1P8JA 3N9QA 3VZJA 2H0VA 4FPLA 2VOVA 2JG9A 4SBVA 4JKLA 1JUIA 1O7FA 3AC0A 4CVUA 3LPFA 3QCWA 1MVEA 4I02A 1JZ7A 1W6QA 3WDXA 2MNGA 3DCQA 1CZSA 4JHTA 4AI1A 3DYMA 1RTVA 3CZUA 4G4FA 4O7XA 4EN8B 4GMP3 2VY0A 3SISA 1OXCA 3KV4A 4BISA 5JAXA 2JDAA 3DN7A 4KBBA 5KR7A 5KXCA 2WA3A 4PQQA 3SCFA 3IM0A 1YFWA 3M7AA 5HV0A 4RL7A 4AFMA 1AR93 1ND3C 2PHTA 4XQWA 5FXWA 1ND2C 2PLV1 2VNGA 3FC0A 1ZBE3 4AYUA 1IS5A 3GHMA 4B1LA 5CKNA 1OKQA 2BWCA 2RM21 3D4KA 4DZGA 1YXWA 4DUXA 1NAEA 1BQPA 2XVKA 1HQWA 1WMDA 5T5OA 4AVAA 5DDJ1 1YIPA 3WW3A 4LQRA 2BYVE 1YNAA 2A73B 3ZIXA 4E2GA 3LPGA 3U4SA 5A1AA 3O0VA 3TEYA 3ZO0B 1NOVA 2QKDA 4I3PA 1VIWB 2HWC2 1I9RA 4NPLA 2DVAA 2WNUC 1FNZA 3VBRC 3WD5A 5C8WA 3UKNA 3O0WA 4CA9A 2A1XA 2XR4A 4Y5Z0 3O0XA 2A6ZA 4GH4C 4A2UA 4AFDA 1HN1A 4K3UA 1XSQA 2AH2A 4TLFA 2WWUA 4LBOA 3WDVA 1AL23 1W6MA 2HEYF 1W2TA 3POJA 1UOJA 3JCIA 3I2OA 3BU7A 1EUUA 1SBEA 3IAPA 1OD3A 4ZHNA 1HRI2 4WM7A 2Q8EA 5LWBA 1SMVA 2AEZA 3TNPB 4Z8BA 3WHTA 3I59A 4HG6B 1NE4A 2TNFA 1PIV2 1QJU2 3O7OA 5C8CC 1OI6A 4NOTA 4XDQA 4AEDB 4EWDA 5EP9A 2RS31 1CGPA 4YW3A 2WZR3 3AB0A 1W06A 3THTA 3Q8EA 4LPLA 3ZFEC 1K12A 2D6LX 1CAVB 5HBAA 3AJYA 1O6UA 4XFFA 4ZZ5A 2NYYA 4Q8LA 1HX6A 5BPXA 1CAWB 1FMD1 1BEV2 1CAUA 1W9SA 3FHAA 3OYWB 3SKJE 5FLHA 3ZXLA 5LB6A 1WA6X 4AQ2A 2HKXA 3ACIA 3J26N 3C3VA 3D3AA 3LDBA 1RUF3 1UOGA 2LALA 2NZ9A 2HWF1 3LD8A 2Y26A 1IPSA 4YGBA 3WNNA 3RZGA 4UBHA 1UX6A 5F6KA 5FZLA 2VZTA 4MXWB 3DXTA 2VZOA 2C9KA 4JAAA 2ZS6B 1DLLA 3VBHC 2W08A 3DV8A 3TEXA 1G9CA 2HBTA 2VNOA 5IVFA 1JZ2A 3GM8A 4AI3A 4ES9A 1UU6A 3G6JB 3VDAA 1LGBA 3S30A 4CP0A 4XFBA 2MEV2 3VBUC 3MICA 4CP2A 1OF3A 5JOZA 4AEMA 3CKHA 2A75A 3GBFA 1FX5A 2SBAA 2ZGTA 3GBWA 2A3XA 3WQ7A 3R4DB 4JDNA 1DGWX 4AOCA 3GXUA 4OVEA 2VW2A 4HVQA 3O1MA 1SEFA 2VVDA 5KHHA 1SHWB 2E33A 1W39A 1NQDA 3BTAA 1YFYA 3ILRA 2GP5A 1W0NA 3OY8A 4EN0A 3L2YA 4ZU7A 4HN0A 1FOD3 3I2GA 4LO4B 5SV8A 2UWAA 4AL9A 1LENA 4ONUA 4C91A 4MGZE 4OYUA 1FPN1 2A6VA 2VU9A 5FY0A 3NL1A 3WP5A 3WNOA 2ZPXA 1V9U3 3FE5A 1VBC2 4RGKA 2GMEA 3FJSA 5IUQA 1CIYA 1N3QA 1MS9A 2OQ7A 2YGLA 3GZTB 4OI2A 2JE7A 5LY2A 3FL7A 3POEA 3AL5A 4CCLA 2WFF1 3OGGA 2J22A 1XBFA 5DXDA 3LSEA 3WVJA 5IW0A 1KS4A 1O4ZA 1VRH1 1A78A 1W6NA 1GP6A 1CAXA 4CP9A 3ZYJB 5CVRA 2Y6GA 2HWD2 1Y7BA 3IN9A 3BN6A 3Q8BA 2RS52 3GZAA 3NJVA 1RUG3 3CJIB 3I2IA 3T2QA 4NUBA 1QJY1 1YC61 4YG3A 1J1TA 5T52A 4BQXA 1QWRA 2RMU3 5FP7A 4D7SA 4OHWA 4XXPA 4XVHA 1T6BX 1ND2A 1VP6A 4NWVA 1W8HA 2HWB1 2VD7A 2WRAA 1AYN3 2FDJA 1W8ZA 2D97A 3UT0A 3ZSLA 4IE0A 2DFCA 3M1HA 1N47A 3OTFA 2GC2A 4YGEA 4BMBA 4DINB 5FYTA 3ACHA 1XYNA 1WCQA 4LKEA 1UD1A 3OGVA 1AXYA 5BYNA 2EXJA 3ABZA 3WHUA 1BMV2 1DQ6A 2ZMKA 1QQP3 4JGYB 1Q43A 4JV4A 2VCAA 3OPZA 2WNUA 3VBRA 3K51A 4XUTA 2XJUA 1LULA 1XXNA 4LK7A 4GH4A 1PIV3 1K5JA 3E6DA 3AKPA 4UW4A 3TBDA 2XXZA 3USUB 1LB2A 1HJGA 3O1OA 1ZZBA 3VGIA 3I49A 3JD71 2B4KA 4W6WA 1LJ7A 4WVVA 1RL3A 3J9SA 3EYPA 4K21A 1LECA 2KR2A 4I3GA 4W8JA 1CAUB 1ENSA 4P9IA 1C8M1 1I3HA 1PK6C 5F5AA 3AZXA 2AC1A 5IYYA 4F3JA 1JYXA 2W94A 2IXHA 2OS2A 5TSWA 3AM2A 5FOBB 4Q4V2 4LHKA 2R0FA 1UZYA 1BZWA 5JOWA 5FXXA 2B42B 2YV8A 5DAQA 4F83A 1SLTA 1JYTA 4IXLA 4K8RB 4IGPA 4FVVA 4FPGA 1IQDC 3UL2A 1QIQA 2XJPA 2PQQA 3PIJA 3MW2A 4EN6B 2Y38A 2PHXA 4KGGA 1X33A 1Q8SA 3SITA 5CFCB 3CQOA 1K5MC 3O12A 4FOYA 4HKLA 3JUUA 2BWAA 5FYZA 4QX2A 4FAGA 3KV6A 3W5NA 2JDKA 2P2KA 2ORZA 3VBOC 2WS93 2QQLA 2PHLA 2EXKA 5F9TA 3NNFA 1GU3A 2Q1ZB 3IDCB 2HBUA 4UW6A 3ZN6A 3K2OA 4KGQA 4FOWA 4JCKA 1AR91 1G86A 2JD4A 2RS12 4LR4A 3IAQA 3VBHA 3PTYA 4RQPA 3H42B 5A7WB 3ZYPA 4A6OA 1IG0A 1X50A 4JGZB 2C5DA 1S55A 2C26A 4N8MA 4AFCA 2DUQA 4INDA 3ZR5A 3DPRB 4FAHA 5BNPB 5A3NA 1X8MA 5FZ8A 3CZJA 3W58A 4UT5A 1Q8OA 4HT1T 4D8MA 1JYNA 4XETA 4CCOA 1LGCA 2P6CA 4X8PA 5KC6A 3ZN6B 2RHPA 2PA7A 4M0NA 2HWE3 1NCRA 1D4M3 3MF6A 1Z0HA 1VBC3 1YQ8A 4Q4X2 4W65A 3N9PA 5IK8A 3ZYGA 2ZXQA 1G8WA 3GGLA 5C6CA 5JDBA 3RYPA 4XHBA 4OUMA 4JKMA 1W6OB 5T3NA 5C4WC 4NIDA 2C4XA 4ISRA 5FP8A 5EHDA 4AZZA 1Z7S3 5E89A 2AR6A 3OG2A 2DBIA 4ASKA 5E6HA 1WKYA 5C3PA 2HWD3 5CKQA 2O0OA 1RJ8A 3LEKA 4Q0VA 1ND3B 4ZS3A 1ZX5A 1PZ7A 1IPKA 3FLRA 2WNEA 2BNOA 5A1FA 5IK5A 1JOBA 4PLOA 1W9FA 4X6RB 1GNYA 2D6KA 3QBQA 4QMAA 4I09A 3W9AA 4E9KA 2A70A 2C6SA 2YFUA 1FV3A 1MEC3 1YYNA 3LEGA 4C90A 3JZVA 3RDIA 3F95A 3K3NA 1SPPB 4QHZA 2V4VA 4IEOA 1JU4A 1U5XA 4LJHA 1UY0A 4EE2A 3ZMOA 1HB2A 2P1BA 4CUGA 3QD6A 4LHSA 4QX5A 3NKGA 1W03A 3IDBB 4Y1XA 4I30A 4MH0E 2GC3A 4Y3OA 5DABA 5FMOS 2VUAA 3VDDC 1DBNA 1CX1A 1J1LA 1RUF1 3BKZA 2DTYA 1PZ8A 4YYOA 3ZFFC 4CUBA 2ZJCA 2CV6A 3GJAA 5FJKA 4AGRA 2NPIA 4RSUA 4DY5A 4TWTA 4I0AA 1W28A 1QU0A 3ES4A 1VB2A 3AZZA 5GM0A 5FY5A 1O5UA 1UKRA 2BOIA 4AEKA 4BQ3A 2YB7A 2ZACA 3VB9A 5KXBA 1ULPA 3UJOA 5C8CB 5ANNA 4CXXA 1V6IA 1DFQA 3M3QA 3MFCA 1AUYA 1ZZ6A 2D93A 3H9AA 5AC93 4IE7A 4META 4BLJA 4XUNA 2QE3A 5GJ6A 3ZFEB 3H8UA 1VBE2 2BDRA 1LCLA 2HYKA 1KQRA 4HBNA 1NKGA 4LO7A 2VZRA 4I0WB 4Y20A 1FOD1 3FLTA 3RJ2X 4A3XA 1VALA 5F37A 3BU0A 2IFWA 5JZGA 4FOVA 4NHYA 3ACLA 1KRIA 4I2OA 4XTMA 2B5HA 4V2WA 1OC1A 4QQ2A 3PIGA 2B7YA 3TNQA 4UXAA 1UIKA 3FHIB 3B93A 2EVXA 4L9BA 5DN2A 4P02B 2W52A 5BNOC 1CR7A 3VBHB 2D3PA 3BIEA 3T3YA 2PXJA 3EJKA 3PVBB 4XBLA 5G05L 1I5PA 3MV01 2RS13 3SCHA 4PLNA 5D8AC 3KQ4B 1W0PA 4F8AA 2XL7A 4X6QB 1R64A 4K6BA 5IHRA 3VBUB 3KCYA 4AI0A 5F5QA 2E9QA 4QAWA 3W21A 5LBEA 4A7ZA 5IFPA 4JDMA 2CAUA 5JOXA 4E4DX 1QKQA 2BGCA 2VZPA 1NYWA 4Z1VA 2HWC1 1PHMA 5FZKA 5F3CA 1L7RA 2VZ3A 2EICA 3POFA 3BOWA 1MS3A 5A33B 4Q4W3 1POV0 4YVWA 3BYWA 4AGVA 2FDIA 5FP9A 1CX4A 1HIXA 3ILFA 1OLQA 3LKJA 1JMUB 5JXJA 5I8TA 3LIHA 1YO8A 2EAAA 2CU5A 2H6BA 3TN93 4YARA 1OMIA 2P17A 4XQDA 1HRI1 2J1SA 4GWNA 4PDWC 3RWNA 1RJ7A 1DF0A 1VBA2 4MUVA 4OLLA 1PIV1 1QJU1 4JZRA 4DUWA 3SH4A 2GH8A 1WZXA 3HT1A 1ULDA 2DTWA 5C4WA 4YVSB 3WDWA 2VBBA 3TYJA 4RHV2 5CFDC 1PVXA 4NHXA 4HSJA 1WCKA 4MHUA 3WP6A 3VZMA 1XC6A 4PIZA 5B2GB 4CDXA 4XF1A 2ZEXA 1BEV1 1AF9A 1SG3A 2Z69A 2X09A 3GJBA 4W50A 5AVPA 5FY4A 4Y5TA 5FIXA 4LORA 4BQWA 2A6YA 1XOYA 2R30A 5F5IA 2GU9A 3WXPA 5HCBA 4AQSA 2BZDA 3DL3A 5HCFA 4JDOA 1RIRA 2RE9A 3NVCA 3E97A 4OZXA 1LTEA 4UF0A 5IK7A 4B29A 1XNCA 1L7QA 1FNYA 3K4AA 3B9IA 2Q5TA 5I0UA 2R042 2W1QA 4GWJA 1R1ZA 2VQ0A 3P3NA 3WF3A 3ZFGC 2KM2A 3OCPA 4BOWA 1XSRA 2VCBA 2ADDA 5L7OC 2ERFA 4XJWA 3C7GA 2XH6A 2OKXA 4ASLA 5L9VA 3VDDA 5FOJB 2MEV1 1REFA 5DG1A 3ZFFA 2TUNA 1WUVA 3PUQA 5J96B 5JPMB 1MQTC 4DS0A 4FPHA 4XEZA 1FATA 1SFNA 2QQJA 3MGUA 3Q8FA 1W8TA 2WO1A 1DDLA 2JIJA 4WVMA 4Y20B 4QDQA 1PK6B 4K20A 4FPJA 4L2NA 2D3SA 3PVEA 4IDZA 2W46A 4DEVA 1LEMA 2NN8A 2HH9A 2ZHKA 3S5QA 1O3RA 2JB8A 4QD2A 3LA7A 2RM23 3IB3A 4PIYA 4L11A 4Q4Y2 4RYDA 4P5HA 3VLBB 3FFQA 3POWA 3HN3A 4M0HA 4AAXA 1R082 1VBC1 2XKPA 4W4ZA 1MZEA 4YRDA 3UK9A 4YM0A 5FPUA 1QOSA 4KG0A 3RMXA 1AX1A 4OQ8A 2VH9A 1XNKA 4QM8A 1CESA 1QXRA 4XMIA 5A7OA 1K5MB 1CPMA 3WP4A 5B4NA 2PQSA 3AXEA 3WG3A 2AENA 1YUDA 1Z7S1 3MIBA 2WA4A 3KZ4C 2GNDA 3VBOB 1H9WA 2HWD1 5A7SA 1RXFA 2RS51 1MVQA 1V70A 3VZNA 1G9BA 1W6PA 1KGYA 4ITCA 1WD4A 3LEIA 1UWWA 1RUD2 4LKSA 4BE3A 5D8AA 3I2JA 1W8NA 4NAMA 4P9WA 1GNHA 2YC4A 1YJKA 4QPIC 4NPMA 1MEC1 2RS33 2W92A 1HB1A 5J37A 3LSDA 2D5FA 3NNJA 5FMCA 5FJHA 1RMU2 4HXCA 4RS5A 3HNBM 2JG9C 1NG0A 3AP6A 1GZ9A 3MPBA 3T2PA 4FFFA 4OZOA 5FBZA 2XWBB 3H1WA 4QKDA 1MZ6A 1BMV1 1K45A 1LOCA 1HV1A 2PHRA 4HOOA 1AYM3 3RMYA 5HCAA 1FMD3 2V72A 3DECA 1JYIA 2P4EA 5C4WB 1VBA3 2J1AA 5CZKA 1J3PA 4XFHA 2D6NA 1RITA 2GALA 3WW4A 2HWF3 4YZ4A 5DAPA 4LBQA 5A6XA 4TLGA 5C5TA 1W2UA 3KQRA 1RUJ2 2R062 2QCSB 2UURA 4W6XA 5FUPA 3SH3A 3WSOA 4PDWA 1GZWA 4Q4V1 4FTSA 1WLCA 3NKTA 3MLJA 5AC91 4AVTA 2CDPA 3HQXA 2B8MA 1MS8A 4HPKB 3OBTA 1DQ0A 4NMIA 2DCYA 1WLWA 5CFDA 1SLBA 4YZ1A 2VZUA 1GANA 1WMEA 1W2AX 2DCKA 1J3RA 3LEMA 2WYSA 3IWZA 4OI4A 3VDCA 4D7TA 1KS5A 4YW4A 4UBGA 4BK4A 3WLUA 3WY6A 1RUI2 2A5ZA 2VMEA 1S0EA 1DYKA 4NO4A 4ATEA 2FZ1A 1GWLA 2ZHNA 4E4ZA 1IPJA 1QH6A 3OGRA 3ZM8A 3MIGA 1BBT3 5DAWA 3U37A 2E32A 1H4GA 4NROA 5EFUA 5A7NA 2RS11 4BPZA 3ORJA 1ZRFA 4KQ7A 5EJZB 1LKNA 2R072 1W8OA 3BPSA 5GZCA 1U12A 5L36A 3KSCA 1AXKA 1SCSA 2WFF3 4CXWA 2IFRA 3RZKA 3CL1A 1UYZA 3NQHA 1AX2A 1SLAA 2VTXA 1VRH3 3QH6A 5EYXA 5KC5A 2O8QA 2ZZJA 3RRDA 1MQTA 1NCQA 2AZ5A 2Z5WA 5A32A 2OPWA 2E53A 2K0GA 2ZX3A 4XF4A 4XDPA 3DYPA 1R083 1WMFA 1QJY3 4NHKA 2XONA 2JKXA 3P5BA 4Q4W1 4QPGA 5SV5A 1LEDA 5C3SA 1Y9MA 2ORXA 2VGDA 3K4DA 4QX1A 5K0UC 2GSYA 3MPPG 2GC1A 3C7HA 3AYDA 1HDKA 3POIA 4BXSV 1WGPA 4E2SA 1DLCA 4M4PA 1E5IA 1W6PB 1UZVA 2K2SA 3ASIA 4QXBA 3RPQA 3WNMA 4V2VA 5BNOB 5GALA 2K46A 3FLPA 3RGBA 1QJX3 2J1EA 2YC2A 3EQEA 4XILA 5D8AB 5EQUA 5GZEA 5A3OA 5LBCA 2GC0A 3VKFC 4J1XA 1IOAA 2VXRA 4N53A 4Y1YA 1NZCA 1BVP1 4HK9A 4NIAA 1PGW2 3GALA 4WZFA 2Y64A 2VBDA 2VMFA 2OQ6A 2Y33A 3FFZA 4ZU5A 5FY8A 2VW1A 1RMU3 5I0SA 3JD73 4JRLA 1OH4A 3RJRA 1VBD2 4KU7A 5CIRA 2JG8A 2Y60A 3KGZA 5H9RA 5IWFA 4CEWC 1QOTA 5DZGA 4TZDA 2D5HA 3HD8B 1AR72 1LOEA 2Z79A 3THDA 4D69A 4D94A 4AFAA 3GZUC 4HN1A 1S0CA 2XWJB 4KWJA 5L9RA 1LOFC 1ACCA 1JZ3A 3SHRA 1YI7A 4FI9A 1GWMA 5I8SA 2WSVA 4Q0QA 1F2NA 1DZQA 3AP4A 4MGYE 1XPWA 3EBRA 5DMYA 2ZGQA 1AL0G 5A70A 5IAVA 3E6CC 4MGSA 4ZS2A 1UW8A 1BYHA 1M4WA 4LBMA 5J7MA 1RVF2 3OBZA 5EV7A 5FTTC 5FZGA 4LBQD 4D7YA 5KXDA 1KDKA 2E26A 1VBE1 2J1TA 1PVC2 3LCPA 2ZGUA 1JXNA 4QKBA 3T0DA 2BP6A 2W68A 4AK3A 4EWEA 1H30A 1JN2P 5FRAA 5T5LA 5I0RA 1OFNA 2HJIA 1AX0A 4Y22A 3BUCA 4BCUA 4FTBA 2PELA 2E31A 3HPNA 4LIUA 3WR0A 1LESA 1DU3D 3VL8A 3LF7A 1XNBA 2JDZA 3JQXA 4XBNA 1LNSA 4KI5M 1OH3A 4FP3A 3B9CA 5FY1A 5FWEA 4A41A 5FZHA 4YW5A 4RFRB 4HFSA 5CKMA 3ZFGB 5IK4A 3HT2A 5L7OB 5F39A 1JOJA 2FCTA 1DCSA 1UZWA 2ID4A 2VZSA 3DKWA 4HZFA 1R092 4L92A 3ZYRA 1MQTB 2WNVA 5FYIA 4AHZA 3AVRA 1E57A 3EXUA 5HXVA 4LK6A 1YFUA 3JBG2 1O3TA 2ZEWA 2YZ4A 2Y6FA 4GULA 4L97A 3N7LA 5GZGA 3THCA 3UNPA 2V73A 3AMHA 2ZA9A 4MOAA 3B7MA 1DGWA 5C70A 3ZN4A 5A1LA 5C3OA 2WNOA 4S2HA 4XIOA 2BBVA 2ZGNA 2D7FA 4L99A 4D3WA 1AYM1 4KMQA 5KHKA 5EIYB 1OFSA 2WT0A 3EB7A 1URXA 2OIIA 4ES8A 4Y24A 1VBA1 4GJZA 3WNKA 5A3LA 4GMP0 5JSRA 2G9FA 2VXJA 3BOPA 2FDGA 3SC7X 4XURA 5K0UA 2WYFA 5IVYA 3AYCA 1AR82 1J84A 1PX3A 4QT6A 3WX5A 1IHMA 1UU5A 4RHV1 4GKXA 4XUQA 3TAYA 4TTGA 1XU2A 4RQPC 1HXS2 5LK5A 1U5ZA 5FZAA 5FPZA 3U75A 2WC2A 1VBD3 1EV13 3E5UA 1KEXA 3OBAA 3VDBA 4O9EA 2NQYA 2CL2A 4BQYA 4HETA 1WBLA 3PUHA 4FQZA 4QPIB 2V5DA 4DRRA 4COUA 3M3IA 1CONA 1QGLA 2WUHA 4RR3A 3M70A 3HR9A 2JG9B 2DCJA 1NCRC 5FZ3A 4N9IA 3AKTA 1W6QB 3HEIA 4MLOA 3KCCA 2BFUS 2R041 3IPVA 1F4HA 3ZOIA 4Q2FA 3CNAA 4CEWA 1J3QA 1XQNA 2XLFA 5FY7A 1VMJA 4FPFA 2VMHA 5E8AA 2WINB 4AHXA 1YLLA 3O1UA 3B69A 1E5HA 5FO7B 3WV6A 1BBT1 2J42A 3QH7A 4LBNA 1LOFA 3IIIA 4UFLA 2R32A 4H2AA 4MZUA 2ZHMA 1ODNA 3BB6A 2KXLA 4TXWA 4KBZA 2C24A 2WO7A 3B94A 4YG0A 3RYRA 1ULOA 2UU8A 4P9JA 3MI8A 1IZ3A 4H14A 1Q3EA 1DG6A 4LULA 5FWJA 4Z07A 1QHDA 4IGQA 5F3EA 1OOPA 2ZGRA 4XE9A 4BQ4A 5LA9A 3BTYA 4Q4Y1 4Y1ZA 1DGLA 3HQRA 2WN3A 4LOTA 1GQPA 1R081 4K9SA 5BNQA 3VBFA 2ETEA 4KWUA 5LBBA 1PZ9A 1G9FA 4Q1PA 2HWC3 3V0BA 3R4SA 4CDWA 1NY72 4YZ3A 1W6MB 2JEMA 5JIAA 4XCAA 1R1A2 2RR12 5EZWA 4IE4A 3N9MA 1UNBA 1R093 2JIGA 3HQUA 3T4VA 3JU9A 4WM7B 5A3WA 2O8OA 1QJX1 5DQ0A 5IVJA 1ULFA 1NLSA 4GALA 3I59B 1GOFA 2A7AA 2Z42A 1RUD1 2VM9A 1HRI3 1CZVA 3NSTA 1RUE2 3AZWA 4XJZA 2J7MA 3VD5A 4LKDA 1JODA 4WM8A 3E5QA 3KVAA 1QJU3 1VMFA 4IQPA 5FQ0A 3MIHA 4D6SA 2QQOA 5HCHA 1KFXL 1RMU1 4WZCA 1PO22 3FWEA 1GMMA 4YFZA 2ZGSA 3HIFA 5DUUA 4B3NA 2BV4A 3HAGA 2WR9A 4GB32 5JZGC 1H1IA 1H2MA 4LLOA 1BEV3 4KNCA 1CVNA 1F5FA 5AFEA 2GN7A 5FK8A 5K0UB 3SQOA 3ZDSA 3CJXA 1PNGA 3ST7A 1PGL2 3FUQA 4UOJA 3UYJA 4D0QA 1W2NA 3ELNA 3KWVA 1J58A 4YGCA 2ZAHA 5DZFA 2F17A 4XACA 1RUJ1 2R061 1SFPA 3L9JT 2JD9A 3R6SA 5DUXA 4QB2A 2Y34A 4FPOB 4AAPA 4PF1A 3KVBA 4EN9B 3VHPA 5IAXA 2Y6JA 2W1WA 1DYPA 2YBSA 1JZ8A 2MEV3 4MG2A 3AZYA 1NLQA 1JOPA 1WCSA 3T1LA 4Y5SA 4QQHA 5C7GA 1OD5A 3WF4A 3IPVB 1C3HA 2G19A 3B5LB 3OY8B 2IC1A 4CCMA 5C71A 4YVWC 1N1YA 1EY2A 1NLRA 3AYAA 2HYXA 1UOFA 2ZTNA 3U10A 4IL7A 1VE0A 3P1IA 4Q0UA 4XDOA 4HANA 2DYCA 3K48A 4XPVA 2ARBA 1NQJA 2RDQA 2VOKA 3UKVA 1SLLA 1O4TA 3DUIA 4BQ2A 2LROA 3CO2A 3W20A 4BIOA 2Q1MA 3LOIA 4UYBA 4XFIA 4UAPA 5FYCA 4YZ5A 1YHFA 3ACGA 2X29A 1OQDA 1GZCA 2R071 3K3OA 3DYOA 3RI8A 4EYUA 3GF6A 2GN3A 4ARXA 1W6NB 5ACA2 4C1XA 3V0AA 1CAXB 4CP9B 2R1DA 1QJEA 3ZYIB 1EAH2 4Q26A 3FBMA 3OBRA 1IKQA 1UU4A 1US3A 4XMAA 5LRRA 4XZUG 1RHI2 2YMZA 4HL0A 4CDXC 3ZXFA 2ARXA 1ZYBA 2LS6A 2RS53 3ZXEA 1W8WA 1T6GC 3GNEA 2IUWA 3I4IA 2Q8OA 3V0BB 1FT9A 1ND2B 3I8TA 1UOBA 2OW4A 3NV4A 5IATA 1O3SA 2PMWB 2OX0A 3SEPA 1IS6A 2P5BA 3KV9A 4H7MA 1COV2 2Y6LA 3E6BA 1JHJA 3M3OA 5FMBA 2FDFA 5AFBA 3APBA 3CIHA 1NA1A 3BIWE 4AEJA 2BOJA 3ZSMA 1UKGA 1BK1A 1HLCA 1S2KA 2C9AA 1QNWA 2WO3A 5FCCA 3NJZA 4Q0SA 4LEJA 4UWDA 1RUH2 4NHLA 3RVHA 1S0FA 2WNUB 1BK0A 2VULA 3VBRB 1JH5A 1LU1A 1XE8A 1ZBA2 1QOOA 2VC9A 2DF7A 4GH4B 5JI7A 5APAA 2IXJA 3N3HA 2XKOA 1ENQA 5FLJA 4MVTA 1OURA 1APNA 1RUE3 2WKKA 4K8FA 3A7QA 4E4SA 5FREA 1H2LA 2QQKA 3OGJA 2UYAA 1U5YA 3VV1A 1IG3A 1S2EA 3H0OA 4LLFA 5F2WA 1CIWA 5B4XA 1YJLA 5FUNA 2DFBA 1U5IA 1VBD1 1EV11 4MX3A 4N43C 3ZYFA 4RN5A 2IXIA 1OLME 2X5IA 1TMF2 4L0PA 4GB33 1AR71 2D3RA 4YNIA 2FCUA 4CDQA 4IETA 4Q4V3 2FZ2A 1WLTA 2AEYA 3T0AA 3I3EA 1YRZA 5ABJA 2D6PA 2NMNA 1JW6A 2IVJA 3NO8A 4RA0A 4QB1A 4LKFA 4DXRA 5FR3A 3TRSB 1MACA 1LOBA 3NNGA 4BMEA 4ASMB 2O14A 2MHFA 4AXOA 1B35C 4LO8A 4LO5B 4JTNA 4CCDA 4JTOA 3ON7A 1RVF1 5CA6A 1QDCA 5I0DA
chains in the Genus database with same CATH topology
2LUWA 4OHXA 1PVC1 1LHOA 4RQPB 5I8YA 1BXHA 4XFGA 4LHLA 2PN5A 4R4ZA 3N4MA 4P9LA 1C5IA 2ZX0A 2AYHA 1S0GA 3N7JA 3TOJA 4RS5C 2Y0IA 4QHBA 5C9AC 1NCRB 1Y9QA 3M2MA 4BYYA 3ZXAC 3ZMNA 5CG8A 4QGNA 4EN7B 1C1LA 4Q4X3 4FOQA 4NN0A 1H8TC 1R091 4DY3A 1SLIA 5IT6A 3NW4A 4BM8A 3ME2A 2FMDA 4ZKTB 2VOWA 4KU8A 2RJLA 1W0OA 4N90A 3CU7A 1A8MA 1JUHA 2JECA 4IEQA 2OYZA 4Z92B 1Z78A 2R16A 4QM9A 2ZGLA 4YG6A 3I2DA 1LOGA 1RC6A 3DGTA 2PHWA 1V6OA 1UCXA 5EYYA 1UMZA 4H55A 4IV3C 2DVDA 1LGNA 4Y1UA 1QY4A 2XJVA 2ZBJA 1V00A 3KGLA 1AR81 4AHYA 2XBO2 3LGRA 1HXS1 4XJUA 2AUYA 4IEYA 4FP2A 3AKQA 4AI2A 4URTA 1DZTA 1TMF3 1VJ2A 1OHFA 3S7EA 3N7KA 1NCQC 1Y3TA 3WCSA 2E7TA 4F7ZA 1KITA 1VBE3 2QZ2A 4LTAA 4FPYA 1OA2A 3D82A 4QPGC 2GMMA 4LT5A 2DCZA 4N43A 5JZGB 3IKWA 4AE2A 2V5YA 1QH7A 1HV0A 2DCTA 3PJQA 4N7IA 4DPNA 1RUNA 2D44A 2E7QA 1ZZ9A 4UW5A 1FPN2 2OA2A 1GR3A 3WDYA 3NAPA 4N53C 4TYSA 1DZRA 3SCGA 3WW2A 1RUC2 3WG4A 3WT3A 5K9YA 2FBEA 1SBFA 4AQ6A 4XFAA 3D0SA 3AP9A 4AEDC 3S0MA 1B35A 3D6EA 2ZAAA 1AR62 3VBSA 5T50A 3VKMA 4IEWA 2JG8C 4CEYC 3WW1A 4WVWA 4RGGA 1JBCA 3WNXA 5I93A 1QF3A 2B45X 5BNNA 3IT8A 4YVWB 2N7GA 4QXKA 2PHDA 1OQ1A 4XJAA 1NY71 3JB8A 2D6MA 2RR11 4XF3A 4SLIA 1Q56A 2HWB2 3LZZA 3MZHA 1OLRA 2IWGB 4COWA 5C9AA 3MLLA 4BA6A 2ZMLA 4LBLA 4QQPA 1KJRA 4GKYA 4HLTA 1IQAA 3GBGA 3T2TA 4AVVA 3P3PA 1RUE1 4HMZA 2DUPA 1HQLA 4J1WA 1TEIA 4IERA 4LA3A 3BCWA 4IEUA 1H8TA 4R9AA 1N3PA 4XFCA 1C57A 1U0AA 1PO21 1VB4A 1PGSA 2YYOA 4RHV3 3KB5A 4KG8A 2UY9A 4G9SB 4CDXB 4CP1A 1H8VA 4N9HA 1QXJA 5LRSA 5CADA 2VQAA 2GAUA 4GB31 1C8M2 5CBLA 1PMIA 3H3ZA 1N1SA 2XVGA 1POV1 2ATFA 2MPFA 1HRV2 1PGL1 1Q8VA 3EO6A 2P37A 2QDRA 1XNDA 2PAEA 2QFEA 5JIUA 1J59A 3LA2A 3AMMA 4IV3A 4FT8A 2R043 1N1TA 4A7KA 3VDDB 2VUJA 3ZFFB 2WNVC 3H7YA 4YW2A 1ASJ2 3MLKA 3POSA 4WVMB 2XB6C 1TNRA 1MZ5A 3INAA 4RGAA 1N3OA 2GNMA 2DURA 4N43B 4KL1A 3X29B 4DOUA 1AR92 2IXLA 2JXAA 3CJIC 2C1FA 1ZBE2 4K1ZA 1ZREA 4LUKA 3POYA 2PTMA 4LE4A 3URFA 4B4RA 5CAZA 4M01A 1YCIA 3KMHA 2WSUA 4Q4Y3 1QJZA 4R9DA 1XYPA 4OHZA 1GQHA 1ONAA 4Q4X1 4DB5A 3SNMA 3V56A 1D2QA 1C8NA 1DQ5A 2C0ZA 1CJDA 1MS5A 3ETQA 2BTVC 5K7PA 1QDOA 1RUC3 3IIAA 4Q0PA 1B35B 3WCRA 4COVA 1F9KA 1AL22 2EF6A 2ET7A 2HEVF 2YXSA 3M3EA 4S2GA 2ET1A 1C5HA 3JQWA 4Z82A 5JOYA 3A0KA 3C2UA 3KLSA 5H9QA 3UV9A 1RUD3 4AWDA 1SBDA 3B00A 3TB0A 4RR3C 4B4PA 1COV1 2WZR2 1UAIA 2P34A 4RS5B 4C0BA 4YGDA 3MYXA 4J6GA 1AJOA 1DQ2A 4AEDA 5C9AB 1EPWA 2EALA 3AYEA 5KHGA 3PHMA 2DVGA 1RUH1 3MW4A 2VPVA 2V09A 2G9GA 3ZVXA 4B7EA 4HKOA 4CEYA 1CAVA 2H6CA 5J36A 1GLHA 3AKSA 1OPOA 1ZVFA 1CAWA 3OYWA 4YFWA 4BHPA 4LHNA 5J3UA 4LBQB 2DVBA 1VAVA 4AI8A 2BNMA 3LWCA 3THPA 4BWOA 4XQ4A 3KT4A 1WLDA 1L3JA 2GNBA 4PDWB 2WT1A 1GZWB 1RUJ3 1NE6A 4MXWA 2R063 1S0DA 1ULCA 1TMF1 1FXZA 1OOPC 1PM7A 4DRRA 4XF9A 4JGZC 5E16A 4GWMA 3VHNA 3GYDA 5DUWA 5FO9B 2D6OX 5CFDB 5CG9A 4IEXA 1I5ZA 4U36A 2YROA 1LR5A 4S2FA 3VBFC 1CQ9A 2ZZQA 2GDFA 5E1RA 4CDWC 2P3IA 1KFUL 1S2BA 4G3YC 3J8F2 1GSLA 1BVVA 4XYXA 2ILMA 1FOD2 1RUI3 2H0BA 1ULGA 2BEOA 2KA3A 4A7YA 1D4VB 4IEPA 3RYKA 3MIEA 2PFWA 2YDEA 2UWCA 1UPIA 1DIWA 1CJPA 1ASJ3 1V9U2 1X36A 5CNAA 5BY5A 1XYOA 2ZGOA 5GKAC 3U07A 3WQ0A 4HVRA 2WZPP 2O1QA 1IS3A 3BPZA 1H4HA 4WM8C 3NV1A 2R073 4TSVA 2ZABA 4OI1A 4FPCA 1B09A 1JTZX 3PNAA 3KM5A 3V65A 1REDA 4AW7A 1S0IA 1NCQB 3AMQA 3M4FA 5A32B 5EWSA 2ZCWA 2EA7A 4GQ7A 1H1MA 2ZKLA 1RUG2 4QPGB 2EIGA 3ZSKA 2P3JA 3OF1A 2RMU2 3CJIA 4XIKA 1BCXA 3VL9A 4HKWA 1GV9A 1AYN2 2K9ZA 4XBQA 2YY1A 1AJKA 4XJ8A 2DU1A 2EXHA 2IZWA 2BQPA 5FMOL 4WBBA 2XL9A 5FPXA 2A3YA 1H2KA 1QQP2 4N53B 2UWBA 1WW6A 3D8CA 2X53S 2ES3A 4JGYA 4XXAA 3AFGA 4FSJA 1HQNA 2E7AA 1C4RA 2SLIA 2VW0A 1VBB2 3J4UH 3CEWA 2JG8B 2Q0AA 3N36A 3USUA 5F1RA 4CEYB 3USSA 1NXD1 1ZZ7A 4OHVA 1KD7A 1QMJA 3VZLA 1OQEA 1QNYA 4FXGB 1A6CA 2PHUA 1AR73 4YZ2A 4WVZA 1GKBA 4O9GA 2CNAA 2IXKA 4UW3A 2YPJA 5FDBA 2XBO1 4L8QA 3WDTA 3HWJA 2VVFA 3WUDA 2W39A 4QGMA 2VVEA 1IKPA 1ZRDA 1G6NA 2ZOEB 3Q9OA 3ZX7A 4OHYA 4PQ9A 4BLIA 5JWPA 1O3QA 2BW8A 2CGPA 3FMGA 4ATFA 5CFCA 2WS92 4M3CE 1RVF3 4CZSA 5GZFA 2FHRA 1ZNPA 3O14A 4Q29A 1PVC3 1H1AA 2JKBA 4WV8A 4Y22B 1WW4A 2XG3A 3MW3A 2D43A 4XTPA 2TBVA 3J8F3 1DQ4A 1NA1C 4IV1C 1LHWA 4JGZA 5BNPA 3DPRA 2R0HA 2WLQA 2E63A 2CTVA 4Q27A 2HWE2 1WA4A 1WW7A 4YM2A 3WOGA 1D4M2 1ZA4A 5KXEA 4K1YA 5LEJA 3H7JA 1RUC1 1V6KA 4IESA 1H0BA 2WNVB 4FPKA 1Z7S2 1AR61 1Y43B 2JJ6A 1W6OA 1GNZA 3D5OA 1Q5OA 3FBYA 4YVSC 4AF9A 4CDUC 2I07B 3RG0A 4JRAA 2X5IC 5CU1A 3JBG3 4BIFA 1LHNA 1MZFA 4CDQC 2CWSA 1O5LA 2VECA 1ND3A 1ZM1A 4MGKE 4JQRA 5ABJC 2BUKA 3SXWA 1MEC2 2XVLA 1KJLA 3WZ1A 2XPJA 1FYUA 1WD3A 4XW3A 5K8SA 2Q30A 5BV6A 2E6VA 3IMNA 4P14A 4B7KA 1ZRRA 5JSOA 1MS0A 4XHXA 3ZSJA 2XJQA 3WP3A 1AR83 1BJQA 1TME2 1WCDJ 3MIDA 2UY8A 1I6XA 4K7JA 1N1VA 2WL1A 5F6LB 4ZXKA 2JENA 1MS1A 3AP7A 4AVSA 2QQPA 1VBB3 3U4XA 2YC0A 1HXS3 2YGMA 2WT2A 2D98A 2XUMA 3UJQA 4I0BA 2NM1A 2FMYA 1ULEA 3RS6A 2UYBA 4RR3B 3UKTA 3LB9A 4XJ9A 3S6PA 3KT7A 4IEZA 5AC92 1HRV1 5C8CA 4NVPA 2CYFA 3H1YA 4BH9A 3S7IA 4XOGA 4R52A 5T55A 4CEWB 3ZFEA 5EXOA 1ZZCA 4R9BA 1RUI1 1KXGA 1XE7A 5E88A 2F4PA 2GMPA 1ZRCA 1FV2A 5KHJA 3JB4C 4GMP1 4FTEA 5I91A 3NV2A 4DXZA 4YSFA 1ASJ1 3ATGA 4P9XA 4EROA 2QUOA 5LK7B 4YW1A 3ZXKA 4DNYA 4PBOA 5T5JA 5JVVA 4NPRA 4M3CF 3A4UA 5DUVA 2DWRA 1OOPB 1ZBE1 3HMYA 4DMIA 2QJVA 2P3KA 2EXIA 3DF0A 3VN4A 4B8EA 4CTEA 3PMEA 5LEKA 2QNKA 3VBFB 1S0BA 2ZKNA 4QQLA 3VBUA 3AXDA 3VZKA 4XF0A 5GLVA 4CDWB 1UN1A 4AVBA 4Q1RA 4BZ4A 4Q4W2 2BNNA 4LBJA 4ZU4A 5L73A 1GBGA 2ZX2A 5JMCA 4IV1A 1AL21 2XJSA 1R1A3 3M3CA 2RR13 1MS4A 4LNVA 5A33A 3ZN5A 3H50A 4FXKB 4EJRA 3FZ3A 3WG1A 3TN92 3WG2A 4M3CA 4OUSA 3V64A 2NP0A 4WM8B 3PVOA 5FQ0B 4MV2A 4PBPA 3OD4A 2OPKA 2WZR1 1PGW1 3H3UA 1AVBA 4Q8KA 3MDPA 4OFGA 4N7UA 1PO23 5GZDA 4CDUA 4YVSA 2JE9A 3QLQA 1DQ1A 3VKOA 5J48A 3AZVA 3AP5A 2B39A 5GLTA 5J09A 1I1EA 1HW5A 1O91A 5KBFA 1POV3 5FFOC 2YUEA 4HSLA 1PO12 2CGOA 2WIIB 4R9CA 1YI9A 1UL9A 1TME3 3HBZA 3NAPC 1RGSA 2OUJA 4GIQA 1EYBA 2ZGPA 3R4UA 1S0JA 3MFAA 2OUHA 3AX4A 4XZPA 5L19A 4LA2A 4MXVA 4AGGA 4COZA 2NLRA 2VMGA 1Q8QA 2EAKA 1UZZA 2WJSA 2ZMNA 3VBSC 4FTBA 1LHVA 1CD3G 1LOAA 3EHKA 4HK8A 4QPYA 2LM3A 5BNNC 3AJZA 2QZ3A 1OA3A 3I7DA 4Z2WA 3J8F1 4E2QA 3A0NA 1OPMA 2PLV2 4GA9A 1PK6A 2IXCA 4U2AA 3IDEA 4Y4YA 3VKNA 2RM22 3RSJA 4MYEA 1RINA 2QDNA 3M8LA 4PIXA 1FI2A 5KWRA 2A71A 5DDJ2 1ALYA 1G9DA 1V9U1 1EP0A 4W6YA 2GH2A 5JPNB 1V6LA 2WQ4A 2ZHLA 3TWIA 3V0AB 4YM1A 5H9SA 1IS4A 2QVSB 1REEA 3LA3A 4ISQA 5ACA3 3AK0A 1K5MA 1EAH3 2ZX4A 3ZXDA 4FCAA 3JBG1 1RHI3 2PAMA 1CN1A 1RUG1 2XJRA 3VBOA 4EWAA 1XRUA 4E27A 2ZGMA 3PJYA 2R6QA 2LTNA 1G7YA 2RMU1 4OI0A 5FLIA 4MSVA 1SLCA 1WW5A 3AKRA 4DQAA 4IV1B 1NA1B 4PCRA 4C1WA 5A3MA 1AYN1 3MIFA 4LUMA 2RS32 1COV3 2B9UA 3B01A 5BUVA 2ZGKA 5JR7B 4FBFA 4M3CB 3KT1A 2Q4SA 4P9YA 1RUH3 4Y26A 3NV3A 1QQP1 3KCXA 1AYM2 1FMD2 2OZ6A 1ZBA3 4HVOA 4NR1A 3T1MA 2CAVA 3ALQA 4LO6B 1F31A 4KWKA 3WINE 4GXLA 2VMIA 1GQGA 5FO8B 3NWKA 4PLMA 2HWF2 5D1IA 4CDUB 1VBB1 3LOBA 1MR5A 3MF9A 2WFPA 4LE3A 1D0GA 2X5IB 3AMNA 1ZZ8A 5DZEA 4R4XA 4CDQB 1LU2A 2XLGA 2WQZC 3E5XA 5I0TA 1BKZA 1UPSA 5ABJB 3ROUA 2ENRA 2I2SA 1CPNA 2WLPA 4YLZA 3AFKA 1PO13 3WDUA 4HPKA 1X7NA 4B4QA 3OJBA 2B46X 1F8VA 1UIJA 2NMOA 1RUOA 1TQ5A 1DHKB 3HN1A 3WUCA 2WS91 1X82A 1BBT2 5JLVA 3IBMA 3BODA 5KHIA 1Q8PA 4ORFA 3FUOA 5T5PA 3N35A 3WQ1A 2WFF2 2VG9A 4P9GA 2PLV3 3ZIWA 4S2DA 1VRH2 3B3QE 4NWWA 3I54A 2CWMA 2FQPA 2Z2SB 2Y0OA 4EV0A 2R1BA 3LAGA 2HWE1 2DV9A 5DDJ3 4IEVA 3O5SA 5EJ3A 1D4M1 1SQ4A 1SACA 1JYCA 1QJY2 2G4IA 1ENRA 1PNFA 3SMHA 4COYA 2I45A 2CY6A 3H1MA 4MGIE 1R1A1 1V6MA 2VNRA 3R05A 5HI0A 3CLPA 3RI9A 3ZPYA 1WBFA 2A6WA 5BXXA 4H3WA 4H7LA 5T54A 1A3KA 3CF6E 1O4YA 5H9PA 1GYKA 1QJX2 5AVAA 5GLWA 1LODA 3GHNA 5BNOA 2PAKA 4Y1VA 3SLIA 4CRQA 2OZJA 1LRHA 4BQ1A 1JHNA 2GZWA 4RD7A 2BVBA 4AG4A 3JD72 3D0JA 1FAYA 2RJKA 1SCRA 3QOPA 2DU0A 1AXZA 1IGOA 2ZX1A 3PMSA 2GNTA 2I74A 3SH5A 1H2NA 4LBKA 2BFUL 5C33A 4KH9A 1TME1 4KWLA 3ZSEA 2XBO3 4RFT0 3B02A 4V1PA 1OA4A 1VAMA 1V6NA 2DVFA 3U11A 3U0ZA 3RZZA 2AREA 4R8HA 2D40A 1D2SA 2PYTA 2YHJA 1V6JA 3L2HA 2BPA2 3VZOA 3ZXJA 4JVAA 2JICA 5DG2A 2X8KA 2F6BA 1LHUA 1M06G 1TNFA 1YWKA 2PHFA 1TE1B 5GLUA 4DFSA 2XJTA 4DRVA 2TEPA 1KDMA 3OD0A 3ILNA 2HEWF 2A6XA 2VOXA 4CYDA 1SDWA 3VHOA 2A3WA 1YIFA 5CB7A 3R0RA 1VR3A 3ES1A 5GLZA 3VKLA 4AFBA 1H9PA 3NAPB 4NHMA 1FPN3 4I01A 4WM7C 1VLNA 1AZDA 3VHRA 4JC1A 4JGYC 3RNSA 1AHSA 5ACA1 2XGXA 3W59A 1ENXA 3ZFGA 1EAH1 1OSGA 2XLAA 3VBSB 5L7OA 2E51A 4QQOA 4AVCA 1AR63 1NXMA 1RHI1 2OVUA 5FAXA 3ECQA 1RB8G 1QXPA 5BNNB 3VUOA 1DGRA 2JX9A 3G7DA 2DUOA 1UF2C 4K40A 5JI9A 1GFF2 3N7MA 2AGSA 1EPZA 4X8NA 4PF5A 1S1AA 2HWB3 3TN91 2R49A 3ENRA 3MEPA 2XHKA 4PJYA 3PLQA 1ZBA1 4FQ4A 3BALA 5J98B 1X8EA 2WWSA 3KD4A 1H8TB 3AMPA 4AQTA 5CFCC 1RUF2 1HKDA 1XU1A 4YM3A 4QU2A 3ZXGA 4OULA 1C28A 1YFXA 1G9AA 1VAKA 4AHWA 5JSPA 2W0XA 1D0HA 1F5JA 3QACA 1EV12 1GICA 3FX3A 2BVVA 3PVNA 4QGLA 1C8M3 5BNPC 3DPRC 1SFYA 4FO9A 2CGNA 1A8DA 3KS7A 4FPEA 5JCTA 3RQ0A 1PO11 1HRV3 1C1FA 4QPIA 4C0HA 4M00A 4IV3B 1DGRN 3VZJA 2H0VA 4FPLA 2VOVA 2JG9A 4SBVA 1JUIA 1O7FA 3QCWA 1MVEA 4I02A 1W6QA 3WDXA 2MNGA 4AI1A 4G4FA 1RTVA 4EN8B 4GMP3 2VY0A 3SISA 5JAXA 5KXCA 3DN7A 4KBBA 2WA3A 3SCFA 3IM0A 1YFWA 3M7AA 4RL7A 4AFMA 1AR93 1ND3C 2PHTA 4XQWA 1ND2C 2PLV1 2VNGA 3FC0A 1ZBE3 4AYUA 1IS5A 3GHMA 1OKQA 2BWCA 2RM21 3D4KA 4DZGA 1YXWA 1BQPA 2XVKA 1HQWA 1WMDA 5T5OA 4AVAA 5DDJ1 1YIPA 3WW3A 3ZIXA 2BYVE 1YNAA 2A73B 4E2GA 3O0VA 3ZO0B 1NOVA 2QKDA 4I3PA 1VIWB 2HWC2 1I9RA 2DVAA 2WNUC 1FNZA 3VBRC 3WD5A 5C8WA 3UKNA 3O0WA 4AFDA 4A2UA 4Y5Z0 3O0XA 2A6ZA 4GH4C 4K3UA 2AH2A 4TLFA 4LBOA 3WDVA 1AL23 1W6MA 2HEYF 3JCIA 3BU7A 1SBEA 1HRI2 4WM7A 1SMVA 3TNPB 4Z8BA 3WHTA 3I59A 1NE4A 2TNFA 1PIV2 1QJU2 3O7OA 5C8CC 1OI6A 4NOTA 4XDQA 4AEDB 4EWDA 2RS31 1CGPA 4YW3A 2WZR3 3AB0A 3THTA 3ZFEC 2D6LX 1CAVB 5HBAA 3AJYA 4XFFA 2NYYA 4Q8LA 1HX6A 5BPXA 1CAWB 1FMD1 1BEV2 1CAUA 3OYWB 3ZXLA 5FLHA 4AQ2A 2HKXA 3J26N 3C3VA 1RUF3 2LALA 2NZ9A 2HWF1 2Y26A 4YGBA 4UBHA 1UX6A 5F6KA 4MXWB 4JAAA 2ZS6B 1DLLA 3VBHC 2W08A 3DV8A 1G9CA 2VNOA 4AI3A 4ES9A 1UU6A 3G6JB 1LGBA 3S30A 4CP0A 4XFBA 2MEV2 3VBUC 3MICA 4CP2A 5JOZA 4AEMA 2A75A 3GBFA 1FX5A 2SBAA 2ZGTA 3GBWA 2A3XA 3WQ7A 3R4DB 4JDNA 1DGWX 4OVEA 2VW2A 4HVQA 1SEFA 2VVDA 5KHHA 1W39A 1NQDA 3BTAA 1YFYA 3ILRA 3OY8A 4EN0A 3L2YA 4ZU7A 4HN0A 1FOD3 4LO4B 5SV8A 2UWAA 1LENA 4ONUA 4C91A 4MGZE 3WP5A 1FPN1