5E1AA

Structure of kcsa with l24c/r117c mutations
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e1aA02
3VGBA 4MAUL 3BJ91 1H5BC 1R3JA 1ZXQA 1E4KC 1YQ2A 2WUBL 5SWZA 3VGEA 3MRIB 4JZJB 4MA7L 3OKLB 2ADJA 3E8UH 1HXYA 4X7SH 3BKJL 2FX8L 4X7FC 1MFEL 1NBQA 1FLTX 3WD5L 1LO3L 4XPFH 1A7PH 3FQUA 1AD9A 4GKZB 1CK0L 2F5BH 4HKJA 1V5JA 3OKEA 3SE4A 1IT9H 3VXSD 5EIQA 5JXEC 1M6OB 5HHVH 1QQDB 4FTVE 3W9EB 4YXHL 2UWEB 3E3QE 2XZCH 1QG3A 3MRNA 5ISZA 4DZBA 3DV6A 3WCYA 4JFQB 5TE6H 1A7OL 3WIHH 2DJ4A 4DFIA 5IBLD 2JIXD 1GC1H 3P11H 1VFAA 5EU3A 1NBYA 1KV3A 1P1ZA 3O45A 5IMLB 1Q8MA 3W82A 3WNNA 4GBXD 1MCEA 2M2DA 3PDOA 1BBJA 5C0NC 2NXZD 2O5YH 1BWWA 3QDGE 2NXYD 2NZIA 3T4AA 1YMMA 5IGXL 5FFLA 1JYNA 4APQD 2B0SL 4NN5B 2BY0A 3AB0C 2IPUG 1EEUA 3ROOB 4X6CE 3BP6B 3NAAH 3T65B 1Q94B 1ZEAH 1G84A 1K2DB 3ROLB 3TPUB 4EDWH 5DJ6A 4GS7B 4P5TD 2RCSL 4ZG1A 4DVRL 1A14L 2BNRE 4BQ6A 2IC2A 2E27L 4IRJB 1MREL 3F7VA 4JFFD 5FA3B 5C0AB 4WUUB 3MOAL 1LEKB 2FECL 1AR2A 5GSVA 2PUQT 2OTPA 1TJGH 3AREC 5DJ2A 3HB3D 5CGMA 1XT5A 3QWRD 5SWSD 4Q9CA 1A9BB 4HIHB 3UZVB 2VLRA 3WBDA 1KOAA 4U7SA 4PB9L 3WO4B 3IFNL 1YNLL 5IEHB 1LE5A 3FAWA 2JJWA 4YHPB 3QUXD 5E2JA 3I3EA 2WMPA 1CD0A 4P3CL 4C83B 4JZOA 4J3VA 5I1CL 3MBEC 3DVGB 4LP4A 2AEWA 3G9VA 3QQ4A 1RQ5A 2XTLA 4ERSH 3LN5B 2O5ZL 3QQ9D 4ODTL 1KIPA 1KPRA 4XHJC 2H2SC 1H8OA 4OBRA 1P9MA 2VDNH 4YQXH 3KLHC 1VENA 3FO9B 5FUOH 1OAZL 5KVGL 1F97A 4OZHA 1EHXA 5JPNB 2C3HA 2DYPA 3NCYP 2ID5A 5IBTL 5ESAA 1V3JA 4ONGH 5EB9A 1IM3A 2YSSA 2AK4D 3H3KA 2R2HB 3BH9A 1CICC 1EV2E 4FXLA 3S7GA 3EJZC 3OG4B 3SCMA 3BO8B 1WCBA 2CDFA 3FT4B 3PWNB 5E4IA 1MCRA 2BSTA 3LN9A 2MCPL 5J11C 4JDZA 1J0IA 4NHCL 4LRIA 1X5FA 2HFTA 2RB8A 2JELL 2YMXH 5I74B 1N59B 5GIRB 2DWEB 3L1OL 3QAZC 2X7LB 4X6CF 3QDJE 4JG0L 2JLLA 2R0LH 4PJAE 3GMOA 4R96A 2ESVD 4X80L 4OI9A 1DANT 1TNNA 1UFUA 3SDYL 3FO2A 1VGKB 4LHQB 1DQTA 5C0RH 1LDPH 5T5NG 4HMDA 1W0WB 4AM0B 1OAXL 5IVXA 1YQVH 3GKZA 3JUZA 2OTWA 2CRZA 3VFRB 3P4OA 3E8UL 4X7SL 4UU9B 3PABA 3G6JF 4R2GC 1FZJB 3BHBB 5I1KL 5IB3B 3W0WE 2XKSA 1A7PL 4Y4FC 2XQYG 3BQUA 2NW2B 5FCSH 1XH3B 4KI5E 3MUGB 3STZB 2F5BL 2CRMA 4LSRH 4ZXBC 2HH0H 3CZJA 5HHVL 1DSFH 2LAAA 2XZCL 3BP4A 5DDHB 4MA8H 5TE6L 3WIHL 1BQUA 5E6IA 4HLJA 4OUUB 1GC1L 1IQDB 3B9AA 3P11L 4LLAA 3FQWA 3FQRB 4JQVA 3L5JA 5CLTA 5LG1A 4XXCA 3O3AB 2W65B 3ULUD 3GDBA 3T0WA 4JVWA 4CU6A 1R6VA 2FO4B 4J4PC 2E6QA 2ICWJ 2GTWA 2Q20A 4NJ9H 5GS0H 1TTGA 1LP9A 5EOTB 2GHWB 3UCRA 1L9MA 4P2RE 1NGWB 3NAAL 1RZJL 2XZAH 3VDBA 1ED3B 1T4KB 3CX5J 3QDMA 4KROB 1CLCA 1ZEAL 4LSTH 2MWCA 4WEBH 3CFIC 1TJHH 1QSFE 4EDWL 4G43B 1EEZB 2NY4D 3VXME 3DX9A 2KL6A 3MFFA 3DHMA 4NN7C 1ZT1B 2KKQA 4N5UA 1FIEA 5KSBA 4NM4H 4PJ7A 2IBZY 2D7MA 2EKJA 1S8DA 4O51A 3UTSA 2D7OA 3HRPA 5EPMB 2X89D 4MAYC 1CI5A 35C8L 2VNCA 2W9DL 4C54A 3QUKB 1B3JA 5GS0C 3VXUA 1IAIL 3VFWA 4DGVL 2N7AA 4GKNB 5IHUH 4ERSL 1NGZB 5E8OA 4LRNH 1JZ2A 5GGSB 5JDJA 3X13A 2CUIA 2Z0BA 3ZSTA 5BQ7A 2QR0B 1BP3B 2F53D 5FUOL 5FHAH 4JGMA 5IFAH 4WGWB 4NHUA 4WENB 4XRCA 5B3JE 4MLSA 3FCTB 2IQAB 3KPRD 1RK1B 4L4TE 4DOHE 1UCTA 4I0PB 4MD5B 4ONGL 1OAKH 3CLFH 1ZHNB 2YPKB 4NPYA 5EULV 1GGIH 2DF3A 1KJVA 2HLAA 3EYSL 4HX1B 5F89A 4K7PY 2DRUA 2XQBH 2Y7QB 3RWHB 2AV7A 5I76A 1INQB 1YNKH 5D7KE 5EZOL 3ZDZE 1A1OA 2YMXL 3RGVA 3ULSA 4JVPA 4AT6A 1UT9A 2O5XH 4R0LA 2AJUH 2NY0C 2VRAA 2OL3H 4PRBB 3P9MA 5T1LA 2VR4A 5C0RL 4NKDA 2FATH 2VAJA 3DI3B 3UBXG 3FQNA 4XWGL 3DPBA 3VU2A 5I17A 3CZFB 3L3GA 1YQVL 3PWLB 4QCIA 4ACPA 1K85A 1A6ZB 4HXAH 5F7YC 4BSVA 2GJ6B 5MENB 5C8JA 5MP6H 2E7CA 2A6JA 5IFHH 3V52L 3ZLQC 4P5KA 5HI4C 2ZCKH 2W0FA 3BH8A 3QUYA 2YBRA 4PRNB 2LE9A 4PY7A 5CEXA 2X09A 1KIUA 4LSRL 3FB6B 4QRPD 2HH0L 3VJ6B 4HF5H 4Z0BH 4ZOBA 2ATKB 3OKNA 1T20B 3DSFL 2R1YA 1S9YA 2C3XA 3I02B 3C9NA 2JTDA 3CDGA 4JJ5B 5GXBB 3MLPA 1BQHA 3O6FC 3QFJD 2WANA 3DBXB 3UBXB 4H88H 4BH8B 1N4XH 2LVCA 4OZIB 3OWEA 3FT2A 4JKLA 1SJHA 2F19L 5IIEB 5B3JF 3AUVA 4ZFZB 1D6VL 2X4TA 2E9IA 2W0PA 2GEEA 3KPMA 4JFED 4R26H 3QUZB 3OJVC 4NJ9L 1OAUH 5CP3H 1PX4A 3WFDL 4YZFF 3D39E 5GISH 5E2UL 4EUPH 1MFNA 3QEHB 2XZAL 3O8XA 4HDIA 1WAAF 3RDTA 4LSTL 4WEBL 1OF2A 2X4OB 4J1UA 3ZT7A 4XP5H 5B38G 3ZDZF 1TJHL 4NO0A 3A6OA 5EBMB 3VA2C 3VI3E 4I0CC 4XPBH 2CK2A 1C5BH 1L9NA 4HJ0C 2R23A 4NQCA 4CNIB 1U3ZA 4BFBD 3TZVC 1RJLB 3I50L 4JY5H 3MRRB 3MV9B 2IAMB 1BIIA 4NO2A 3VD4A 4RBPH 4HJGB 5DRWA 1QSEA 1AJ7H 4ZUVA 4ZSOE 1IEHA 5MEOA 2DQFB 3DVNA 1Z9OA 5I16B 4GW4A 3T0XA 1F4YL 3QSKB 2V7NB 4X7CC 3MLUL 4ZFOA 4LDLB 4UAOC 5LVEA 5IHUL 3CCHA 4BQBA 3LN4B 3TIEA 3VFGH 3EGSA 2XYCA 2D7TH 2EIBA 1AO7A 1Y18B 3WFCH 3HS0A 5FHAL 4UDTB 4R97C 2NX5D 1KGCE 1LMKA 1VADB 2OXHA 1IJ9A 1NBZB 1ZGLP 1OAKL 1QHPA 3CLFL 5BO1H 1GSMA 2WLZA 1CG9A 4N8CL 1OQXA 1E6JH 4PTTB 4C56B 1CZ8L 1GGIL 1T6WA 5I66A 1JJUA 3F6IA 5JIKA 5I1DA 4M7LT 2DQTH 3GSNH 3LZFH 4WY7H 2HTLC 2EIZA 3CIQA 1YNKL 4IMKC 1WJ3A 3T04D 1F3RB 4EXKA 4P5MA 3JWOH 2WUCH 1H3GA 5HHMB 3TLRA 1MAMH 1PDKA 3WFZA 2AJUL 4MJ5A 2OL3L 4LLWB 1ULVA 3VI3F 1S7XA 4E5XA 1ONQA 2FATL 1MLCA 5MEPB 5K9OA 3ZE2E 4D0BA 5LQBH 1MHPH 4X5WB 5ERWB 5I18H 3H3BC 3QIWB 1U8HA 3SDDD 5MP6L 4Z7NF 2NR6C 1LO0H 3WE6B 5IFHL 2F8XC 1QYGH 3QZWA 4PFEA 1TZHB 4CW1A 1TQCC 4LCYA 2ZCKL 1WWAX 1FE8H 1PEZA 3QEGH 1KTDA 1X4YA 4JHZA 5JHLH 4XXDA 5K9KB 1DUYB 2X4RA 1EFXD 2YUWA 4XP9H 4ZQKA 4NCC1 2VQ1A 1FPTH 3VWKD 1Q0YL 3JWOC 3G5XB 3ARQA 2Y5TA 4WWKB 3X11B 4NQSB 4RFNC 1J9CT 1BZ9B 1CXEA 3GNMH 1K4CB 4H88L 4LLYB 5EWIH 1F3JB 1KG0A 2VDQH 4I13B 3WLBA 1YEGH 5KS9B 3SJVA 4UV7H 2EECA 4R26L 2PW2A 4M6OH 5DVKA 3NFPA 1IGJB 2G2RB 5HBBA 3RWFA 5GISL 3RFZC 3ALWA 2GITA 3DIFA 5ANMA 1TXKA 2XFXA 4XCEA 3D1MC 1G6RA 1WTGT 3SKJH 4M1CC 5EG6C 4XP5L 2WAHA 4S1QH 2IWGA 4QHUB 1CR9H 1I3RA 4XPBL 3V6BR 3VWJB 4YHYC 2EKSA 2OR9H 4FQQA 4BKLA 3QISA 1YMHA 4KXZH 5T33L 4OF7A 5IJVA 5BJTA 4UQ2A 4JY5L 4QRTA 3SKOA 5MEQA 5D4QA 5DRZA 4KU1A 5H94A 4YWGL 2FB4H 4LSUL 2QJDA 5EU6D 4NKOA 3CVHA 5CKGA 1AJ7L 5CJ5A 3NABH 4F57L 3BOVA 1FAIL 5EC2A 1KJ2B 4ZD3L 2DQCL 1ZSDA 4D0CB 1A7RL 4OLEA 1H3TA 3UPCA 3RI5K 5A2IH 2PYEB 5C0ND 2LVEA 5DJCA 3UTZA 4MQ7B 2Z9TA 5BW7C 3WFCL 2GK0A 4OZHF 1FYTD 1CIDA 5D8JH 2P48B 5SX4H 1NFDA 1OQOA 1IM9A 1DBKH 2V5TA 5FGBA 5HPOA 3G9AB 4JO4H 4L8DB 1QRKA 4JM2A 1NMBH 4X4XA 2E7LC 4X0KB 4JPIA 2YA2A 4AG4L 5BO1L 3RWGA 3V6OE 1IARB 1E6JL 5C0JA 1KIQA 1UWGH 5HD8D 1CLYL 4PRHA 2C9AA 5KSVA 2OJEB 1MFBH 1NEZA 3GI8L 4WFHD 2DQTL 3GSNL 3LZFL 4GG8B 2A83A 2D7NA 2I5YH 4WY7L 4ZDHB 1OD9A 4CVUA 1CFNB 3MNVA 4ZFFB 5DURD 3PGCB 3DRQA 4JRWA 1LD9A 2WUCL 3T77B 3MRLB 1UKSA 3MBEB 2AK1H 1MAML 4Y2OA 3L3DB 5D7JA 3RNKA 2XG4A 3IFPA 3KDMB 1XGTB 1AKJD 4BFIB 5KSBE 1YY9D 4UTBL 2VOTA 1EVTC 1E6OH 1MPAH 4DZ8B 4PB0L 4MYWB 5E5RB 5JA9A 5LQBL 1MHPL 4X7TB 1XF3B 5JW5B 2VH5H 1R3HB 2FZ3B 4YNYB 3CDCA 1QYGL 3ARBC 4NO5B 5FOJA 3VXUE 5C08A 1FE8L 1TJIH 3ILPB 3FRPG 2GUOB 5FGCB 1T7ZA 5JHLL 2O61B 3F12A 4XP9L 3DROA 2YD7A 3UTPD 2UZIL 1HHHA 3ARFB 4NYLA 3GNML 5MHSE 5EWIL 3NZHH 3QNYB 2VDQL 3MSPA 1DDHB 1KXVC 2VLKE 4Y16D 1T04A 4PJFA 5I73B 3R0NA 4UV7L 3LSOB 3LV3B 4OCRH 1T0MB 3C5SA 4R2GB 4TN9A 1H3VA 3OKMA 4LVNC 1XGRA 2GTZB 4KRMB 4LHUG 3CXHJ 5L2KE 3MJ7B 4BZYA 5F6IC 1ND0A 3D85B 4D3CL 5M94B 3V5KA 5EOCH 5L8JB 3WIIL 4ZXBB 4OCLC 1GOFA 3EOYG 1I1CA 3U36A 4S1QL 5HPMA 1CR9L 1M71A 5JHDB 1PEWA 5HYJB 4OIBA 2R8SH 2E3VA 4L4VE 3CLEH 1XGPA 5J1AB 4Q58C 4V1DA 3F7PC 3KYKH 4U1IB 5KSBF 2BJMH 3MNZA 4MJID 3O6LH 5AAWA 3MRDB 4GG6E 2VE6A 1K8DA 3LS4H 4WO4C 5TGBA 4DW2H 1DQJA 4M6AA 2FB4L 4RCAA 3BJLA 1JYVA 2R0WH 2VSCA 1VKXA 3ULVE 2OBGA 1UEMA 1T1YA 3RWDB 1CF8L 1C12A 4LHUB 3QQ3A 3HNVH 1G7IB 4E41E 1EEQA 3DTXA 1N8ZB 4CADB 4XNXH 5CILH 4OZ4A 2HTKC 4UIKH 3PGFL 3MBXL 3O0RL 5FUCC 3WMSA 5HY9A 4P99A 2HVKB 3U9UA 3VRJA 4PBVC 4H0HB 4J4PD 5D8JL 1EHNA 3HZYA 3L3HB 3HE6C 1NCDH 4NN7B 5DJDB 2HA1A 4HULB 4RMWA 1NMBL 4ZAKC 1U3HC 3CSBA 4KJPC 4U1NA 4OLUL 5F88A 2G60H 1YPZE 3FB8A 2L7JA 2H9GB 2F58H 1UWGL 3C6LA 1PLGH 3KXFB 5DR5H 2FIKA 2R4SH 4JO2H 2PTUA 3FZUC 4PGDB 2IF7A 2I5YL 5C0BD 4MAYB 4PRIB 4Z7WA 5MI0B 1PZUB 3LKOA 4F9LA 4QRRE 3AGVA 2Z31D 1DN0B 3C5JA 4Y4KC 3WS3A 2AK1L 5AZ2L 5GGRB 2JJSC 1J86A 4E9LA 2SEBA 2XN9B 3E3QC 12E8H 2FBJH 1E6OL 1MPAL 5ESQB 1PKQB 3C8KA 4X98B 4MNGB 3CUPA 3ARZA 1B6DA 1EPFA 5F44A 3F5WA 4HC1H 3CXDL 5GS2H 1T89A 5IWLA 1LGVA 1B4JH 1RURH 2O93L 3J7HA 3DGCR 5IMKB 4OKDA 2Z93B 3BGMA 5D7SL 2AEIT 3KR3H 3ULVF 1MQ8A 3ZKXB 3ALXA 1TJIL 3GSQA 5ID0A 4EI5B 2FR4B 1RJZA 1JWSB 1U58A 5DFVC 4JVUA 1L0YA 3KHQA 3TESA 3V6FB 3CGTA 1K6QL 4FFYH 4F7CB 3EO0B 2BY1A 4NDMA 2G75B 4JFHD 4UT9H 1XR8B 2D4FA 1G1CA 4WV1C 2NY0B 4Z0XB 3TBTA 1I8MA 2V2TB 4P9MH 1YEDA 4NCC2 3V7AG 3UPRA 1QA9A 3NZHL 1WQVT 3FO0H 3D87B 2N4IA 2XTJE 1HOCA 5H37H 2IH3A 4I5BA 1IEAA 2CDEA 4Z7UA 1JZ8A 2YN5A 5KVEL 1CT8A 4OCRL 1BOGB 1JWUA 3QO1B 5EZLA 3TFKD 5F97E 1ZA6B 3NIDE 1ES0A 4FXGA 5EOCL 2DBLL 1QLFA 3QDMB 4NQXB 1T0NA 5H35A 1ITBB 4ZFGH 5C86A 3MC0A 4I48B 2HN7A 4IRSA 3QEQA 4QKXB 4JAMA 3L3KA 1ETZA 4OCYH 5HI4D 3CLEL 2P5EB 4J8RA 5DMIH 3EIFA 3KYKL 2ARJA 2BP3A 4JFDB 2BJML 4HGKC 3O6LL 4EDXA 3KPLB 4QHMA 1E28A 3LS4L 4XP4H 4DW2L 2CXGA 2R2CA 5J9PA 2DI9A 1KJ3H 2R0WL 2ZNXA 4XCYA 3U4BL 5E2WL 1KEGL 1QTYT 4PJCB 1S7QA 2YPVL 4X9GA 1RHFA 2ZOLA 4HH9B 4MDIA 3O6FD 4L5FH 1JYWA 5JMRA 4XNXL 2A6DB 2Q6WB 4GKSA 1KIRB 4N8VA 2HJKA 4M8VA 1KB9J 2YZ8A 4L3CA 2BFVH 4BQ9A 3O3DA 1X4XA 2ITDB 1FL3B 3UDWA 2I07B 2A6KA 3TBWB 1CFTB 1NLDH 3HLAA 3SDCA 3BPCB 1H0DB 2ICWB 5CIPB 4UILH 4P3DB 5BV7H 4O2EA 5GSRA 2YWZA 2EC9T 1OCWH 2YD5A 4RRPA 1YECH 2G60L 4PRAB 5DT1L 4QHNB 2GJJA 5FXCH 2FWOA 1S9WB 3Q48A 3QUMH 5DR5L 3JV4B 4JO2L 3N50A 1U8JA 1ZE3C 3D0LB 2P44B 2NTFA 4PBXA 1MHHA 1LILA 2K7QA 3TZVD 2V7HB 2XXMB 1A64A 5DGRA 2WV3A 3NIDF 4NOFA 4W4OA 4KPHH 4UAOB 3SPVB 2HMIC 1T6VN 4HKXA 3W39A 2CUHA 5KVDL 2V9RA 4LPYA 3QEUB 1HDMB 3T1FA 3QULB 1KCSH 1MJUH 5K59F 12E8L 2YEZB 2X9XA 2FBJL 1OL0A 4G9FE 3VGDA 5CEYB 4V2BA 3DUSB 1H3PL 4YC2C 5CGTA 3RGHA 5C9KA 5ICYB 5IF0A 1NCAH 2FDBP 4HC1L 5FO8A 5I1LB 4LGSB 5CJXC 5IVZB 4NM8H 3UROR 1LE9B 2QADC 1A47A 4RWHA 3EYQC 5C07E 5DRNB 4RBPK 3P9LB 4I1NB 5CD3B 1KELH 1ZHKB 5C3TA 4AEEA 3QRGH 4KVCL 5INDA 4U1HA 4ZTPH 5CEZE 2QQLL 2C1OA 3VXPB 3D3VA 3TNMB 1D6EB 4HBQA 1A6WL 1MJJA 1CFSA 3NGBC 4NNXA 3IRPX 1NFDE 1D5IL 3O41A 4UT9L 5CJBA 5HHOB 2EEAA 5ALBH 4APQA 1QLRA 4P9ML 4ZOEA 2NY5H 4P48A 4OZFH 4BQ8A 3GUTB 2BMKA 3FO0L 5BS0E 2JCCE 4M61B 4U1MA 2XWTA 4PRHE 1Q1JH 5TFSH 4EBQH 2FJFB 4X6DA 5D7LE 5FYKU 1C5DB 4LSPL 3PWPB 5HDBE 5KZCB 4Y19B 4GAGH 5DHVA 4QNPE 5IHZB 5GGVY 5BXFB 1F8TL 1I3VA 5AAMA 1G7PB 5IMMA 3U7YH 4F58H 4LNRA 1JPST 4K7FB 3GMQA 4I9WD 3RQ3A 4ZFGL 1I8KB 3TN0D 1NBVH 3VXRD 1QRNA 4KHXL 3QJFB 1BZ7A 5SWSA 1R3LA 4TTDC 1CGTA 1DLFL 1WBXB 4OCYL 3D18A 2CKBB 5E0QA 3UJJH 3LPGA 3BN9C 1A1NB 4IHOB 4JY4B 4RFNB 5DMIL 2XNAB 4LKCA 1WLHA 2FJHA 4FFZH 2PXYD 4M4RA 1MI5A 3RTQC 3MRJA 3BRFA 4XP4L 3IETB 3QHTC 4HIEB 3MV7D 3IU4H 4F7MB 1KJ3L 2DJUA 4QY8B 5EFIA 1EBPA 3SHSA 4TOYL 1EO8H 4TTGA 3I6GB 3D2UA 1I1YB 3SOBH 5F7UA 2GW5A 1EMTH 4L5FL 2DWDB 3HC3H 4OJFH 3TWCH 2IPKB 4MX7B 4ESKA 4KK8C 4Y4HC 1UXWB 1UYWH 1MVFA 3VH8G 2X10A 2BFVL 3LKRA 3N1GC 4CVZB 4KJYA 5F7WC 3SDXE 5K93A 3WO3B 5HI5C 3QP3A 5JMOC 3DURA 4TVPE 1NFDF 1SBBA 4JFOA 4LKXB 1F45A 3X17A 5D2NB 5T3XH 4FQHA 3VFMB 1Q38A 4UILL 2EDTA 5BV7L 4MD4B 4O2FA 5FGRA 1J05B 4YO0B 3WLWC 1YECL 4M1CD 4YHMH 2JCCF 5SX5H 4HEPG 5C9JA 3FMGH 1UEYA 2HLFC 2P8MB 3RWIB 3QNXB 4GRLD 3GB7B 3O9WC 3QUML 5HHNA 2OJZH 4PJ5E 2ORBH 2XXCB 1BD2D 3U2SA 1FCCA 5HDBF 3IRZA 3MACH 3MLVH 5DEFA 5CBEA 3DUUB 3MYJA 1HILA 4HSQA 4LBEA 3VMOA 4KPHL 4YAQA 3LQAL 4KTEH 3BDXA 5J12C 1FVCA 4K8RC 1HHGB 4L4JA 3BPLB 1KCSL 1MJUL 5FEBA 1NANI 1W0VA 4P23C 4HKZA 5ENWB 2IBZX 1RK0B 3KPSD 4PUBL 4MWFA 4JR9L 3SKMB 2WW8A 2VLJB 2RFXA 3E1F1 4NM8L 5E1AB 5HTSA 1L0XA 4X4YA 5BVJA 5CSGA 1ZVYA 1K3ZA 5JZ7C 4DTGH 1J0JA 4IRJD 1F42A 1KELL 4X6FA 1VACA 2Z8VC 3K0WA 5C0AD 3UTTE 1ACZA 2RQ8A 4KUZH 4P2OC 4ZTPL 4O4YH 4KKAC 4LLDB 3SY0A 4MXVE 4UZGA 4C57C 2AI0H 3H7BA 4OD2A 3ZMRA 4N0UE 1OVZA 5ALBL 3VXNB 3SDXF 2NY5L 3FO1A 4PP1C 2H3NB 5IM7B 5TH2B 4JRXB 5C0CE 3UYRH 4P4KB 4POUB 2PO6B 5TFSL 4EBQL 1J7VR 3SQBA 2PW2B 1BLNB 1KCRH 1U3YA 4I3RL 4GAGL 4U1KB 5DTFA 1KCKA 3DX8A 2YPLB 4JY6B 4MCZB 4AJ0A 4K07A 4NQEB 3SE4C 3U7YL 4F58L 5D1QA 2MPAL 3AAZA 4S2SA 4ZYKA 3MTRA 2XKNB 4XVTH 1NC4D 3OZ9H 4N9GB 2WBJA 1XCTB 3MLYH 5KN5A 3BXNB 1WC7A 3V4VH 4HZLA 5I1GH 1JUFA 2Z35B 3SE8H 1MFDL 2X5PA 4O2CB 4H25A 3UJJL 1W72B 4DFHA 5A2JH 3PQYB 5B39A 4M43H 4FFZL 2G5BB 1MCDA 5H2BA 2WWKT 1AGBB 5H94B 4LCWD 5I1EH 3IU4L 1FIGH 5DVNA 1GOGA 4JKWA 3G5ZA 1BREA 3QH3A 3MRQB 4M03A 3UX9B 3UXFA 1U8MB 3MV8D 5ETUA 3SOBL 2APTA 1EMTL 3HG1B 4LVNB 3VG9B 3AFLA 3HC3L 1N6UA 3NH7L 2NY3C 4NQTA 1UYWL 1RIVH 3LMJH 3QWOA 1MEXL 2WINA 1FFOA 4EVNA 1WBYB 3GRWA 2ZKHH 3BEWA 2PYFB 4JPVL 4MXVF 3K2MC 5EO0B 3D48R 4P9HC 2JJTA 3ES6A 4WNQA 3SDAC 6FABL 1SEQL 3WHXB 5T3XL 3B9EA 1UM5L 4R4BA 2AJZA 3RIAF 4YHML 4F33A 1H8SA 4OKVB 3U4EA 1JE6A 3MLZH 1A2YA 4ZOCA 4ZS7H 5CFHA 2OJZL 4N0YL 2ORBL 4OI8A 4UIMA 5F7DA 4LSVH 5EA0H 2X44D 4WU7A 4YPGB 4RZCB 1OP3H 1QP1A 1KACB 4HGMA 3MACL 3MLVL 2AKRA 1T03H 2VITA 4N8PA 5HYQA 3BZ4A 2ZUUA 4GRWB 2DBJA 4WO4D 5IB2A 4IM8A 3QXUA 3V5HA 1MY5A 1DFBL 4KTEL 3NFSH 1P7QA 2FGWH 1RJYB 4RMUA 2GI7A 3HE7B 1SMAA 3X12B 3HMWL 4MHHG 4P4RA 5DJ0A 2BVPA 4YHIB 1AIFA 4TULL 4KROD 4Z78A 4QRPA 2HTKD 5I6XC 1ZGLM 4RGNC 4GXUN 1BFSA 1FZKB 4U1SB 4ZAKB 3LPFA 1SJEA 1T1XA 1O0VA 3DX7A 3SCMC 4H26A 2EE3A 4M1DL 3VXOB 1WBZB 1NCTA 5BRZA 3FB5B 3KYNB 5AD0B 2FO1A 3C5ZB 4DTGL 3QFJA 4LRIC 1Y6MR 3EO9L 4L8CB 3MNWB 4AH2B 1YEFL 2J6EL 2O26U 3DGGB 4Y4KB 1F11A 1BVZA 1FHGA 2XY1A 4Q9QH 4X8JA 3EYFA 4JFEA 4ODUB 4FTVB 3RY4A 3V5DA 4GOSA 5I9QB 4UMGA 3NA9L 3GFUA 1CFBA 1EVUA 4U1LA 3RBGA 4XMKH 3IXAA 1G9NH 1T3FA 4P2QA 3RVTC 1AE6L 4K3JH 4M9OA 2BY2A 1FFPB 2FEDD 3MCLH 3PJSA 5IB1B 5IFJB 4LSSL 4MA1B 2R9HC 5DUPH 4DGYL 3QDGB 1WFTA 5I8CB 1I4FA 4L8BB 4PJ9B 4G8GA 4EN3A 4RMRA 4KQ3L 2D3VA 5I1IH 4XVTL 3REVB 1FZMA 3MLYL 4Z7VE 3T0VA 4X6CB 2LU7A 5E6IC 2QQKH 4UT6H 1D9KB 3MR9B 3SE8L 2OYPA 1S7SA 3Q5YA 3VFOB 3O3EB 4JQVC 1K3IA 3JV0A 5CCKH 4WV1B 1XR9A 4MVBC 4XXCC 3VXSE 2WZPD 3VFUB 4I2XA 1JPTH 1I7RA 1MCPL 3L3IB 5B3NA 1B6UA 1J8HA 1ORQB 2BC4A 2BNRB 1QO3B 5DFVD 2GJZA 3LRSA 1G9NC 2A1WL 3MRKA 3S3SA 1Q9OA 1S7VA 2LV4A 4XCNB 4MSWB 4LIQE 43CAB 5H37G 3SE9H 1IKNA 1IQWH 3MA9H 1NCUA 1UJ3B 2CMRH 3WIFB 3QA3A 5DD5H 5MEND 3JV5A 3ORJA 1C7SA 1FJ1A 3MRPA 5C09D 2ZKHL 2HKHH 1CIUA 4KK9D 2Z4QA 4FQJH 1J5OH 2AQ2A 1G6VK 3PHQA 5GS2D 1KT2B 4XNMB 1LO5B 2AERT 4KTYA 2C3VA 3U79A 1S7TA 5BZWA 5IQ9B 3ARPA 3MLZL 3RAJL 5LCVH 3IAGC 4FXKB 1KNOB 4JFFE 1TETH 1YUHB 3U0PA 4YLQT 5HGAA 3VFVA 4JZNB 1T03L 5JPMA 1SBSH 2DLTA 2RBLA 4CDGC 3U46B 1OP5H 4OLYL 3NFSL 2ZCHL 3P77A 3QUZD 3WJLA 1E4XI 2CLZA 3CPLB 5F8QC 3UZEA 4JLRB 4Z7VF 4GW1B 1SHMA 3GJEA 1FL5B 3IJSB 3RWEA 1NAMA 3QDJB 4PJAB 3RJDA 4PLKC 1P4LB 3BIBX 3VMNA 5EBWA 1IGMH 5FKPB 1TCRA 3WJJA 5DYOB 1QBMH 3T0DA 1AD0B 3SKUD 3Q5OA 2WIIB 1EA9C 3VWKA 4M7JH 4N5EC 3PL6B 3S4SA 2WP3T 5F7EH 2C1PB 3ZT5A 1MUJA 2V5YA 3UBXI 1AXSA 3ALPA 3W0WB 1T2QH 3B9KC 5D96C 1RAMA 2AK4E 4ZUWB 5HHPA 1JPSH 1IAOB 4U0RB 4Q9QL 1MWAA 1XCQA 4PJDE 4NKIH 2H32A 2H2PC 3VCLA 3ZTNH 1HIML 3LDBC 4XMKL 3JTSB 4M6ML 5D6CA 5CBAA 3FJTA 3OF6D 4YC2B 3BDYH 1ZHBA 5F9AC 2ESVE 3SGJC 4I5BB 4X6DF 3MREA 3OB0H 3MCLL 1LQSR 2VC2H 2CGRH 5DQJB 3GSVA 1FNEB 3QUYC 1OP9A 2MKWA 3GMLA 3ULVC 3WUWA 1U41A 1S78D 1AQDB 1ADQA 2XZQL 3MOQA 4K94H 5TQ0H 4GUPA 1OGAA 1NCNA 3RWCA 5I1IL 1UQSA 3DO7B 3OKDA 4HUKB 3OV6A 4P2RB 5T1KB 1ZV5A 2PNDA 4XNZC 2IGFL 3IKCA 2X9YA 1R5WA 1IC5H 5DMKA 3EYQD 3QIUC 5CCKL 1QSFB 4LLMA 4C58B 4LLQA 4QYOB 3W9DB 3T2NL 4PJ8C 1AXTH 1FBIH 4NNYA 3TO4A 3VXMB 5LGJB 4XPGL 5DMGD 4KMTL 3IU3B 1TVHA 5INCA 3GMPB 4L9LA 3FN0H 2IALA 5SWQA 3P0GB 4OZFG 3VA6A 2VDPL 3Q2CA 4U6XA 4L9DA 1LO2H 3LKPA 4O00A 3FKUS 4MS8C 1A4JB 4PG9B 1XGQA 3SQOH 32C2A 1P84K 3SE9L 4ODWB 1FYTA 2WNGA 5CMAB 1IQWL 3MA9L 3RDTC 1ZAGA 3S37H 5M95B 3GMRA 2DLFH 3WXWL 5AG8A 5JO5B 4FQXA 2W07A 4XMLH 5DGQA 5EZJA 4K94C 3MRMA 4KRPC 1T7YA 5ACZB 4FQJL 3V79C 5CHNB 2GIYA 2A6IB 1R3KB 5DFWH 4A6YA 5FECA 4M5YH 1F6AB 2EE2A 1AR1D 2R29L 5GZND 1N5AB 3UPAA 3LD8C 3TA3C 4BUGA 3IS0X 1FNHA 1T7WA 1R5IA 1EDQA 4WRLA 3TVMB 1QACA 4L4TB 3S34H 4DOHB 1JMXA 5LCVL 1ZS8A 2ZSVB 1TETL 3HKFA 3KPQA 1U8KA 4J3OC 2X4UA 3CSYA 1TIUA 3BN9D 3MA7A 4WHTA 4F3FB 4GRMA 1UZ8B 1FVDA 1UA6H 4H0IA 4QOKA 5CUSL 1IAKB 3Q3GA 4XC1H 4Y4HB 4U6HA 1AP2B 4JRYD 2F54D 2Q3AA 4HAFA 1CYGA 4JDVA 4WFGD 4LFHD 4NZDA 3S3PA 4QRUB 2QQQA 3UZQA 1JPFB 3BT2H 4D0DA 5GJSH 1IGML 3IJHB 4KK8D 1QPXA 3KPPB 1I1AD 1BM3H 2F53E 3JVGC 4G8EA 4PP2A 1CE1H 5A16B 4YDIH 3S35X 2ZSWA 1PZ5B 2DM7A 3O9WB 3KPRE 5F7EL 5D1ZA 4NWUH 5IROA 1DBJL 1IGTB 2OTUA 1T2QL 1KPVB 4KWUA 4JFYB 5GJTL 25C8H 3ULUF 5FOBA 2HT2C 2G5RA 3ILQD 1J87A 2YXMA 4Y16A 2P5WD 4XNQB 1XEDA 3EFDL 1JN6B 3H9SB 3ZTNL 2J1KA 2AXHA 4P23B 3SO3B 1XF4B 1ZWIB 3K81A 4FRWA 4HD9A 3BDYL 4RAHA 4Z95H 5TDNA 4M3JA 1SQ2N 4K2UL 3C60B 2PYED 3CC5B 2VC2L 2CGRL 3BYTA 3O11B 2F8VA 3WFBL 2XWJB 3F7QA 1VHPA 3FQXB 1RZIA 2W59A 5SX5K 3QIBD 2X70B 3HHRB 5E99H 5TQ0L 3TV3L 5DA4A 2CKBL 4F7PA 5IT2H 2VZ1A 4MCYB 3D39B 3OGCB 2VAAA 3MCKA 5T3XD 4CMMA 2D7PA 5D7IE 3CFJA 5EU7E 4NBYB 1Q9KA 5D1XC 4XP6H 3NN8A 5DQDH 5FYKH 1MHCA 2Z92B 3CVHH 2NW3A 3VXQA 4C4KT 4X9BA 4YJZL 4YUEL 2HFEA 4RFOH 2J88H 4U6YA 4ZUTB 1VPOH 4Y2DA 3FN0L 5DJYB 1DQDH 1BX2A 5EU5A 5ICXB 4ZFOL 2EYRA 2QLVB 2EE9A 1AGCA 4QF1A 3SQOL 4E0RA 5DS8B 2V2WA 1DL7H 3QI9A 5DSCB 2FD6H 3OJDA 5DJ8A 1CTNA 3FOLA 2DLFL 4ZSOB 3T2PA 4DK3A 4KTDH 3MV11 2ICEA 2ARWA 2L4OA 3N9GH 4F7EA 3BZEB 1I9IL 5HGHB 4OAWB 3VGFA 4PR5B 1QKZH 1BVKB 1X44A 3B2VH 3FN3A 4XPTH 1DBAH 4WHYG 1KYOJ 4NRYA 1QFWH 2Z31A 3BX7C 1QOKA 3S34L 4RFEA 4AYFA 3OSKA 5C7XH 1INDH 1X6LA 3ARFD 1FZOA 4QHLA 4NKMA 5DRXB 2XY2A 2VIRA 1AGEB 1PJ9A 1UC6A 1KXQE 2I9TB 3M45A 1CLOH 1U8IB 3TGXA 2YN3A 2IMNA 4DGIL 4ELME 3SGEH 1Z9LA 4XVUC 3SGDI 2CDGA 3BT2L 5D7IF 3SDAB 3D85D 5GJSL 1KTLB 3WHE1 3MXVH 3KWWB 4RMVA 2OR8A 5TE7H 5JHDD 5J6GB 1BM3L 1F90H 5HYJD 1CE1L 4YDIL 5D5ME 1IAMA 5IP4A 2NX5E 3RZCB 3BIKB 2VXUH 3JSSA 2CKNA 4U6VH 3F7YA 3LVEA 1YY8A 5IJKA 3DXAB 5DVLA 3GHEL 2FJGA 1RVFH 2HJFA 3BVNB 3K80A 4CVXA 4NIKB 5D9SB 2VLRD 4I18A 4G7VH 4OF3A 4ZPTA 4YFLF 3VFTB 4OV5A 1W8OA 1VFBB 3H9ZA 4JFZH 5BVPL 4AK1A 1NCBH 3AS2A 1TZIB 4Z95L 4JPWL 3PWUA 3V6ZB 4Q6YA 3TCLB 3GIVB 2HKFH 4TQEH 1T1WB 3WHE0 3IGAB 3HZKA 3KLDA 2Q87A 5E99L 5IK3B 3V8OA 4TUKH 1YEJH 5IT2L 2J5LC 4RX4D 4PREA 1DBBH 4NFDA 3ARGB 5KG9A 5I75B 4YDKH 2PTTB 4YGVB 2I9LA 1KLFA 5DQDL 3KPNA 4PRID 4ELMF 4YFEA 1OSZA 1JNHB 3HRZA 3JTTB 1CGSH 1HWGB 5J6HA 1A0QH 2IPTH 4KJWD 4Y1AA 4XBPA 1MH5A 2VDRH 3L6FB 2NY1D 3KYMB 5HXMA 5E94B 4ZMAT 2VDKH 3QG6A 4X8XA 2BNQA 15C8H 43C9B 5HGDB 1YNTB 1DL7L 1HXMA 2GK2A 3SKNA 3QDHA 4X5XB 4R6UA 3P4NA 3MO1B 3W2DH 4BK5A 3RY6C 1CL7H 3BQUD 3OQ3B 3ZTJH 4Y5XA 4MNHA 1NC2B 2WBKA 4YDJA 1I8LC 5DUMH 1QKZL 4MNQA 3IDYB 4EI5D 3B2VL 1IBGH 1DBAL 2Y5EA 1QFWL 4Y5YA 3HUJE 3T0EA 5CWSA 1F2XK 4XC3H 5F7LB 5C7XL 2APBA 5EU4A 4X6EB 3GSXA 1F3DH 1QFPA 4HQQH 2ZPKL 4LVOB 3RNQB 4C55A 4KHTH 3RIFK 3MUJA 5KTEH 4D94A 1ZA3A 4NT6B 5EU6E 3RL2B 2R1WA 2YC1A 1LEGA 1NFKA 5C2BH 3BISA 1MLBA 1O7SA 1WEJH 3FFCA 4H1LA 2B4CH 2YR3A 3DYOA 1SYVB 1KFAH 1YEKH 4UNTA 5IB4A 1R5VA 4K71B 4P46B 5B21A 3JUYA 4QO1A 3QDMD 1ORSB 4JN1L 1WZ1H 3S96B 3DOSA 2FEEL 5DWUH 4EIZC 2VL4A 3DNKA 1FGNL 5TE7L 4LCCB 2XV6B 3U6RA 1F90L 1PYWA 2NYYD 3C6LC 1SYSA 2HFGH 4ZNCD 1MCFA 3F62A 2QSCH 4YXKH 2VXUL 3CFKA 4HBCH 3ARSA 4R9HA 1QUNA 3TNNB 2P5ED 5BMFH 2COQA 5ACLA 3M1BB 4JFDD 2PR4H 1HCFX 3MOBH 4PG2A 1R24B 1G7MA 4MJ4A 1FG2A 5FO7A 5F7MC 2P7TB 1JRHI 3BP5B 3CFDB 3GJFB 4GO6B 1FV1A 4JPKH 4WFHE 3O4LB 5JA8B 4G7VL 1TITA 3NIGE 2YK1L 5BZDB 3RWJB 3PV6A 4ONFL 2UUDH 4DCQA 2GFBA 2GT9B 4RIRB 5DI8A 5HJ3B 5IWLC 1T89C 2B4CC 3EOBB 1JTTA 1AI1H 3CX5K 3U0TA 1KPUA 4LOUD 2HKFL 1CVRA 1IZJA 4TQEL 3VXRA 1YEIH 1JGDB 2VLKB 3HUJF 5JTWA 1JGEA 5KBNC 1EEYB 3ARYA 2NY7H 4X99A 1NGXB 1I4FB 5C3LD 1BAFH 4ELKA 1CFVL 5F3HA 2PXYA 4TUKL 3B9KB 5L2KB 1JF1B 2VXQH 3THMH 3WFHA 1RJCA 1DBBL 2CO7B 4EI6B 3GMMB 1RZKC 2IBBA 5FHBH 1DCLA 3CFEA 2VB5A 1E0OB 1LWRA 5FV1L 3EJJX 1T66D 5CKAA 1OP5K 5LXGL 4HWZA 4N5ED 3S5LG 2DQIH 1A0QL 1IGIH 2IPTL 3RGVD 1A6VL 4L4VB 5JW4M 4MA3B 3MRIA 3UTPE 4JZJA 5IMOB 2D2OA 4NQDB 3OKLA 3WNLA 5FIEA 4YDLB 2R56H 4GG6B 3L9RB 4XTRC 5E8DH 4MZ3A 5KSUB 1W0YT 4OQTA 2R2EB 4GKZA 2ICWI 4HWNA 2DI8A 2B7DT 5FO9B 4YHNB 2OQJB 1J10A 4E41B 5FM5O 1M6OA 1QQDA 3W9EA 3RI5F 4IRSC 5EUOE 1I7TB 1V7NH 4YHLH 2EDHA 3MGTB 1NPUA 4R4ND 1CL7L 4JFQA 3QUYD 5DUML 4PJEE 3S5LB 5DJZB 3QIUB 3NIGF 2BVQB 2H26B 3I75B 1Y0LB 4XGZB 4PJ8B 1G7JB 2A0LD 5IMLA 1WVZA 5CJQH 4CKVX 2APVA 5HHOD 1BF2A 3KLAB 4OZGE 4Z5RB 3S98A 1A6TB 1LK2B 1YPZB 4MJIE 5F6HI 1VFUA 4KHTL 2CH8A 3ROOA 2VZSA 5DLMH 5KTEL 3BP6A 3T65A 1Q94A 4OCXH 1K2DA 5C0IB 2P24B 5LWYH 4QRRB 3ROLA 5C2BL 3TPUA 4KRPB 5KZCD 5IR1B 3V4UH 2QL1A 3NA4A 4AEIH 1KFAL 4HPOH 4IRJA 3O8XD 5FA3A 5C0AA 4WUUA 1LEKA 1WZ1L 1BZQK 1TCRB 5DWUL 1JVKA 1XIWB 3TA3B 4FFVC 1HQ4B 5IOPB 2EDNA 4NO0D 3WL9B 1F58H 4TNVK 2HFGL 2ATPB 3U7WH 4PLJC 1A9BA 4XBEH 4LQFH 4HIHA 4F37K 3WFEH 2UYLB 4ENED 2P42B 4HBCL 4XBGB 4XAWH 4NQCD 2E9JA 1ZK9A 5IEHA 3MOBL 4XNYH 4YHPA 4XH2B 1R3IL 4W4OC 4C83A 1BEYH 1RZFH 1VCAA 1WZKA 3HAEB 3DVGA 1OAYH 3EUUA 1QSED 1MIEL 4LL9A 3OHXB 3LN5A 4MJ6B 2ADGB 5C0BE 2WWMD 3I85A 5EUOF 3WNKA 2D7QA 3FO9A 1NUFA 3MUY1 1C5CL 1T83A 3JWDC 1HYRC 3OKKB 4TRPL 5JPNA 4JHWH 1ZTXH 5DHVH 4PJEF 2B1AH 3KNBB 1JZ5A 4MB5A 1YEIL 1V05A 3QZWG 2XTJB 4K7PH 3HPLB 5IBLC 2R2HA 1DBML 2R0KH 3BO8A 1CXFA 1QR4A 3FT4A 3PWNA 4N1HB 1A8JH 4OZGF 5JIPA 1BAFL 5EIVA 5DHXB 2D03H 4JO3H 3TBSB 2BVYA 3THML 3VFSB 5FM8A 2NXZC 1N59A 5GIRA 2DWEA 3DRTB 2X7LA 3ZYJA 1RUKH 3BD5A 5F3BB 5FHBL 1MCWW 4GQ9H 2EXWD 4APQC 4YK4C 1I7ZB 1FGVL 1R5WB 4ODHH 4B7IA 4HCRA 1VGKA 3BKYL 2DQIL 1IZKA 1IGIL 1W0WA 4AM0A 5J3HD 3VFRA 3MJGX 2XA8H 3NCEB 3KHOA 4UU9A 2R56L 1MCOH 5CINH 3L7FB 1FZJA 3BHBA 3KAAA 5E8DL 5IB3A 3N1PC 2GSIB 3BSZH 2NW2A 1XH3A 2E9WA 3MUGA 1EJOH 2P8PB 3STZA 1C16A 3UJIL 4HKBB 4DJMA 1GJIA 2D9QB 4XPHH 3HB3C 4IJ3C 4ODBD 2E7BA 1U8NB 1KBGH 1LHZA 2MCG1 4OB5H 4WDIB 5DDHA 2X40A 3W5NA 1WCQA 1UZ6F 4OUUA 1IQDA 3TT1H 5D1XB 3QUXC 2V5MA 3FQRA 4BM7A 3O3AA 2W65A 2Y6SD 4JHAH 4KK6D 5CJQL 1CD1B 3QQ9C 1B0WA 1T5XB 1Q9LB 2ADIB 2Q86B 2FO4A 1U6AH 4JQIL 1EUTA 1BFOB 3GM8A 4HT1H 5EOTA 4OF0A 1NGWA 5DLML 3BFOA 1JNNL 2I25N 1ED3A 1T4KA 4MXQD 1WISA 4P4KD 3C2AH 4X9IA 3SJVD 1XZ0B 2PO6D 1VEMA 2AJ3B 3IYLW 1XAUA 4G43A 3V4UL 1EEZA 1KCUH 2YPLD 4JHBA 3PF2A 2EYSB 4K9EL 5KSAB 4AEIL 1F6FB 1D7FA 5I8KH 2KBGA 4HPOL 1ZT1A 3A67L 3NFNB 5DEGB 1Q72H 1TQBC 2Q7YB 4NZUH 4G9FB 2UVEA 1F58L 2NY6C 4UNUA 3OXSB 1U9KA 4XBEL 4LQFL 4XAWL 4HLZG 5EPMA 3UTQB 3PQYD 3ULUH 4GLRI 5CZVH 4GMSH 4XNYL 2DLGA 4O02H 5C07B 3QUKA 4RNRB 3QCVL 4GAFB 4GKNA 1OAYL 5CP7B 4RQQB 2LABA 1NGZA 5GGSA 1KCVL 3O2DA 1E4JA 2QR0A 1G7QB 4MQXD 3TO2B 3TBYB 5JLZB 1UB5B 4JHWL 1ZTXL 3FCTA 2IQAA 5EBLB 1RK1A 2B1AL 2Z91B 3RHWK 4I0PA 1PG7W 4GT7A 4MD5A 1OOAA 4PJIE 5BS0B 1A4KB 2JCCB 1ZHNA 4K7PL 2YPKA 1N0XH 2K3TA 4NZTL 5FKAB 4HS6B 2I60H 3B2UD 5FDYA 4JKKA 5HVWA 4QWWD 4DUXA 5JW3L 1Q0XH 1IM9D 5D7LB 4HX1A 2Y7QA 3RWHA 4JO3L 1INQA 4JM2D 3UTOA 1QR1B 4Q6IC 3ULUC 3NPSC 1QD0A 4BH7B 3H6JA 3RKPA 2CXKA 1RUKL 4M8QB 2FSEB 4U33A 2W60B 3GZKA 3IDIB 4ODHL 1RUPH 4WW2F 4QGTA 4PRBA 1QEWB 5CJ8A 2XWBB 3OMZA 3I6LE 3CZFA 3FB7B 3PWLA 4YR6B 1A6ZA 2XA8L 2GJ6A 5D7JD 5MENA 1MCOL 5EZIH 3IXTB 2NY4C 3HE7D 4POZC 5D1QC 3LHPH 3BSZL 3GRWH 2BERA 4HC1A 4PRNA 1EJOL 3EJYD 1B0RB 2WBJC 3FB6A 4LPXA 4QRSB 3VJ6A 4XPHL 4IDLA 2ATKA 3GMNB 2J5LB 1T20A 4Z9KB 5EOQH 4FZEH 1II4E 1KBGL 3I02A 4FG6D 1FC2D 4JJ5A 4I9WE 3C5ZD 3SDXB 3VDCA 4OT1H 2A2QT 3DBXA 3UBXA 1TDQA 2DL2A 4BH8A 2YD6A 4OZIA 1G7LB 4P59H 2I24N 3QO0B 4JHAL 5IIEA 4ZFZA 5IESH 1EO5A 4XP1H 3QUZA 3VGGA 5HYIA 1QLEL 4G6FB 1U6AL 1QBBA 4R90H 4CBPA 1CDBA 2A73B 4IMLB 3MV7E 1EGJA 1H9VA 4PJ5B 4OI7A 3QEHA 1M05B 4MMXC 1GAFH 2X4OA 2VKWA 2YWYA 2FHCA 3RPIB 3ZO0A 4UDUB 4WJ5B 5EBMA 2JJTC 4WI4A 4ZO6A 4A2LA 2EEDA 3KJ4C 4H20L 3MLXH 4KY1L 4QXGH 4PJ9D 4CNIA 2D4DA 4MGXA 4RGMC 1Q72L 1UB6B 1OSPH 2JB6B 3DMMB 4ZPVB 1RJLA 3MRRA 3MV9A 2IAMA 3ZTJG 4IRZL 3RUGE 3OX8B 1D9KD 3P40A 3J8F7 3JWNC 4HJGA 4GFTB 4DAGH 2WK2A 2OZ4L 4MHHI 4M6NH 5JOPD 2DQFA 2G9HB 2VR5A 5SV3A 5CZVL 4GMSL 4KVNL 4O02L 5I16A 5MERB 4NKQB 2UWEE 3LEXB 4QXTB 3QXVA 2V7NA 4X4MA 5JOFB 1QSZA 4UI2A 3UTTB 4I4WB 3X3GL 2X4NB 1BD2E 4DK6A 3LN4A 3RPKA 5M7QA 3CU7A 1Y18A 4BZ2H 4N0UB 1T80A 4UDTA 5EU7C 3TPKA 5L7XH 1CGVA 1VADA 5F9JB 4AMKH 3L3JB 1NBZA 3HI5H 4U1GB 2EDKA 1N0XL 5C0CB 2CD0A 4PTTA 4C56A 2I60L 2YD1A 2PCPB 2AJSH 4AEHH 1Q0XL 3KPSE 4N68A 3RU8H 1XGYL 2B39A 2J8UE 2NTSP 3C8DA 1TVBB 4H8WH 5L8KB 1MRDL 5C0AE 4KH2A 3VW3H 1MFCH 4LLWA 3S88H 4MAUH 1L7IL 2WUBH 3SBWC 3ZDYE 5MEPA 1DVFB 3CSGA 4X5WA 5ERWA 3QIWA 3I6KB 4PGBB 2FX8H 1I1FB 3QB7C 3WE6A 1MFEH 5GS3A 1TZHA 3LHPL 4O58L 4L3AA 3RUGF 3GRWL 4EN3C 1K8IB 2RJMA 4GW5B 3VD3A 1KJMB 4WHDA 4KRNA 3O2VL 5K9KA 3VFPB 1DUYA 4F15C 2JKXA 4RDQF 3DYMA 2UWEF 3LKSB 4FZEL 5EOQL 4YXHH 4KUCD 1MCNA 3BGFB 3G5XA 4WWKA 3X11A 4NQSA 1RSFA 2VXVL 1BZ9A 2BVEA 1K4CA 3E2HC 3BPOC 3P9WB 4LLYA 3QHFH 3HN3A 1F3JA 4KI5D 4P59L 2UUDK 1E4KA 4LAQH 3B6SB 4ODXB 1MCQA 5KS9A 1RMFH 1CE6B 3MGOB 4QTHB 3EDFA 5IGXH 4TPRH 4LASL 1FAKT 1IKNC 4HS3B 5GGUB 4Z77B 1H15B 2AEQH 2G2RA 3K3QA 3H9HB 4LCWE 1OTTD 1NGPH 1FO0B 2VXSH 1GAFL 1NAMH 1GCFA 3MV8E 1WFUA 2BVOA 1GZQB 2J8UF 5IUSA 4KAQH 4QHUA 1BVLB 1Z2KA 3VWJA 4QRQB 4DVBB 1QFUH 3K8LA 2QBWA 2YOCA 1BFVH 2E27H 1MREH 2CRYA 3WS6C 3MOAH 3NTCL 5FAAA 5J1TC 3R8QA 3M07A 4RRPG 5T1KD 3REWB 3ZDYF 4IRSD 3QEQD 1F2QA 3TEUA 4WFFD 1JPGB 2Y4SA 1WGOA 1MWAH 1KJ2A 5CGYD 2H32H 1EAJA 2H1PL 4D0CA 5HDQL 3WJLC 5C6PB 2PYEA 4MQ7A 4G8IB 3EHBD 4BZ2L 4JREB 5J57B 4WW1B 3BWAB 5EUKB 2JJUA 4X7EC 3WJJC 4L8DA 2R1XB 1JCKA 4X0KA 1KB5B 4AMKL 1ADQH 3VWKC 3K8MA 3RA7H 1ZVHA 3TH2T 2AJSL 3SDCD 3OAUH 4GAYA 4AEHL 2OJEA 5DXWA 3HNTH 4GG8A 3RU8L 2IG2L 1U8LB 4ZDHA 1CFNA 5FUCE 4ZFFA 2JELH 3PGCA 3T77A 2MQ3A 3MRLA 1LNUB 3TVMD 3TJEH 5KVFL 3MBEA 2AXGB 3F65A 3L3DA 4H8WL 2ED9A 4X80H 3BEVB 4UUJB 3IDXL 3VW3L 3KDMA 1XGTA 4Z7VB 4BFIA 3S88L 3SDYH 5D2LE 4HIXH 4WI9A 1IL1B 2X4SB 4X5LA 4DZ8A 1OAXH 3VXSB 4YIQB 3MMEB 4X7TA 1XF3A 5JW5A 3WKNA 1R3HA 5E8NB 1PBYA 2FZ3A 4YNYA 5I1KH 1UH2A 4NO5A 3TT3H 3QCTL 5C0EB 2JIXB 1I85C 3ILPA 2GUOA 2O61A 5C6TL 2HT4D 4GBXB 4A6YH 1ZT7B 3GSRA 2NXZB 1KSRA 3IAPA 4ETQB 5GRZA 2NXYB 3K4DA 4HGWB 4I3SH 3G6AB 3DYPA 3ARUA 2FLRT 2J6EA 1KLUB 3Q6GH 3WN5C 3ARFA 2DB8A 1HSAB 1PD6A 1C08B 3QHFL 1KLGB 3QNYA 3D3VD 4LAQL 1DDHA 5ITBH 5DK0B 1UWEL 3LRHA 4CL7A 1RMFL 3LSOA 3LV3A 4TPRL 1T0MA 3H9SD 4JN2B 4KJQD 1BWMA 4PGEB 4C59B 4P5TB 2GTZA 2AEQL 1NJ9B 5AG9A 3MJ7A 3FRPA 4XWOD 3GK8H 4JFFB 3D85A 1NGPL 3P0YL 3HMXL 1RZJH 2VXSL 1NAML 3C60D 5EC1B 4ZXBA 1KXTB 1JZ4A 8FABB 4IJ3B 4KAQL 4PJXE 5JHDA 3GSUB 4GXUM 1MOEA 5HYJA 4L8SC 5HD8C 3BKML 4J3TA 4LLUB 4RMTA 3WEXB 5KJRH 4LF3B 1QFUL 4KC3B 1XGUB 1BFVL 5J1AA 4FQ1H 5MENE 3OPZL 1M1SA 4U1IA 5D2LF 5CZKA 3QUXB 5C09E 3G6JE 1HHJB 3MRDA 4MQTB 1GZPB 1X5GA 2MHAB 1GC1C 1QRND 1UJTA 4GQPH 4KGLA 4M9PA 4M48H 3S35L 1EHLH 4NRZB 2QSTA 3RWDA 4PJHE 4YBLB 1DTUA 1A9EB 1YY9C 4LHUA 5JQ6L 1ACYH 1G7IA 1MI5D 35C8H 1MWAL 2W9DH 1N8ZA 4CADA 3MCG1 5DJAB 2GYSA 1IAIH 2AABH 1M7XA 4DGVH 5IKCB 3K1KC 2BXYA 1RZJC 2AK4B 2HVKA 3D2UD 3GBML 2DM2A 2OI9B 3E6FB 3E6HB 3L3HA 5DJDA 4PJDB 4WUKL 4CMHB 4RX4A 1ADQL 4OF5A 3IDUA 3TYGH 3RA7L 2ESVB 2H9GA 2EICA 1S7UB 4N0CD 2OLDA 3OAUL 3KXFA 3EYSH 3HNTL 4PGDA 1KCLA 1D5XB 4RSVA 4AL8L 4MAYA 4PRIA 4WI8A 4J7RA 2M26A 3VGAB 3AU1B 1DLHB 4FFWD 5EZOH 4Y16C 1W2KT 1DN0A 1AFVH 4DKFL 3TJEL 5E8PB 1Z5LB 2NY6D 1A7BA 5GGRA 4AENB 5HGGS 2XN9A 4PJXF 1C7TA 4HIXL 4PIRF 1HWHB 2YRPA 3MFGB 1I1RA 1ROWA 5ESQA 1PKQA 4X98A 1MCHA 4MNGA 4HWEL 4XWGH 5BCAA 2AQ1A 4MB4A 1EXUB 1D5ZB 4LEXL 4H5SB 5F93C 5IMKA 2Z93A 3V52H 3TT3L 4UQ3B 1HYSD 4PJHF 4MXWH 1C16B 4BJLA 4HPYH 4EI5A 4P3WA 2FR4A 3VG0H 1XF1A 1JWSA 4Q6IB 4A6YL 5GS1C 3DSFH 1F5WA 3NPSB 3V6FA 4KDWA 4F7CA 3EO0A 2G75A 3RY5A 4I3SL 1FVEB 1XR8A 3MJ8B 4KKCC 4Y5VB 4Z0XA 2V2TA 3Q6GL 4HFUL 1MSPA 2J4WL 5B39G 2OK0L 1GGYA 1ODAA 4W70A 3DXAD 2NY2B 2E6JA 5ITBL 3BI9X 2YRLA 2F19H 3ZT6A 4LPVA 1JK8A 3FT3B 1D6VH 3HZMB 3OG6B 4M1GL 1BOGA 2KQMA 5JORB 3AC0A 3TF7C 1ZKAA 2UZXB 3QO1A 3WFDH 4ZNEE 3GK8L 1RZ7L 2JB5H 1ZA6A 5E2UH 4M4PA 2BSRB 3OTTA 4NQXA 4Q2ZB 3QPQD 1P53A 3TH4T 1K9TA 5GQBA 3MJ9A 1HCVA 4I48A 5CD5D 5IW6B 1EAPB 5KJRL 3K4AA 4POZD 5D1QD 2P5EA 4LVHC 4FQ1L 1JP5A 4JFDA 4MDJB 4JKMA 3FAXA 2Z31C 3I50H 3KPLA 3AXLB 2WBJD 1N7MH 3Q6FB 5ECJE 3O4OB 4M48L 4FABL 1EHLL 1NMCC 1BIHA 4RWYH 3KJ6L 4PRPB 2IANB 1ZT4B 4FQ2H 1WIUA 1XMWA 3ARGD 4I77H 5F6HJ 4CUCA 3BUTA 1PGRB 5FA4B 4IOFD 4PJCA 4XAKD 1AH1A 1BECA 2F53B 1ACYL 1UWXH 4HH9A 5CEZL 2YZ1A 2EO1A 2A6DA 1F4YH 1HHKB 3KPRB 2Q6WA 3FQTB 1KIRA 2AABL 4JO1H 3MLUH 3U30C 2EYTB 2RAMA 2ITDA 5F1OB 1FYHB 1FL3A 3MRGB 3V8CA 2I07A 3MZTA 3CVIL 3TBWA 1CFTA 2AEPH 3BP7B 4J3UA 3BPCA 1H0DA 4JRYE 2ICWA 5CIPA 3GGWB 2F54E 4LHJB 4RGMB 4K3DH 4P3DA 4BSWB 4WFGE 1NLBL 1CDYA 4F7TB 4PRAA 5E9DE 3TYGL 1P2CB 5HHQB 4FN0A 4QHNA 5D93C 4N8CH 4YZFE 3QXDB 1IGCH 1CZ8H 1S9WA 4YBQC 1DUZB 3JV4A 4JANB 4P57B 2EDLA 1WAAE 3ME0A 2MQCA 4IS6B 3KS0H 3D0LA 3Q1SH 3QDAA 4OFKA 5EORL 2MOVA 2V7HA 2JK5B 1U8PB 2H41A 1AFVL 2H6PB 4I18C 1AGDB 3ZHKA 2Q3ZA 3SPVA 1G9MH 2EH8H 4OLWL 3QEUA 5FM4A 2P8LB 1HDMA 3QULA 5CJOL 4NQVB 2YEZA 3TFKC 4UINL 5CEYA 3DUSA 5D7IB 4ONOA 2E9BA 1P6FA 2P5WE 5ICYA 3EO1B 1U0QA 3U9PL 2AXFB 1P7QD 5I1LA 5A40E 5HVHB 5JXAH 5IVZA 1LE9A 5DRNA 3P9LA 2V5RA 3QWQB 5CD3A 3S36H 1WFOA 4MXWL 5GGTA 4HPYL 1JHKL 3HTLX 1ZHKA 2PYEE 4O9HL 4P46D 3GJFK 2YUVA 3VG0L 2JJVA 3VXPA 4HIIB 1D6EA 4ZUUB 3TNMA 4HS8H 5HHOA 1P7KB 1Q0YH 2BXZA 5BRZD 4ODVL 4WW2C 1U2HA 1IVLA 3H8NA 3GUTA 5I1AB 4R7DB 3O81A 4M61A 5T3XE 2A77H 1CDJA 5EIIB 2EXYD 3CJJA 5FYJU 1J0ZA 1BJ1J 1OD7A 3O4LD 2L0DA 2FJFA 3EDJA 2X42A 3V7MA 1C5DA 3PWPA 2VISB 4Y19A 2X6MA 1A5FL 5IHZA 2MNUA 1SVZA 5BXFA 3GSWB 4PGCB 2AW2A 1G7PA 1S9XB 5DD6B 5B8CC 2JB5L 4P2QD 4K7FA 4H1LH 3QFDB 5F9OH 1QSVA 5MHSD 4F15B 1I8KA 4EQ2A 3GBNH 1AHWB 1JGVH 3QJFA 2NQCA 1HNFA 2ZJSH 4Y5XC 2XKUA 4RA0C 5SWZE 1WBXA 5DVMA 1CCZA 5KAQF 2CKBA 3GSOB 5T33H 4D9LL 4G8GD 1A1NA 4IHOA 4EN3D 1IEBB 4JY4A 3EAKA 3UYOD 4ELMB 2XNAA 3QPXH 3E2HB 1JFQH 2IBGA 4Z7NE 1N7ML 3IETA 3WDIA 4HIEA 4YWGH 4F7MA 3RZWA 1HKLH 4EOWL 4RWYL 4LSUH 4QY8A 2ZCLH 4FQ2L 4B53A 4I77L 1J1XL 4F57H 1ZGLB 3I6GA 1I1YA 1FAIH 4HUWB 5D5MB 2DWDA 2NX5B 1J8HD 3ARDB 3WKML 4ZD3H 2IPKA 4MX7A 5ISZE 2DQCH 1UXWA 1A7QL 1A7RH 4JO1L 4NQDD 5EO1B 2OXGA 2PW1B 4W68A 5B38B 4G6AC 1N3NB 4CVZA 5ID1B 1JHLH 3VRIB 5ILTH 4K3HA 1KB5H 2AEPL 5DF0A 4LKXA 2EZ0D 5D2NA 1T5WB 3VFMA 1F00I 1YMME 4K3DL 1X7QB 4MD4A 3D6GA 1J05A 3I84A 3IF1B 4YO0A 4AG4H 1U93B 4WU5B 4DEPB 4Y7MA 5IQ7H 2P8MA 3RWIA 3QNXA 1IGCL 1HK6A 3GB7A 1CLYH 5DUBB 3HR5B 4PG2C 5F1NB 3GI8H 4U2YA 4KI1A 1NGQH 3Q1SL 2R39A 1UG9A 3DUUA 4FA8A 4RGOH 5L0QB 2KZ1B 2BRRH 4J3XA 3SDDB 1G9ML 2EH8L 2OMNA 5E4EC 1HHGA 2X9WA 3W11D 1ZMYA 4UTBH 5JOEA 3I9GH 4MQSB 3T08A 1PY4A 4PB0H 5ENWA 2VLRE 1RK0A 3TBVB 1EFXB 4OQTH 3TN0C 4MB3A 5F9WC 3HA0A 4QRRD 3SKMA 1I7UB 4NO3B 1A6AB 5JXAL 2VLJA 1J12A 5E1AA 4EQ3A 3WUWG 4FQIL 1NCWH 3S36L 1JNLH 2IJ0C 2PXYC 3X14B 5HDOA 1NFIB 4LLDA 5J0BA 4NSKB 3T4YB 4Z7QF 3O6MH 4HS8L 4OZHE 5C0GB 2ZOKB 2UZIH 3VXNA 2PTVA 1HI6B 4G42B 4Q74A 4RGNE 3OGOE 2H3NA 5IM7A 1H5BB 4JZJC 5TH2A 4JRXA 2A77L 4P4KA 2PO6A 5FF6B 3PP3H 1BLNA 1J18A 1YDPB 3HUJB 1N2RB 4U1KA 1GRWA 2VL5B 2YPLA 4JY6A 4MCZA 2GCYB 4NQEA 2FHFA 4RMSA 1G9EA 1CD8A 4D3CH 4OGZA 5F9OL 1OGTB 4HJJH 2FX9H 3WIIH 2XKNA 4N9GA 1T22B 3IFOA 5I1HH 2BVOB 1L4IA 1XCTA 2DIJA 3GBNL 1JGVL 2XTJD 4F8QA 2ZJSL 3BXNA 4GRLC 5EU6B 2Z35A 1NKRA 4O2CA 5IVXE 4KV5E 1W72A 3PNWB 3PQYA 3WN5B 1OGAD 1PVHA 2G5BA 3QPXL 3RVWD 3OKOB 1JFQL 2ZZUT 1AGBA 3STBA 3OXRB 5F72S 3VDAA 5EOCJ 3TYFB 4U05A 1FL6B 1HKLL 3NIFE 1DQMH 3UJTH 2OX5A 3KYOB 2ZCLL 4G8FB 3MRQA 1CF8H 1U8MA 5TDOB 5C92A 1KEMH 3HG1A 3IDMB 2DQJL 2ZNWA 3AB0B 4RAUB 3RP1A 3TO4D 3JBG7 4ETYA 3PGFH 3MBXH 1D5BB 1HH6B 3O0RH 4RISL 1M7DB 3LIZH 1WBYA 5EH1A 2PYFA 1JHLL 1D3CA 1LDSA 1T21B 4Y88A 2ED8A 3FONB 4LEOB 5ILTL 5EO0A 1KB5L 4L8SB 4IRJC 5I0DA 1GOHA 5KVMC 3WHXA 4FQXD 5DURB 4QXWA 3GHBH 2EH7H 5HYEA 3AREB 4OLUH 1LP9E 4OKVA 5IQ7L 5I71C 5FK9B 3WO4C 2AV1B 3L3OB 3LY6A 3PGDB 1AKJB 2Y36L 4GAYB 3H42L 1FNAA 3QDME 4NJAL 4P2CG 4OLVH 1NGQL 2BNUB 2FH8A 4YPGA 4RZCA 2VABB 4FZ8H 4U3CA 4CN6A 1JL8A 4HCRH 4RGOL 2BRRL 2EO9A 2P5EE 5AZ2H 1S7WB 1RJYA 4JFDE 1RD6A 3IDJB 5K9QG 1RPQA 3HE7A 1T83C 4PJ7E 3X12A 4UOJA 3MUHL 4PYGA 3I9GL 5DA0B 5IVXF 4KV5F 4QOKD 4YHIA 3UTSE 4OQTL 4WFED 1DZBA 5B4MD 1FZKA 3CXDH 4U1SA 4ZAKA 1LK3H 3G04B 4XVJL 3C6SB 4LIQL 5GZOD 4NZRH 3HNSH 3OR7B 5D7SH 3NIFF 3IT8D 1CICB 3VXOA 1WBZA 5KSAD 4CJ1A 2C3WA 1BOYA 5AD0A 3FB5A 3KYNA 1NCWL 2WWKO 3U83A 1JNLL 2FBOJ 3C5ZA 1YJDH 2ICCA 5J11B 1MCLA 3D0VB 3MNWA 4G9FD 5KANG 4L8CA 5EO9B 4AH2A 2LTQC 3GSRB 3O6ML 3QAZB 1EIBA 1K6QH 3DGGA 4Y4KA 1X3DA 5D72L 4M93C 4ODUA 2EDXA 2J12B 2JJSA 4FTVA 5D1ZD 5EUOB 4ZUSB 3KPOB 5IV2B 5FYLH 3P4MB 1QBAA 3QRFM 3L5HA 4HK0B 4KKBD 4PJEB 3KG5A 5CEZD 3F7RA 1FFPA 5KVEH 1QNZH 5IB1A 5IFJA 2HFFB 2GSGB 2X4QB 1LP9F 3G08B 3QNZB 5DQ9B 2UY6A 5HYSG 3A6BH 3QDGA 4Y4FB 5I8CA 4OZGB 2I26N 1U92B 3NCMA 4L8BA 4PJ9A 3NZ8B 1RI8A 1I8IB 4MJIB 2DBLH 4HJJL 2FX9L 3REVA 5ICZB 3RIFF 2YA0A 1CDIA 5I1HL 1MJ8H 2FNBA 5GS1B 5DMJB 1T7XA 5HGBB 3VXTB 4X6CA 1X5KA 1D9KA 3MR9A 3VFOA 4HUMB 3O3EA 1OLLA 1XF2A 4WV1A 4OCWL 3VFUA 3JZ7A 2OP4L 5CZXD 3L3IA 4PJ7F 2ENYA 1ORQA 3FOMB 2BNRA 5K9JH 1QO3A 1DQML 3UJTL 3U4BH 2QHLA 5E2WH 4PJCF 1KEGH 4LK4A 4DUWA 1NMAL 4XCNA 4OTXL 2YPVH 1KEML 4KKCD 3HR6A 5HYSB 4MSWA 43CAA 4CDHA 2MMXA 4ZS6D 4DN4H 4KROC 3O2DH 1O7VA 4Y2DD 3L5WB 1UJ3A 4YE4H 4F2MB 3WIFA 5I8EB 3I2CH 4JQXA 3LIZL 4CN4A 1C1EH 4XZUB 3D69B 3L7EB 1P4IL 3QI9D 4AIXA 5C0BB 1KT2A 2AGJH 1Z9SA 4XNMA 3HZVB 1LO5A 3B3IB 3EDKA 1ZHLB 2ADFH 4PV9B 3GHBL 2EH7L 2FHBA 4ZOAA 5DT1H 4FMKA 5IQ9A 1PQZB 1IKFH 1FP5A 4FXKA 1KNOA 1YUHA 4M7KH 4OLVL 4NBZB 4Q97A 4YBHA 3SGKA 4FZ8L 2MSPA 4JZNA 5C0DB 3NCJL 4HCRL 3EBAA 1OB1B 2FEDC 3U46A 4NQCE 4HUUB 5FDWB 2BVTA 5KVDH 3CPLA 3LH2H 5JUEL 4JLRA 4GW1A 1FL5A 3IJSA 3QDJA 4PJAA 1H3PH 1P4LA 2BSSB 1E27B 1QSEE 4ZO9A 2FX7H 5FKPA 4RAVB 1LK3L 3BAEH 5DYOA 3PUCA 3KGRA 1AD0A 3KLSA 4FMFA 4S1DD 4NZRL 3HNSL 5D93B 4Z76B 2WIIA 3PL6A 5TPWL 2ZP0T 2C1PA 5E95B 1YJDL 3DMMD 3W0WA 4KVCH 2QQLH 3L5XH 1UWXK 1HEZB 3O3BB 2HT3D 1AO7E 4G80B 4ZUWA 4JFXB 1A6WH 1IAOA 4R4FH 1D5IH 2NLJB 5CS7A 4NFBA 4YBQD 2HG5B 4J3SA 5FYLL 3JTSA 5E2VH 3MRHB 3BD4A 1X5IA 1JK8B 2DMBA 4KK9C 1EGJH 3MYZA 5ACMA 1QNZL 5DQJA 1UXSB 4LSPH 3V0VB 1FNEA 3B4NA 2C7UB 1VB9A 1HHIB 1DP0A 3A6BL 1F8TH 1PAMA 1EH9A 1AQDA 2EE6A 1LO4H 3DO7A 4PJBB 1MJ8L 3ZYOA 3AS0A 4HFWB 4MMZC 4P2RA 1TLKA 1BBDH 4KHXH 5T1KA 5K59E 3CFCH 2J2ZA 4U31A 1DLFH 5IB5B 4R7NB 3H2WA 5GHWH 4WW2B 1QSFA 3O6FB 4LMQE 1CQYA 4QYOA 3W9DA 4Y89A 4G9DB 2VR9A 3VXMA 5LGJA 2OL3B 3IU3A 3GMPA 5K9JL 3M17B 3LEVL 2CIKB 3QUZC 3KVQA 4TNVF 1XF5B 3IJYB 4TOYH 4F37F 1A4JA 4PG9A 4ODWA 5CMAA 3WXVH 4DN4L 1HZHH 4Y1AD 3LQZB 3AS3A 3O2DL 5B8CB 1SY6H 1DVFD 4YE4L 3WDHA 5JO5A 3I2CL 2BHZA 4HXBH 1C1EL 1WIPA 2K7PA 2OCFD 2WP3O 4ODSH 5ACZA 4ORGB 5J06A 2BNQD 3D25B 5CHNA 1JF5A 4EUPG 4H1LG 2LAGB 5AZEH 3BZFB 2A6IA 1R3KA 5ESVB 1M7IB 2AGJL 3T2OA 3SJVE 1F6AA 2R2BB 2IH1B 5HVFB 1N5AA 2NNAB 3TZVB 2ADFL 2C26A 2XT1B 3T0AA 3FTGB 1IC1A 1DEEB 1ZVSB 3TVMA 1U3JA 4L4TA 1IKFL 4NRXB 2YD9A 5ANME 1AGFB 2ZSVA 5I2IB 4PJIB 2HRLA 4MNQD 4M7KL 1HH9B 2GAZB 5F7KC 1YC7A 4F3FA 1UZ8A 3PWJB 4N0FB 1IAKA 3HFML 3T0ED 1GIGL 4Y4HA 1AP2A 3N0PB 1YEEH 3LQAH 3PQYE 4W4NA 4GKOA 3EYUL 3PIQB 3MJ6A 3O3UN 4EUPB 3LH2L 2CLVB 5IEKB 4ZODA 1S78C 3ARRA 4QRUA 1JPFA 1V3KA 4FQPA 5ADPL 3IDGB 5F1IB 1E4XL 4R97B 4XNUH 5FYKE 2FX7L 3IJHA 1FNSH 4PUBH 3BAEL 3KPPA 3BESR 4JR9H 5CSBA 4PV8B 3CH1B 2FYYB 4G6AD 1ZLUH 1JZ6A 3FFCD 4JM4L 4HIJB 5BV7C 3JXAA 1MCWM 1DANU 5A16A 1SEBB 1PZ5A 4L3EB 3O9WA 5FB8B 1ZLWK 4S11A 1IGTA 1NDMB 1DE4B 1ZLVH 1KPVA 5DMGC 4JFYA 2QV2A 3L5XL 1B0GB 4BQCA 3DV4B 2ZUVA 3PE9A 1VGEL 3QXAB 4XNQA 4R4FL 4PY8I 4TUOB 1JN6A 3H9SA 2VQUA 1OAQH 3LQAC 4P23A 4X9FA 1XF4A 1ZWIA 3LKNB 5ITFB 4CN1A 5E2VL 4DQOH 4MD0B 3C60A 3TN0B 1EGJL 3CC5A 1OARL 3T8XB 5F9WB 3O11A 3PP4H 2XWJA 3MLTB 1UM6L 4I3RH 3FQXA 1CLZH 3UAJD 1B4RA 1TQCB 2X70A 1BQLL 4GRWE 3I3BA 1AR1C 2MPAH 5GZNC 3MV01 1LO4L 1U8OB 3N1QC 1CBVL 4G7YL 4MCYA 3D39A 3MV7B 2EDOA 3GSNB 4RDQG 1BBDL 4AQOA 3OGCA 3CFCL 4NOBA 1A1MB 3BE1H 3K1DA 5J7CC 4WWKC 4HK3N 1MFDH 5FYJH 2F74B 4PJGB 5GHWL 2YXFA 2F5AH 3QJHB 3MRCB 5GRWA 4PRDB 4OFYD 2WLYA 2Z92A 1QHOA 1QVOB 2NY5C 3PHOB 4ZUTA 1DQQB 5C08E 5DJYA 5FV2A 3DX6B 4LPCA 1KJ2H 2EDDA 2LU4A 5ICXA 1RUQL 1RZ8B 4B5EA 3RUGB 5DS8A 4IIQC 3WXVL 5DSCA 1HZHL 3NH7H 4Z8FH 1I9EA 4WTZA 1SY6L 2BDNH 4ZSOA 4S0TD 3O2WL 3BDBA 1MEXH 4HXBL 5E70A 1I1AC 3BZEA 3VWJC 4ODSL 5HGHA 4JPVH 3DHJA 5AZEL 4GRLB 1VDGA 4OAWA 4YHYB 5C0FB 4PR5A 5E00B 1BD2B 3MRFB 2Q1EA 5KW9H 4PJFE 6FABH 1SEQH 1U91B 2CQVA 1BVKA 4JM2F 5E2TH 1UM5H 1K5NB 3ILQC 4HUXB 2ICES 1DN2A 4RMQA 3T0BA 3RHWF 4WWID 2D0GA 2VDOH 2CLRB 4EEEA 4N0YH 2B2XL 1JWMB 5A3ID 3P3YA 3EYVB 4YHOH 3PP3K 3RVUD 2F9BT 5DRXA 4X6BB 5E6ZA 4GRWF 3U4AA 3VH8B 1AGEA 3CFBB 3KPSB 2RR3A 4HWUA 3ARWA 4BUHA 4OD1L 1HQRB 3WSQH 2I9TA 1TVDA 1YEEL 4KZEH 1DFBH 2J8UB 1F6LL 1GL4B 3P4LA 4V1DE 3V0AC 1U8IA 3UC0H 5JOPE 5DD0L 3QIBC 4BYHA 1EO7A 4QEGA 3HMWH 3SDAA 4XNUL 2MKLC 3UP1A 1KTLA 4UTAL 4TULH 5HI3C 2J3SA 3KWWA 1FNSL 1PSKH 4OLXH 4IEFB 3L95B 3SGDH 2CIIB 1KN2H 5J6GA 1J1OL 2IPUK 5I71B 4M1DH 3RZCA 5GGQL 3BIKA 4C4KO 1K4DB 4OF8A 4X4ZA 1OTSD 2Y06L 1U42A 4WUUD 4S1RL 2NMSA 3EO9H 1KF9B 3MLWH 3NCFB 3DXAA 1YEFH 2J6EH 5AUMA 1RUMH 3OJ2C 2OZ4A 3BVNA 1H3WM 5D9SA 1NL0L 1OAQL 3VFTA 4WCYL 2NCMA 1VFBA 5IG7B 1HINL 3NA9H 1I75A 4YH6A 3GI9L 1HSBB 4OSUL 3F58H 1TZIA 4PJFF 3V6ZA 1AE6H 4DQOL 1NC4B 3TCLA 3GIVA 4PD4J 4Z7WE 3PHSA 1T1WA 3PP4L 3PXJA 4LCUB 4LSSH 3X3FH 1OTUD 4DGYH 3ARBB 1CLZL 3IGAA 4NC2B 5ELIA 3RKDD 3PWVB 5J13C 5IK3A 1WZLA 2YHGA 2X4PB 1KC5L 3HC4L 4HHAB 4KQ3H 3IFOB 4LCWB 2XOTA 3EYOB 2LTQB 4PTUB 3ET9F 1OPGH 3AS1A 5EN2B 3BE1L 3VFNB 5FYJL 3ARGA 3MV8B 3ARFC 4Z18A 1U95B 2F5AL 4M93B 2PTTA 4YGVA 1LEIB 1JNHA 1RUAH 3JTTA 1MCPH 2ZUQC 5I73C 2Y9RT 3FRUB 5KOMC 3L6FA 3KYMA 3HC0B 5E94A 4U2ZA 1KJ2L 1RHHB 4NWTH 2A1WH 5IW1B 5E24E 4OF6A 4XPFL 4WI2A 4PLOB 43C9A 5DJXB 5HGDA 1OWRM 1YNTA 3LEYH 2VUYA 3HCVB 1UVQB 2ERJC 4Z8FL 1U8QB 1IT9L 2HJLB 2ED7A 4WEUD 5F6IB 2BDNL 1S9VB 4X5XA 4FHBD 4JFPB 3HPJB 5A43C 3G6DH 3ZHDA 1MCKA 3MO1A 3CK0H 1UM4H 1NC2A 1TFHA 1AXIB 5KW9L 4Z7UE 5E2TL 4ISVB 1A3LH 2O5YL 4WO4B 1J0KA 2VDOL 2XQYK 3RAJH 3VI4E 4DKDC 2CPCA 4Z7WF 1DEDA 3P73B 4YHOL 4FQLH 4X6EA 3WDJA 3V6OA 2VZTA 3RNQA 1UH4A 2NY2D 4L29B 3CH8A 3R1GH 1TPXC 3GKWH 1WK0A 3QEQE 3AROA 4NT6A 3WSQL 3RL2A 4S10A 5DK2B 4KZEL 4OLYH 4WFFE 3EFFB 5FYLD 2ZCHH 1P9MC 3UC0L 5A2FA 2D31B 1CGYA 4PJAF 3BGAA 4CAGA 4KKLD 3NCBB 4WIQA 2RHEA 5DHYB 1SYVA 2ZUWA 5T1MB 1B88A 3HE6B 3MRBB 4P46A 1TJGL 5D2LB 4OLXL 1PSKL 1ORSA 3S96A 2Y25A 3PDGA 1U3HB 4UV4H 2FRGP 4LCCA 3VD5A 1KN2L 3Q5TA 4KUCF 4TYUA 1X5XA 5J1SC 3VRLE 2GKIA 3N06B 3QQNA 2K9UA 2DD8H 3S8WA 5MI0C 3TNNA 4LSQH 1YN6B 3M1BA 5BOZG 4KJWC 4EIGB 1R24A 3N1MC 3MLWL 4KI5F 1A02N 3T3PE 1NGYB 2NY1C 2P7TA 1JHTB 3BP5A 3CFDA 1FCGA 1RUML 5GRJH 3GJFA 5JDSB 4PRPD 3T3ME 2IAND 4UB0H 3O4LA 2H8PB 3OR6B 5KOVC 1JRHH 2AS5M 2VDNL 4YQXL 1T1ZB 5BZDA 1HIMH 3RWJA 3ZKSD 4YPJA 4M6MH 2GT9A 3VE0B 3F58L 1JV5B 1RZGB 2E8YA 4RIRA 5HJ3A 3EOBA 1AQKH 4Z7UF 4GH7B 5K33A 4AQ1B 1IGYB 4ZO8A 2BOBB 1EERB 1WWWX 2FL5B 3BQUC 1JGDA 2VLKA 3X3FL 3ZKXC 1EEYA 1IMHC 1NGXA 5JR1H 3VI4F 4OM1H 4EI5C 3MJ9H 4JEGB 2XZQH 1H3UA 4I0PD 5GPRA 3B9KA 5L2KA 1JF1A 1X4ZA 2Y72A 2BCKB 1OPGL 4EI6A 2R0LL 3GMMA 1UKTA 2IGFH 4PJXB 1BJMA 4QHKI 1PX3A 1JI2A 1LDPL 3T2NH 1RUAL 1D5MB 2DIAA 4XPGH 4OGXH 3MROB 4KMTH 4L4VA 1EFQA 4MA3A 5IMOA 4NQDA 3OL2A 4QT5B 3SGJA 4NWTL 5C09B 3G6JB 2VDPH 2EDRA 4GG6A 3CU1A 4Q9RH 1MIMH 3L9RA 1MVUB 2ZG3A 5KSUA 4ONHB 3D3VE 1PY9A 2A9NH 3LEYL 2R2EA 3VRLF 3TC9A 4PJHB 3H0TB 5ADOH 5FO9A 4YHNA 2OQJA 1P4BH 3WXWH 4E41A 3H9SE 2GJ6D 1DSFL 2NYYC 3B8SA 5CIPH 3T3PF 3G6DL 1I7TA 4YDVB 4MA8L 4MLIA 3MGTA 3CK0L 2QKIB 1UM4L 3C8HA 3T3MF 1FNGA 3S5LA 5DJZA 3QIUA 2BVQA 2H26A 3O6KH 2R29H 3I75A 4XCFH 1Y0LA 4X6DE 4XGZA 4PJ8A 1G7JA 1A3LL 1N26A 5L2JB 3KLAA 4Z5RA 5GS0L 1A6TA 1LK2A 1YPZA 2Q76B 4FQLL 4D8PB 4XI5C 4I0KA 4KK5C 1TENA 3IVKB 1QRNE 3RVVD 4I8DA 3EZJB 3R1GL 5SWSE 3GKWL 5JNYB 3LKQB 4LOUC 5CUSH 4K3GA 4U1JB 4TUJB 5C0IA 1NDGB 2AXJA 2P24A 4L1HA 4QRRA 1MI5E 1OWWA 3IDNB 5IR1A 3HMXA 4IOIB 2V2XB 3P2TA 4NUJB 2HVJB 4NM4L 1S7RB 2KDGA 1XIWA 4UV4L 3TA3A 1HQ4A 5GGTH 5IOPA 1IILE 3WL9A 2ATPA 2XACC 1T66C 3K2UH 3VGHA 4HV8B 2UYLA 4Y8AA 2DD8L 4YFLI 4XBGA 5DC0A 3JV6B 4LSQL 1WICA 1P5VA 1DBJH 1VEPA 3RGVC 1N6VA 3MV9D 2A74B 2IAMD 4OFPA 4XH2A 5GJTH 4OQ1A 5GRJL 2EDWA 3DJ9A 3HAEA 4R0LC 3V4PH 4LRNL 4R3SB 3OHXA 3EFDH 4UB0L 3NCYS 4MJ6A 5I19H 2ADGA 1JRHL 3B9VA 2OM5A 2XPGB 5IFAL 3R06B 5IHLB 3ECBB 1FFNB 5F71A 3ARDD 2DQGH 3OKKA 1AQKL 3NACH 3KNBA 4K2UH 5CSZB 2E7HA 3G5VB 2BOCB 4GMTH