5E1AC

Structure of kcsa with l24c/r117c mutations
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
ACHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGCEQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5e1aC00
2KB1A 4PDRA 4HYOA 3E89A 4MSWC 2WLHA 2ZXWC 2BOBC 4MVMA 3OR6C 3E8HA 3FB8C 4R6ZA 4WFGA 3SYQA 3SPHA 3ABKC 3LDCA 4R50A 3T1CA 3IGAC 2EIKC 1G4YB 2IH3C 2A79B 3JYCA 1R3LC 1OCZC 2HVKC 2ZD9A 4RUFA 1P7BA 3ASNC 4GX0A 4X89A 3K08A 4KFMA 3VOUA 3SYCA 5EBWC 2ATKC 3LUTB 2EILC 3OR7C 3SPGA 4PA7A 4XDJA 4MTOA 1OCCC 3SPJA 2AHYA 3ZJZA 1V55C 2H8PC 2W0FC 3PJSK 4PDMA 3SPIA 4I9WA 3STLC 2X6CA 2ITCC 2QKSA 1R3IC 4LCUC 4RAIA 2WLKA 2Y69C 4QE7A 4RO2A 3SYAA 4F4LA 2HFEC 3WG7C 1QLEC 2DYSC 4RUEA 1JVMA 2Q6AA 3BEHA 3SYPA 3RBZA 3F7VC 4H33A 4HZ3A 4PA3A 4CBCA 1M57C 3K06A 2Q68A 2QTOA 4G28B 2WLMA 4GX2A 4JTDB 4PA9A 3F7YC 2HG5C 2K1EA 4UUJC 3FB6C 3UKMA 5KUMA 3KG2A 4TWKA 5E1AC 2DWEC 4XDKA 4DXWA 5EC2C 4X88A 3T4DA 4MVZA 4ZBMA 5CBHA 4OXSA 5J9PC 1K4CC 5EC1C 2BOCC 3GB7C 3K0DA 4WFEA 1XL4A 2X6AA 2WLIB 3SJQC 3K03A 4MVSA 2A0LA 4PA4A 5B3SC 5EK0A 1M56C 2YEVA 3OUSA 4P2ZA 2DYRC 2AHZA 2DWDC 4LBEC 2WLNA 4MTFA 4MVQA 1R3KC 1ZWIC 3LDDA 4JTCB 3TCUA 2EINC 3AG1C 4J9ZB 4QNHB 3IFXA 3HPLC 4JTAB 4WFFA 3RW0A 2A9HA 4MTGA 3AG2C 2JK5C 2ITDC 4XDLA 4WFHA 4P9OA 5EBMC 3OGCC 1KKDA 3E8BA 3FB5C 4LP8A 2WLLA 2WLJA 3UM7A 5BZBA 3EFFK 5CBGA 2P7TC 3ASOC 2WLLB 4MS2A 3TETA 4P9PA 4R7CA 2IH1C 2X6BA 3SPCA 1S5HC 2WLIA 4X8AA 2HVJC 1R3JC 3RVYA 2OCCC 3F5WC 4P30A 1ORQC 3K0GA 3LDEA 3OUFA 4H37A 4MVOA 2EIMC 5CBFA 1J95A 3FB7C 3STZC 4GX5A 4BW5A 3E86A 2R9RB 3LNMB 1BL8A 3E8FA 4GX1A 4QE9A 5B1BC 2EIJC 4MW8A 5B1AC 2Q67A 3E83A 4MVUA 4J9YB 4R8CA 5IY5C 4PA6A 5KUKA 3AG4C 3RVZA 3E8GA 3SYOA 3ABMC 3R65A 4PDLA 4PDVA 1LNQA 1XL6A 2HJFC 2Q69A 4MVRA 1V54C 5EBLC 3T2MA 3ZRSA 2NLJC 3ABLC 3T4ZA 4EKWA 4G27B 4MW3A 3AG3C 3K04A 1OCOC 1K4DC 1OCRC 3X2QC
chains in the Genus database with same CATH superfamily
2Q8VA 3E89A 4R6ZA 1IURA 5BR8O 4DR6B 5LGUA 2AZ0A 1G8MA 3RYCA 3N27A 3JYCA 4RUFA 1IXBA 3VOUA 4DV5O 4I0XA 5EBWC 5DECA 1EN6A 5LP6A 3S3WA 4UCUA 2YSUB 4JYCA 3STLC 4WFAV 4B3MO 4KL1A 4YJ3A 1ZL8B 1K92A 1QLEC 2KKWA 1NTKH 2FTKA 5LYJA 3CCUV 1FXKB 2Q73A 4PA9A 2YI9A 2M6YA 2QM8A 4BW9A 4NVPA 1SA0B 4W4KA 4DR1B 4DR2O 3UO3A 5IWAO 4DV0B 5IJ0A 5CBHA 4OXSA 5EC1C 5B1BB 2X6AA 1RM1C 1VQ8V 4JI1O 2UXCB 3UO2A 1YJNV 2XAQA 1YTFB 1NJIW 1S77D 3LDDA 4L87A 3G6BA 1XNRO 2ZXWB 4DK0A 2A9HA 2WA3A 5CA0A 1RPOA 5CA3A 4NXNB 1SC5B 4GLXA 4MS2A 4TOIA 4JI7O 1AR4A 1NI8A 2V7QG 4K8ZA 1AI5A 1YZBA 3E8FA 4UV9A 2PYLA 4J7KA 3VBBA 2XNDG 2CTQA 2DQ3A 4LF6O 4FMTA 1EZJA 5B3SB 3E8GA 3ABMC 1N4CA 2HJFC 1V54C 2IJJA 1FXKC 4QJFB 3N2KB 3K04A 3BAAA 1K3EA 3U10A 5IE9A 3P3NA 1XI1A 3IGAC 4X1KA 4FM0A 1J5EB 5KAFZ 5LL6Y 4CH5A 3JSLA 3CD6V 3AEIA 4KP4A 4CH3A 2ILMA 2KG7B 1Z5VA 3N2GA 4JV5O 4LFCO 3SPIA 4YHHB 2XAJA 3TGUH 4N23A 4F4LA 4H44B 1W0KG 2YXHA 5CA1A 3S3XA 4X64B 4HZ3A 4PA3A 1F51A 2EJ7A 3CXHF 1A32A 3ZHTA 1YDXA 1PKXA 4UVCA 2WLMA 4UUJC 3SR2C 4OPAA 5BMVB 2X0LA 4BR6A 1BHAA 1TUEB 3R66A 5EC2C 1VQ6V 4IHJA 2BSKA 3T1HO 3CC2V 2Y4TA 3OMIB 4ZBMA 4X9QA 1IBMB 2WLIB 5B3SC 2YEVA 1OHHG 4FZ1A 3JAMN 4AILC 1P49A 4O4HA 1K33A 3FAVB 5L3DA 1PPJH 1OCOB 3TCUA 2LO1A 4DV1B 4PJ0Z 5JCOA 4LWSA 4U3FH 1LUVA 2JK5C 1Q3EA 3BCCH 3A0HZ 3D8CA 4P9PA 2QJ1A 4F6RB 1QLNA 2C2AA 4B3SB 1QQCA 1Y76B 4MVOA 1GN6A 1K73W 2UUBB 1NS1A 4JI6B 3STZC 3ZMUA 4E2LA 2EIJC 4R8CA 2Y69B 5JVDB 4DW0A 1H2KA 2O57A 2JJ2G 2CE4A 2JVDA 4O2AB 3OEEG 5KHHA 4FFBA 3FFQA 1WB8A 3QG5A 2HHHB 3THOA 2QDOA 3W7WA 1H2LA 3AG1B 3K59A 2ZDIA 1NTMH 4HBNA 1PNKA 1KP2A 2DW4A 2IH3C 3CWBH 4B3TB 3RYCB 2Z0AA 3ASNC 3L75H 1HNZB 1NTZH 2N74A 1KUQA 1DGSA 4I0XB 3BRCA 5LP6B 2AHYA 3ZJZA 2Y0PA 3B8NA 3M99B 1HDJA 2VS0A 4YJ3B 2H3OA 4LFBO 1JR9A 3FX7A 3ETQA 1XMOO 3CSXA 1BE3H 2Q7GA 4FZ0A 2JJ1G 1K5QA 5JWPA 4LF8O 1BCCH 3BA8A 3Q4HA 4GUNA 2ZT9B 3HKCA 2BOCC 1AILA 1JQ0A 4Z1MG 3W7XA 3RWRD 1AR5A 1ENVA 5LHGA 1G1XB 2PI4A 3ABLB 4DV7B 1R3KC 1O9GA 3AG1C 4DR3B 1VEWA 2M7WA 2QWPB 2DOSA 1B3QA 4P9OA 5EIBC 1GRJA 3UM7A 4FLXA 3ABUA 1R3JC 2R72A 2XT9A 4D7TA 4EFBA 3OE7G 1Q90D 3B4SA 1V55B 1XEQA 3H1KH 3ZHVA 1MSWD 3E86A 1VMGA 2JGDB 5KUKA 3AG4C 2JS3A 3WG7B 1CPYA 1K34A 3A0BZ 2P06A 2UXNA 1URFA 1M57B 3TK1A 2UUAB 1K4DC 1Z5WA 1VF6C 5AG2A 3JALA 4ABMA 2L35A 4DUZO 4X1KB 1I94O 4J41A 3G67A 1GK9A 2ARHA 4UVAA 4YY3O 2ZIOA 2PY5A 4NYKA 1ZUQA 2WPDG 1YIJV 1KC8W 3A0RA 1QHTA 4PV1B 3CMEV 2JEXA 5CA1B 4I5SA 1CXZB 4LF9B 5LMNO 1XILA 2PYJA 4JAVA 4I7ZB 4F6EA 3X2QB 3U11A 5KX5A 3K9AA 3GWOA 3ZHUA 2QGNA 4DXWA 2E5LB 3FYIB 4IHJB 1QR9A 2BSKB 2QKAA 2PUSA 4RQFA 1VF7A 3GB7C 3JD1A 1IXMA 3NXSA 4J10A 3JATA 1KECA 3OMAB 1SQPH 4CC5A 1S3JA 2YEVB 4UV8A 1FXKA 4AHCA 3CMAV 1XBLA 3JCUZ 4UCRA 4FK5C 4O4HB 5DN6G 1SERA 4QNHB 2Q7EA 5HFMA 5J2UA 1WNSA 4LWSB 3SDLA 1N36B 4X62B 3E8BA 1HP8A 4KUMA 2IH1C 2X6BA 3QF7A 4K0KO 4P30A 2MW2B 2HR3A 3BABA 1ZX3A 1DK1A 3ZHQA 3E83A 4E4EA 4PA6A 2QKCA 2R70A 2QWRB 3RVZA 2HKOA 3G4SV 1FJGO 1GTOA 2CDYA 5B5EZ 4LR3A 4ZHQA 4FFBB 3HKBA 3X2QC 4PDRA 2WLHA 5KHJA 3E35A 3E2EA 1L1FA 1S5JA 2ZCEA 2V1DA 1XREA 2MK3A 4WBNA 1FFXA 1TUBA 4RWUA 4JI5B 3RYHA 4IYIA 4KHPB 2HP8A 2Q5ZA 4MTOA 3RYIA 3SPJA 2R9AA 3KKYA 2QWQB 1XMQO 1SQXH 2YIBD 4TV8A 2JDIG 1AROP 3N2KA 4DR5B 5GTIZ 2IM9A 3MHHC 4I4TA 3CP1A 5KA6A 3U0ZA 1SQFA 5JCOC 4B7KA 4CS4A 3CCJV 3ZHSA 1PP9H 4GX2A 5FNVA 1XUQA 5DM6V 1AI7A 4DV3O 1KMIZ 2KG7A 2VQEO 3T1YB 2UXBB 4B7EA 1FFTB 3JAWA 1I7FA 1JPXA 5LHIA 4O2BA 3Q4HB 5KHIA 2H94A 3MDSA 3J81N 3HKCB 1XHXA 2KSDA 1H2GA 5IY5B 3CHXA 5DEDA 1JA8A 3CRCA 2QA4V 3CS5A 2AXTZ 2ADPA 4FFKA 2YXLA 5BMVA 1GAXA 4FIPC 1NR1A 1MZEA 3QO8A 4WFFA 4LFAB 3CCQV 3AK3A 1SKVA 3OGCC 3FB5C 3DC6A 1TA8A 3QTCA 1RPRA 1DF4A 2WLIA 1JJ2U 1BQZA 2QWOB 4LC1A 3K9SA 1X59A 1S76D 2IBZH 4FVMA 3LDEA 2KQXA 4X1YB 4JZGA 3LNMB 2EZPA 4JI4B 5B1AC 4JASA 2F93B 1FS0G 3ZIAG 3TXSA 3ZS8C 3JASB 1QLEB 4D7SA 4PDVA 1XL6A 5EBLC 3SGIA 4MW3A 3K5LA 2YXYA 4J9ZB 3ZMZA 1WJZA 1N33B 4R50A 2E3CA 3JALB 1G6UA 4HNAA 1P7BA 4DV2O 2IJKA 2NR5A 3I56V 3SPGA 1RM1B 4UXNA 4X66B 1NVPD 1AVMA 3ZMSA 3CPWU 1H2NA 4RUEA 4JPRA 2RCVA 3L70H 4B3MB 1NR7A 1XQ8A 2ZNJA 5BY1A 2ZKOA 4TV9A 4ICGA 3JSNA 4YXWG 1Q5OA 4A5UB 5KX5B 5LGNA 4I9QA 1Q6UA 4YJ2B 4FPPA 1WB7A 3JD3A 2IU0A 1QCEA 2G38A 4OGQB 2BTOA 4GKKB 2D3OW 1N34O 3OTOB 1XL4A 3JATB 4PA4A 1B04A 1GMGA 3ABMB 2AZ2A 1V54B 3ML0A 5JJEB 3AK2A 2GV9A 4U3JB 2ZM6B 1VF6A 5J2UB 3AG2C 1O9HA 3AK1A 1S5LZ 5BZBA 4O4JB 5L3FA 3H1HH 3LSUA 2PI5A 4J80A 4X8AA 2OT5A 3ZCCA 2EBOA 1VQ5V 2HLDG 2W0XA 1SQBH 4J9YB 1R6TA 1GH6A 4O4LB 3K57A 1JMKC 1M56B 1BMFG 2ZR3A 2RNBA 1VF5B 4ZHQB 2PZSA 4LF6B 3HKBB 3FB8C 3ZRXA 1YHQV 5IT9N 4DR1O 2RQ6A 2A79B 1P84F 2QE7G 1FAFA 3OTFA 4X89A 4PI2A 2GBOA 4WBNB 1AI6A 2ATKC 2JGDA 1FFXB 1TUBB 3RYHB 1U96A 2FB5A 2XOKG 3OGIB 1Q81W 2BE3A 3ETGA 3RYIB 3FD9A 1KP3A 4TV8B 1EN4A 3O65A 2ITCC 4LF5B 2WSSG 1F7YA 3SYAA 4EFEA 1H2SB 1UPGA 4LFCB 5E79Z 4I4TB 2ZE8A 4GKJO 4DR4O 2Q68A 1NBMG 5FNVB 5H9CA 3ABKB 1IBLB 2UXDO 3JAWB 3CJHA 2YDEA 4O2BB 3B2EE 4NTYA 1IDSA 4JYAO 1GN4A 3P32A 2EIJB 4QPJA 1CEZA 1N0NA 2E74B 3H01A 1M56C 3T1HB 4P2ZA 4FM2A 1Y66A 2AHZA 4LBEC 2W6IG 1VQMV 3WU2Z 5H5NA 4JTCB 5C93A 4JYBA 2ZINA 4NXMO 2YIBA 5LGTA 1NQTA 3RN4A 1XNQB 1J5EO 2GDSA 2WLLA 3ASNB 1Q86W 5EZYA 1OJHA 3F5WC 5FL7G 3CRQA 2N05A 3FB7C 1ROPA 4BW5A 5IJ9A 1UJWB 4YHHO 2VQFB 1BGYH 3UT5A 2ZQMA 1R6NA 1HNXO 5H6RA 1GO3F 1KKCA 1YJWV 1Q7YW 3K5MA 2FKXA 1TGOA 1M4UA 3AG7A 1B6QA 4JI2B 1PD3A 4RQEA 5L3CA 4U7NA 3ABKC 5HFLA 1M90W 1MA1A 1ZSPA 1U97A 4FLZA 4DYLA 4GX0A 4HNAB 4B3RB 5L3BA 1IBMO 2RN9A 3RFRA 4LNUA 5C8YB 2LJ2A 3C90A 4TQFA 3OT7A 2LW1A 2BTQA 2RDCA 1Q6IA 2XAHA 4DV1O 5FLXN 1VQPV 1AI4A 2Q6AA 5CB4A 2IJHA 4JTDB 2LP7A 2K1EA 3HB3B 4C7UA 4TV9B 1SQVH 2EJRA 1W0JG 1BS3A 2XAFA 1XMOB 4K8XA 4B3SO 4OX9O 2HEPA 3KCYA 3WFVA 2ADQB 3K0DA 2E75B 4MVSA 3AG4B 2JRIA 1N8RW 2WLNA 1B06A 1YJ9V 1WLEA 2HHHO 1ZWIC 4TT3G 3G80A 3D3IA 3ICXA 4PD4F 4JI3B 4TUYB 1BSMA 2RMKB 1YVWA 3CC4V 1UFIA 5J2TB 1MABG 5TISZ 4B3TO 3L73H 3TETA 4GYCB 2UUCO 2PTMA 5JJJB 1NH2B 1VQOV 2B1GA 4WFBV 5CBFA 1VP7A 1SRYA 4MW8A 1BT8A 4UCVA 1IBKO 2Q67A 1H2MA 4DUYO 2CGOA 3CCRV 2EZOA 1VQ9V 1L0NH 3BFRA 3R65A 4X1IA 1I5YA 3T4ZA 1VQ7V 1OCRC 4BIOA 3BVOA 4UB8Z 5LOVB 4DK1A 3LDCA 2LGWA 4X1YA 2OCHA 1AP6A 4LF4O 2F4VB 1OCZC 3ETDA 4TQDA 4BIUA 1VQKV 3B8MA 1YXBA 3HKDA 2LW7A 3JASA 4GT1A 1PL4A 1S0VA 2OCCB 1QU7A 4BWAA 1IVSA 5LHHA 1I94B 3J7AU 1KB9F 4G2KA 4WCEV 3CYOA 3LNNA 4DV7O 4RO2A 4JI0O 4DR3O 4ZKIA 2YIAA 5EYPA 3L72H 4D6TH 4UCSA 1M93A 5D5PA 5GTHZ 1W2BU 5GW7A 1N0JA 5LMNB 3CJHB 4J7ZA 3FKSG 4DV6B 1EFRG 3RGBA 2GUZA 1TAEA 2V4DA 3OUSA 1NH2D 2DWDC 4X65B 1MZFA 2UUAO 3LSSA 4I55A 1JFFB 3IFXA 1P4RA 3F5TA 2R9IA 4UCOA 2ITDC 4YJ2A 2FMLA 3IAYA 3K3WA 2FL4A 2WLLB 5KHKA 3CRAA 5EZYB 1GN3A 2OCCC 2EIMC 4UFZA 4FLYA 1M9NA 5IJ9B 4U3JA 5H6QA 3VQWA 1QBZA 3UT5B 2OIGA 3OD4A 3SYOA 2UU9O 2PF4E 4JZ2A 1EM1A 5A2QN 3C3SA 3T2MA 1X4TA 4G27B 3BHPA 5KLVH 3W7UA 4O4JA 2XUMA 4DO2A 2KB1A 2EX3A 3E8HA 4PHZA 3RYFA 1TVKB 3MHSC 4AQYO 2EIKC 2QM4A 3L9DA 3DGEA 3SYCA 3ASOB 3LUTB 3WB1A 1PNMA 2Q0AA 4O4LA 4B08A 4LNUB 1BQ0A 4NR1A 4CS3A 1QVGU 4CH6A 2LQTA 1ZAUA 4I50A 4RAIA 2BTQB 1JX9A 2DJVA 3BPZA 5CN0A 1ZLZA 5CB4B 5JQGA 1HWYA 1N36O 2CAZC 2UXXA 4JYYA 3UKMA 2HG5C 3K5OA 2ZE7A 4GZRB 4TSFG 4X88A 2P90A 1MOFA 1AJQA 4DV3B 3H1JH 2FYUH 4MTXA 5B1AB 1KYOF 1WPBA 1S72V 2QM7A 4DW1A 2DYRC 1Q6HA 2A06H 2XHBA 2WA4A 1KU9A 3RW0A 1NVPB 4K3AA 5KHGA 1KKDA 2WLJA 1HNWB 4JI8B 3ASOC 4JI5O 4EEQA 4KHPO 2HVJC 4ZIBA 4Z1VA 4DV4O 4H37A 1FYJA 1J95A 3CCLV 4LH7A 3ZN1A 4MVUA 2ZNIA 1E1QG 2Q69A 4DRXB 2JEUA 4X1IB 2GTSA 4NTXA 5JJNB 4LP8A 3SJBC 4MSWC 4WFGA 2ETNA 5LMUO 2YC0A 3SYQA 3T1YO 4Z2WA 2UXBO 1M5IA 5D5QA 2Y0IA 1FPOA 3K08A 2QTSA 4KFMA 1RP3B 1PNLA 3HKDB 2ZR2A 2A7WA 1N32B 1YITV 2YS8A 4DV2B 1OV9A 4NB5A 4QIWF 5IYBO 2DN9A 1QVFU 1R3IC 4L8JA 2DYSC 1KQSU 1JVMA 2OWOA 3AG2B 4DR7B 1HR0O 3F7VC 1VQLV 4LF7B 3B77A 4G28B 5EYPB 2AW9A 5BR8B 1SETA 2DQ0A 5H2FZ 2GSMB 5C8YA 4HAMA 4DV5B 4JI4O 1BZKA 3D36C 5EK0A 1GM8A 3WB2A 2CTRA 2GUZB 1SS3A 2P22C 4OPHA 3VQXA 1NU1H 2EINC 1BHBA 3HPLC 2F95B 1THZA 1N33O 4I55B 3K79A 1I0HA 3SJAC 2RJZA 1RSOB 4NTWA 4H0LB 2NNUA 3B09A 4CH4A 5CBGA 3EFFK 2N04A 5IDJA 3BY6A 1NZ6A 4DR2B 3G6EV 4X66O 3HKEA 3OUFA 2W6JG 2IW5A 5IWAB 1EZVH 1LUWA 4GX1A 3W7SA 3TXQA 5F2VO 1K5SA 4JI1B 4TUYA 1LNQA 4MVRA 1GN2A 2OYQA 5J2TA 4DR6O 1Y4MA 5B1NA 3AG3C 4CS2A 3DXRB 1XNRB 1LR1A 2B1IA 3CCEV 3RYFB 2ODMA 3CE2A 2LFSA 3APOA 4JI7B 4GKKO 3OTOO 1H38A 1AJNA 3CCVV 3PJSK 4I9WA 1WP8A 1SESA 1YEWA 3SJCC 4QE7A 4I50B 1I5XA 1RFYA 2HFEC 4ASUG 2ZM6O 5LOVA 3EHBB 3RBZA 1VQ4V 5JQGB 3JARB 3OAAG 2QTOA 4DV0O 5KA5A 2GTAA 1Q43A 3KG2A 4TWKA 1WP7A 1XDCA 4GKJB 1FKAO 4DR4B 4X20A 2UXCO 1D5AA 2P4VA 1K4CC 4Q20A 2EILB 4JV5B 2UXDB 3OM3B 4JYAB 2CK3G 4NXNO 4MVQA 2CGNA 4XDLA 5IYCO 4WFHA 2Q9LA 5EBMC 3P3PA 1F4NA 3JD0A 3QO5A 4NXMB 2DMXA 2ZIMA 2JGUA 1WPXA 1QNMA 1QR8A 4YIPA 4BAYA 3W7TA 2XASA 2BCCH 3ZRWA 3UQ8A 5B1BC 2AGAA 2JS5A 1E79G 4LF5O 1JFFA 4N21A 4PDLA 5FPRA 4YIOA 2OTLV 1HNXB 4HYOA 3I5DA 4MVMA 4ZOLB 2ZXWC 1K8AW 3SPHA 1IBLO 3APQA 5GONA 1G4YB 1SZXA 1DF5A 1YTFD 2DE0X 4AI8A 2EILC 3OW2U 4O4IA 3JAKB 1WA8A 5IYZA 4IGGA 2W0FC 3ABTA 4U7OA 4X64O 1R6KA 3J80N 1YCIA 1TVKA 1GM7A 1VIBA 1Q82W 3DC5A 1D5NA 1XNQO 3F7YC 1R1BA 2CTPA 4ZI7A 2GHYA 5KUMA 4JGSA 4IIJA 4XDKA 1SZTA 4FLUA 4UB6Z 4MVZA 4MT8A 3D3QA 2CH7B 1IX9A 1GKFA 2VQFO 2LGQA 3OEHG 4OX9B 3CRRA 3PN1A 3G71V 4UVBA 2NN4A 4J42A 4J11A 4MTFA 5K1XA 4LFBB 1OCRB 4JI2O 3OMNB 1MG1A 2UUBO 4JI6O 1OCZB 1PL0A 4B3RO 2P7TC 5LA6A 1L8DA 3I55V 2QWNB 1YSCA 1S5HC 1AR1B 4LF8B 2F1MA 4WF9V 4FM1A 3JCZA 2F23A 3HKEB 4GX5A 4CZZA 4QE9A 1V9PA 2UUCB 3P30A 3CXCU 3ZHRA 5A9GA 4JAAA 3JD2A 3TJTA 2HJDA 4Q6GA 3H9VA 2QSAA 1IBKB 4DUYB 1OCOC 1HNZO 4FLWA 1MSDA 1Y74A 2BOBC 1K9MW 2IJIA 5LYJB 3IJ4A 5BXZA 1M1KW 1XOUA 3LSQA 5LXTA 3OR7C 4H13B 1AB3A 1JCHA 1WN7A 5JH7A 3D36A 1PV0A 4EB6A 5L3EA 4DRXA 4LF4B 4W4LA 4PELA 4UCTA 1L0LH 3E22A 5IJ0B 2X6CA 2Y69C 1E1RG 3H1LH 1K97A 4JI3O 1PM9A 3SYPA 3HR0A 2YIDA 3M8AA 2ZE6A 1EN5A 2B9ZA 4JI0B 1CP9A 5B1OA 3CB2A 3ZRVA 1GM9A 3A2FA 5CA0B 5ITZA 4DUZB 3T4DA 2EIMB 3M7MX 4X20B 4FLTA 3CEIA 4WFEA 4YY3B 5LP6C 3SJQC 1OCCB 2A0LA 2CUGA 2P5OA 4PI0A 1ZTEA 4JF3A 2VWJA 2A3QA 1R73A 5EIBD 2XAGA 4JTAB 3H1IH 3A8TA 3ZEDA 5KMGA 4XBFA 2EIKB 2F4VO 2XTAA 5K1PA 2OIEA 4R7CA 3K0GA 2YI8A 2F43G 1MMMA 1NKDA 3ZRWB 3GWKC 1Z2GA 3N2GB 1Y67A 1RSOA 1Y6XA 3ETEA 5FPOA 1K7DA 2Z3YA 3ABLC 2QEXV 4FJCC 3ZX6A 2UU9B 3ZN0A 2P4KA 3T1CA 4NKGB 5GONB 1R3LC 2ZD9A 2HVKC 3KCXA 1MNGA 4DV6O 1T5EA 4IL6Z 3O9OA 4XDJA 4AQYB 1OCCC 4K0KB 3KZIZ 1V55C 4O4IB 4PDMA 1WA8B 5IYZB 2DYRB 1DTOA 4X65O 2CTWA 1ZL8A 4LF9O 1AJPA 3DXRA 2F66C 2Q4PA 3WG7C 1FJGB 2OTJV 3GVMA 3CRMA 3BEHA 1F23A 2WWWA 4CBCA 1WAZA 1M57C 3K06A 2E5LO 2IU3A 5IYDO 3K58A 1YI2V 4FLVA 1SA0A 3IC7A 4ZI7B 5E1AC 3CX5F 4IIJB 1SQGA 2Z5UA 3ZMVA 1FXHA 4IYHA 2WAMA 4J7JA 3K03A 1XMQB 3MD0A 1NT2B 1KD1W 3JARA 1D2DA 3CCSV 4X62O 2JIZG 3DTUB 2Q0OC 4JAUA 1EBOA 3RT3C 2VQEB 3SPCA 5LA6B 1AP5A 3RVYA 3EXAA 4K35A 3MAQA 1ORQC 1OZ0A 1BL8A 3OFNG 1SF9A 4DV4B 2QR4A 2DYSB 2E76B 4LH6A 1US6A 3ZRSA 2NLJC 4EKWA 3QO7A 3FYEB 2L6LA 3OR6C 4BIZA 1Y74B 3BA9A 2K9PA 2P6JA 1P7GA 4QPKA 5LMUB 4IT5A 4DR5O 4PA7A 5LXTB 1YF2A 5JH7B 2VRZA 3IC9A 2H8PC 4EB6B 3DSQA 3UCSC 3CCMV 1SQQH 2P67A 2QKSA 3L74H 3QVNA 4LCUC 2WLKA 3E22B 5L3GA 1H8EG 4ZOLA 1COWG 1DLBA 3B40A 2EINB 1VQNV 1F4MA 4H33A 4KXRA 5B66Z 1IZ3A 3QNEA 2VWKA 1HNWO 3FB6C 4JI8O 1KBHA 2ZDIC 3K5NA 1XHZA 3VQYA 2DWEC 1HR0B 3JAKA 3JD4A 5ITZB 1H8HG 2ZE5A 4GCZA 3NR7A 2EULA 2X7RB 5J9PC 1FD9A 1FXVA 2Y48A 3VQVA 2PGGA 4QGPA 1W59A 5CMUA 4LFAO 2Q7HA 1Q8IA 5LBQA 3FAVA 3AG3B 2YUAA 2YICA 3WB0A 5KAIZ 3ZBHA 4MTGA 3CC7V 2LFRA 5KMGB 1I08A 2CH7A 3ZMTA 4F6RA 4CC6A 1HW7A 1N32O 1Y76A 2R9RB 1JJOA 1N34B 3C3TA 5JVDA 3L71H 2B5UA 5IY5C 1JOYA 4O2AA 3EVKA 1VARA 4DR7O 2Y4UA 2D2CB 4LF7O
chains in the Genus database with same CATH topology
4PDRA 4HYOA 3E89A 4MVMA 2WLHA 2ZXWC 3E35A 4R6ZA 1K8AW 3E2EA 3SPHA 3LDCA 1L1FA 5LGUA 1G8MA 1G4YB 2V1DA 3JYCA 1OCZC 3ETDA 4RUFA 4BIUA 2MK3A 1VQKV 1DF5A 1YTFD 3B8MA 3VOUA 5EBWC 2EILC 3OW2U 4GT1A 4MTOA 3SPJA 1S0VA 2OCCB 2YSUB 4JYCA 2W0FC 3ABTA 4U7OA 5LHHA 3STLC 4G2KA 4WCEV 2JDIG 3CYOA 1AROP 1R6KA 4WFAV 1K92A 4RO2A 1QLEC 3MHHC 3CP1A 1GM7A 5KA6A 2FTKA 4ZKIA 1Q82W 3CCUV 1FXKB 3CCJV 4GX2A 4PA9A 3F7YC 5DM6V 1AI7A 2GHYA 2QM8A 5KUMA 4JGSA 1W2BU 4XDKA 1FFTB 1SZTA 5GW7A 1JPXA 5LHIA 4MVZA 4MT8A 2H94A 5CBHA 4OXSA 1GKFA 5EC1C 5B1BB 3FKSG 1EFRG 3OEHG 2X6AA 1H2GA 1RM1C 5IY5B 1VQ8V 3G71V 4UVBA 3OUSA 1NH2D 2DWDC 2QA4V 1YJNV 2XAQA 1YTFB 4MTFA 1NJIW 1S77D 3LDDA 3LSSA 4L87A 1OCRB 3IFXA 3OMNB 4FIPC 1NR1A 1P4RA 3QO8A 2ZXWB 2R9IA 2A9HA 4WFFA 3CCQV 1MG1A 2ITDC 1RPOA 5CA3A 3OGCC 3K3WA 3FB5C 1OCZB 1PL0A 2P7TC 2WLLB 4MS2A 3I55V 1RPRA 1DF4A 1S5HC 1YSCA 2WLIA 1AR1B 1JJ2U 4LC1A 1S76D 2OCCC 4WF9V 3LDEA 2V7QG 3JCZA 2EIMC 1AI5A 4GX5A 4CZZA 3LNMB 3E8FA 4QE9A 2EZPA 4UV9A 1M9NA 5B1AC 4JASA 5H6QA 3VBBA 2XNDG 1FS0G 3ZIAG 1QBZA 2DQ3A 4FMTA 1EZJA 3P30A 5B3SB 3CXCU 1QLEB 3E8GA 3SYOA 3ABMC 3JD2A 4PDVA 1XL6A 2HJFC 5EBLC 1V54C 3T2MA 2IJJA 1FXKC 4QJFB 4G27B 4MW3A 3W7UA 3K04A 1OCOC 4DO2A 4J9ZB 1K3EA 2KB1A 3ZMZA 2BOBC 3E8HA 1K9MW 3MHSC 2IJIA 4R50A 3IGAC 2EIKC 1P7BA 1M1KW 3LSQA 3DGEA 3SYCA 3ASOB 3CD6V 2IJKA 3LUTB 3AEIA 3OR7C 4KP4A 3I56V 3SPGA 1JCHA 1PNMA 3D36A 1RM1B 4UXNA 1NVPD 5L3EA 4PELA 3SPIA 3ZMSA 3CPWU 1QVGU 2XAJA 2X6CA 4RAIA 2Y69C 4N23A 1E1RG 4F4LA 1W0KG 1JX9A 4RUEA 5CN0A 4JPRA 1K97A 3SYPA 1HWYA 1NR7A 4HZ3A 1F51A 4PA3A 2UXXA 1PKXA 4UVCA 2WLMA 3UKMA 4UUJC 2HG5C 1CP9A 4YXWG 5B1OA 4TSFG 2X0LA 5LGNA 1BHAA 3ZRVA 1GM9A 1TUEB 1VQ6V 5EC2C 4X88A 4FPPA 3T4DA 2EIMB 3JD3A 3CC2V 2IU0A 2P90A 1MOFA 3OMIB 1QCEA 1AJQA 4ZBMA 2D3OW 5B1AB 4MTXA 4WFEA 1XL4A 2WLIB 3SJQC 5B3SC 1OCCB 2A0LA 4PA4A 1S72V 2QM7A 1GMGA 2YEVA 3ABMB 4JF3A 1OHHG 2DYRC 1R73A 1V54B 3ML0A 1K33A 2XAGA 5L3DA 1OCOB 3TCUA 4JTAB 3RW0A 1NVPB 3AG2C 2JK5C 4XBFA 2EIKB 1KKDA 2WLJA 5BZBA 5L3FA 3ASOC 4P9PA 2PI5A 1QLNA 4R7CA 2C2AA 4X8AA 2OT5A 2HVJC 3ZCCA 2EBOA 3K0GA 4H37A 4MVOA 1K73W 1J95A 2F43G 3STZC 1NKDA 3ZMUA 1VQ5V 4E2LA 3CCLV 2HLDG 2EIJC 3ZRWB 3ZN1A 4MVUA 4R8CA 1E1QG 4J9YB 2Y69B 2JJ2G 1M56B 1BMFG 2Q69A 2ZR3A 2JEUA 3ETEA 3OEEG 1K7DA 2Z3YA 3ABLC 2QEXV 4FJCC 4LP8A 3W7WA 4MSWC 3AG1B 4WFGA 2ZDIA 3ZN0A 3FB8C 3SYQA 3ZRXA 1PNKA 1YHQV 1KP2A 3T1CA 2DW4A 2IH3C 2A79B 2QE7G 1R3LC 2ZD9A 2HVKC 4X89A 3ASNC 3K08A 4KFMA 1AI6A 1PNLA 2ATKC 2ZR2A 4XDJA 1OCCC 2AHYA 2XOKG 1Q81W 3ETGA 3ZJZA 1V55C 4PDMA 1KP3A 1YITV 2DYRB 1DTOA 3B8NA 3M99B 4QIWF 5IYBO 1QVFU 2ITCC 1R3IC 1AJPA 2WSSG 3SYAA 3WG7C 2DYSC 2OTJV 1KQSU 1JVMA 3BEHA 1F23A 2WWWA 3AG2B 3F7VC 4CBCA 1VQLV 1M57C 3K06A 3B77A 2Q68A 2IU3A 4G28B 5IYDO 1YI2V 1NBMG 1SETA 2DQ0A 2JJ1G 3IC7A 1K5QA 2GSMB 5H9CA 5E1AC 3ABKB 2Z5UA 4HAMA 3P32A 1FXHA 3ZMVA 2EIJB 2BOCC 2WAMA 4QPJA 1CEZA 3K03A 1JQ0A 4Z1MG 3H01A 3W7XA 5EK0A 1GM8A 1M56C 4P2ZA 3MD0A 1ENVA 1Y66A 2AHZA 4LBEC 2W6IG 5LHGA 1VQMV 1KD1W 2PI4A 3ABLB 3CCSV 1R3KC 4JTCB 2EINC 4JYBA 3AG1C 5C93A 1BHBA 2JIZG 3HPLC 3DTUB 1THZA 3K79A 2M7WA 5LGTA 1NQTA 4JAUA 4P9OA 1EBOA 2NNUA 2WLLA 3UM7A 5CBGA 3ASNB 3EFFK 1Q86W 3ABUA 5IDJA 3SPCA 3BY6A 1R3JC 3RVYA 3F5WC 5FL7G 3G6EV 1ORQC 3OE7G 3OUFA 2W6JG 2IW5A 1V55B 1OZ0A 3FB7C 1ROPA 1MSWD 4BW5A 3E86A 4GX1A 3W7SA 1BL8A 1UJWB 3OFNG 2ZQMA 1R6NA 5KUKA 3AG4C 3WG7B 1CPYA 2DYSB 1K34A 1K5SA 5H6RA 1LNQA 1GO3F 4MVRA 3ZRSA 2UXNA 1Y4MA 2NLJC 1YJWV 1Q7YW 4EKWA 5B1NA 3QO7A 1M57B 3AG3C 3FYEB 3TK1A 1K4DC 1B6QA 1PD3A 2B1IA 3OR6C 4BIZA 5L3CA 4RQEA 4U7NA 3ABKC 3CCEV 5HFLA 1M90W 2LFSA 2P6JA 4GX0A 4QPKA 5L3BA 1GK9A 4UVAA 4PA7A 1H38A 1AJNA 2H8PC 3CCVV 3PJSK 2WPDG 3CCMV 4I9WA 1SESA 2P67A 2QKSA 4LCUC 1YIJV 2WLKA 4QE7A 5L3GA 1KC8W 1H8EG 1COWG 1DLBA 1I5XA 2HFEC 4ASUG 3A0RA 2EINB 2XAHA 1VQNV 1VQPV 1F4MA 3EHBB 3CMEV 1AI4A 2JEXA 2Q6AA 2IJHA 4I5SA 3RBZA 4H33A 1VQ4V 3QNEA 3OAAG 2QTOA 4JTDB 2LP7A 4JAVA 2K1EA 3HB3B 3FB6C 3X2QB 5KA5A 2EJRA 3K9AA 3GWOA 2ZDIC 1W0JG 3KG2A 4TWKA 2XAFA 2DWEC 3JD4A 4DXWA 3FYIB 1H8HG 3WFVA 4GCZA 1QR9A 2X7RB 5J9PC 1K4CC 4RQFA 3GB7C 3JD1A 1IXMA 1FXVA 2EILB 2Y48A 3K0DA 3NXSA 4Q20A 1KECA 4MVSA 3OMAB 3AG4B 5CMUA 1S3JA 2YEVB 4UV8A 1FXKA 3OM3B 5LBQA 1N8RW 2WLNA 3CMAV 2CK3G 4FK5C 1WLEA 4MVQA 5DN6G 1YJ9V 1ZWIC 3AG3B 4TT3G 1SERA 4QNHB 5HFMA 3D3IA 4MTGA 3CC7V 4XDLA 5IYCO 4WFHA 3CC4V 2LFRA 1MABG 5EBMC 3E8BA 3ZMTA 1F4NA 4KUMA 3JD0A 3TETA 3QO5A 2IH1C 2X6BA 1WPXA 1QR8A 4P30A 1NH2B 4BAYA 1VQOV 2B1GA 4WFBV 5CBFA 3W7TA 2HR3A 2R9RB 2XASA 3ZRWA 1SRYA 4MW8A 5B1BC 1E79G 2Q67A 3E83A 2B5UA 4PA6A 5IY5C 3CCRV 4N21A 3RVZA 2EZOA 1JOYA 2HKOA 3G4SV 1VQ9V 3R65A 4PDLA 1GTOA 1I5YA 3T4ZA 1VQ7V 2OTLV 1OCRC 3X2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB1 A;  4PDR A;  4HYO A;  3E89 A;  4MSW C;  2WLH A;  2ZXW C;  2BOB C;  4MVM A;  3OR6 C;  3E8H A;  3FB8 C;  4R6Z A;  4WFG A;  3SYQ A;  3SPH A;  3ABK C;  3LDC A;  4R50 A;  3T1C A;  3IGA C;  2EIK C;  1G4Y B;  2IH3 C;  2A79 B;  3JYC A;  1R3L C;  1OCZ C;  2HVK C;  2ZD9 A;  4RUF A;  1P7B A;  3ASN C;  4GX0 A;  4X89 A;  3K08 A;  4KFM A;  3VOU A;  3SYC A;  5EBW C;  2ATK C;  3LUT B;  2EIL C;  3OR7 C;  3SPG A;  4PA7 A;  4XDJ A;  4MTO A;  1OCC C;  3SPJ A;  2AHY A;  3ZJZ A;  1V55 C;  2H8P C;  2W0F C;  3PJS K;  4PDM A;  3SPI A;  4I9W A;  3STL C;  2X6C A;  2ITC C;  2QKS A;  1R3I C;  4LCU C;  4RAI A;  2WLK A;  2Y69 C;  4QE7 A;  4RO2 A;  3SYA A;  4F4L A;  2HFE C;  3WG7 C;  1QLE C;  2DYS C;  4RUE A;  1JVM A;  2Q6A A;  3BEH A;  3SYP A;  3RBZ A;  3F7V C;  4H33 A;  4HZ3 A;  4PA3 A;  4CBC A;  1M57 C;  3K06 A;  2Q68 A;  2QTO A;  4G28 B;  2WLM A;  4GX2 A;  4JTD B;  4PA9 A;  3F7Y C;  2HG5 C;  2K1E A;  4UUJ C;  3FB6 C;  3UKM A;  5KUM A;  3KG2 A;  4TWK A;  5E1A C;  2DWE C;  4XDK A;  4DXW A;  5EC2 C;  4X88 A;  3T4D A;  4MVZ A;  4ZBM A;  5CBH A;  4OXS A;  5J9P C;  1K4C C;  5EC1 C;  2BOC C;  3GB7 C;  3K0D A;  4WFE A;  1XL4 A;  2X6A A;  2WLI B;  3SJQ C;  3K03 A;  4MVS A;  2A0L A;  4PA4 A;  5B3S C;  5EK0 A;  1M56 C;  2YEV A;  3OUS A;  4P2Z A;  2DYR C;  2AHZ A;  2DWD C;  4LBE C;  2WLN A;  4MTF A;  4MVQ A;  1R3K C;  1ZWI C;  3LDD A;  4JTC B;  3TCU A;  2EIN C;  3AG1 C;  4J9Z B;  4QNH B;  3IFX A;  3HPL C;  4JTA B;  4WFF A;  3RW0 A;  2A9H A;  4MTG A;  3AG2 C;  2JK5 C;  2ITD C;  4XDL A;  4WFH A;  4P9O A;  5EBM C;  3OGC C;  1KKD A;  3E8B A;  3FB5 C;  4LP8 A;  2WLL A;  2WLJ A;  3UM7 A;  5BZB A;  3EFF K;  5CBG A;  2P7T C;  3ASO C;  2WLL B;  4MS2 A;  3TET A;  4P9P A;  4R7C A;  2IH1 C;  2X6B A;  3SPC A;  1S5H C;  2WLI A;  4X8A A;  2HVJ C;  1R3J C;  3RVY A;  2OCC C;  3F5W C;  4P30 A;  1ORQ C;  3K0G A;  3LDE A;  3OUF A;  4H37 A;  4MVO A;  2EIM C;  5CBF A;  1J95 A;  3FB7 C;  3STZ C;  4GX5 A;  4BW5 A;  3E86 A;  2R9R B;  3LNM B;  1BL8 A;  3E8F A;  4GX1 A;  4QE9 A;  5B1B C;  2EIJ C;  4MW8 A;  5B1A C;  2Q67 A;  3E83 A;  4MVU A;  4J9Y B;  4R8C A;  5IY5 C;  4PA6 A;  5KUK A;  3AG4 C;  3RVZ A;  3E8G A;  3SYO A;  3ABM C;  3R65 A;  4PDL A;  4PDV A;  1LNQ A;  1XL6 A;  2HJF C;  2Q69 A;  4MVR A;  1V54 C;  5EBL C;  3T2M A;  3ZRS A;  2NLJ C;  3ABL C;  3T4Z A;  4EKW A;  4G27 B;  4MW3 A;  3AG3 C;  3K04 A;  1OCO C;  1K4D C;  1OCR C;  3X2Q C; 
#chains in the Genus database with same CATH topology
 2Q8V A;  3E89 A;  4R6Z A;  1IUR A;  5BR8 O;  4DR6 B;  5LGU A;  2AZ0 A;  1G8M A;  3RYC A;  3N27 A;  3JYC A;  4RUF A;  1IXB A;  3VOU A;  4DV5 O;  4I0X A;  5EBW C;  5DEC A;  1EN6 A;  5LP6 A;  3S3W A;  4UCU A;  2YSU B;  4JYC A;  3STL C;  4WFA V;  4B3M O;  4KL1 A;  4YJ3 A;  1ZL8 B;  1K92 A;  1QLE C;  2KKW A;  1NTK H;  2FTK A;  5LYJ A;  3CCU V;  1FXK B;  2Q73 A;  4PA9 A;  2YI9 A;  2M6Y A;  2QM8 A;  4BW9 A;  4NVP A;  1SA0 B;  4W4K A;  4DR1 B;  4DR2 O;  3UO3 A;  5IWA O;  4DV0 B;  5IJ0 A;  5CBH A;  4OXS A;  5EC1 C;  5B1B B;  2X6A A;  1RM1 C;  1VQ8 V;  4JI1 O;  2UXC B;  3UO2 A;  1YJN V;  2XAQ A;  1YTF B;  1NJI W;  1S77 D;  3LDD A;  4L87 A;  3G6B A;  1XNR O;  2ZXW B;  4DK0 A;  2A9H A;  2WA3 A;  5CA0 A;  1RPO A;  5CA3 A;  4NXN B;  1SC5 B;  4GLX A;  4MS2 A;  4TOI A;  4JI7 O;  1AR4 A;  1NI8 A;  2V7Q G;  4K8Z A;  1AI5 A;  1YZB A;  3E8F A;  4UV9 A;  2PYL A;  4J7K A;  3VBB A;  2XND G;  2CTQ A;  2DQ3 A;  4LF6 O;  4FMT A;  1EZJ A;  5B3S B;  3E8G A;  3ABM C;  1N4C A;  2HJF C;  1V54 C;  2IJJ A;  1FXK C;  4QJF B;  3N2K B;  3K04 A;  3BAA A;  1K3E A;  3U10 A;  5IE9 A;  3P3N A;  1XI1 A;  3IGA C;  4X1K A;  4FM0 A;  1J5E B;  5KAF Z;  5LL6 Y;  4CH5 A;  3JSL A;  3CD6 V;  3AEI A;  4KP4 A;  4CH3 A;  2ILM A;  2KG7 B;  1Z5V A;  3N2G A;  4JV5 O;  4LFC O;  3SPI A;  4YHH B;  2XAJ A;  3TGU H;  4N23 A;  4F4L A;  4H44 B;  1W0K G;  2YXH A;  5CA1 A;  3S3X A;  4X64 B;  4HZ3 A;  4PA3 A;  1F51 A;  2EJ7 A;  3CXH F;  1A32 A;  3ZHT A;  1YDX A;  1PKX A;  4UVC A;  2WLM A;  4UUJ C;  3SR2 C;  4OPA A;  5BMV B;  2X0L A;  4BR6 A;  1BHA A;  1TUE B;  3R66 A;  5EC2 C;  1VQ6 V;  4IHJ A;  2BSK A;  3T1H O;  3CC2 V;  2Y4T A;  3OMI B;  4ZBM A;  4X9Q A;  1IBM B;  2WLI B;  5B3S C;  2YEV A;  1OHH G;  4FZ1 A;  3JAM N;  4AIL C;  1P49 A;  4O4H A;  1K33 A;  3FAV B;  5L3D A;  1PPJ H;  1OCO B;  3TCU A;  2LO1 A;  4DV1 B;  4PJ0 Z;  5JCO A;  4LWS A;  4U3F H;  1LUV A;  2JK5 C;  1Q3E A;  3BCC H;  3A0H Z;  3D8C A;  4P9P A;  2QJ1 A;  4F6R B;  1QLN A;  2C2A A;  4B3S B;  1QQC A;  1Y76 B;  4MVO A;  1GN6 A;  1K73 W;  2UUB B;  1NS1 A;  4JI6 B;  3STZ C;  3ZMU A;  4E2L A;  2EIJ C;  4R8C A;  2Y69 B;  5JVD B;  4DW0 A;  1H2K A;  2O57 A;  2JJ2 G;  2CE4 A;  2JVD A;  4O2A B;  3OEE G;  5KHH A;  4FFB A;  3FFQ A;  1WB8 A;  3QG5 A;  2HHH B;  3THO A;  2QDO A;  3W7W A;  1H2L A;  3AG1 B;  3K59 A;  2ZDI A;  1NTM H;  4HBN A;  1PNK A;  1KP2 A;  2DW4 A;  2IH3 C;  3CWB H;  4B3T B;  3RYC B;  2Z0A A;  3ASN C;  3L75 H;  1HNZ B;  1NTZ H;  2N74 A;  1KUQ A;  1DGS A;  4I0X B;  3BRC A;  5LP6 B;  2AHY A;  3ZJZ A;  2Y0P A;  3B8N A;  3M99 B;  1HDJ A;  2VS0 A;  4YJ3 B;  2H3O A;  4LFB O;  1JR9 A;  3FX7 A;  3ETQ A;  1XMO O;  3CSX A;  1BE3 H;  2Q7G A;  4FZ0 A;  2JJ1 G;  1K5Q A;  5JWP A;  4LF8 O;  1BCC H;  3BA8 A;  3Q4H A;  4GUN A;  2ZT9 B;  3HKC A;  2BOC C;  1AIL A;  1JQ0 A;  4Z1M G;  3W7X A;  3RWR D;  1AR5 A;  1ENV A;  5LHG A;  1G1X B;  2PI4 A;  3ABL B;  4DV7 B;  1R3K C;  1O9G A;  3AG1 C;  4DR3 B;  1VEW A;  2M7W A;  2QWP B;  2DOS A;  1B3Q A;  4P9O A;  5EIB C;  1GRJ A;  3UM7 A;  4FLX A;  3ABU A;  1R3J C;  2R72 A;  2XT9 A;  4D7T A;  4EFB A;  3OE7 G;  1Q90 D;  3B4S A;  1V55 B;  1XEQ A;  3H1K H;  3ZHV A;  1MSW D;  3E86 A;  1VMG A;  2JGD B;  5KUK A;  3AG4 C;  2JS3 A;  3WG7 B;  1CPY A;  1K34 A;  3A0B Z;  2P06 A;  2UXN A;  1URF A;  1M57 B;  3TK1 A;  2UUA B;  1K4D C;  1Z5W A;  1VF6 C;  5AG2 A;  3JAL A;  4ABM A;  2L35 A;  4DUZ O;  4X1K B;  1I94 O;  4J41 A;  3G67 A;  1GK9 A;  2ARH A;  4UVA A;  4YY3 O;  2ZIO A;  2PY5 A;  4NYK A;  1ZUQ A;  2WPD G;  1YIJ V;  1KC8 W;  3A0R A;  1QHT A;  4PV1 B;  3CME V;  2JEX A;  5CA1 B;  4I5S A;  1CXZ B;  4LF9 B;  5LMN O;  1XIL A;  2PYJ A;  4JAV A;  4I7Z B;  4F6E A;  3X2Q B;  3U11 A;  5KX5 A;  3K9A A;  3GWO A;  3ZHU A;  2QGN A;  4DXW A;  2E5L B;  3FYI B;  4IHJ B;  1QR9 A;  2BSK B;  2QKA A;  2PUS A;  4RQF A;  1VF7 A;  3GB7 C;  3JD1 A;  1IXM A;  3NXS A;  4J10 A;  3JAT A;  1KEC A;  3OMA B;  1SQP H;  4CC5 A;  1S3J A;  2YEV B;  4UV8 A;  1FXK A;  4AHC A;  3CMA V;  1XBL A;  3JCU Z;  4UCR A;  4FK5 C;  4O4H B;  5DN6 G;  1SER A;  4QNH B;  2Q7E A;  5HFM A;  5J2U A;  1WNS A;  4LWS B;  3SDL A;  1N36 B;  4X62 B;  3E8B A;  1HP8 A;  4KUM A;  2IH1 C;  2X6B A;  3QF7 A;  4K0K O;  4P30 A;  2MW2 B;  2HR3 A;  3BAB A;  1ZX3 A;  1DK1 A;  3ZHQ A;  3E83 A;  4E4E A;  4PA6 A;  2QKC A;  2R70 A;  2QWR B;  3RVZ A;  2HKO A;  3G4S V;  1FJG O;  1GTO A;  2CDY A;  5B5E Z;  4LR3 A;  4ZHQ A;  4FFB B;  3HKB A;  3X2Q C;  4PDR A;  2WLH A;  5KHJ A;  3E35 A;  3E2E A;  1L1F A;  1S5J A;  2ZCE A;  2V1D A;  1XRE A;  2MK3 A;  4WBN A;  1FFX A;  1TUB A;  4RWU A;  4JI5 B;  3RYH A;  4IYI A;  4KHP B;  2HP8 A;  2Q5Z A;  4MTO A;  3RYI A;  3SPJ A;  2R9A A;  3KKY A;  2QWQ B;  1XMQ O;  1SQX H;  2YIB D;  4TV8 A;  2JDI G;  1ARO P;  3N2K A;  4DR5 B;  5GTI Z;  2IM9 A;  3MHH C;  4I4T A;  3CP1 A;  5KA6 A;  3U0Z A;  1SQF A;  5JCO C;  4B7K A;  4CS4 A;  3CCJ V;  3ZHS A;  1PP9 H;  4GX2 A;  5FNV A;  1XUQ A;  5DM6 V;  1AI7 A;  4DV3 O;  1KMI Z;  2KG7 A;  2VQE O;  3T1Y B;  2UXB B;  4B7E A;  1FFT B;  3JAW A;  1I7F A;  1JPX A;  5LHI A;  4O2B A;  3Q4H B;  5KHI A;  2H94 A;  3MDS A;  3J81 N;  3HKC B;  1XHX A;  2KSD A;  1H2G A;  5IY5 B;  3CHX A;  5DED A;  1JA8 A;  3CRC A;  2QA4 V;  3CS5 A;  2AXT Z;  2ADP A;  4FFK A;  2YXL A;  5BMV A;  1GAX A;  4FIP C;  1NR1 A;  1MZE A;  3QO8 A;  4WFF A;  4LFA B;  3CCQ V;  3AK3 A;  1SKV A;  3OGC C;  3FB5 C;  3DC6 A;  1TA8 A;  3QTC A;  1RPR A;  1DF4 A;  2WLI A;  1JJ2 U;  1BQZ A;  2QWO B;  4LC1 A;  3K9S A;  1X59 A;  1S76 D;  2IBZ H;  4FVM A;  3LDE A;  2KQX A;  4X1Y B;  4JZG A;  3LNM B;  2EZP A;  4JI4 B;  5B1A C;  4JAS A;  2F93 B;  1FS0 G;  3ZIA G;  3TXS A;  3ZS8 C;  3JAS B;  1QLE B;  4D7S A;  4PDV A;  1XL6 A;  5EBL C;  3SGI A;  4MW3 A;  3K5L A;  2YXY A;  4J9Z B;  3ZMZ A;  1WJZ A;  1N33 B;  4R50 A;  2E3C A;  3JAL B;  1G6U A;  4HNA A;  1P7B A;  4DV2 O;  2IJK A;  2NR5 A;  3I56 V;  3SPG A;  1RM1 B;  4UXN A;  4X66 B;  1NVP D;  1AVM A;  3ZMS A;  3CPW U;  1H2N A;  4RUE A;  4JPR A;  2RCV A;  3L70 H;  4B3M B;  1NR7 A;  1XQ8 A;  2ZNJ A;  5BY1 A;  2ZKO A;  4TV9 A;  4ICG A;  3JSN A;  4YXW G;  1Q5O A;  4A5U B;  5KX5 B;  5LGN A;  4I9Q A;  1Q6U A;  4YJ2 B;  4FPP A;  1WB7 A;  3JD3 A;  2IU0 A;  1QCE A;  2G38 A;  4OGQ B;  2BTO A;  4GKK B;  2D3O W;  1N34 O;  3OTO B;  1XL4 A;  3JAT B;  4PA4 A;  1B04 A;  1GMG A;  3ABM B;  2AZ2 A;  1V54 B;  3ML0 A;  5JJE B;  3AK2 A;  2GV9 A;  4U3J B;  2ZM6 B;  1VF6 A;  5J2U B;  3AG2 C;  1O9H A;  3AK1 A;  1S5L Z;  5BZB A;  4O4J B;  5L3F A;  3H1H H;  3LSU A;  2PI5 A;  4J80 A;  4X8A A;  2OT5 A;  3ZCC A;  2EBO A;  1VQ5 V;  2HLD G;  2W0X A;  1SQB H;  4J9Y B;  1R6T A;  1GH6 A;  4O4L B;  3K57 A;  1JMK C;  1M56 B;  1BMF G;  2ZR3 A;  2RNB A;  1VF5 B;  4ZHQ B;  2PZS A;  4LF6 B;  3HKB B;  3FB8 C;  3ZRX A;  1YHQ V;  5IT9 N;  4DR1 O;  2RQ6 A;  2A79 B;  1P84 F;  2QE7 G;  1FAF A;  3OTF A;  4X89 A;  4PI2 A;  2GBO A;  4WBN B;  1AI6 A;  2ATK C;  2JGD A;  1FFX B;  1TUB B;  3RYH B;  1U96 A;  2FB5 A;  2XOK G;  3OGI B;  1Q81 W;  2BE3 A;  3ETG A;  3RYI B;  3FD9 A;  1KP3 A;  4TV8 B;  1EN4 A;  3O65 A;  2ITC C;  4LF5 B;  2WSS G;  1F7Y A;  3SYA A;  4EFE A;  1H2S B;  1UPG A;  4LFC B;  5E79 Z;  4I4T B;  2ZE8 A;  4GKJ O;  4DR4 O;  2Q68 A;  1NBM G;  5FNV B;  5H9C A;  3ABK B;  1IBL B;  2UXD O;  3JAW B;  3CJH A;  2YDE A;  4O2B B;  3B2E E;  4NTY A;  1IDS A;  4JYA O;  1GN4 A;  3P32 A;  2EIJ B;  4QPJ A;  1CEZ A;  1N0N A;  2E74 B;  3H01 A;  1M56 C;  3T1H B;  4P2Z A;  4FM2 A;  1Y66 A;  2AHZ A;  4LBE C;  2W6I G;  1VQM V;  3WU2 Z;  5H5N A;  4JTC B;  5C93 A;  4JYB A;  2ZIN A;  4NXM O;  2YIB A;  5LGT A;  1NQT A;  3RN4 A;  1XNQ B;  1J5E O;  2GDS A;  2WLL A;  3ASN B;  1Q86 W;  5EZY A;  1OJH A;  3F5W C;  5FL7 G;  3CRQ A;  2N05 A;  3FB7 C;  1ROP A;  4BW5 A;  5IJ9 A;  1UJW B;  4YHH O;  2VQF B;  1BGY H;  3UT5 A;  2ZQM A;  1R6N A;  1HNX O;  5H6R A;  1GO3 F;  1KKC A;  1YJW V;  1Q7Y W;  3K5M A;  2FKX A;  1TGO A;  1M4U A;  3AG7 A;  1B6Q A;  4JI2 B;  1PD3 A;  4RQE A;  5L3C A;  4U7N A;  3ABK C;  5HFL A;  1M90 W;  1MA1 A;  1ZSP A;  1U97 A;  4FLZ A;  4DYL A;  4GX0 A;  4HNA B;  4B3R B;  5L3B A;  1IBM O;  2RN9 A;  3RFR A;  4LNU A;  5C8Y B;  2LJ2 A;  3C90 A;  4TQF A;  3OT7 A;  2LW1 A;  2BTQ A;  2RDC A;  1Q6I A;  2XAH A;  4DV1 O;  5FLX N;  1VQP V;  1AI4 A;  2Q6A A;  5CB4 A;  2IJH A;  4JTD B;  2LP7 A;  2K1E A;  3HB3 B;  4C7U A;  4TV9 B;  1SQV H;  2EJR A;  1W0J G;  1BS3 A;  2XAF A;  1XMO B;  4K8X A;  4B3S O;  4OX9 O;  2HEP A;  3KCY A;  3WFV A;  2ADQ B;  3K0D A;  2E75 B;  4MVS A;  3AG4 B;  2JRI A;  1N8R W;  2WLN A;  1B06 A;  1YJ9 V;  1WLE A;  2HHH O;  1ZWI C;  4TT3 G;  3G80 A;  3D3I A;  3ICX A;  4PD4 F;  4JI3 B;  4TUY B;  1BSM A;  2RMK B;  1YVW A;  3CC4 V;  1UFI A;  5J2T B;  1MAB G;  5TIS Z;  4B3T O;  3L73 H;  3TET A;  4GYC B;  2UUC O;  2PTM A;  5JJJ B;  1NH2 B;  1VQO V;  2B1G A;  4WFB V;  5CBF A;  1VP7 A;  1SRY A;  4MW8 A;  1BT8 A;  4UCV A;  1IBK O;  2Q67 A;  1H2M A;  4DUY O;  2CGO A;  3CCR V;  2EZO A;  1VQ9 V;  1L0N H;  3BFR A;  3R65 A;  4X1I A;  1I5Y A;  3T4Z A;  1VQ7 V;  1OCR C;  4BIO A;  3BVO A;  4UB8 Z;  5LOV B;  4DK1 A;  3LDC A;  2LGW A;  4X1Y A;  2OCH A;  1AP6 A;  4LF4 O;  2F4V B;  1OCZ C;  3ETD A;  4TQD A;  4BIU A;  1VQK V;  3B8M A;  1YXB A;  3HKD A;  2LW7 A;  3JAS A;  4GT1 A;  1PL4 A;  1S0V A;  2OCC B;  1QU7 A;  4BWA A;  1IVS A;  5LHH A;  1I94 B;  3J7A U;  1KB9 F;  4G2K A;  4WCE V;  3CYO A;  3LNN A;  4DV7 O;  4RO2 A;  4JI0 O;  4DR3 O;  4ZKI A;  2YIA A;  5EYP A;  3L72 H;  4D6T H;  4UCS A;  1M93 A;  5D5P A;  5GTH Z;  1W2B U;  5GW7 A;  1N0J A;  5LMN B;  3CJH B;  4J7Z A;  3FKS G;  4DV6 B;  1EFR G;  3RGB A;  2GUZ A;  1TAE A;  2V4D A;  3OUS A;  1NH2 D;  2DWD C;  4X65 B;  1MZF A;  2UUA O;  3LSS A;  4I55 A;  1JFF B;  3IFX A;  1P4R A;  3F5T A;  2R9I A;  4UCO A;  2ITD C;  4YJ2 A;  2FML A;  3IAY A;  3K3W A;  2FL4 A;  2WLL B;  5KHK A;  3CRA A;  5EZY B;  1GN3 A;  2OCC C;  2EIM C;  4UFZ A;  4FLY A;  1M9N A;  5IJ9 B;  4U3J A;  5H6Q A;  3VQW A;  1QBZ A;  3UT5 B;  2OIG A;  3OD4 A;  3SYO A;  2UU9 O;  2PF4 E;  4JZ2 A;  1EM1 A;  5A2Q N;  3C3S A;  3T2M A;  1X4T A;  4G27 B;  3BHP A;  5KLV H;  3W7U A;  4O4J A;  2XUM A;  4DO2 A;  2KB1 A;  2EX3 A;  3E8H A;  4PHZ A;  3RYF A;  1TVK B;  3MHS C;  4AQY O;  2EIK C;  2QM4 A;  3L9D A;  3DGE A;  3SYC A;  3ASO B;  3LUT B;  3WB1 A;  1PNM A;  2Q0A A;  4O4L A;  4B08 A;  4LNU B;  1BQ0 A;  4NR1 A;  4CS3 A;  1QVG U;  4CH6 A;  2LQT A;  1ZAU A;  4I50 A;  4RAI A;  2BTQ B;  1JX9 A;  2DJV A;  3BPZ A;  5CN0 A;  1ZLZ A;  5CB4 B;  5JQG A;  1HWY A;  1N36 O;  2CAZ C;  2UXX A;  4JYY A;  3UKM A;  2HG5 C;  3K5O A;  2ZE7 A;  4GZR B;  4TSF G;  4X88 A;  2P90 A;  1MOF A;  1AJQ A;  4DV3 B;  3H1J H;  2FYU H;  4MTX A;  5B1A B;  1KYO F;  1WPB A;  1S72 V;  2QM7 A;  4DW1 A;  2DYR C;  1Q6H A;  2A06 H;  2XHB A;  2WA4 A;  1KU9 A;  3RW0 A;  1NVP B;  4K3A A;  5KHG A;  1KKD A;  2WLJ A;  1HNW B;  4JI8 B;  3ASO C;  4JI5 O;  4EEQ A;  4KHP O;  2HVJ C;  4ZIB A;  4Z1V A;  4DV4 O;  4H37 A;  1FYJ A;  1J95 A;  3CCL V;  4LH7 A;  3ZN1 A;  4MVU A;  2ZNI A;  1E1Q G;  2Q69 A;  4DRX B;  2JEU A;  4X1I B;  2GTS A;  4NTX A;  5JJN B;  4LP8 A;  3SJB C;  4MSW C;  4WFG A;  2ETN A;  5LMU O;  2YC0 A;  3SYQ A;  3T1Y O;  4Z2W A;  2UXB O;  1M5I A;  5D5Q A;  2Y0I A;  1FPO A;  3K08 A;  2QTS A;  4KFM A;  1RP3 B;  1PNL A;  3HKD B;  2ZR2 A;  2A7W A;  1N32 B;  1YIT V;  2YS8 A;  4DV2 B;  1OV9 A;  4NB5 A;  4QIW F;  5IYB O;  2DN9 A;  1QVF U;  1R3I C;  4L8J A;  2DYS C;  1KQS U;  1JVM A;  2OWO A;  3AG2 B;  4DR7 B;  1HR0 O;  3F7V C;  1VQL V;  4LF7 B;  3B77 A;  4G28 B;  5EYP B;  2AW9 A;  5BR8 B;  1SET A;  2DQ0 A;  5H2F Z;  2GSM B;  5C8Y A;  4HAM A;  4DV5 B;  4JI4 O;  1BZK A;  3D36 C;  5EK0 A;  1GM8 A;  3WB2 A;  2CTR A;  2GUZ B;  1SS3 A;  2P22 C;  4OPH A;  3VQX A;  1NU1 H;  2EIN C;  1BHB A;  3HPL C;  2F95 B;  1THZ A;  1N33 O;  4I55 B;  3K79 A;  1I0H A;  3SJA C;  2RJZ A;  1RSO B;  4NTW A;  4H0L B;  2NNU A;  3B09 A;  4CH4 A;  5CBG A;  3EFF K;  2N04 A;  5IDJ A;  3BY6 A;  1NZ6 A;  4DR2 B;  3G6E V;  4X66 O;  3HKE A;  3OUF A;  2W6J G;  2IW5 A;  5IWA B;  1EZV H;  1LUW A;  4GX1 A;  3W7S A;  3TXQ A;  5F2V O;  1K5S A;  4JI1 B;  4TUY A;  1LNQ A;  4MVR A;  1GN2 A;  2OYQ A;  5J2T A;  4DR6 O;  1Y4M A;  5B1N A;  3AG3 C;  4CS2 A;  3DXR B;  1XNR B;  1LR1 A;  2B1I A;  3CCE V;  3RYF B;  2ODM A;  3CE2 A;  2LFS A;  3APO A;  4JI7 B;  4GKK O;  3OTO O;  1H38 A;  1AJN A;  3CCV V;  3PJS K;  4I9W A;  1WP8 A;  1SES A;  1YEW A;  3SJC C;  4QE7 A;  4I50 B;  1I5X A;  1RFY A;  2HFE C;  4ASU G;  2ZM6 O;  5LOV A;  3EHB B;  3RBZ A;  1VQ4 V;  5JQG B;  3JAR B;  3OAA G;  2QTO A;  4DV0 O;  5KA5 A;  2GTA A;  1Q43 A;  3KG2 A;  4TWK A;  1WP7 A;  1XDC A;  4GKJ B;  1FKA O;  4DR4 B;  4X20 A;  2UXC O;  1D5A A;  2P4V A;  1K4C C;  4Q20 A;  2EIL B;  4JV5 B;  2UXD B;  3OM3 B;  4JYA B;  2CK3 G;  4NXN O;  4MVQ A;  2CGN A;  4XDL A;  5IYC O;  4WFH A;  2Q9L A;  5EBM C;  3P3P A;  1F4N A;  3JD0 A;  3QO5 A;  4NXM B;  2DMX A;  2ZIM A;  2JGU A;  1WPX A;  1QNM A;  1QR8 A;  4YIP A;  4BAY A;  3W7T A;  2XAS A;  2BCC H;  3ZRW A;  3UQ8 A;  5B1B C;  2AGA A;  2JS5 A;  1E79 G;  4LF5 O;  1JFF A;  4N21 A;  4PDL A;  5FPR A;  4YIO A;  2OTL V;  1HNX B;  4HYO A;  3I5D A;  4MVM A;  4ZOL B;  2ZXW C;  1K8A W;  3SPH A;  1IBL O;  3APQ A;  5GON A;  1G4Y B;  1SZX A;  1DF5 A;  1YTF D;  2DE0 X;  4AI8 A;  2EIL C;  3OW2 U;  4O4I A;  3JAK B;  1WA8 A;  5IYZ A;  4IGG A;  2W0F C;  3ABT A;  4U7O A;  4X64 O;  1R6K A;  3J80 N;  1YCI A;  1TVK A;  1GM7 A;  1VIB A;  1Q82 W;  3DC5 A;  1D5N A;  1XNQ O;  3F7Y C;  1R1B A;  2CTP A;  4ZI7 A;  2GHY A;  5KUM A;  4JGS A;  4IIJ A;  4XDK A;  1SZT A;  4FLU A;  4UB6 Z;  4MVZ A;  4MT8 A;  3D3Q A;  2CH7 B;  1IX9 A;  1GKF A;  2VQF O;  2LGQ A;  3OEH G;  4OX9 B;  3CRR A;  3PN1 A;  3G71 V;  4UVB A;  2NN4 A;  4J42 A;  4J11 A;  4MTF A;  5K1X A;  4LFB B;  1OCR B;  4JI2 O;  3OMN B;  1MG1 A;  2UUB O;  4JI6 O;  1OCZ B;  1PL0 A;  4B3R O;  2P7T C;  5LA6 A;  1L8D A;  3I55 V;  2QWN B;  1YSC A;  1S5H C;  1AR1 B;  4LF8 B;  2F1M A;  4WF9 V;  4FM1 A;  3JCZ A;  2F23 A;  3HKE B;  4GX5 A;  4CZZ A;  4QE9 A;  1V9P A;  2UUC B;  3P30 A;  3CXC U;  3ZHR A;  5A9G A;  4JAA A;  3JD2 A;  3TJT A;  2HJD A;  4Q6G A;  3H9V A;  2QSA A;  1IBK B;  4DUY B;  1OCO C;  1HNZ O;  4FLW A;  1MSD A;  1Y74 A;  2BOB C;  1K9M W;  2IJI A;  5LYJ B;  3IJ4 A;  5BXZ A;  1M1K W;  1XOU A;  3LSQ A;  5LXT A;  3OR7 C;  4H13 B;  1AB3 A;  1JCH A;  1WN7 A;  5JH7 A;  3D36 A;  1PV0 A;  4EB6 A;  5L3E A;  4DRX A;  4LF4 B;  4W4L A;  4PEL A;  4UCT A;  1L0L H;  3E22 A;  5IJ0 B;  2X6C A;  2Y69 C;  1E1R G;  3H1L H;  1K97 A;  4JI3 O;  1PM9 A;  3SYP A;  3HR0 A;  2YID A;  3M8A A;  2ZE6 A;  1EN5 A;  2B9Z A;  4JI0 B;  1CP9 A;  5B1O A;  3CB2 A;  3ZRV A;  1GM9 A;  3A2F A;  5CA0 B;  5ITZ A;  4DUZ B;  3T4D A;  2EIM B;  3M7M X;  4X20 B;  4FLT A;  3CEI A;  4WFE A;  4YY3 B;  5LP6 C;  3SJQ C;  1OCC B;  2A0L A;  2CUG A;  2P5O A;  4PI0 A;  1ZTE A;  4JF3 A;  2VWJ A;  2A3Q A;  1R73 A;  5EIB D;  2XAG A;  4JTA B;  3H1I H;  3A8T A;  3ZED A;  5KMG A;  4XBF A;  2EIK B;  2F4V O;  2XTA A;  5K1P A;  2OIE A;  4R7C A;  3K0G A;  2YI8 A;  2F43 G;  1MMM A;  1NKD A;  3ZRW B;  3GWK C;  1Z2G A;  3N2G B;  1Y67 A;  1RSO A;  1Y6X A;  3ETE A;  5FPO A;  1K7D A;  2Z3Y A;  3ABL C;  2QEX V;  4FJC C;  3ZX6 A;  2UU9 B;  3ZN0 A;  2P4K A;  3T1C A;  4NKG B;  5GON B;  1R3L C;  2ZD9 A;  2HVK C;  3KCX A;  1MNG A;  4DV6 O;  1T5E A;  4IL6 Z;  3O9O A;  4XDJ A;  4AQY B;  1OCC C;  4K0K B;  3KZI Z;  1V55 C;  4O4I B;  4PDM A;  1WA8 B;  5IYZ B;  2DYR B;  1DTO A;  4X65 O;  2CTW A;  1ZL8 A;  4LF9 O;  1AJP A;  3DXR A;  2F66 C;  2Q4P A;  3WG7 C;  1FJG B;  2OTJ V;  3GVM A;  3CRM A;  3BEH A;  1F23 A;  2WWW A;  4CBC A;  1WAZ A;  1M57 C;  3K06 A;  2E5L O;  2IU3 A;  5IYD O;  3K58 A;  1YI2 V;  4FLV A;  1SA0 A;  3IC7 A;  4ZI7 B;  5E1A C;  3CX5 F;  4IIJ B;  1SQG A;  2Z5U A;  3ZMV A;  1FXH A;  4IYH A;  2WAM A;  4J7J A;  3K03 A;  1XMQ B;  3MD0 A;  1NT2 B;  1KD1 W;  3JAR A;  1D2D A;  3CCS V;  4X62 O;  2JIZ G;  3DTU B;  2Q0O C;  4JAU A;  1EBO A;  3RT3 C;  2VQE B;  3SPC A;  5LA6 B;  1AP5 A;  3RVY A;  3EXA A;  4K35 A;  3MAQ A;  1ORQ C;  1OZ0 A;  1BL8 A;  3OFN G;  1SF9 A;  4DV4 B;  2QR4 A;  2DYS B;  2E76 B;  4LH6 A;  1US6 A;  3ZRS A;  2NLJ C;  4EKW A;  3QO7 A;  3FYE B;  2L6L A;  3OR6 C;  4BIZ A;  1Y74 B;  3BA9 A;  2K9P A;  2P6J A;  1P7G A;  4QPK A;  5LMU B;  4IT5 A;  4DR5 O;  4PA7 A;  5LXT B;  1YF2 A;  5JH7 B;  2VRZ A;  3IC9 A;  2H8P C;  4EB6 B;  3DSQ A;  3UCS C;  3CCM V;  1SQQ H;  2P67 A;  2QKS A;  3L74 H;  3QVN A;  4LCU C;  2WLK A;  3E22 B;  5L3G A;  1H8E G;  4ZOL A;  1COW G;  1DLB A;  3B40 A;  2EIN B;  1VQN V;  1F4M A;  4H33 A;  4KXR A;  5B66 Z;  1IZ3 A;  3QNE A;  2VWK A;  1HNW O;  3FB6 C;  4JI8 O;  1KBH A;  2ZDI C;  3K5N A;  1XHZ A;  3VQY A;  2DWE C;  1HR0 B;  3JAK A;  3JD4 A;  5ITZ B;  1H8H G;  2ZE5 A;  4GCZ A;  3NR7 A;  2EUL A;  2X7R B;  5J9P C;  1FD9 A;  1FXV A;  2Y48 A;  3VQV A;  2PGG A;  4QGP A;  1W59 A;  5CMU A;  4LFA O;  2Q7H A;  1Q8I A;  5LBQ A;  3FAV A;  3AG3 B;  2YUA A;  2YIC A;  3WB0 A;  5KAI Z;  3ZBH A;  4MTG A;  3CC7 V;  2LFR A;  5KMG B;  1I08 A;  2CH7 A;  3ZMT A;  4F6R A;  4CC6 A;  1HW7 A;  1N32 O;  1Y76 A;  2R9R B;  1JJO A;  1N34 B;  3C3T A;  5JVD A;  3L71 H;  2B5U A;  5IY5 C;  1JOY A;  4O2A A;  3EVK A;  1VAR A;  4DR7 O;  2Y4U A;  2D2C B;  4LF7 O; 
#chains in the Genus database with same CATH homology
 4PDR A;  4HYO A;  3E89 A;  4MVM A;  2WLH A;  2ZXW C;  3E35 A;  4R6Z A;  1K8A W;  3E2E A;  3SPH A;  3LDC A;  1L1F A;  5LGU A;  1G8M A;  1G4Y B;  2V1D A;  3JYC A;  1OCZ C;  3ETD A;  4RUF A;  4BIU A;  2MK3 A;  1VQK V;  1DF5 A;  1YTF D;  3B8M A;  3VOU A;  5EBW C;  2EIL C;  3OW2 U;  4GT1 A;  4MTO A;  3SPJ A;  1S0V A;  2OCC B;  2YSU B;  4JYC A;  2W0F C;  3ABT A;  4U7O A;  5LHH A;  3STL C;  4G2K A;  4WCE V;  2JDI G;  3CYO A;  1ARO P;  1R6K A;  4WFA V;  1K92 A;  4RO2 A;  1QLE C;  3MHH C;  3CP1 A;  1GM7 A;  5KA6 A;  2FTK A;  4ZKI A;  1Q82 W;  3CCU V;  1FXK B;  3CCJ V;  4GX2 A;  4PA9 A;  3F7Y C;  5DM6 V;  1AI7 A;  2GHY A;  2QM8 A;  5KUM A;  4JGS A;  1W2B U;  4XDK A;  1FFT B;  1SZT A;  5GW7 A;  1JPX A;  5LHI A;  4MVZ A;  4MT8 A;  2H94 A;  5CBH A;  4OXS A;  1GKF A;  5EC1 C;  5B1B B;  3FKS G;  1EFR G;  3OEH G;  2X6A A;  1H2G A;  1RM1 C;  5IY5 B;  1VQ8 V;  3G71 V;  4UVB A;  3OUS A;  1NH2 D;  2DWD C;  2QA4 V;  1YJN V;  2XAQ A;  1YTF B;  4MTF A;  1NJI W;  1S77 D;  3LDD A;  3LSS A;  4L87 A;  1OCR B;  3IFX A;  3OMN B;  4FIP C;  1NR1 A;  1P4R A;  3QO8 A;  2ZXW B;  2R9I A;  2A9H A;  4WFF A;  3CCQ V;  1MG1 A;  2ITD C;  1RPO A;  5CA3 A;  3OGC C;  3K3W A;  3FB5 C;  1OCZ B;  1PL0 A;  2P7T C;  2WLL B;  4MS2 A;  3I55 V;  1RPR A;  1DF4 A;  1S5H C;  1YSC A;  2WLI A;  1AR1 B;  1JJ2 U;  4LC1 A;  1S76 D;  2OCC C;  4WF9 V;  3LDE A;  2V7Q G;  3JCZ A;  2EIM C;  1AI5 A;  4GX5 A;  4CZZ A;  3LNM B;  3E8F A;  4QE9 A;  2EZP A;  4UV9 A;  1M9N A;  5B1A C;  4JAS A;  5H6Q A;  3VBB A;  2XND G;  1FS0 G;  3ZIA G;  1QBZ A;  2DQ3 A;  4FMT A;  1EZJ A;  3P30 A;  5B3S B;  3CXC U;  1QLE B;  3E8G A;  3SYO A;  3ABM C;  3JD2 A;  4PDV A;  1XL6 A;  2HJF C;  5EBL C;  1V54 C;  3T2M A;  2IJJ A;  1FXK C;  4QJF B;  4G27 B;  4MW3 A;  3W7U A;  3K04 A;  1OCO C;  4DO2 A;  4J9Z B;  1K3E A;  2KB1 A;  3ZMZ A;  2BOB C;  3E8H A;  1K9M W;  3MHS C;  2IJI A;  4R50 A;  3IGA C;  2EIK C;  1P7B A;  1M1K W;  3LSQ A;  3DGE A;  3SYC A;  3ASO B;  3CD6 V;  2IJK A;  3LUT B;  3AEI A;  3OR7 C;  4KP4 A;  3I56 V;  3SPG A;  1JCH A;  1PNM A;  3D36 A;  1RM1 B;  4UXN A;  1NVP D;  5L3E A;  4PEL A;  3SPI A;  3ZMS A;  3CPW U;  1QVG U;  2XAJ A;  2X6C A;  4RAI A;  2Y69 C;  4N23 A;  1E1R G;  4F4L A;  1W0K G;  1JX9 A;  4RUE A;  5CN0 A;  4JPR A;  1K97 A;  3SYP A;  1HWY A;  1NR7 A;  4HZ3 A;  1F51 A;  4PA3 A;  2UXX A;  1PKX A;  4UVC A;  2WLM A;  3UKM A;  4UUJ C;  2HG5 C;  1CP9 A;  4YXW G;  5B1O A;  4TSF G;  2X0L A;  5LGN A;  1BHA A;  3ZRV A;  1GM9 A;  1TUE B;  1VQ6 V;  5EC2 C;  4X88 A;  4FPP A;  3T4D A;  2EIM B;  3JD3 A;  3CC2 V;  2IU0 A;  2P90 A;  1MOF A;  3OMI B;  1QCE A;  1AJQ A;  4ZBM A;  2D3O W;  5B1A B;  4MTX A;  4WFE A;  1XL4 A;  2WLI B;  3SJQ C;  5B3S C;  1OCC B;  2A0L A;  4PA4 A;  1S72 V;  2QM7 A;  1GMG A;  2YEV A;  3ABM B;  4JF3 A;  1OHH G;  2DYR C;  1R73 A;  1V54 B;  3ML0 A;  1K33 A;  2XAG A;  5L3D A;  1OCO B;  3TCU A;  4JTA B;  3RW0 A;  1NVP B;  3AG2 C;  2JK5 C;  4XBF A;  2EIK B;  1KKD A;  2WLJ A;  5BZB A;  5L3F A;  3ASO C;  4P9P A;  2PI5 A;  1QLN A;  4R7C A;  2C2A A;  4X8A A;  2OT5 A;  2HVJ C;  3ZCC A;  2EBO A;  3K0G A;  4H37 A;  4MVO A;  1K73 W;  1J95 A;  2F43 G;  3STZ C;  1NKD A;  3ZMU A;  1VQ5 V;  4E2L A;  3CCL V;  2HLD G;  2EIJ C;  3ZRW B;  3ZN1 A;  4MVU A;  4R8C A;  1E1Q G;  4J9Y B;  2Y69 B;  2JJ2 G;  1M56 B;  1BMF G;  2Q69 A;  2ZR3 A;  2JEU A;  3ETE A;  3OEE G;  1K7D A;  2Z3Y A;  3ABL C;  2QEX V;  4FJC C;  4LP8 A;  3W7W A;  4MSW C;  3AG1 B;  4WFG A;  2ZDI A;  3ZN0 A;  3FB8 C;  3SYQ A;  3ZRX A;  1PNK A;  1YHQ V;  1KP2 A;  3T1C A;  2DW4 A;  2IH3 C;  2A79 B;  2QE7 G;  1R3L C;  2ZD9 A;  2HVK C;  4X89 A;  3ASN C;  3K08 A;  4KFM A;  1AI6 A;  1PNL A;  2ATK C;  2ZR2 A;  4XDJ A;  1OCC C;  2AHY A;  2XOK G;  1Q81 W;  3ETG A;  3ZJZ A;  1V55 C;  4PDM A;  1KP3 A;  1YIT V;  2DYR B;  1DTO A;  3B8N A;  3M99 B;  4QIW F;  5IYB O;  1QVF U;  2ITC C;  1R3I C;  1AJP A;  2WSS G;  3SYA A;  3WG7 C;  2DYS C;  2OTJ V;  1KQS U;  1JVM A;  3BEH A;  1F23 A;  2WWW A;  3AG2 B;  3F7V C;  4CBC A;  1VQL V;  1M57 C;  3K06 A;  3B77 A;  2Q68 A;  2IU3 A;  4G28 B;  5IYD O;  1YI2 V;  1NBM G;  1SET A;  2DQ0 A;  2JJ1 G;  3IC7 A;  1K5Q A;  2GSM B;  5H9C A;  5E1A C;  3ABK B;  2Z5U A;  4HAM A;  3P32 A;  1FXH A;  3ZMV A;  2EIJ B;  2BOC C;  2WAM A;  4QPJ A;  1CEZ A;  3K03 A;  1JQ0 A;  4Z1M G;  3H01 A;  3W7X A;  5EK0 A;  1GM8 A;  1M56 C;  4P2Z A;  3MD0 A;  1ENV A;  1Y66 A;  2AHZ A;  4LBE C;  2W6I G;  5LHG A;  1VQM V;  1KD1 W;  2PI4 A;  3ABL B;  3CCS V;  1R3K C;  4JTC B;  2EIN C;  4JYB A;  3AG1 C;  5C93 A;  1BHB A;  2JIZ G;  3HPL C;  3DTU B;  1THZ A;  3K79 A;  2M7W A;  5LGT A;  1NQT A;  4JAU A;  4P9O A;  1EBO A;  2NNU A;  2WLL A;  3UM7 A;  5CBG A;  3ASN B;  3EFF K;  1Q86 W;  3ABU A;  5IDJ A;  3SPC A;  3BY6 A;  1R3J C;  3RVY A;  3F5W C;  5FL7 G;  3G6E V;  1ORQ C;  3OE7 G;  3OUF A;  2W6J G;  2IW5 A;  1V55 B;  1OZ0 A;  3FB7 C;  1ROP A;  1MSW D;  4BW5 A;  3E86 A;  4GX1 A;  3W7S A;  1BL8 A;  1UJW B;  3OFN G;  2ZQM A;  1R6N A;  5KUK A;  3AG4 C;  3WG7 B;  1CPY A;  2DYS B;  1K34 A;  1K5S A;  5H6R A;  1LNQ A;  1GO3 F;  4MVR A;  3ZRS A;  2UXN A;  1Y4M A;  2NLJ C;  1YJW V;  1Q7Y W;  4EKW A;  5B1N A;  3QO7 A;  1M57 B;  3AG3 C;  3FYE B;  3TK1 A;  1K4D C;  1B6Q A;  1PD3 A;  2B1I A;  3OR6 C;  4BIZ A;  5L3C A;  4RQE A;  4U7N A;  3ABK C;  3CCE V;  5HFL A;  1M90 W;  2LFS A;  2P6J A;  4GX0 A;  4QPK A;  5L3B A;  1GK9 A;  4UVA A;  4PA7 A;  1H38 A;  1AJN A;  2H8P C;  3CCV V;  3PJS K;  2WPD G;  3CCM V;  4I9W A;  1SES A;  2P67 A;  2QKS A;  4LCU C;  1YIJ V;  2WLK A;  4QE7 A;  5L3G A;  1KC8 W;  1H8E G;  1COW G;  1DLB A;  1I5X A;  2HFE C;  4ASU G;  3A0R A;  2EIN B;  2XAH A;  1VQN V;  1VQP V;  1F4M A;  3EHB B;  3CME V;  1AI4 A;  2JEX A;  2Q6A A;  2IJH A;  4I5S A;  3RBZ A;  4H33 A;  1VQ4 V;  3QNE A;  3OAA G;  2QTO A;  4JTD B;  2LP7 A;  4JAV A;  2K1E A;  3HB3 B;  3FB6 C;  3X2Q B;  5KA5 A;  2EJR A;  3K9A A;  3GWO A;  2ZDI C;  1W0J G;  3KG2 A;  4TWK A;  2XAF A;  2DWE C;  3JD4 A;  4DXW A;  3FYI B;  1H8H G;  3WFV A;  4GCZ A;  1QR9 A;  2X7R B;  5J9P C;  1K4C C;  4RQF A;  3GB7 C;  3JD1 A;  1IXM A;  1FXV A;  2EIL B;  2Y48 A;  3K0D A;  3NXS A;  4Q20 A;  1KEC A;  4MVS A;  3OMA B;  3AG4 B;  5CMU A;  1S3J A;  2YEV B;  4UV8 A;  1FXK A;  3OM3 B;  5LBQ A;  1N8R W;  2WLN A;  3CMA V;  2CK3 G;  4FK5 C;  1WLE A;  4MVQ A;  5DN6 G;  1YJ9 V;  1ZWI C;  3AG3 B;  4TT3 G;  1SER A;  4QNH B;  5HFM A;  3D3I A;  4MTG A;  3CC7 V;  4XDL A;  5IYC O;  4WFH A;  3CC4 V;  2LFR A;  1MAB G;  5EBM C;  3E8B A;  3ZMT A;  1F4N A;  4KUM A;  3JD0 A;  3TET A;  3QO5 A;  2IH1 C;  2X6B A;  1WPX A;  1QR8 A;  4P30 A;  1NH2 B;  4BAY A;  1VQO V;  2B1G A;  4WFB V;  5CBF A;  3W7T A;  2HR3 A;  2R9R B;  2XAS A;  3ZRW A;  1SRY A;  4MW8 A;  5B1B C;  1E79 G;  2Q67 A;  3E83 A;  2B5U A;  4PA6 A;  5IY5 C;  3CCR V;  4N21 A;  3RVZ A;  2EZO A;  1JOY A;  2HKO A;  3G4S V;  1VQ9 V;  3R65 A;  4PDL A;  1GTO A;  1I5Y A;  3T4Z A;  1VQ7 V;  2OTL V;  1OCR C;  3X2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...