5E1AC

Structure of kcsa with l24c/r117c mutations
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
b'ACHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGCEQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5e1aC00
4PA3A 4GX2A 3ASOC 2ITCC 4JTDB 5IY5C 2DYSC 3LNMB 4MVRA 2EIKC 2EIMC 2NLJC 4H33A 2A0LA 3OGCC 3R65A 3SPIA 5KUMA 4UUJC 1XL4A 1JVMA 1S5HC 3KG2A 3SYPA 1LNQA 2WLLA 4LP8A 1XL6A 3OR7C 4H37A 4HYOA 3T4ZA 1R3IC 2WLHA 1ZWIC 3AG1C 2WLJA 2HVKC 3STZC 4PDRA 4CBCA 5CBFA 3FB6C 3OUSA 3F5WC 4RUFA 4TWKA 3E83A 3E8BA 3FB8C 5B1AC 4RO2A 4QNHB 4MTFA 3K0GA 4MVQA 1QLEC 3X2QC 3RVYA 3TETA 3K0DA 3LDEA 3SYCA 3ABLC 2WLLB 2BOCC 2X6CA 4MTOA 3K06A 4OXSA 2ATKC 2WLNA 2EIJC 4MSWC 2A9HA 4XDLA 3RBZA 3ZJZA 4MVZA 2EINC 2Q68A 3IGAC 4PA9A 4R8CA 3SPGA 2WLKA 3BEHA 4RUEA 3SPHA 5E1AC 5CBHA 1R3JC 4EKWA 2DWEC 3E8FA 3EFFK 3LUTB 4MW3A 4J9ZB 3ZRSA 4MVSA 3SYQA 1OCZC 2W0FC 4PA4A 4GX1A 1M56C 3PJSK 5EBWC 3E89A 5BZBA 1K4CC 1BL8A 3IFXA 2P7TC 3E86A 1V55C 4F4LA 2ZXWC 1K4DC 4PDLA 4R6ZA 2HJFC 2Q67A 2Q69A 3LDCA 4WFGA 3OR6C 4ZBMA 4P30A 4R7CA 5EC2C 2JK5C 3K03A 4X8AA 1M57C 4G28B 4GX0A 2DWDC 3LDDA 2IH3C 4R50A 4LCUC 3RW0A 2IH1C 3K08A 3WG7C 4JTCB 1R3LC 1OCCC 2Q6AA 3UM7A 4PDMA 1J95A 4RAIA 4QE9A 3SYOA 4WFFA 2WLIA 2OCCC 4MTGA 4P9OA 2HVJC 3TCUA 5B1BC 4BW5A 3FB5C 4PA7A 3AG3C 2EILC 2H8PC 4MVMA 1P7BA 4HZ3A 2QTOA 5EBLC 2AHZA 3F7YC 4XDJA 4PDVA 2K1EA 3RVZA 3AG4C 5CBGA 2HG5C 2ZD9A 4MVUA 3UKMA 5B3SC 3T1CA 4DXWA 3T4DA 1V54C 2AHYA 3SPCA 2BOBC 1R3KC 2X6BA 4WFHA 4PA6A 2ITDC 2Y69C 2WLIB 2QKSA 2DYRC 3ABMC 4G27B 4J9YB 4MVOA 5EC1C 1G4YB 3AG2C 3E8GA 4P2ZA 4KFMA 1KKDA 4I9WA 1ORQC 1OCRC 5J9PC 3SYAA 4WFEA 2X6AA 4P9PA 3HPLC 3ABKC 2WLMA 3FB7C 3GB7C 3SJQC 3F7VC 4JTAB 4X88A 4XDKA 3T2MA 3OUFA 4GX5A 5EK0A 2YEVA 5KUKA 3SPJA 2R9RB 4MW8A 4MS2A 4QE7A 3K04A 2HFEC 2KB1A 3JYCA 3STLC 3VOUA 2A79B 4LBEC 5EBMC 3E8HA 3ASNC 1OCOC 4X89A
chains in the Genus database with same CATH superfamily
4QGPA 2YXLA 1YIJV 1XNRO 1EZJA 1URFA 1AR1B 1HNXO 2IJHA 4DR6B 1QLEB 3OTOO 4LFBB 2OIEA 5CA1B 1ZAUA 4YJ2A 1Q3EA 1R6TA 5JCOC 4AILC 1XL6A 1NTKH 1QR8A 4DW1A 1DGSA 3E8BA 1QVFU 2DE0X 2UUBB 3H1IH 4DR2O 2DMXA 1X4TA 1M56B 2Q7GA 5H9CA 3AEIA 5IT9N 5JH7B 2NN4A 4YIPA 1IZ3A 2UXXA 1WPXA 4RUEA 5A9GA 2EJ7A 4DR1B 5LGUA 4JI2O 4TT3G 2HP8A 1K4CC 1BL8A 3IFXA 5ITZA 2RNBA 5JJNB 5LOVB 3DXRA 2JJ2G 4X1IA 4GX0A 4IHJA 2DQ0A 3WB0A 1V55B 1PNLA 4PDMA 4JI6O 4TOIA 5LOVA 1N33B 4B08A 3CRMA 1QR9A 1HNZB 2HVJC 1VARA 2H8PC 3BRCA 2QTOA 1M4UA 3FFQA 3IC9A 3CYOA 4DXWA 2XNDG 1SF9A 3L9DA 3AG3B 2LGWA 1M1KW 3E8GA 1VQ4V 4K8ZA 1LR1A 1K34A 3LSUA 2GSMB 1NS1A 3ASNB 5L3EA 4JI8B 2QA4V 4YHHB 2E5LB 3N2GA 2YIAA 3DSQA 2UXDO 5KUKA 5DECA 1MMMA 4PJ0Z 1FAFA 3JYCA 2QR4A 4UFZA 2HEPA 1PNMA 3VQXA 5LGTA 5IY5C 3K58A 1R1BA 2V1DA 5EYPA 4NTWA 4CS2A 1NH2B 4EB6A 2GUZA 1SKVA 2JEUA 2QWPB 4H37A 2WLJA 3STZC 4JI1O 2JS3A 4QNHB 4I55B 2M6YA 4TSFG 4MTOA 1SQBH 4OXSA 5C8YB 1EBOA 3CCLV 2ZXWB 4LF6B 4J7JA 4PA9A 1F4MA 4LF9O 3SPHA 3JALA 4O2AB 2RQ6A 1XDCA 5IJ0B 3JAWA 4DV6O 3TXSA 5LXTB 2LGQA 4X65O 2WSSG 1WLEA 1VQNV 1B06A 4Z1VA 4DV0O 4DV7O 1K73W 1GM9A 1GM7A 1K5SA 3QO8A 4LFAB 4JYYA 3K5MA 4IT5A 3A0HZ 4O4IB 5LMNO 1M57C 2W0XA 3JARB 4NTYA 4B3MB 1PD3A 3LDDA 3W7SA 1U96A 1F7YA 3ZCCA 3JD4A 2OCCC 3UCSC 1AJPA 1W0JG 2PGGA 2Q73A 3F7YC 3RVZA 1Q86W 4UCSA 1J5EB 5HFMA 4JI3B 2YC0A 1G4YB 1N0NA 1IBLB 1Q82W 1YVWA 1TAEA 1KUQA 1QHTA 2EIMB 4BR6A 5CA0A 3FX7A 4TV8B 3VQYA 5LP6C 4TQFA 1OCOC 3ML0A 1XREA 5CB4A 3P3NA 4ZOLA 1OZ0A 2IM9A 3A8TA 3L72H 1LNQA 3SGIA 2WLLA 3THOA 1D5AA 3MHSC 4PDRA 3KZIZ 5KMGA 1G1XB 3Q4HB 3IAYA 1JX9A 4QPJA 2MK3A 4YY3O 2QWQB 3ZJZA 1VF6A 2E3CA 2WLKA 1AR5A 2YIDA 3CC7V 1QQCA 4MW3A 4N23A 1OCZC 3WFVA 2QEXV 2W0FC 2DW4A 1B3QA 3NXSA 2Y4TA 1UPGA 2HJFC 3ICXA 2Q9LA 1XBLA 4D6TH 2PY5A 2DWDC 1NKDA 1FFTB 4LCUC 2IH1C 4ICGA 2XHBA 4LF7O 4K0KB 1SQPH 1ZTEA 3ZMZA 3SJBC 3CC4V 4JAUA 2EILC 2PI4A 2FMLA 4JI0O 1TVKA 3IC7A 3CJHA 2ZD9A 4MVUA 1XNRB 2KG7A 4HNAB 2P4KA 3DGEA 3OTOB 4DR7B 1PKXA 2AZ2A 1OCRC 5B3SB 1XI1A 1KECA 5KLVH 2W6JG 4GX5A 2FKXA 2VRZA 4MS2A 4DR2B 4B3TB 1H2SB 2VQEB 5EBMC 2DQ3A 3AG1B 3E8HA 5LBQA 1S72V 2LP7A 1QCEA 4O4JA 2A0LA 2JGDB 3D3IA 3SPIA 4FLUA 3SYPA 3T1HO 1N32O 4LP8A 3G71V 5K1XA 3EXAA 3OD4A 1KBHA 3HKDB 3CP1A 1HNZO 3ZHSA 4I7ZB 2F4VO 3BA9A 1LUVA 3K5NA 2ZIOA 4GUNA 5JWPA 3LUTB 2ZDIA 2Y4UA 3HKEB 3CD6V 2EIJB 2QKCA 4PA4A 5B1NA 2EINB 4I50A 4YHHO 2E5LO 4FLVA 1V55C 1F23A 4X66O 1TA8A 3ZRVA 3ZMVA 2P67A 4I9QA 1H2NA 5K1PA 3IJ4A 3H1KH 1YDXA 3TCUA 5B1BC 4CH6A 1Q6IA 3AG3C 2DN9A 2JEXA 4MVMA 4HZ3A 3P32A 3RFRA 4O4HB 3FYEB 2K1EA 3L75H 1MG1A 3CCSV 5KAIZ 5BMVB 3FYIB 3I55V 1K8AW 2PYJA 1VIBA 2P90A 3JD2A 4P2ZA 4LFCO 1TUBA 3B8MA 3SJAC 1VF5B 4P9PA 3H01A 3W7XA 4JI1B 1I94O 2ZKOA 3S3WA 1VQPV 2HLDG 1VQ6V 4JZ2A 4PHZA 2EJRA 4LFAO 1MZFA 2QE7G 4FLTA 1WAZA 1IBKO 4BWAA 4DV6B 3X2QB 4X65B 4F6RA 4U7OA 3ZHTA 1P7GA 3MD0A 2FTKA 3ASOB 2ETNA 2HVKC 3ZX6A 2QM4A 5LMNB 3B8NA 1F51A 3K57A 2XAGA 2Z5UA 2Z3YA 3VQVA 4MVQA 2CDYA 2QKAA 3DC5A 4X1KB 3OW2U 3JAKA 1J5EO 3CXHF 5JJJB 1FJGO 5IYDO 4FVMA 4U3JB 2QDOA 3BEHA 2BSKA 1PNKA 1DF5A 1IBLO 3O9OA 1VQ5V 3ZRWB 4JZGA 2ZT9B 3N2KA 2Q0AA 1DF4A 3C90A 4F4LA 4WFGA 2Q67A 4DV3B 1NVPD 1BZKA 4JGSA 2ZM6O 5L3BA 3ZRWA 2DJVA 4ZHQB 4R50A 2F23A 3VQWA 3RW0A 4WBNB 1NJIW 3K9SA 2MW2B 3OM3B 1AVMA 5GONA 3KCYA 4WFFA 4CZZA 4BW5A 2LFSA 1P7BA 4UCVA 1FXVA 3P3PA 3R66A 4LWSA 4B7KA 2EX3A 4XDJA 3QF7A 1SQVH 2Q0OC 4WCEV 3H1HH 1O9GA 4NKGB 5KHGA 2DYRC 3CCUV 1GO3F 1L8DA 3RT3C 4DUYO 2DOSA 2Y69B 5DN6G 2RCVA 2R9RB 1OV9A 2WPDG 2P22C 4YY3B 1QVGU 4D7TA 2ITCC 4Q6GA 1FFXA 4X20B 2NLJC 2ZCEA 2AXTZ 4NR1A 5H5NA 1JVMA 2D2CB 2BTQA 1MOFA 2WLHA 4CH3A 4CH4A 2YXHA 4FZ1A 5L3DA 1V9PA 1Y4MA 2CH7A 3FAVA 4TWKA 4I4TA 2Y0PA 5KHIA 1AI6A 3ZRXA 2P6JA 2ZNIA 4YJ2B 4LF7B 2UXBO 4FLXA 4DR7O 3W7WA 1E1RG 1MA1A 3EHBB 4JI0B 4FMTA 5KHKA 1IBMO 3JCZA 1EFRG 1SZXA 3G80A 4R6ZA 1PV0A 4DR5O 1SS3A 1I5XA 1Y67A 2JK5C 1EN5A 2GTSA 4B3TO 2G38A 2VQEO 1O9HA 4B3SB 2X7RB 1SERA 1XUQA 5ITZB 3SYOA 4EEQA 2OWOA 2CTWA 5J2UA 2FL4A 4P9OA 3DXRB 4ZI7A 3FB5C 5H6RA 4X1IB 1JPXA 2GDSA 1YJ9V 4IHJB 3OAAG 5KAFZ 5EBLC 5B3SC 3T4DA 4H44B 3SPCA 1R3KC 1ZX3A 4G27B 4J9YB 4OPAA 4BW9A 4UB6Z 3T1HB 1N32B 1MABG 2V4DA 2X6AA 3ABMB 4JI5O 3MDSA 4MW8A 5IJ9A 2IU3A 2JRIA 3BABA 2F4VB 1NR7A 4UV8A 2A79B 1YCIA 3BVOA 4PA3A 3N2GB 4L87A 3RYFA 1YITV 3D36C 2HJDA 2K9PA 3ZHUA 2QWNB 4CH5A 1UFIA 2XAHA 1VQKV 3M7MX 2EIKB 2E75B 1Y6XA 4X66B 1NT2B 5EYPB 1H2GA 4MTFA 3JD3A 2ZR2A 1QNMA 3RVYA 2GUZB 4EB6B 5FNVB 3RYHB 5KHJA 2XUMA 2EZOA 3KCXA 2EIJC 2EINC 2FB5A 5C93A 3K3WA 5E1AC 3CCQV 3CSXA 4EKWA 1I0HA 2LO1A 3E8FA 5CN0A 5FNVA 3RYHA 3CXCU 5D5QA 2PI5A 1AI4A 3ABUA 3GVMA 2EULA 3QG5A 3PJSK 2IJKA 5EBWC 3CMEV 5JVDA 2KKWA 1ZL8A 1K92A 3MHHC 4FLZA 1FD9A 4K3AA 4PDLA 3JALB 3LDCA 2Y0IA 4DO2A 3OR6C 4LFCB 5KX5A 1WB8A 4GLXA 4FLWA 4KHPO 1YEWA 3JAWB 5CA3A 1VQ8V 1I5YA 4JTCB 4LF4O 1HP8A 1I94B 1Y74A 5L3CA 2VQFO 2A06H 4CS4A 3G67A 3W7UA 4DUZO 5EZYA 1XEQA 1IBKB 1KU9A 2ZIMA 2ITDC 2QWRB 4DV4B 1YJWV 1WB7A 3AG2C 4QJFB 1PP9H 2JDIG 2N74A 3ZIAG 1VQ7V 1JA8A 2ZNJA 2YEVA 4O4LA 5JQGA 2R70A 2IU0A 2C2AA 2N05A 2ZE5A 5BR8O 4B3RO 1GH6A 3E22A 4MTXA 1TUEB 3CRAA 2LW1A 1GN2A 1FJGB 2ZR3A 3ASOC 1YTFB 1L1FA 3M99B 4RQEA 3JASA 5CA0B 4DV3O 3OGCC 2PUSA 4X1YA 1RFYA 1K5QA 3H1LH 4FK5C 1KYOF 3L73H 3OR7C 5LMUB 5IWAO 5CB4B 4ZOLB 3FB8C 4LNUA 2AZ0A 1BMFG 2ZM6B 1FPOA 4I5SA 2ADPA 4DV2O 2WLLB 2BOCC 1B04A 3CHXA 2A9HA 3SPGA 5KMGB 3ZMUA 1H2MA 1R3JC 2YDEA 1N4CA 3AK3A 3H9VA 1YHQV 3JD1A 3GWOA 2HR3A 1RP3B 3A0BZ 4W4LA 4WFAV 1QLNA 1Q8IA 4P30A 4X8AA 1TGOA 1Y76A 4DUYB 2LJ2A 3SDLA 1R3LC 4ZKIA 3CPWU 4JI7B 4MTGA 1XNQO 1ZLZA 4NVPA 2Y48A 3JATA 4KL1A 4PDVA 1XHZA 2KSDA 2O57A 2XASA 5IYZA 1FXKA 1SQQH 3HR0A 2Y69C 1R6NA 2FYUH 4JAAA 1S0VA 5KA6A 5L3GA 3AG4B 1F4NA 2OT5A 1TVKB 1V54B 3AK2A 3CJHB 4IIJA 1FYJA 4H13B 2OCHA 1JQ0A 3U0ZA 2KG7B 1JFFA 1Q6UA 1W59A 1SQFA 1DTOA 3TJTA 2UXBB 4X89A 2UUAO 3JCUZ 4RQFA 2GV9A 1AILA 5KA5A 5JCOA 5KUMA 1S5HC 1IBMB 2B1GA 4B3SO 2UXCO 3OUSA 4DR5B 4O4JB 1U97A 4DV5B 3ZBHA 1QLEC 4XBFA 1H2KA 1IURA 3G6EV 2ATKC 1OHHG 4QPKA 3TK1A 4FM2A 3IGAC 4LF5O 2BCCH 3JSLA 1K3EA 3CCMV 3OEHG 2YS8A 3ZRSA 1GK9A 4MVSA 4Q20A 1M56C 2UUCB 4ABMA 5GTHZ 3JSNA 4HAMA 4GCZA 2IH3C 2OIGA 4I50B 3DTUB 1HR0O 2CGOA 1S5LZ 5EIBC 4JI5B 2WLIA 1VF7A 3ZS8C 5EIBD 4PA7A 1JJOA 2CUGA 2ADQB 2AHZA 4CC5A 2QKSA 3ABMC 3D36A 4FIPC 4NTXA 1KQSU 1RSOA 4I9WA 3LSSA 1OJHA 4OPHA 4X64O 3SJQC 3F7VC 3U10A 4U7NA 5FPOA 5EK0A 3BAAA 1RM1B 1JR9A 2JJ1G 3E35A 1TUBB 3VOUA 3DC6A 1N36O 1XQ8A 3WU2Z 3ASNC 3APOA 1WN7A 1WA8A 3UT5A 3BHPA 1N34O 2EIKC 4LR3A 4O2BA 4JV5B 1CPYA 1RPRA 5LGNA 2YICA 1R6KA 4BAYA 2DYSB 2YI8A 4HBNA 5AG2A 1PPJH 5LYJA 4KHPB 1D2DA 4F6RB 3BPZA 2EBOA 2QWOB 1BGYH 1ROPA 4LF4B 2ZE8A 1MNGA 2ZINA 1NH2D 4JAVA 2RDCA 2VQFB 4I0XA 2EZPA 1WP8A 4DV4O 1AI7A 4AI8A 3UQ8A 4DUZB 3CCVV 1Q90D 3JAKB 2VWJA 3E86A 2OCCB 2ZXWC 1K4DC 2BSKB 2OTLV 4H0LB 3I56V 1EN4A 2IW5A 2XAJA 1SA0A 3N2KB 3ZMSA 4KP4A 2QTSA 2M7WA 4MT8A 5BR8B 4B3RB 1Z5VA 3WG7B 1OCCB 2IJJA 1L0LH 3RYIA 1MZEA 3OTFA 5LMUO 2HG5C 1KB9F 1M93A 1MSWD 5GONB 4J7ZA 1AB3A 2B1IA 1FKAO 5LA6A 1THZA 4DYLA 1AP6A 4LWSB 2R9AA 1S77D 5FPRA 5IWAB 1XMOO 5J2TA 1M5IA 3HKBA 4UCRA 4X88A 4XDKA 2H94A 4J41A 1GN4A 4UVBA 1HNWO 3SPJA 5LP6A 1SETA 2VS0A 3CWBH 1YXBA 1EZVH 2BTOA 4DV2B 4IGGA 4AQYO 4U3FH 4W4KA 2E76B 4BIZA 2XOKG 4MVRA 2EIMC 2LQTA 4DR4O 3ZMTA 4TV9A 1NZ6A 3R65A 2OYQA 4Z2WA 1Y66A 4HYOA 3OMAB 1R3IC 1MSDA 3ZN1A 3WB1A 1FFXB 4JI7O 3F5WC 5JJEB 4UXNA 3K0GA 3H1JH 3O65A 4J7KA 3LSQA 1KMIZ 4CS3A 2BTQB 2X6CA 2P4VA 2WLNA 2ZQMA 4XDLA 4F6EA 2CE4A 2CH7B 3FAVB 3RYCA 2NR5A 4I4TB 1ENVA 3HKCA 2DWEC 2YIBD 1XNQB 3G4SV 2A3QA 2CTRA 3E89A 1JJ2U 1PL0A 2P7TC 3U11A 4DRXA 2YUAA 4WFBV 3J81N 4ZBMA 3BA8A 1K7DA 2F43G 3FD9A 3L70H 3K03A 2XAQA 2UU9O 1E79G 3K08A 3UM7A 2Q5ZA 3CRCA 1J95A 5B1OA 4FFBA 4AHCA 4NXNO 4LH6A 1GMGA 2Q7EA 1OCRB 1M9NA 1IDSA 3F5TA 4GYCB 1WPBA 1VEWA 1YZBA 2AGAA 2HKOA 3AG4C 3QVNA 4TUYA 3UKMA 4E4EA 2UUAB 1V54C 2AHYA 3ETEA 5J2UB 4YJ3A 2R72A 4ZI7B 4DV5O 5EC1C 3K79A 2ILMA 2CAZC 3SYAA 2UXCB 1K97A 3FB7C 5LL6Y 5D5PA 1X59A 3TXQA 3CCEV 4QE7A 5CA1A 3ABKB 5IYBO 3WB2A 3T1YO 2UUCO 4LF5B 1B6QA 1E1QG 4UVAA 1YSCA 3J7AU 2QM7A 5IJ9B 1BQ0A 4UUJC 4GKJB 3CRQA 1Q7YW 4A5UB 4X62O 1FXHA 3ZHRA 3AG1C 4UCUA 5JH7A 4CBCA 1P49A 3JAMN 1VP7A 3RYFB 3E83A 5GW7A 3BY6A 1HR0B 3UO2A 3K06A 1FS0G 5BY1A 5HFLA 3RBZA 1GKFA 3KKYA 5B1AB 3A0RA 5CBHA 1K9MW 3CE2A 3D3QA 1BCCH 2WAMA 4GX1A 2ZDIC 4FM0A 2CK3G 5LHIA 1EN6A 2ODMA 5B1BB 4CC6A 3K59A 1G8MA 4DV1O 1A32A 1XOUA 2XT9A 4X64B 4JYBA 1NTZH 5JVDB 1ZL8B 4FFKA 2XAFA 4JV5O 3LNNA 5KX5B 2GHYA 4LF8B 4L8JA 3C3SA 1N36B 3HB3B 3CX5F 3N27A 1WNSA 4UCTA 4IYIA 1Y74B 2BOBC 1N34B 4PA6A 4FPPA 2OTJV 2YXYA 2LFRA 4YXWG 2XTAA 4Z1MG 4OX9O 2UXNA 1KKDA 5J9PC 1RM1C 1W2BU 1XMQO 1YJNV 2GTAA 5EZYB 2PYLA 3HPLC 1KP3A 2WLMA 4EFBA 3ZN0A 4N21A 3JD0A 1HW7A 4K8XA 2HFEC 4LBEC 4JASA 1PM9A 4GKKO 2DYSC 4PV1B 5DEDA 3ZEDA 2YEVB 4O4LB 5JQGB 3K5LA 1R73A 2CTPA 3KG2A 4I55A 3E22B 3B77A 3T4ZA 4JYAO 5C8YA 1S5JA 1AJNA 5CBFA 3FB6C 3OMIB 3JASB 2KQXA 4LC1A 2ZE6A 4GT1A 4O2AA 5IJ0A 4X1YB 5LXTA 2RN9A 3ETGA 3X2QC 4C7UA 1IVSA 4WF9V 3ETDA 2AW9A 1NVPB 4MSWC 2N04A 1VQ9V 4O4IA 4LNUB 3ABLB 3EFFK 3JARA 2P06A 1XILA 1KD1W 4PI2A 5DM6V 2NNUA 4ZIBA 4DK1A 5BZBA 1VQLV 3MAQA 2F66C 4UCOA 2Q69A 4DR3O 1SQGA 5KHHA 4FZ0A 4E2LA 3I5DA 5H2FZ 2QM8A 5FL7G 1XMOB 3WG7C 1OCCC 1HWYA 2A7WA 4RAIA 3QO5A 4QE9A 4TQDA 2DYRB 1HNWB 1NQTA 5FLXN 4JF3A 4JI4O 1Y76B 2IBZH 3CCRV 4DW0A 4AQYB 3ZHQA 1UJWB 4KXRA 3T1CA 3QNEA 4DR4B 1BT8A 1RPOA 1SC5B 4TV8A 4KFMA 1H8HG 5IYCO 1ORQC 3JATB 2B5UA 4RWUA 5IYZB 1FXKB 3BFRA 4NXMO 1K33A 3AG7A 3BCCH 1IX9A 1QBZA 2F1MA 3K04A 5E79Z 1P4RA 1Q6HA 4IIJB 2PF4E 4J80A 2YIBA 1N8RW 1JFFB 1P84F 3Q4HA 2HHHO 1SESA 3G6BA 1GM8A 1M90W 4PELA 2D3OW 3K5OA 2E74B 4B7EA 1NTMH 3TGUH 4LH7A 1I08A 1Z2GA 2UU9B 3TETA 1W0KG 1VMGA 1SQXH 3LDEA 1ZSPA 4NXNB 1JOYA 2Q68A 1GN6A 3CCJV 1N0JA 1ZUQA 2L6LA 3SJCC 4DR6O 1WP7A 3K9AA 4LFBO 4UB8Z 2WWWA 3OEEG 5L3FA 3AK1A 4NB5A 2RMKB 2QJ1A 1LUWA 3RWRD 1HNXB 4R7CA 5EC2C 2F93B 5B5EZ 4G28B 2UUBO 5CMUA 3OT7A 3APQA 4UVCA 3CC2V 4HNAA 1AI5A 1S76D 3UO3A 4IL6Z 2R9IA 3T1YB 4GKJO 4DR1O 4OGQB 4X9QA 5IDJA 3GWKC 4WFHA 1Q5OA 2L35A 2WLIB 4J10A 1IXBA 1Z5WA 4JI2B 4X62B 5H6QA 1YI2V 3B40A 3ABKC 3FKSG 1PL4A 1YF2A 3PN1A 4IYHA 1HDJA 3OUFA 1N33O 2JGDA 1RSOB 3VBBA 2IJIA 4JPRA 1EM1A 3HKDA 4JTDB 4JI6B 2PTMA 1BHAA 1S3JA 1I7FA 1KP2A 4H33A 2QSAA 1XL4A 2H3OA 5GTIZ 1G6UA 5IY5B 1ZWIC 4JI8O 2Q7HA 1BQZA 2F95B 3UT5B 1WA8B 3W7TA 1KKCA 5B1AC 4O2BB 1JCHA 4LF8O 2GBOA 2CGNA 4DV1B 3HKEA 3B4SA 3D8CA 3SYCA 2JS5A 1XHXA 5B66Z 4MVZA 2CTQA 2Q4PA 5TISZ 5LYJB 1KC8W 2UXDB 4D7SA 4PD4F 4J42A 4J9ZB 5IE9A 1NU1H 2X0LA 1H8EG 1BS3A 3M8AA 1BSMA 2WA3A 4I0XB 3L71H 3J80N 4OX9B 3CB2A 1COWG 1VQMV 1BE3H 1XMQB 4O4HA 1NBMG 2PZSA 2Q6AA 5BMVA 1Q43A 1SRYA 2WA4A 4LF6O 1M57B 1L0NH 1GAXA 3AG2B 2LW7A 3RN4A 3ZHVA 2BE3A 2Z0AA 2JVDA 4GKKB 1SA0B 4FM1A 2YSUB 4NYKA 2X6BA 1QU7A 1H38A 4LF9B 1NI8A 4BIUA 4KUMA 4B3MO 1SZTA 3C3TA 3RYIB 4GZRB 4J11A 3OMNB 4JYAB 1T5EA 3GB7C 4DV0B 4DV7B 3T2MA 2VWKA 2RJZA 4EFEA 4YIOA 5LA6B 1IXMA 2KB1A 3OFNG 5J2TB 4GX2A 3HKBB 1JMKC 3CS5A 3LNMB 1GN3A 2ZE7A 4JI3O 4DK0A 3S3XA 5LP6B 3CEIA 3NR7A 1OCOB 4X1KA 1CEZA 1GRJA 1AJQA 4PI0A 3RGBA 4U3JA 4RUFA 1CP9A 4DR3B 4RO2A 4TV9B 1YTFD 3K0DA 1Q81W 3ABLC 4JYCA 1CXZB 4FJCC 3B09A 3OGIB 3QO7A 4R8CA 2ARHA 2B9ZA 2V7QG 4JI4B 5LHGA 4BIOA 1VQOV 1AROP 4ASUG 4ZHQA 3SYQA 4WBNA 3E2EA 4K35A 3EVKA 3QTCA 3RYCB 3HKCB 1OCZB 1DLBA 1AR4A 5F2VO 2YI9A 1GTOA 3CMAV 4NXMB 2JGUA 4DRXB 3SR2C 1VF6C 4QIWF 5LHHA 3P30A 5BXZA 1D5NA 1BHBA 1AP5A 2W6IG 5CBGA 1H2LA 2JIZG 3OE7G 4FFBB 1WJZA 2EILB 3ABTA 1FXKC 4G2KA 4MVOA 2HHHB 2Q8VA 2P5OA 4UV9A 1US6A 4WFEA 4TUYB 3ETQA 4FLYA 4K0KO 4JTAB 1DK1A 4X20A 4YJ3B 3L74H 1NR1A 3B2EE 3CRRA 3STLC 3A2FA 2QGNA 5A2QN
chains in the Genus database with same CATH topology
1YIJV 2QE7G 1EZJA 2DYSC 4RQFA 1AR1B 2IJHA 2YEVB 1QLEB 5KA5A 3X2QB 5KUMA 1R73A 3KG2A 1S5HC 4U7OA 2B1GA 3B77A 3MD0A 2FTKA 3ASOB 1XL6A 3T4ZA 1QR8A 2HVKC 1AJNA 5CBFA 3FB6C 3OMIB 3OUSA 3B8NA 1F51A 4LC1A 2XAGA 3E8BA 1QVFU 4GT1A 2Z5UA 2Z3YA 4MVQA 1QLEC 3ETGA 4XBFA 3X2QC 3OW2U 1M56B 3ETDA 4WF9V 3G6EV 5H9CA 2ATKC 3AEIA 1NVPB 4MSWC 1OHHG 4QPKA 3TK1A 5IYDO 3IGAC 1VQ9V 4RUEA 2UXXA 1WPXA 3BEHA 1K3EA 1PNKA 1DF5A 3CCMV 3ABLB 3EFFK 3OEHG 1KD1W 3ZRSA 1GK9A 5LGUA 4MVSA 4Q20A 4TT3G 1VQ5V 3ZRWB 5DM6V 1M56C 2NNUA 5BZBA 1K4CC 1BL8A 1VQLV 3IFXA 1DF4A 4F4LA 2Q69A 2JJ2G 2Q67A 4WFGA 1NVPD 4JGSA 4E2LA 4HAMA 5L3BA 4GX0A 3ZRWA 4GCZA 2IH3C 4R50A 2QM8A 5FL7G 2DQ0A 3RW0A 1NJIW 3WG7C 1V55B 1OCCC 1PNLA 3DTUB 3OM3B 1HWYA 4PDMA 3QO5A 4RAIA 4QE9A 4WFFA 2DYRB 2WLIA 1QR9A 4CZZA 2HVJC 1NQTA 4BW5A 2LFSA 4JF3A 4PA7A 2H8PC 1P7BA 3CCRV 1FXVA 2QTOA 2AHZA 4XDJA 1UJWB 3CYOA 3T1CA 4DXWA 3QNEA 4WCEV 2XNDG 3AG3B 1RPOA 2QKSA 2DYRC 3ABMC 3D36A 1M1KW 4FIPC 3CCUV 3E8GA 1VQ4V 1KQSU 1GO3F 4KFMA 1H8HG 4I9WA 5IYCO 1ORQC 1K34A 3LSSA 2GSMB 3ASNB 5L3EA 2QA4V 2B5UA 2Y69B 3SJQC 3F7VC 1FXKB 4U7NA 5DN6G 1K33A 5EK0A 5KUKA 2R9RB 1RM1B 3E35A 2JJ1G 1QBZA 3K04A 3JYCA 3VOUA 1P4RA 2WPDG 1QVGU 1PNMA 3ASNC 1N8RW 2ITCC 5LGTA 5IY5C 2EIKC 2V1DA 2NLJC 1CPYA 1RPRA 5LGNA 1NH2B 1JVMA 1R6KA 2JEUA 1SESA 4BAYA 1GM8A 4H37A 1M90W 1MOFA 2WLHA 2DYSB 2WLJA 4PELA 3STZC 2D3OW 5L3DA 1Y4MA 4TWKA 4QNHB 1AI6A 3ZRXA 2EBOA 2P6JA 3TETA 1ROPA 1W0KG 3LDEA 4TSFG 4MTOA 4OXSA 1NH2D 1EBOA 4JAVA 3CCLV 1JOYA 2ZXWB 2Q68A 4PA9A 2EZPA 1F4MA 3SPHA 3CCJV 1AI7A 3W7WA 1E1RG 3EHBB 3K9AA 2WSSG 3CCVV 1WLEA 4FMTA 1VQNV 2WWWA 3OEEG 5L3FA 3JCZA 1EFRG 1K73W 1GM9A 1GM7A 1K5SA 3QO8A 3E86A 2OCCB 2ZXWC 1K4DC 4R6ZA 4R7CA 1I5XA 2JK5C 5EC2C 2OTLV 1M57C 4G28B 1PD3A 3LDDA 3I56V 5CMUA 3W7SA 2IW5A 2XAJA 2X7RB 3ZCCA 3ZMSA 1SERA 4KP4A 4UVCA 3SYOA 3CC2V 3JD4A 2M7WA 4MT8A 2OCCC 4P9OA 1AJPA 1W0JG 1AI5A 1S76D 3FB5C 5H6RA 2R9IA 3WG7B 1JPXA 1OCCB 2IJJA 1YJ9V 3OAAG 5EBLC 3F7YC 3RVZA 1Q86W 2HG5C 5B3SC 3T4DA 1MSWD 5IDJA 5HFMA 3SPCA 1R3KC 4WFHA 2B1IA 2WLIB 4G27B 4J9YB 1G4YB 1THZA 1S77D 1Q82W 1MABG 5H6QA 2X6AA 1YI2V 3ABKC 3FKSG 3ABMB 4X88A 4XDKA 2EIMB 2H94A 3OUFA 4UVBA 3SPJA 1SETA 4MW8A 2IU3A 3VBBA 1NR7A 4UV8A 2A79B 2IJIA 1OCOC 3ML0A 4JPRA 4PA3A 4JTDB 4BIZA 2XOKG 4L87A 1BHAA 1S3JA 4MVRA 2EIMC 3ZMTA 1KP2A 4H33A 1OZ0A 1YITV 3R65A 1XL4A 1Y66A 1LNQA 2WLLA 4HYOA 3OMAB 1R3IC 5IY5B 1ZWIC 2XAHA 1VQKV 3MHSC 2EIKB 3ZN1A 4PDRA 3F5WC 3W7TA 5B1AC 4UXNA 1JCHA 1H2GA 4MTFA 3JD3A 3K0GA 2ZR2A 1JX9A 4QPJA 3LSQA 3RVYA 3SYCA 2MK3A 2X6CA 2EZOA 2WLNA 2ZQMA 2EIJC 4XDLA 3ZJZA 4MVZA 2EINC 5C93A 2WLKA 3K3WA 5E1AC 1KC8W 3CCQV 4EKWA 1ENVA 3CC7V 2DWEC 3E8FA 5CN0A 3CXCU 3G4SV 2PI5A 4MW3A 4J9ZB 4N23A 1OCZC 1AI4A 3ABUA 2W0FC 3WFVA 2QEXV 2X0LA 3PJSK 2IJKA 3E89A 2DW4A 5EBWC 1JJ2U 3CMEV 1H8EG 1PL0A 2P7TC 3NXSA 1K92A 3MHHC 4WFBV 4PDLA 4ZBMA 2HJFC 3LDCA 4DO2A 1K7DA 2F43G 3OR6C 3K03A 1COWG 5CA3A 1VQMV 2XAQA 1VQ8V 2DWDC 1NKDA 1FFTB 1I5YA 1E79G 2IH1C 1NBMG 3K08A 4LCUC 4JTCB 2Q6AA 3UM7A 1J95A 5B1OA 1SRYA 5L3CA 3ZMZA 1M57B 1GMGA 3AG2B 3CC4V 4JAUA 3W7UA 1OCRB 1M9NA 2EILC 2PI4A 3IC7A 3AG4C 2HKOA 2ZD9A 4MVUA 3UKMA 2YSUB 1V54C 2AHYA 2X6BA 3ETEA 2ITDC 1H38A 3DGEA 1YJWV 5EC1C 3AG2C 1PKXA 3K79A 4BIUA 4KUMA 1OCRC 1SZTA 4QJFB 5B3SB 3SYAA 2JDIG 3ZIAG 3OMNB 1KECA 1K97A 1VQ7V 3FB7C 3GB7C 2W6JG 3T2MA 4GX5A 2YEVA 2IU0A 2C2AA 4MS2A 3CCEV 4QE7A 1IXMA 3ABKB 2KB1A 5IYBO 4MTXA 5EBMC 1TUEB 3OFNG 2DQ3A 3AG1B 3E8HA 2ZR3A 4GX2A 3ASOC 1YTFB 1L1FA 5LBQA 3M99B 1B6QA 3LNMB 1E1QG 4RQEA 1S72V 2LP7A 1QCEA 4UVAA 1YSCA 2A0LA 3D3IA 3OGCC 3SPIA 2QM7A 1K5QA 4UUJC 4FK5C 3SYPA 1OCOB 4LP8A 3G71V 1CEZA 3OR7C 1Q7YW 1FXHA 3AG1C 1AJQA 3CP1A 4CBCA 2OTJV 4RUFA 1CP9A 3E83A 3FB8C 5GW7A 3BY6A 4RO2A 1BMFG 1YTFD 4I5SA 3K0DA 1Q81W 3ABLC 2WLLB 2BOCC 4JYCA 4FJCC 3K06A 1FS0G 5HFLA 3RBZA 2A9HA 1GKFA 5B1AB 3QO7A 4R8CA 3SPGA 3A0RA 5CBHA 2V7QG 3ZMUA 1R3JC 1K9MW 5LHGA 1VQOV 1AROP 3LUTB 2ZDIA 3CD6V 4ASUG 2EIJB 2WAMA 3SYQA 1YHQV 4PA4A 3JD1A 2EINB 5B1NA 3E2EA 3GWOA 2ZDIC 4GX1A 2CK3G 2HR3A 1V55C 1F23A 4WFAV 5LHIA 1QLNA 5B1BB 4P30A 1OCZB 1DLBA 4X8AA 3ZRVA 3ZMVA 1G8MA 2P67A 1R3LC 4JYBA 4ZKIA 1GTOA 3CMAV 3CPWU 2XAFA 4MTGA 3TCUA 5B1BC 4QIWF 5LHHA 3P30A 2GHYA 3AG3C 2JEXA 4MVMA 4HZ3A 1BHBA 3P32A 2Y48A 3HB3B 2W6IG 3FYEB 4PDVA 2K1EA 5CBGA 1MG1A 3CCSV 2XASA 1FXKA 2JIZG 3FYIB 2BOBC 3OE7G 4PA6A 2Y69C 4FPPA 2EILB 1R6NA 3ABTA 3I55V 1FXKC 2LFRA 4G2KA 4MVOA 4YXWG 1K8AW 1S0VA 5KA6A 4Z1MG 5L3GA 2P90A 2UXNA 3JD2A 4P2ZA 1KKDA 3AG4B 1F4NA 5J9PC 2OT5A 1RM1C 3B8MA 4UV9A 1W2BU 1V54B 4WFEA 1YJNV 4P9PA 3HPLC 1KP3A 2WLMA 1JQ0A 3H01A 4JTAB 3W7XA 3ZN0A 4N21A 3JD0A 1VQPV 2HLDG 1VQ6V 1NR1A 1DTOA 2HFEC 3STLC 2EJRA 4LBEC 4JASA 4X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA3 A;  4GX2 A;  3ASO C;  2ITC C;  4JTD B;  5IY5 C;  2DYS C;  3LNM B;  4MVR A;  2EIK C;  2EIM C;  2NLJ C;  4H33 A;  2A0L A;  3OGC C;  3R65 A;  3SPI A;  5KUM A;  4UUJ C;  1XL4 A;  1JVM A;  1S5H C;  3KG2 A;  3SYP A;  1LNQ A;  2WLL A;  4LP8 A;  1XL6 A;  3OR7 C;  4H37 A;  4HYO A;  3T4Z A;  1R3I C;  2WLH A;  1ZWI C;  3AG1 C;  2WLJ A;  2HVK C;  3STZ C;  4PDR A;  4CBC A;  5CBF A;  3FB6 C;  3OUS A;  3F5W C;  4RUF A;  4TWK A;  3E83 A;  3E8B A;  3FB8 C;  5B1A C;  4RO2 A;  4QNH B;  4MTF A;  3K0G A;  4MVQ A;  1QLE C;  3X2Q C;  3RVY A;  3TET A;  3K0D A;  3LDE A;  3SYC A;  3ABL C;  2WLL B;  2BOC C;  2X6C A;  4MTO A;  3K06 A;  4OXS A;  2ATK C;  2WLN A;  2EIJ C;  4MSW C;  2A9H A;  4XDL A;  3RBZ A;  3ZJZ A;  4MVZ A;  2EIN C;  2Q68 A;  3IGA C;  4PA9 A;  4R8C A;  3SPG A;  2WLK A;  3BEH A;  4RUE A;  3SPH A;  5E1A C;  5CBH A;  1R3J C;  4EKW A;  2DWE C;  3E8F A;  3EFF K;  3LUT B;  4MW3 A;  4J9Z B;  3ZRS A;  4MVS A;  3SYQ A;  1OCZ C;  2W0F C;  4PA4 A;  4GX1 A;  1M56 C;  3PJS K;  5EBW C;  3E89 A;  5BZB A;  1K4C C;  1BL8 A;  3IFX A;  2P7T C;  3E86 A;  1V55 C;  4F4L A;  2ZXW C;  1K4D C;  4PDL A;  4R6Z A;  2HJF C;  2Q67 A;  2Q69 A;  3LDC A;  4WFG A;  3OR6 C;  4ZBM A;  4P30 A;  4R7C A;  5EC2 C;  2JK5 C;  3K03 A;  4X8A A;  1M57 C;  4G28 B;  4GX0 A;  2DWD C;  3LDD A;  2IH3 C;  4R50 A;  4LCU C;  3RW0 A;  2IH1 C;  3K08 A;  3WG7 C;  4JTC B;  1R3L C;  1OCC C;  2Q6A A;  3UM7 A;  4PDM A;  1J95 A;  4RAI A;  4QE9 A;  3SYO A;  4WFF A;  2WLI A;  2OCC C;  4MTG A;  4P9O A;  2HVJ C;  3TCU A;  5B1B C;  4BW5 A;  3FB5 C;  4PA7 A;  3AG3 C;  2EIL C;  2H8P C;  4MVM A;  1P7B A;  4HZ3 A;  2QTO A;  5EBL C;  2AHZ A;  3F7Y C;  4XDJ A;  4PDV A;  2K1E A;  3RVZ A;  3AG4 C;  5CBG A;  2HG5 C;  2ZD9 A;  4MVU A;  3UKM A;  5B3S C;  3T1C A;  4DXW A;  3T4D A;  1V54 C;  2AHY A;  3SPC A;  2BOB C;  1R3K C;  2X6B A;  4WFH A;  4PA6 A;  2ITD C;  2Y69 C;  2WLI B;  2QKS A;  2DYR C;  3ABM C;  4G27 B;  4J9Y B;  4MVO A;  5EC1 C;  1G4Y B;  3AG2 C;  3E8G A;  4P2Z A;  4KFM A;  1KKD A;  4I9W A;  1ORQ C;  1OCR C;  5J9P C;  3SYA A;  4WFE A;  2X6A A;  4P9P A;  3HPL C;  3ABK C;  2WLM A;  3FB7 C;  3GB7 C;  3SJQ C;  3F7V C;  4JTA B;  4X88 A;  4XDK A;  3T2M A;  3OUF A;  4GX5 A;  5EK0 A;  2YEV A;  5KUK A;  3SPJ A;  2R9R B;  4MW8 A;  4MS2 A;  4QE7 A;  3K04 A;  2HFE C;  2KB1 A;  3JYC A;  3STL C;  3VOU A;  2A79 B;  4LBE C;  5EBM C;  3E8H A;  3ASN C;  1OCO C;  4X89 A; 
#chains in the Genus database with same CATH topology
 4QGP A;  2YXL A;  1YIJ V;  1XNR O;  1EZJ A;  1URF A;  1AR1 B;  1HNX O;  2IJH A;  4DR6 B;  1QLE B;  3OTO O;  4LFB B;  2OIE A;  5CA1 B;  1ZAU A;  4YJ2 A;  1Q3E A;  1R6T A;  5JCO C;  4AIL C;  1XL6 A;  1NTK H;  1QR8 A;  4DW1 A;  1DGS A;  3E8B A;  1QVF U;  2DE0 X;  2UUB B;  3H1I H;  4DR2 O;  2DMX A;  1X4T A;  1M56 B;  2Q7G A;  5H9C A;  3AEI A;  5IT9 N;  5JH7 B;  2NN4 A;  4YIP A;  1IZ3 A;  2UXX A;  1WPX A;  4RUE A;  5A9G A;  2EJ7 A;  4DR1 B;  5LGU A;  4JI2 O;  4TT3 G;  2HP8 A;  1K4C C;  1BL8 A;  3IFX A;  5ITZ A;  2RNB A;  5JJN B;  5LOV B;  3DXR A;  2JJ2 G;  4X1I A;  4GX0 A;  4IHJ A;  2DQ0 A;  3WB0 A;  1V55 B;  1PNL A;  4PDM A;  4JI6 O;  4TOI A;  5LOV A;  1N33 B;  4B08 A;  3CRM A;  1QR9 A;  1HNZ B;  2HVJ C;  1VAR A;  2H8P C;  3BRC A;  2QTO A;  1M4U A;  3FFQ A;  3IC9 A;  3CYO A;  4DXW A;  2XND G;  1SF9 A;  3L9D A;  3AG3 B;  2LGW A;  1M1K W;  3E8G A;  1VQ4 V;  4K8Z A;  1LR1 A;  1K34 A;  3LSU A;  2GSM B;  1NS1 A;  3ASN B;  5L3E A;  4JI8 B;  2QA4 V;  4YHH B;  2E5L B;  3N2G A;  2YIA A;  3DSQ A;  2UXD O;  5KUK A;  5DEC A;  1MMM A;  4PJ0 Z;  1FAF A;  3JYC A;  2QR4 A;  4UFZ A;  2HEP A;  1PNM A;  3VQX A;  5LGT A;  5IY5 C;  3K58 A;  1R1B A;  2V1D A;  5EYP A;  4NTW A;  4CS2 A;  1NH2 B;  4EB6 A;  2GUZ A;  1SKV A;  2JEU A;  2QWP B;  4H37 A;  2WLJ A;  3STZ C;  4JI1 O;  2JS3 A;  4QNH B;  4I55 B;  2M6Y A;  4TSF G;  4MTO A;  1SQB H;  4OXS A;  5C8Y B;  1EBO A;  3CCL V;  2ZXW B;  4LF6 B;  4J7J A;  4PA9 A;  1F4M A;  4LF9 O;  3SPH A;  3JAL A;  4O2A B;  2RQ6 A;  1XDC A;  5IJ0 B;  3JAW A;  4DV6 O;  3TXS A;  5LXT B;  2LGQ A;  4X65 O;  2WSS G;  1WLE A;  1VQN V;  1B06 A;  4Z1V A;  4DV0 O;  4DV7 O;  1K73 W;  1GM9 A;  1GM7 A;  1K5S A;  3QO8 A;  4LFA B;  4JYY A;  3K5M A;  4IT5 A;  3A0H Z;  4O4I B;  5LMN O;  1M57 C;  2W0X A;  3JAR B;  4NTY A;  4B3M B;  1PD3 A;  3LDD A;  3W7S A;  1U96 A;  1F7Y A;  3ZCC A;  3JD4 A;  2OCC C;  3UCS C;  1AJP A;  1W0J G;  2PGG A;  2Q73 A;  3F7Y C;  3RVZ A;  1Q86 W;  4UCS A;  1J5E B;  5HFM A;  4JI3 B;  2YC0 A;  1G4Y B;  1N0N A;  1IBL B;  1Q82 W;  1YVW A;  1TAE A;  1KUQ A;  1QHT A;  2EIM B;  4BR6 A;  5CA0 A;  3FX7 A;  4TV8 B;  3VQY A;  5LP6 C;  4TQF A;  1OCO C;  3ML0 A;  1XRE A;  5CB4 A;  3P3N A;  4ZOL A;  1OZ0 A;  2IM9 A;  3A8T A;  3L72 H;  1LNQ A;  3SGI A;  2WLL A;  3THO A;  1D5A A;  3MHS C;  4PDR A;  3KZI Z;  5KMG A;  1G1X B;  3Q4H B;  3IAY A;  1JX9 A;  4QPJ A;  2MK3 A;  4YY3 O;  2QWQ B;  3ZJZ A;  1VF6 A;  2E3C A;  2WLK A;  1AR5 A;  2YID A;  3CC7 V;  1QQC A;  4MW3 A;  4N23 A;  1OCZ C;  3WFV A;  2QEX V;  2W0F C;  2DW4 A;  1B3Q A;  3NXS A;  2Y4T A;  1UPG A;  2HJF C;  3ICX A;  2Q9L A;  1XBL A;  4D6T H;  2PY5 A;  2DWD C;  1NKD A;  1FFT B;  4LCU C;  2IH1 C;  4ICG A;  2XHB A;  4LF7 O;  4K0K B;  1SQP H;  1ZTE A;  3ZMZ A;  3SJB C;  3CC4 V;  4JAU A;  2EIL C;  2PI4 A;  2FML A;  4JI0 O;  1TVK A;  3IC7 A;  3CJH A;  2ZD9 A;  4MVU A;  1XNR B;  2KG7 A;  4HNA B;  2P4K A;  3DGE A;  3OTO B;  4DR7 B;  1PKX A;  2AZ2 A;  1OCR C;  5B3S B;  1XI1 A;  1KEC A;  5KLV H;  2W6J G;  4GX5 A;  2FKX A;  2VRZ A;  4MS2 A;  4DR2 B;  4B3T B;  1H2S B;  2VQE B;  5EBM C;  2DQ3 A;  3AG1 B;  3E8H A;  5LBQ A;  1S72 V;  2LP7 A;  1QCE A;  4O4J A;  2A0L A;  2JGD B;  3D3I A;  3SPI A;  4FLU A;  3SYP A;  3T1H O;  1N32 O;  4LP8 A;  3G71 V;  5K1X A;  3EXA A;  3OD4 A;  1KBH A;  3HKD B;  3CP1 A;  1HNZ O;  3ZHS A;  4I7Z B;  2F4V O;  3BA9 A;  1LUV A;  3K5N A;  2ZIO A;  4GUN A;  5JWP A;  3LUT B;  2ZDI A;  2Y4U A;  3HKE B;  3CD6 V;  2EIJ B;  2QKC A;  4PA4 A;  5B1N A;  2EIN B;  4I50 A;  4YHH O;  2E5L O;  4FLV A;  1V55 C;  1F23 A;  4X66 O;  1TA8 A;  3ZRV A;  3ZMV A;  2P67 A;  4I9Q A;  1H2N A;  5K1P A;  3IJ4 A;  3H1K H;  1YDX A;  3TCU A;  5B1B C;  4CH6 A;  1Q6I A;  3AG3 C;  2DN9 A;  2JEX A;  4MVM A;  4HZ3 A;  3P32 A;  3RFR A;  4O4H B;  3FYE B;  2K1E A;  3L75 H;  1MG1 A;  3CCS V;  5KAI Z;  5BMV B;  3FYI B;  3I55 V;  1K8A W;  2PYJ A;  1VIB A;  2P90 A;  3JD2 A;  4P2Z A;  4LFC O;  1TUB A;  3B8M A;  3SJA C;  1VF5 B;  4P9P A;  3H01 A;  3W7X A;  4JI1 B;  1I94 O;  2ZKO A;  3S3W A;  1VQP V;  2HLD G;  1VQ6 V;  4JZ2 A;  4PHZ A;  2EJR A;  4LFA O;  1MZF A;  2QE7 G;  4FLT A;  1WAZ A;  1IBK O;  4BWA A;  4DV6 B;  3X2Q B;  4X65 B;  4F6R A;  4U7O A;  3ZHT A;  1P7G A;  3MD0 A;  2FTK A;  3ASO B;  2ETN A;  2HVK C;  3ZX6 A;  2QM4 A;  5LMN B;  3B8N A;  1F51 A;  3K57 A;  2XAG A;  2Z5U A;  2Z3Y A;  3VQV A;  4MVQ A;  2CDY A;  2QKA A;  3DC5 A;  4X1K B;  3OW2 U;  3JAK A;  1J5E O;  3CXH F;  5JJJ B;  1FJG O;  5IYD O;  4FVM A;  4U3J B;  2QDO A;  3BEH A;  2BSK A;  1PNK A;  1DF5 A;  1IBL O;  3O9O A;  1VQ5 V;  3ZRW B;  4JZG A;  2ZT9 B;  3N2K A;  2Q0A A;  1DF4 A;  3C90 A;  4F4L A;  4WFG A;  2Q67 A;  4DV3 B;  1NVP D;  1BZK A;  4JGS A;  2ZM6 O;  5L3B A;  3ZRW A;  2DJV A;  4ZHQ B;  4R50 A;  2F23 A;  3VQW A;  3RW0 A;  4WBN B;  1NJI W;  3K9S A;  2MW2 B;  3OM3 B;  1AVM A;  5GON A;  3KCY A;  4WFF A;  4CZZ A;  4BW5 A;  2LFS A;  1P7B A;  4UCV A;  1FXV A;  3P3P A;  3R66 A;  4LWS A;  4B7K A;  2EX3 A;  4XDJ A;  3QF7 A;  1SQV H;  2Q0O C;  4WCE V;  3H1H H;  1O9G A;  4NKG B;  5KHG A;  2DYR C;  3CCU V;  1GO3 F;  1L8D A;  3RT3 C;  4DUY O;  2DOS A;  2Y69 B;  5DN6 G;  2RCV A;  2R9R B;  1OV9 A;  2WPD G;  2P22 C;  4YY3 B;  1QVG U;  4D7T A;  2ITC C;  4Q6G A;  1FFX A;  4X20 B;  2NLJ C;  2ZCE A;  2AXT Z;  4NR1 A;  5H5N A;  1JVM A;  2D2C B;  2BTQ A;  1MOF A;  2WLH A;  4CH3 A;  4CH4 A;  2YXH A;  4FZ1 A;  5L3D A;  1V9P A;  1Y4M A;  2CH7 A;  3FAV A;  4TWK A;  4I4T A;  2Y0P A;  5KHI A;  1AI6 A;  3ZRX A;  2P6J A;  2ZNI A;  4YJ2 B;  4LF7 B;  2UXB O;  4FLX A;  4DR7 O;  3W7W A;  1E1R G;  1MA1 A;  3EHB B;  4JI0 B;  4FMT A;  5KHK A;  1IBM O;  3JCZ A;  1EFR G;  1SZX A;  3G80 A;  4R6Z A;  1PV0 A;  4DR5 O;  1SS3 A;  1I5X A;  1Y67 A;  2JK5 C;  1EN5 A;  2GTS A;  4B3T O;  2G38 A;  2VQE O;  1O9H A;  4B3S B;  2X7R B;  1SER A;  1XUQ A;  5ITZ B;  3SYO A;  4EEQ A;  2OWO A;  2CTW A;  5J2U A;  2FL4 A;  4P9O A;  3DXR B;  4ZI7 A;  3FB5 C;  5H6R A;  4X1I B;  1JPX A;  2GDS A;  1YJ9 V;  4IHJ B;  3OAA G;  5KAF Z;  5EBL C;  5B3S C;  3T4D A;  4H44 B;  3SPC A;  1R3K C;  1ZX3 A;  4G27 B;  4J9Y B;  4OPA A;  4BW9 A;  4UB6 Z;  3T1H B;  1N32 B;  1MAB G;  2V4D A;  2X6A A;  3ABM B;  4JI5 O;  3MDS A;  4MW8 A;  5IJ9 A;  2IU3 A;  2JRI A;  3BAB A;  2F4V B;  1NR7 A;  4UV8 A;  2A79 B;  1YCI A;  3BVO A;  4PA3 A;  3N2G B;  4L87 A;  3RYF A;  1YIT V;  3D36 C;  2HJD A;  2K9P A;  3ZHU A;  2QWN B;  4CH5 A;  1UFI A;  2XAH A;  1VQK V;  3M7M X;  2EIK B;  2E75 B;  1Y6X A;  4X66 B;  1NT2 B;  5EYP B;  1H2G A;  4MTF A;  3JD3 A;  2ZR2 A;  1QNM A;  3RVY A;  2GUZ B;  4EB6 B;  5FNV B;  3RYH B;  5KHJ A;  2XUM A;  2EZO A;  3KCX A;  2EIJ C;  2EIN C;  2FB5 A;  5C93 A;  3K3W A;  5E1A C;  3CCQ V;  3CSX A;  4EKW A;  1I0H A;  2LO1 A;  3E8F A;  5CN0 A;  5FNV A;  3RYH A;  3CXC U;  5D5Q A;  2PI5 A;  1AI4 A;  3ABU A;  3GVM A;  2EUL A;  3QG5 A;  3PJS K;  2IJK A;  5EBW C;  3CME V;  5JVD A;  2KKW A;  1ZL8 A;  1K92 A;  3MHH C;  4FLZ A;  1FD9 A;  4K3A A;  4PDL A;  3JAL B;  3LDC A;  2Y0I A;  4DO2 A;  3OR6 C;  4LFC B;  5KX5 A;  1WB8 A;  4GLX A;  4FLW A;  4KHP O;  1YEW A;  3JAW B;  5CA3 A;  1VQ8 V;  1I5Y A;  4JTC B;  4LF4 O;  1HP8 A;  1I94 B;  1Y74 A;  5L3C A;  2VQF O;  2A06 H;  4CS4 A;  3G67 A;  3W7U A;  4DUZ O;  5EZY A;  1XEQ A;  1IBK B;  1KU9 A;  2ZIM A;  2ITD C;  2QWR B;  4DV4 B;  1YJW V;  1WB7 A;  3AG2 C;  4QJF B;  1PP9 H;  2JDI G;  2N74 A;  3ZIA G;  1VQ7 V;  1JA8 A;  2ZNJ A;  2YEV A;  4O4L A;  5JQG A;  2R70 A;  2IU0 A;  2C2A A;  2N05 A;  2ZE5 A;  5BR8 O;  4B3R O;  1GH6 A;  3E22 A;  4MTX A;  1TUE B;  3CRA A;  2LW1 A;  1GN2 A;  1FJG B;  2ZR3 A;  3ASO C;  1YTF B;  1L1F A;  3M99 B;  4RQE A;  3JAS A;  5CA0 B;  4DV3 O;  3OGC C;  2PUS A;  4X1Y A;  1RFY A;  1K5Q A;  3H1L H;  4FK5 C;  1KYO F;  3L73 H;  3OR7 C;  5LMU B;  5IWA O;  5CB4 B;  4ZOL B;  3FB8 C;  4LNU A;  2AZ0 A;  1BMF G;  2ZM6 B;  1FPO A;  4I5S A;  2ADP A;  4DV2 O;  2WLL B;  2BOC C;  1B04 A;  3CHX A;  2A9H A;  3SPG A;  5KMG B;  3ZMU A;  1H2M A;  1R3J C;  2YDE A;  1N4C A;  3AK3 A;  3H9V A;  1YHQ V;  3JD1 A;  3GWO A;  2HR3 A;  1RP3 B;  3A0B Z;  4W4L A;  4WFA V;  1QLN A;  1Q8I A;  4P30 A;  4X8A A;  1TGO A;  1Y76 A;  4DUY B;  2LJ2 A;  3SDL A;  1R3L C;  4ZKI A;  3CPW U;  4JI7 B;  4MTG A;  1XNQ O;  1ZLZ A;  4NVP A;  2Y48 A;  3JAT A;  4KL1 A;  4PDV A;  1XHZ A;  2KSD A;  2O57 A;  2XAS A;  5IYZ A;  1FXK A;  1SQQ H;  3HR0 A;  2Y69 C;  1R6N A;  2FYU H;  4JAA A;  1S0V A;  5KA6 A;  5L3G A;  3AG4 B;  1F4N A;  2OT5 A;  1TVK B;  1V54 B;  3AK2 A;  3CJH B;  4IIJ A;  1FYJ A;  4H13 B;  2OCH A;  1JQ0 A;  3U0Z A;  2KG7 B;  1JFF A;  1Q6U A;  1W59 A;  1SQF A;  1DTO A;  3TJT A;  2UXB B;  4X89 A;  2UUA O;  3JCU Z;  4RQF A;  2GV9 A;  1AIL A;  5KA5 A;  5JCO A;  5KUM A;  1S5H C;  1IBM B;  2B1G A;  4B3S O;  2UXC O;  3OUS A;  4DR5 B;  4O4J B;  1U97 A;  4DV5 B;  3ZBH A;  1QLE C;  4XBF A;  1H2K A;  1IUR A;  3G6E V;  2ATK C;  1OHH G;  4QPK A;  3TK1 A;  4FM2 A;  3IGA C;  4LF5 O;  2BCC H;  3JSL A;  1K3E A;  3CCM V;  3OEH G;  2YS8 A;  3ZRS A;  1GK9 A;  4MVS A;  4Q20 A;  1M56 C;  2UUC B;  4ABM A;  5GTH Z;  3JSN A;  4HAM A;  4GCZ A;  2IH3 C;  2OIG A;  4I50 B;  3DTU B;  1HR0 O;  2CGO A;  1S5L Z;  5EIB C;  4JI5 B;  2WLI A;  1VF7 A;  3ZS8 C;  5EIB D;  4PA7 A;  1JJO A;  2CUG A;  2ADQ B;  2AHZ A;  4CC5 A;  2QKS A;  3ABM C;  3D36 A;  4FIP C;  4NTX A;  1KQS U;  1RSO A;  4I9W A;  3LSS A;  1OJH A;  4OPH A;  4X64 O;  3SJQ C;  3F7V C;  3U10 A;  4U7N A;  5FPO A;  5EK0 A;  3BAA A;  1RM1 B;  1JR9 A;  2JJ1 G;  3E35 A;  1TUB B;  3VOU A;  3DC6 A;  1N36 O;  1XQ8 A;  3WU2 Z;  3ASN C;  3APO A;  1WN7 A;  1WA8 A;  3UT5 A;  3BHP A;  1N34 O;  2EIK C;  4LR3 A;  4O2B A;  4JV5 B;  1CPY A;  1RPR A;  5LGN A;  2YIC A;  1R6K A;  4BAY A;  2DYS B;  2YI8 A;  4HBN A;  5AG2 A;  1PPJ H;  5LYJ A;  4KHP B;  1D2D A;  4F6R B;  3BPZ A;  2EBO A;  2QWO B;  1BGY H;  1ROP A;  4LF4 B;  2ZE8 A;  1MNG A;  2ZIN A;  1NH2 D;  4JAV A;  2RDC A;  2VQF B;  4I0X A;  2EZP A;  1WP8 A;  4DV4 O;  1AI7 A;  4AI8 A;  3UQ8 A;  4DUZ B;  3CCV V;  1Q90 D;  3JAK B;  2VWJ A;  3E86 A;  2OCC B;  2ZXW C;  1K4D C;  2BSK B;  2OTL V;  4H0L B;  3I56 V;  1EN4 A;  2IW5 A;  2XAJ A;  1SA0 A;  3N2K B;  3ZMS A;  4KP4 A;  2QTS A;  2M7W A;  4MT8 A;  5BR8 B;  4B3R B;  1Z5V A;  3WG7 B;  1OCC B;  2IJJ A;  1L0L H;  3RYI A;  1MZE A;  3OTF A;  5LMU O;  2HG5 C;  1KB9 F;  1M93 A;  1MSW D;  5GON B;  4J7Z A;  1AB3 A;  2B1I A;  1FKA O;  5LA6 A;  1THZ A;  4DYL A;  1AP6 A;  4LWS B;  2R9A A;  1S77 D;  5FPR A;  5IWA B;  1XMO O;  5J2T A;  1M5I A;  3HKB A;  4UCR A;  4X88 A;  4XDK A;  2H94 A;  4J41 A;  1GN4 A;  4UVB A;  1HNW O;  3SPJ A;  5LP6 A;  1SET A;  2VS0 A;  3CWB H;  1YXB A;  1EZV H;  2BTO A;  4DV2 B;  4IGG A;  4AQY O;  4U3F H;  4W4K A;  2E76 B;  4BIZ A;  2XOK G;  4MVR A;  2EIM C;  2LQT A;  4DR4 O;  3ZMT A;  4TV9 A;  1NZ6 A;  3R65 A;  2OYQ A;  4Z2W A;  1Y66 A;  4HYO A;  3OMA B;  1R3I C;  1MSD A;  3ZN1 A;  3WB1 A;  1FFX B;  4JI7 O;  3F5W C;  5JJE B;  4UXN A;  3K0G A;  3H1J H;  3O65 A;  4J7K A;  3LSQ A;  1KMI Z;  4CS3 A;  2BTQ B;  2X6C A;  2P4V A;  2WLN A;  2ZQM A;  4XDL A;  4F6E A;  2CE4 A;  2CH7 B;  3FAV B;  3RYC A;  2NR5 A;  4I4T B;  1ENV A;  3HKC A;  2DWE C;  2YIB D;  1XNQ B;  3G4S V;  2A3Q A;  2CTR A;  3E89 A;  1JJ2 U;  1PL0 A;  2P7T C;  3U11 A;  4DRX A;  2YUA A;  4WFB V;  3J81 N;  4ZBM A;  3BA8 A;  1K7D A;  2F43 G;  3FD9 A;  3L70 H;  3K03 A;  2XAQ A;  2UU9 O;  1E79 G;  3K08 A;  3UM7 A;  2Q5Z A;  3CRC A;  1J95 A;  5B1O A;  4FFB A;  4AHC A;  4NXN O;  4LH6 A;  1GMG A;  2Q7E A;  1OCR B;  1M9N A;  1IDS A;  3F5T A;  4GYC B;  1WPB A;  1VEW A;  1YZB A;  2AGA A;  2HKO A;  3AG4 C;  3QVN A;  4TUY A;  3UKM A;  4E4E A;  2UUA B;  1V54 C;  2AHY A;  3ETE A;  5J2U B;  4YJ3 A;  2R72 A;  4ZI7 B;  4DV5 O;  5EC1 C;  3K79 A;  2ILM A;  2CAZ C;  3SYA A;  2UXC B;  1K97 A;  3FB7 C;  5LL6 Y;  5D5P A;  1X59 A;  3TXQ A;  3CCE V;  4QE7 A;  5CA1 A;  3ABK B;  5IYB O;  3WB2 A;  3T1Y O;  2UUC O;  4LF5 B;  1B6Q A;  1E1Q G;  4UVA A;  1YSC A;  3J7A U;  2QM7 A;  5IJ9 B;  1BQ0 A;  4UUJ C;  4GKJ B;  3CRQ A;  1Q7Y W;  4A5U B;  4X62 O;  1FXH A;  3ZHR A;  3AG1 C;  4UCU A;  5JH7 A;  4CBC A;  1P49 A;  3JAM N;  1VP7 A;  3RYF B;  3E83 A;  5GW7 A;  3BY6 A;  1HR0 B;  3UO2 A;  3K06 A;  1FS0 G;  5BY1 A;  5HFL A;  3RBZ A;  1GKF A;  3KKY A;  5B1A B;  3A0R A;  5CBH A;  1K9M W;  3CE2 A;  3D3Q A;  1BCC H;  2WAM A;  4GX1 A;  2ZDI C;  4FM0 A;  2CK3 G;  5LHI A;  1EN6 A;  2ODM A;  5B1B B;  4CC6 A;  3K59 A;  1G8M A;  4DV1 O;  1A32 A;  1XOU A;  2XT9 A;  4X64 B;  4JYB A;  1NTZ H;  5JVD B;  1ZL8 B;  4FFK A;  2XAF A;  4JV5 O;  3LNN A;  5KX5 B;  2GHY A;  4LF8 B;  4L8J A;  3C3S A;  1N36 B;  3HB3 B;  3CX5 F;  3N27 A;  1WNS A;  4UCT A;  4IYI A;  1Y74 B;  2BOB C;  1N34 B;  4PA6 A;  4FPP A;  2OTJ V;  2YXY A;  2LFR A;  4YXW G;  2XTA A;  4Z1M G;  4OX9 O;  2UXN A;  1KKD A;  5J9P C;  1RM1 C;  1W2B U;  1XMQ O;  1YJN V;  2GTA A;  5EZY B;  2PYL A;  3HPL C;  1KP3 A;  2WLM A;  4EFB A;  3ZN0 A;  4N21 A;  3JD0 A;  1HW7 A;  4K8X A;  2HFE C;  4LBE C;  4JAS A;  1PM9 A;  4GKK O;  2DYS C;  4PV1 B;  5DED A;  3ZED A;  2YEV B;  4O4L B;  5JQG B;  3K5L A;  1R73 A;  2CTP A;  3KG2 A;  4I55 A;  3E22 B;  3B77 A;  3T4Z A;  4JYA O;  5C8Y A;  1S5J A;  1AJN A;  5CBF A;  3FB6 C;  3OMI B;  3JAS B;  2KQX A;  4LC1 A;  2ZE6 A;  4GT1 A;  4O2A A;  5IJ0 A;  4X1Y B;  5LXT A;  2RN9 A;  3ETG A;  3X2Q C;  4C7U A;  1IVS A;  4WF9 V;  3ETD A;  2AW9 A;  1NVP B;  4MSW C;  2N04 A;  1VQ9 V;  4O4I A;  4LNU B;  3ABL B;  3EFF K;  3JAR A;  2P06 A;  1XIL A;  1KD1 W;  4PI2 A;  5DM6 V;  2NNU A;  4ZIB A;  4DK1 A;  5BZB A;  1VQL V;  3MAQ A;  2F66 C;  4UCO A;  2Q69 A;  4DR3 O;  1SQG A;  5KHH A;  4FZ0 A;  4E2L A;  3I5D A;  5H2F Z;  2QM8 A;  5FL7 G;  1XMO B;  3WG7 C;  1OCC C;  1HWY A;  2A7W A;  4RAI A;  3QO5 A;  4QE9 A;  4TQD A;  2DYR B;  1HNW B;  1NQT A;  5FLX N;  4JF3 A;  4JI4 O;  1Y76 B;  2IBZ H;  3CCR V;  4DW0 A;  4AQY B;  3ZHQ A;  1UJW B;  4KXR A;  3T1C A;  3QNE A;  4DR4 B;  1BT8 A;  1RPO A;  1SC5 B;  4TV8 A;  4KFM A;  1H8H G;  5IYC O;  1ORQ C;  3JAT B;  2B5U A;  4RWU A;  5IYZ B;  1FXK B;  3BFR A;  4NXM O;  1K33 A;  3AG7 A;  3BCC H;  1IX9 A;  1QBZ A;  2F1M A;  3K04 A;  5E79 Z;  1P4R A;  1Q6H A;  4IIJ B;  2PF4 E;  4J80 A;  2YIB A;  1N8R W;  1JFF B;  1P84 F;  3Q4H A;  2HHH O;  1SES A;  3G6B A;  1GM8 A;  1M90 W;  4PEL A;  2D3O W;  3K5O A;  2E74 B;  4B7E A;  1NTM H;  3TGU H;  4LH7 A;  1I08 A;  1Z2G A;  2UU9 B;  3TET A;  1W0K G;  1VMG A;  1SQX H;  3LDE A;  1ZSP A;  4NXN B;  1JOY A;  2Q68 A;  1GN6 A;  3CCJ V;  1N0J A;  1ZUQ A;  2L6L A;  3SJC C;  4DR6 O;  1WP7 A;  3K9A A;  4LFB O;  4UB8 Z;  2WWW A;  3OEE G;  5L3F A;  3AK1 A;  4NB5 A;  2RMK B;  2QJ1 A;  1LUW A;  3RWR D;  1HNX B;  4R7C A;  5EC2 C;  2F93 B;  5B5E Z;  4G28 B;  2UUB O;  5CMU A;  3OT7 A;  3APQ A;  4UVC A;  3CC2 V;  4HNA A;  1AI5 A;  1S76 D;  3UO3 A;  4IL6 Z;  2R9I A;  3T1Y B;  4GKJ O;  4DR1 O;  4OGQ B;  4X9Q A;  5IDJ A;  3GWK C;  4WFH A;  1Q5O A;  2L35 A;  2WLI B;  4J10 A;  1IXB A;  1Z5W A;  4JI2 B;  4X62 B;  5H6Q A;  1YI2 V;  3B40 A;  3ABK C;  3FKS G;  1PL4 A;  1YF2 A;  3PN1 A;  4IYH A;  1HDJ A;  3OUF A;  1N33 O;  2JGD A;  1RSO B;  3VBB A;  2IJI A;  4JPR A;  1EM1 A;  3HKD A;  4JTD B;  4JI6 B;  2PTM A;  1BHA A;  1S3J A;  1I7F A;  1KP2 A;  4H33 A;  2QSA A;  1XL4 A;  2H3O A;  5GTI Z;  1G6U A;  5IY5 B;  1ZWI C;  4JI8 O;  2Q7H A;  1BQZ A;  2F95 B;  3UT5 B;  1WA8 B;  3W7T A;  1KKC A;  5B1A C;  4O2B B;  1JCH A;  4LF8 O;  2GBO A;  2CGN A;  4DV1 B;  3HKE A;  3B4S A;  3D8C A;  3SYC A;  2JS5 A;  1XHX A;  5B66 Z;  4MVZ A;  2CTQ A;  2Q4P A;  5TIS Z;  5LYJ B;  1KC8 W;  2UXD B;  4D7S A;  4PD4 F;  4J42 A;  4J9Z B;  5IE9 A;  1NU1 H;  2X0L A;  1H8E G;  1BS3 A;  3M8A A;  1BSM A;  2WA3 A;  4I0X B;  3L71 H;  3J80 N;  4OX9 B;  3CB2 A;  1COW G;  1VQM V;  1BE3 H;  1XMQ B;  4O4H A;  1NBM G;  2PZS A;  2Q6A A;  5BMV A;  1Q43 A;  1SRY A;  2WA4 A;  4LF6 O;  1M57 B;  1L0N H;  1GAX A;  3AG2 B;  2LW7 A;  3RN4 A;  3ZHV A;  2BE3 A;  2Z0A A;  2JVD A;  4GKK B;  1SA0 B;  4FM1 A;  2YSU B;  4NYK A;  2X6B A;  1QU7 A;  1H38 A;  4LF9 B;  1NI8 A;  4BIU A;  4KUM A;  4B3M O;  1SZT A;  3C3T A;  3RYI B;  4GZR B;  4J11 A;  3OMN B;  4JYA B;  1T5E A;  3GB7 C;  4DV0 B;  4DV7 B;  3T2M A;  2VWK A;  2RJZ A;  4EFE A;  4YIO A;  5LA6 B;  1IXM A;  2KB1 A;  3OFN G;  5J2T B;  4GX2 A;  3HKB B;  1JMK C;  3CS5 A;  3LNM B;  1GN3 A;  2ZE7 A;  4JI3 O;  4DK0 A;  3S3X A;  5LP6 B;  3CEI A;  3NR7 A;  1OCO B;  4X1K A;  1CEZ A;  1GRJ A;  1AJQ A;  4PI0 A;  3RGB A;  4U3J A;  4RUF A;  1CP9 A;  4DR3 B;  4RO2 A;  4TV9 B;  1YTF D;  3K0D A;  1Q81 W;  3ABL C;  4JYC A;  1CXZ B;  4FJC C;  3B09 A;  3OGI B;  3QO7 A;  4R8C A;  2ARH A;  2B9Z A;  2V7Q G;  4JI4 B;  5LHG A;  4BIO A;  1VQO V;  1ARO P;  4ASU G;  4ZHQ A;  3SYQ A;  4WBN A;  3E2E A;  4K35 A;  3EVK A;  3QTC A;  3RYC B;  3HKC B;  1OCZ B;  1DLB A;  1AR4 A;  5F2V O;  2YI9 A;  1GTO A;  3CMA V;  4NXM B;  2JGU A;  4DRX B;  3SR2 C;  1VF6 C;  4QIW F;  5LHH A;  3P30 A;  5BXZ A;  1D5N A;  1BHB A;  1AP5 A;  2W6I G;  5CBG A;  1H2L A;  2JIZ G;  3OE7 G;  4FFB B;  1WJZ A;  2EIL B;  3ABT A;  1FXK C;  4G2K A;  4MVO A;  2HHH B;  2Q8V A;  2P5O A;  4UV9 A;  1US6 A;  4WFE A;  4TUY B;  3ETQ A;  4FLY A;  4K0K O;  4JTA B;  1DK1 A;  4X20 A;  4YJ3 B;  3L74 H;  1NR1 A;  3B2E E;  3CRR A;  3STL C;  3A2F A;  2QGN A;  5A2Q N; 
#chains in the Genus database with same CATH homology
 1YIJ V;  2QE7 G;  1EZJ A;  2DYS C;  4RQF A;  1AR1 B;  2IJH A;  2YEV B;  1QLE B;  5KA5 A;  3X2Q B;  5KUM A;  1R73 A;  3KG2 A;  1S5H C;  4U7O A;  2B1G A;  3B77 A;  3MD0 A;  2FTK A;  3ASO B;  1XL6 A;  3T4Z A;  1QR8 A;  2HVK C;  1AJN A;  5CBF A;  3FB6 C;  3OMI B;  3OUS A;  3B8N A;  1F51 A;  4LC1 A;  2XAG A;  3E8B A;  1QVF U;  4GT1 A;  2Z5U A;  2Z3Y A;  4MVQ A;  1QLE C;  3ETG A;  4XBF A;  3X2Q C;  3OW2 U;  1M56 B;  3ETD A;  4WF9 V;  3G6E V;  5H9C A;  2ATK C;  3AEI A;  1NVP B;  4MSW C;  1OHH G;  4QPK A;  3TK1 A;  5IYD O;  3IGA C;  1VQ9 V;  4RUE A;  2UXX A;  1WPX A;  3BEH A;  1K3E A;  1PNK A;  1DF5 A;  3CCM V;  3ABL B;  3EFF K;  3OEH G;  1KD1 W;  3ZRS A;  1GK9 A;  5LGU A;  4MVS A;  4Q20 A;  4TT3 G;  1VQ5 V;  3ZRW B;  5DM6 V;  1M56 C;  2NNU A;  5BZB A;  1K4C C;  1BL8 A;  1VQL V;  3IFX A;  1DF4 A;  4F4L A;  2Q69 A;  2JJ2 G;  2Q67 A;  4WFG A;  1NVP D;  4JGS A;  4E2L A;  4HAM A;  5L3B A;  4GX0 A;  3ZRW A;  4GCZ A;  2IH3 C;  4R50 A;  2QM8 A;  5FL7 G;  2DQ0 A;  3RW0 A;  1NJI W;  3WG7 C;  1V55 B;  1OCC C;  1PNL A;  3DTU B;  3OM3 B;  1HWY A;  4PDM A;  3QO5 A;  4RAI A;  4QE9 A;  4WFF A;  2DYR B;  2WLI A;  1QR9 A;  4CZZ A;  2HVJ C;  1NQT A;  4BW5 A;  2LFS A;  4JF3 A;  4PA7 A;  2H8P C;  1P7B A;  3CCR V;  1FXV A;  2QTO A;  2AHZ A;  4XDJ A;  1UJW B;  3CYO A;  3T1C A;  4DXW A;  3QNE A;  4WCE V;  2XND G;  3AG3 B;  1RPO A;  2QKS A;  2DYR C;  3ABM C;  3D36 A;  1M1K W;  4FIP C;  3CCU V;  3E8G A;  1VQ4 V;  1KQS U;  1GO3 F;  4KFM A;  1H8H G;  4I9W A;  5IYC O;  1ORQ C;  1K34 A;  3LSS A;  2GSM B;  3ASN B;  5L3E A;  2QA4 V;  2B5U A;  2Y69 B;  3SJQ C;  3F7V C;  1FXK B;  4U7N A;  5DN6 G;  1K33 A;  5EK0 A;  5KUK A;  2R9R B;  1RM1 B;  3E35 A;  2JJ1 G;  1QBZ A;  3K04 A;  3JYC A;  3VOU A;  1P4R A;  2WPD G;  1QVG U;  1PNM A;  3ASN C;  1N8R W;  2ITC C;  5LGT A;  5IY5 C;  2EIK C;  2V1D A;  2NLJ C;  1CPY A;  1RPR A;  5LGN A;  1NH2 B;  1JVM A;  1R6K A;  2JEU A;  1SES A;  4BAY A;  1GM8 A;  4H37 A;  1M90 W;  1MOF A;  2WLH A;  2DYS B;  2WLJ A;  4PEL A;  3STZ C;  2D3O W;  5L3D A;  1Y4M A;  4TWK A;  4QNH B;  1AI6 A;  3ZRX A;  2EBO A;  2P6J A;  3TET A;  1ROP A;  1W0K G;  3LDE A;  4TSF G;  4MTO A;  4OXS A;  1NH2 D;  1EBO A;  4JAV A;  3CCL V;  1JOY A;  2ZXW B;  2Q68 A;  4PA9 A;  2EZP A;  1F4M A;  3SPH A;  3CCJ V;  1AI7 A;  3W7W A;  1E1R G;  3EHB B;  3K9A A;  2WSS G;  3CCV V;  1WLE A;  4FMT A;  1VQN V;  2WWW A;  3OEE G;  5L3F A;  3JCZ A;  1EFR G;  1K73 W;  1GM9 A;  1GM7 A;  1K5S A;  3QO8 A;  3E86 A;  2OCC B;  2ZXW C;  1K4D C;  4R6Z A;  4R7C A;  1I5X A;  2JK5 C;  5EC2 C;  2OTL V;  1M57 C;  4G28 B;  1PD3 A;  3LDD A;  3I56 V;  5CMU A;  3W7S A;  2IW5 A;  2XAJ A;  2X7R B;  3ZCC A;  3ZMS A;  1SER A;  4KP4 A;  4UVC A;  3SYO A;  3CC2 V;  3JD4 A;  2M7W A;  4MT8 A;  2OCC C;  4P9O A;  1AJP A;  1W0J G;  1AI5 A;  1S76 D;  3FB5 C;  5H6R A;  2R9I A;  3WG7 B;  1JPX A;  1OCC B;  2IJJ A;  1YJ9 V;  3OAA G;  5EBL C;  3F7Y C;  3RVZ A;  1Q86 W;  2HG5 C;  5B3S C;  3T4D A;  1MSW D;  5IDJ A;  5HFM A;  3SPC A;  1R3K C;  4WFH A;  2B1I A;  2WLI B;  4G27 B;  4J9Y B;  1G4Y B;  1THZ A;  1S77 D;  1Q82 W;  1MAB G;  5H6Q A;  2X6A A;  1YI2 V;  3ABK C;  3FKS G;  3ABM B;  4X88 A;  4XDK A;  2EIM B;  2H94 A;  3OUF A;  4UVB A;  3SPJ A;  1SET A;  4MW8 A;  2IU3 A;  3VBB A;  1NR7 A;  4UV8 A;  2A79 B;  2IJI A;  1OCO C;  3ML0 A;  4JPR A;  4PA3 A;  4JTD B;  4BIZ A;  2XOK G;  4L87 A;  1BHA A;  1S3J A;  4MVR A;  2EIM C;  3ZMT A;  1KP2 A;  4H33 A;  1OZ0 A;  1YIT V;  3R65 A;  1XL4 A;  1Y66 A;  1LNQ A;  2WLL A;  4HYO A;  3OMA B;  1R3I C;  5IY5 B;  1ZWI C;  2XAH A;  1VQK V;  3MHS C;  2EIK B;  3ZN1 A;  4PDR A;  3F5W C;  3W7T A;  5B1A C;  4UXN A;  1JCH A;  1H2G A;  4MTF A;  3JD3 A;  3K0G A;  2ZR2 A;  1JX9 A;  4QPJ A;  3LSQ A;  3RVY A;  3SYC A;  2MK3 A;  2X6C A;  2EZO A;  2WLN A;  2ZQM A;  2EIJ C;  4XDL A;  3ZJZ A;  4MVZ A;  2EIN C;  5C93 A;  2WLK A;  3K3W A;  5E1A C;  1KC8 W;  3CCQ V;  4EKW A;  1ENV A;  3CC7 V;  2DWE C;  3E8F A;  5CN0 A;  3CXC U;  3G4S V;  2PI5 A;  4MW3 A;  4J9Z B;  4N23 A;  1OCZ C;  1AI4 A;  3ABU A;  2W0F C;  3WFV A;  2QEX V;  2X0L A;  3PJS K;  2IJK A;  3E89 A;  2DW4 A;  5EBW C;  1JJ2 U;  3CME V;  1H8E G;  1PL0 A;  2P7T C;  3NXS A;  1K92 A;  3MHH C;  4WFB V;  4PDL A;  4ZBM A;  2HJF C;  3LDC A;  4DO2 A;  1K7D A;  2F43 G;  3OR6 C;  3K03 A;  1COW G;  5CA3 A;  1VQM V;  2XAQ A;  1VQ8 V;  2DWD C;  1NKD A;  1FFT B;  1I5Y A;  1E79 G;  2IH1 C;  1NBM G;  3K08 A;  4LCU C;  4JTC B;  2Q6A A;  3UM7 A;  1J95 A;  5B1O A;  1SRY A;  5L3C A;  3ZMZ A;  1M57 B;  1GMG A;  3AG2 B;  3CC4 V;  4JAU A;  3W7U A;  1OCR B;  1M9N A;  2EIL C;  2PI4 A;  3IC7 A;  3AG4 C;  2HKO A;  2ZD9 A;  4MVU A;  3UKM A;  2YSU B;  1V54 C;  2AHY A;  2X6B A;  3ETE A;  2ITD C;  1H38 A;  3DGE A;  1YJW V;  5EC1 C;  3AG2 C;  1PKX A;  3K79 A;  4BIU A;  4KUM A;  1OCR C;  1SZT A;  4QJF B;  5B3S B;  3SYA A;  2JDI G;  3ZIA G;  3OMN B;  1KEC A;  1K97 A;  1VQ7 V;  3FB7 C;  3GB7 C;  2W6J G;  3T2M A;  4GX5 A;  2YEV A;  2IU0 A;  2C2A A;  4MS2 A;  3CCE V;  4QE7 A;  1IXM A;  3ABK B;  2KB1 A;  5IYB O;  4MTX A;  5EBM C;  1TUE B;  3OFN G;  2DQ3 A;  3AG1 B;  3E8H A;  2ZR3 A;  4GX2 A;  3ASO C;  1YTF B;  1L1F A;  5LBQ A;  3M99 B;  1B6Q A;  3LNM B;  1E1Q G;  4RQE A;  1S72 V;  2LP7 A;  1QCE A;  4UVA A;  1YSC A;  2A0L A;  3D3I A;  3OGC C;  3SPI A;  2QM7 A;  1K5Q A;  4UUJ C;  4FK5 C;  3SYP A;  1OCO B;  4LP8 A;  3G71 V;  1CEZ A;  3OR7 C;  1Q7Y W;  1FXH A;  3AG1 C;  1AJQ A;  3CP1 A;  4CBC A;  2OTJ V;  4RUF A;  1CP9 A;  3E83 A;  3FB8 C;  5GW7 A;  3BY6 A;  4RO2 A;  1BMF G;  1YTF D;  4I5S A;  3K0D A;  1Q81 W;  3ABL C;  2WLL B;  2BOC C;  4JYC A;  4FJC C;  3K06 A;  1FS0 G;  5HFL A;  3RBZ A;  2A9H A;  1GKF A;  5B1A B;  3QO7 A;  4R8C A;  3SPG A;  3A0R A;  5CBH A;  2V7Q G;  3ZMU A;  1R3J C;  1K9M W;  5LHG A;  1VQO V;  1ARO P;  3LUT B;  2ZDI A;  3CD6 V;  4ASU G;  2EIJ B;  2WAM A;  3SYQ A;  1YHQ V;  4PA4 A;  3JD1 A;  2EIN B;  5B1N A;  3E2E A;  3GWO A;  2ZDI C;  4GX1 A;  2CK3 G;  2HR3 A;  1V55 C;  1F23 A;  4WFA V;  5LHI A;  1QLN A;  5B1B B;  4P30 A;  1OCZ B;  1DLB A;  4X8A A;  3ZRV A;  3ZMV A;  1G8M A;  2P67 A;  1R3L C;  4JYB A;  4ZKI A;  1GTO A;  3CMA V;  3CPW U;  2XAF A;  4MTG A;  3TCU A;  5B1B C;  4QIW F;  5LHH A;  3P30 A;  2GHY A;  3AG3 C;  2JEX A;  4MVM A;  4HZ3 A;  1BHB A;  3P32 A;  2Y48 A;  3HB3 B;  2W6I G;  3FYE B;  4PDV A;  2K1E A;  5CBG A;  1MG1 A;  3CCS V;  2XAS A;  1FXK A;  2JIZ G;  3FYI B;  2BOB C;  3OE7 G;  4PA6 A;  2Y69 C;  4FPP A;  2EIL B;  1R6N A;  3ABT A;  3I55 V;  1FXK C;  2LFR A;  4G2K A;  4MVO A;  4YXW G;  1K8A W;  1S0V A;  5KA6 A;  4Z1M G;  5L3G A;  2P90 A;  2UXN A;  3JD2 A;  4P2Z A;  1KKD A;  3AG4 B;  1F4N A;  5J9P C;  2OT5 A;  1RM1 C;  3B8M A;  4UV9 A;  1W2B U;  1V54 B;  4WFE A;  1YJN V;  4P9P A;  3HPL C;  1KP3 A;  2WLM A;  1JQ0 A;  3H01 A;  4JTA B;  3W7X A;  3ZN0 A;  4N21 A;  3JD0 A;  1VQP V;  2HLD G;  1VQ6 V;  1NR1 A;  1DTO A;  2HFE C;  3STL C;  2EJR A;  4LBE C;  4JAS A;  4X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...