5E1AC

Structure of kcsa with l24c/r117c mutations
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
ACHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGCEQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Conformational heterogeneity in closed and open states of the KcsA potassium channel in lipid bicelles.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5e1aC00
4MVOA 3E8BA 3T4ZA 4R7CA 2Q67A 3SYCA 5EK0A 4LCUC 3SPJA 2EIMC 5EC2C 2DWDC 4WFHA 4JTDB 3E8FA 4H37A 4X89A 2X6CA 3T1CA 3SPGA 2Q68A 4G27B 2HVKC 3AG2C 2ZXWC 5BZBA 3LDEA 4P30A 2P7TC 4GX2A 3JYCA 5B3SC 1M57C 4PDLA 3LNMB 5CBHA 4PA6A 4X8AA 4GX0A 4JTAB 3ABKC 4H33A 4UUJC 3OR6C 4JTCB 1XL6A 3FB8C 2QKSA 3SPIA 3E86A 4WFFA 1JVMA 4PDVA 4X88A 3K0GA 3UKMA 5E1AC 4DXWA 4PDMA 2DYRC 4MW8A 4QE9A 2X6BA 4P9PA 2YEVA 4HZ3A 1LNQA 3ABLC 3E8HA 3K04A 3SPCA 2BOCC 2Y69C 2EIJC 3LDCA 4MVUA 4MVSA 3STLC 2QTOA 3ABMC 3TETA 1BL8A 3FB5C 3T4DA 1R3KC 5EBLC 4J9YB 4G28B 4XDLA 5J9PC 3LDDA 4MTGA 4RUEA 3FB6C 4J9ZB 3SJQC 3X2QC 3F7YC 3OUFA 3EFFK 3RVYA 4WFEA 2WLIA 3TCUA 2BOBC 4QNHB 2AHZA 4P9OA 5IY5C 1R3LC 2W0FC 3F5WC 2R9RB 4RAIA 1G4YB 3E8GA 3FB7C 4LP8A 1ZWIC 2DWEC 2IH3C 3AG4C 4MVRA 4PA3A 4MVZA 3RW0A 4EKWA 1K4DC 2Q69A 3RVZA 3K08A 2ITDC 4R50A 2Q6AA 4TWKA 3ZJZA 2A0LA 1XL4A 4ZBMA 3OR7C 5EBMC 3ASOC 3KG2A 2X6AA 4LBEC 3IGAC 4XDJA 2EIKC 2EILC 4RUFA 4GX5A 2EINC 1P7BA 3IFXA 1R3JC 3AG1C 2ZD9A 3BEHA 1V55C 4RO2A 1KKDA 5KUMA 5KUKA 4MTFA 4GX1A 3RBZA 4CBCA 1V54C 2HFEC 5CBFA 3UM7A 3ZRSA 2ATKC 3T2MA 4QE7A 3STZC 3AG3C 5B1AC 2WLJA 1K4CC 1OCZC 3E83A 3PJSK 5B1BC 3E89A 4MVMA 4R6ZA 3WG7C 2HG5C 4XDKA 3ASNC 5EC1C 3R65A 5CBGA 2DYSC 1OCRC 2OCCC 2WLLA 1OCCC 3SYQA 3OGCC 2NLJC 1QLEC 4MTOA 3SYOA 4I9WA 4WFGA 1J95A 2K1EA 4BW5A 3K03A 4PA4A 3GB7C 3SPHA 4KFMA 2AHYA 4MVQA 4PA7A 2A79B 2A9HA 2WLHA 3HPLC 3VOUA 2HJFC 1OCOC 2IH1C 2WLIB 2WLMA 4MSWC 2WLKA 3OUSA 2H8PC 2KB1A 2WLNA 2HVJC 5EBWC 4F4LA 4MW3A 4OXSA 4PDRA 2WLLB 1R3IC 2ITCC 4P2ZA 4HYOA 1S5HC 4MS2A 4PA9A 2JK5C 3LUTB 3SYAA 3K0DA 3F7VC 3K06A 4R8CA 1M56C 1ORQC 3SYPA
chains in the Genus database with same CATH superfamily
3T4ZA 5CA0A 4IHJA 2Q67A 4R7CA 1L1FA 1I5YA 4J41A 1YIJV 4LF9O 3LDEA 2HJDA 4GX2A 4EEQA 4LF8O 1M57C 1G1XB 3CHXA 1BCCH 1TUBB 4JASA 3SJBC 4JZ2A 2RQ6A 3H1KH 4G2KA 1N34O 2IJIA 3RYHB 1HW7A 1M90W 2Y69B 2DQ3A 3JARB 4X20B 3ZHUA 1FFXB 4P9PA 1FS0G 2BTQB 2IU0A 3R66A 4DR1O 3K04A 1CEZA 3I56V 3IC9A 3STLC 1VF7A 2QTOA 2QDOA 5L3BA 2QE7G 1BL8A 4TV9B 1LUWA 5CA0B 1VQ6V 1Q6UA 5AG2A 4EKWA 3B77A 3B40A 4XDJA 3ZEDA 3FYIB 2EIKC 5LGTA 3JAWB 3N2KA 2EILC 1Q43A 4U3FH 1MSDA 1K97A 2R72A 4EB6A 4B3SO 1Q6IA 4CBCA 3OW2U 2EZPA 4J7KA 4R6ZA 4LF6B 3AK1A 3A0HZ 1YCIA 4JV5O 3CPWU 4UVBA 4DV1O 5JCOA 4O2AA 3BA9A 3FD9A 2ETNA 2Y4TA 3SPHA 1S72V 1OV9A 3S3WA 4FFBA 1SQXH 3GVMA 3M7MX 4ZI7A 1O9HA 1WLEA 4B08A 3QO8A 1M56C 1Y67A 3N2KB 1P84F 1PM9A 3FX7A 1MSWD 3E8FA 4EB6B 5B3SB 4U7OA 3B4SA 5CA1A 5H2FZ 3LSSA 2XNDG 4BIUA 4DV5O 4B3SB 2Y4UA 2RMKB 2XT9A 1VQ9V 4O2AB 2DN9A 4YXWG 4J7ZA 1VQPV 2QWQB 3AEIA 4FFBB 2NNUA 5BR8O 4KUMA 4UXNA 4ZI7B 1E1QG 3WB0A 2ADPA 3UQ8A 2Y69C 2ZINA 2XAFA 3T4DA 1GMGA 4PV1B 4GZRB 3DTUB 2IJKA 3K5MA 3AG4B 4EFEA 3RYCA 3F5WC 5CA1B 1G8MA 2Z0AA 3O65A 5GTIZ 1BHBA 1QQCA 2XAQA 4RUFA 5L3DA 5LL6Y 4GX5A 1M93A 4ZIBA 4TT3G 1KKDA 2YIBA 3STZC 2WLJA 1YF2A 2F93B 3C3TA 1OZ0A 4K3AA 4BR6A 2ZQMA 1VQ5V 3HR0A 5BR8B 1UFIA 3JAMN 3S3XA 1GO3F 3MAQA 1VIBA 2CGOA 4PA4A 1DF5A 4YHHO 2IH1C 2KB1A 2OIGA 4JI2B 2K9PA 2JGDA 2Y48A 4HYOA 4IGGA 4MS2A 1PV0A 1NKDA 3F7VC 1TUEB 1ZL8B 4NB5A 2YSUB 2YI8A 4LFCO 1IBMO 2X0LA 3CCSV 3IJ4A 2ZT9B 1JFFA 2N04A 4JI4O 2R9IA 2ZM6B 4FK5C 1PP9H 1VQNV 1S5LZ 1RP3B 5B3SC 4PDLA 3SDLA 3ZMZA 1P49A 3RN4A 1HDJA 4FMTA 1EN6A 2WA3A 5JCOC 3E22A 5JH7A 4MW8A 3ABMB 5JVDA 1URFA 2JGDB 4YHHB 1AI5A 4X1YA 1SQFA 2ILMA 1ROPA 3THOA 3H9VA 1XMQB 1YI2V 1QVGU 1D5AA 1U97A 1FXKA 1AR1B 3ZCCA 2LP7A 3AG4C 1P7GA 2XTAA 3TXQA 4LFCB 1IBMB 1K4DC 1NH2D 3JATA 1GM7A 3OR7C 3ABUA 5FLXN 2ZKOA 2RN9A 1XI1A 1AR5A 3OE7G 1QR9A 5KUMA 3ASNB 3E22B 5JH7B 1OCRB 4DRXB 1OCCB 5JVDB 2QEXV 4ZKIA 2OTJV 2E3CA 4B3MB 2CTQA 1YSCA 2XASA 4KP4A 1U96A 4X1YB 4CH6A 3OEEG 2HP8A 3WFVA 2RDCA 5LGUA 2WLMA 4JI1O 4QGPA 2Q5ZA 1HR0O 4WF9V 1E79G 1YDXA 4JI3O 1YTFD 3HKCA 1JPXA 2XOKG 2QWNB 2CDYA 1N36O 3JATB 3K06A 4X1IA 5CB4A 3ETQA 3SYCA 3CX5F 2BCCH 4UCTA 2QWOB 2EZOA 2D2CB 2LFSA 4Q6GA 2HVKC 4AHCA 3N2GB 2ZIOA 3WU2Z 2IW5A 1XOUA 1FJGB 3ML0A 4GYCB 4ICGA 3RYFA 2NR5A 4AQYB 2HHHB 4DR3O 3ABLB 2UU9B 4JYAB 3ZN0A 2F66C 2WA4A 2EIJB 2DOSA 2UUAO 2X6BA 5IJ0A 1B3QA 3HKCB 1OHHG 4FJCC 3E8HA 3P30A 2B5UA 5LP6A 4MVSA 3ABMC 4X1IB 1KBHA 2CH7A 3U11A 1XEQA 5FPRA 5IY5B 3W7UA 1BS3A 3JD0A 5CB4B 3SJQC 2EJ7A 4WFEA 3ETEA 3L71H 2BOBC 4QNHB 5EYPA 2GTSA 4X65O 3FB7C 5IYBO 2ODMA 1JCHA 4JAVA 1S76D 2XAGA 2CTPA 1YITV 2EINB 3LSUA 2F43G 1GN6A 3RYFB 4YY3O 2Q7GA 1P7BA 3DC5A 1RM1B 3B09A 5KUKA 3JSNA 1EFRG 5IJ0B 5LMUO 5LP6B 3WG7C 3J80N 2EX3A 3K59A 4DR3B 3ASNC 1OCRC 3K5LA 1OCCC 4NXMB 4MTOA 2UUAB 1XILA 3JCZA 3AK2A 4FM1A 5KHJA 1AP6A 2QSAA 4GUNA 1EN5A 5F2VO 3WB1A 5EYPB 4DV0O 1KKCA 2H8PC 1R6NA 2QKAA 5JJJB 4MW3A 4OXSA 1FXKC 3PN1A 1S5HC 4D7TA 2W6JG 4R8CA 3IC7A 2JDIG 4MVOA 4X65B 1XHZA 5LA6A 1PPJH 1BHAA 2ZXWB 5EC2C 4CH5A 5IYCO 3QNEA 4DR6O 5ITZA 3KCXA 4NTYA 2UXNA 1IDSA 1SS3A 1SQGA 1CP9A 4DW0A 4DV2O 5GW7A 4CC6A 1KUQA 3CRQA 4JI5O 5LMUB 3VQVA 4EFBA 1WB7A 1FD9A 2UUCB 2IJJA 2JS5A 2ZIMA 1SRYA 4B3TO 4OPHA 3ABLC 3CCVV 1UPGA 2BOCC 5D5QA 2EJRA 4JI7O 2EIJC 1JX9A 1AP5A 3ZHQA 1Q3EA 5IYZA 5EBLC 4MTGA 5LA6B 3RVYA 3JSLA 5IY5C 5ITZB 1S77D 3CSXA 3CEIA 3P3NA 4E4EA 1AJNA 1YJWV 2HEPA 2IJHA 5FNVA 4MVZA 3ZRWB 2CE4A 4X1KA 5LHIA 3HB3B 4B7KA 4DR6B 5EBMC 5KA6A 2VRZA 1GM9A 4JAUA 1VEWA 2EINC 1QNMA 2QKCA 4UCOA 4DV2B 2LQTA 2UXBB 5B1BC 4JI5B 2KQXA 1RM1C 1TGOA 1HNXB 3SR2C 4WCEV 4IL6Z 2HG5C 4CZZA 3EHBB 3JASA 4DR5B 5IYZB 3SYOA 5LP6C 1NTZH 1K5QA 4DV4B 1XNQO 2PUSA 4JI7B 4JI6B 3ZMSA 4W4LA 2WLLB 3OEHG 1DGSA 4PA9A 1A32A 1KP3A 4X1KB 3K5OA 3E8BA 3AG2B 1WP7A 2OYQA 1VARA 2QM7A 1YZBA 3W7XA 3X2QB 2CTRA 2ZXWC 4RQFA 1I7FA 1GM8A 4IYIA 1WN7A 4LNUA 2BTQA 4UCUA 3JASB 1LUVA 4GX0A 4JYYA 2GBOA 5H6QA 1ZUQA 4DW1A 3WB2A 1WNSA 1YEWA 2HLDG 5KHGA 5KAFZ 3SPIA 3EVKA 1H8EG 1KP2A 5BMVA 2AZ2A 1LNQA 1XNQB 1ZTEA 2HKOA 3LDCA 4QJFB 1THZA 1H38A 3ETDA 3DSQA 2N05A 3OUFA 1Y74A 5IYDO 4DUYB 2QM8A 3JAWA 4K35A 3CMEV 5IJ9B 3E8GA 4LF6O 3VQYA 1AR4A 5KHHA 4LH6A 1GN3A 2OIEA 1Y66A 4L87A 4LNUB 1NJIW 1KYOF 3BA8A 5DN6G 2DE0X 2UXCO 1K8AW 4B3RB 2F4VB 4DK1A 2B1IA 2YIAA 3G67A 1IXBA 5BMVB 2PF4E 1QLEB 3PJSK 3SGIA 4BAYA 1IVSA 4DV6B 4JGSA 4BW5A 4WFAV 2AHYA 1Y74B 1Q82W 2R9AA 2EULA 2WLNA 4PDRA 3D8CA 3GWOA 2LFRA 3D36A 1S3JA 1N0JA 1BQ0A 5C93A 2ARHA 1UJWB 2LGWA 4YIOA 2QM4A 2YXLA 3QTCA 4H37A 2Q68A 3HKDB 2UXCB 3AG2C 1F23A 2Z5UA 2KSDA 2P7TC 4PJ0Z 5DEDA 2V4DA 2E5LO 2KG7A 3E2EA 2VQEO 2ZNJA 3KCYA 1AB3A 4J42A 2ADQB 3KZIZ 5CA3A 4J7JA 2DYRC 2JRIA 4UVCA 4FLWA 3K9AA 5KHIA 2C2AA 1PNLA 2ZCEA 1K7DA 4I4TA 3ZMTA 5LYJB 5H5NA 1W0KG 4LP8A 1QU7A 2VWJA 1CPYA 3ZJZA 2DW4A 3Q4HB 4AILC 2KG7B 3KG2A 4PD4F 4GCZA 1VF6A 4FIPC 3K58A 1SZTA 1R73A 2Q8VA 2E5LB 4JI2O 1PL4A 2VQEB 1AJPA 5LXTA 2AZ0A 5CBFA 2EIMB 3FAVA 4WBNA 3ZMVA 1MG1A 3G6EV 1MMMA 4LFBO 4N21A 2OWOA 5CBGA 5GONA 3ZIAG 1QLEC 3GB7C 2CAZC 3K3WA 4I4TB 3ABKB 1ZL8A 2Q7EA 2ZM6O 5JWPA 4DV7O 1R1BA 1IBLO 2JEXA 4XBFA 2JJ1G 1H2GA 3K0DA 1DF4A 2V7QG 4CS3A 2Q0AA 1NQTA 3BFRA 4BIOA 2DWDC 5A2QN 1EN4A 1M1KW 5LXTB 2ZE6A 3FAVB 4WBNB 1NTMH 3D3QA 5LHGA 2XHBA 4JF3A 1NR7A 2YIBD 1NVPB 4X8AA 5GONB 4CS2A 1XMQO 4X64O 4UCVA 4JI8O 2UXDO 3J81N 3QG5A 4LFBB 1PKXA 4U3JA 1HNZB 1FXVA 5J2UA 3UKMA 3AK3A 4J11A 1K5SA 4NTWA 1KQSU 3SPCA 1SC5B 3A2FA 5H6RA 2R70A 1Z2GA 4DV7B 3D36C 2PI5A 1M4UA 5J9PC 1IBLB 5EZYA 1H2MA 2MW2B 2Y0PA 2FL4A 1Q86W 2RNBA 2W0XA 2R9RB 3H1IH 4B3MO 4UCSA 3L74H 3JAKB 1IBKB 4PA3A 4DYLA 5IDJA 4RQEA 1GRJA 5KAIZ 2ITDC 4HNAA 3RFRA 4DRXA 1EZVH 4DO2A 4LBEC 3JD3A 5E79Z 3CB2A 2VQFB 1R6KA 2H3OA 1YJ9V 3AG3B 3UCSC 2ZD9A 4U3JB 3G80A 5J2UB 4GLXA 4X64B 3CWBH 4OX9O 4JI8B 3L70H 4AI8A 4F6RA 1X59A 2FB5A 4LF5B 2UXDB 1P4RA 1QR8A 4ZOLB 2B1GA 4I9WA 4HBNA 2Z3YA 5EZYB 4O2BA 2A79B 2N74A 5HFMA 1XNRB 5LHHA 5B1NA 1JA8A 1KMIZ 1FJGO 4HNAB 4NXNO 3N2GA 4AQYO 2HHHO 4BIZA 2UU9O 3OTOB 2PYJA 4JYAO 4FVMA 4H13B 1H2LA 1GN4A 3OD4A 1HNWO 1VF6C 3CC4V 1I0HA 1EBOA 2WPDG 4F6RB 1NI8A 3P32A 3LNMB 1YHQV 1NZ6A 1QHTA 3ZHVA 4OX9B 1WA8A 4JTCB 1VQ8V 1XDCA 4O2BB 1JVMA 3K0GA 3CCRV 4LC1A 1F7YA 1LR1A 1NBMG 1I5XA 3L75H 1OJHA 2LW1A 3ZHTA 4XDLA 4CS4A 1KC8W 4NXNB 1JMKC 3QO5A 4JI0B 1PL0A 1ZWIC 3RW0A 1T5EA 3RWRD 2YICA 3APQA 5K1XA 4NXMO 2A0LA 4LWSA 1HNWB 4GKJO 3MD0A 1V55B 2OCHA 2P67A 1NU1H 1BGYH 1WA8B 3CCEV 2KKWA 1WPBA 3CYOA 3UO3A 4UB8Z 3T2MA 3AG3C 3E83A 2YDEA 2CGNA 3FYEB 3SYQA 3OGCC 3BRCA 3VBBA 2K1EA 2AXTZ 3K03A 5LGNA 4MVQA 1BT8A 4RWUA 2WLKA 2ZR2A 4F4LA 2XUMA 1N33O 2LW7A 3BVOA 1GKFA 4CH3A 5CMUA 3DC6A 3H1JH 4LWSB 3OMAB 4YJ3B 3I5DA 2UUCO 4FLXA 2WWWA 2BSKA 3TGUH 5B5EZ 4GKJB 2IBZH 1AJQA 1VP7A 1COWG 1S0VA 1K33A 1N0NA 2QTSA 1BSMA 4UB6Z 4O4JA 2YC0A 3CJHB 4JZGA 1TVKB 4JTAB 4Q20A 3FB8C 3HKEA 3CCJV 4WFFA 1GH6A 3LSQA 4H44B 3OM3B 4DR2O 2HR3A 5L3FA 4TUYB 2JJ2G 3H1HH 4TSFG 2D3OW 4I9QA 3JD2A 3OTFA 3ZRWA 3UT5A 1N33B 3LDDA 4RUEA 3FB6C 4J9ZB 3OMNB 1VQOV 2BSKB 3CC7V 2UXBO 4RAIA 1G4YB 1HNXO 2PY5A 3ASOB 5IE9A 4MVRA 2OTLV 3JD1A 3A0BZ 4Z2WA 3K08A 4DR5O 2PGGA 4O4JB 4DV4O 3IGAC 3LNNA 4JI6O 3HKEB 2A7WA 1V55C 2FMLA 2CUGA 3EXAA 2OCCB 2GHYA 2GTAA 3U0ZA 4E2LA 2F1MA 1PD3A 1Z5WA 2IU3A 2Q7HA 2WLLA 1H2NA 4X62B 4D6TH 3UT5B 4DR2B 2BTOA 1Q81W 4NTXA 3HKBA 1J5EB 1XMOB 2HVJC 1I08A 4N23A 3APOA 1ENVA 3H1LH 3T1HB 3LUTB 2FTKA 3D3IA 2W6IG 1K73W 3SYPA 5L3EA 1SERA 1RPRA 4WFHA 3P3PA 2X6CA 2A3QA 5LMNO 4CC5A 3BABA 5DECA 1VQ7V 5CBHA 4PA6A 4OGQB 2Q73A 1B6QA 1W59A 1K9MW 1F4NA 3OR6C 3TXSA 4DUYO 5JJNB 4UCRA 1Z5VA 1QCEA 3HKBB 2EILB 5GTHZ 4PDMA 5KX5A 4TQFA 2CTWA 1BMFG 1FXHA 2XAHA 5IJ9A 2B9ZA 4I55B 3TETA 3ZRVA 4B3RO 1SA0A 2F4VO 3B2EE 3C90A 4IIJA 3CRRA 3E35A 1FFTB 4FM0A 4TOIA 3M99B 4GKKB 2JGUA 4I50A 2DWEC 3ZX6A 4DV6O 1JJ2U 2Y0IA 1ZX3A 2Q6AA 1V9PA 4ZBMA 5KLVH 3ASOC 1YXBA 4LF4B 4ASUG 5TISZ 5LMNB 1PNMA 1F51A 1KU9A 2P5OA 4DK0A 2HFEC 5KX5B 3E89A 4MVMA 3K57A 5EC1C 2L35A 2OCCC 3CRMA 2GSMB 1MA1A 1SA0B 2NLJC 3TJTA 4IIJB 2GUZA 3ZRXA 1JQ0A 1Q8IA 2F95B 1SQQH 2A9HA 2LJ2A 1D5NA 3OGIB 1Y6XA 4X9QA 1PNKA 2AW9A 1MNGA 1FYJA 2ZDIA 4I50B 4UVAA 1YJNV 1TA8A 3HKDA 4O4IA 1WAZA 5KHKA 1L0NH 4TQDA 3SPJA 2MK3A 2NN4A 4O4HB 1AVMA 4PELA 3QF7A 4LFAB 3VQXA 5EIBC 3UO2A 3OMIB 1I94O 2V1DA 4IHJB 1TAEA 2YUAA 4H33A 1VQLV 2XAJA 2GUZB 1NS1A 3RYIA 1L0LH 4Z1VA 1US6A 3E86A 4PDVA 4QE9A 2WAMA 3J7AU 5LYJA 4J80A 4LF9B 4LF8B 3FB5C 4O4IB 4J9YB 3NXSA 1DK1A 3X2QC 3Q4HA 1N34B 4LR3A 2LGQA 2WLIA 2AHZA 4P9OA 2W0FC 2CK3G 3K9SA 5JJEB 1GAXA 3CXHF 4DR1B 3DXRA 3OFNG 3AG1B 1B04A 1AI4A 3RYIB 5B1AB 2QJ1A 1I94B 1OCZB 2AGAA 1HP8A 1XQ8A 2G38A 2FYUH 1M9NA 2Q4PA 4QE7A 1K4CC 1M5IA 1YVWA 1VQKV 4PI2A 5BXZA 2YXYA 4K0KO 4I5SA 5LBQA 2BE3A 3MDSA 2Q9LA 4KFMA 2RCVA 3VOUA 1D2DA 5C8YA 2WLIB 4FLVA 3A8TA 3O9OA 4DUZO 5EBWC 1R3IC 2ITCC 4P2ZA 1SKVA 4FZ0A 3ZHRA 1K92A 3L72H 3DXRB 3FKSG 4L8JA 4JV5B 3SJCC 3SJAC 4DV1B 1HNZO 1QBZA 5IT9N 1KB9F 5FPOA 4JTDB 3SPGA 2JS3A 2GV9A 4DV3O 5KMGA 4CH4A 3RT3C 3CMAV 3L9DA 4QIWF 4UUJC 3FFQA 1SQVH 3I55V 1NVPD 3ZS8C 5C8YB 5HFLA 3JCUZ 3ICXA 1IBKO 4D7SA 4DXWA 4K0KB 4U7NA 1QVFU 2YEVA 1VQ4V 2P90A 2P4KA 2YI9A 1N4CA 1SF9A 3OT7A 1WPXA 3JAKA 2ZDIC 1R3KC 4DUZB 2VQFO 1N32O 4DV5B 4QPKA 2JVDA 1L8DA 2ZR3A 2PI4A 3W7WA 4W4KA 5KA5A 4KL1A 1W2BU 4LF5O 1BQZA 2FKXA 4PHZA 5KMGB 3RVZA 4R50A 1H2KA 1EM1A 3CP1A 3T1YO 1ZLZA 3RYCB 4DV3B 4YJ2A 2YIDA 5LOVA 1XNRO 2ZE7A 4FLTA 3IFXA 4UV8A 3AG1C 4ZOLA 2A06H 3ZRSA 2YEVB 3H01A 5B1AC 1OCZC 4K8ZA 2M6YA 3OTOO 2P06A 4GT1A 3BHPA 4JYBA 1NT2B 3KKYA 1J95A 4JAAA 4OPAA 4DR7O 1SESA 3CS5A 2WLHA 2F23A 2HJFC 4MSWC 4IYHA 1N32B 4FLUA 5FL7G 1CXZB 1JOYA 3ZN1A 2E75B 4YJ2B 5LOVB 5EK0A 2EIMC 3MHHC 3T1YB 3CCQV 1XREA 1GTOA 3ABKC 4Z1MG 2QGNA 1JFFB 2O57A 4BWAA 2QKSA 3ZBHA 4JI0O 2P6JA 4X88A 1W0JG 1N8RW 4HZ3A 4DR7B 4JI4B 2L6LA 1VMGA 3W7TA 1IX9A 3RGBA 3B8MA 4G28B 3WG7B 3DGEA 4FFKA 2JEUA 3TCUA 1Q7YW 1H2SB 1NH2B 1R3LC 4KXRA 3K5NA 2IH3C 1G6UA 1HWYA 1H8HG 1RSOA 1WP8A 4FM2A 1FXKB 1IZ3A 3BEHA 5L3GA 1SZXA 3AG7A 4GX1A 3CCLV 2DYSB 2ATKC 4FLZA 1Y76A 2UUBO 3G4SV 1FAFA 3R65A 2UXXA 3QO7A 1ZAUA 1OCOB 1NR1A 3GWKC 1YTFB 3CCMV 3CRAA 1MOFA 2DQ0A 4PA7A 4YJ3A 3N27A 4HAMA 1DTOA 1ZSPA 1RSOB 1ORQC 4UFZA 3JALA 1BZKA 1R6TA 3CJHA 4LCUC 4X66O 1Q5OA 1TVKA 1NTKH 2E76B 1VF5B 4I7ZB 1Q90D 2RJZA 3BY6A 3T1CA 3ZMUA 4JI1B 4B7EA 1HR0B 5BZBA 4O4LA 5IWAO 4I0XA 1Y76B 4JI3B 4DR4O 5H9CA 3CE2A 1KECA 3G71V 5D5PA 1N36B 4TUYA 1IURA 2UUBB 1XL6A 3K79A 4NVPA 4JYCA 4A5UB 3B8NA 5JQGA 4IT5A 5K1PA 2EBOA 3A0RA 4MVUA 4NKGB 5B1BB 3JALB 1GN2A 2IM9A 3ETGA 4KHPO 4UV9A 1K3EA 5B66Z 2LO1A 2ZNIA 3F7YC 1FKAO 4WFBV 2GDSA 1MABG 2VS0A 1Q6HA 1GK9A 1SETA 2OT5A 2M7WA 4FZ1A 3G6BA 4O4LB 4I0XB 2CH7B 3L73H 4X66B 2Q69A 3BPZA 4X62O 4TWKA 2P22C 1XL4A 1AROP 2X6AA 5IWAB 1V54B 1J5EO 4DR4B 4C7UA 5J2TA 2PTMA 4FPPA 4RO2A 1XMOO 1K34A 4JPRA 4MTFA 2DMXA 5CN0A 2YXHA 5JQGB 3ZHSA 3T1HO 2ZE5A 3CXCU 1E1RG 1AI7A 4XDKA 2Q0OC 2DYSC 1DLBA 3BAAA 3TK1A 4WFGA 4YIPA 3U10A 3C3SA 4YY3B 1OCOC 2YS8A 2H94A 1XUQA 1SQBH 4LF7O 1BE3H 4KHPB 2JIZG 3ABTA 4ABMA 2VWKA 1JJOA 1WB8A 1FPOA 2PZSA 4ZHQA 5J2TB 1IXMA 1SQPH 3M8AA 5B1OA 4X89A 1M57B 1S5JA 4G27B 4DV0B 1EZJA 4P30A 3JYCA 5EIBD 1XHXA 4NYKA 4BW9A 5L3CA 1B06A 1JR9A 5DM6V 2QR4A 4I55A 4PI0A 4TV8A 4GKKO 5E1AC 3OAAG 1Y4MA 3QVNA 5BY1A 2X7RB 4LF4O 1RFYA 3MHSC 1O9GA 4ZHQB 1F4MA 1RPOA 1X4TA 1AILA 3F5TA 4MTXA 3CRCA 4LF7B 2QWRB 3EFFK 3W7SA 1MZFA 3VQWA 4J10A 2EIKB 4B3TB 1MZEA 3NR7A 4LH7A 1KD1W 1WJZA 1VQMV 2PYLA 1R3JC 4K8XA 4TV8B 2ZE8A 5FNVB 4FLYA 3RBZA 1V54C 3UM7A 2DJVA 1QLNA 4QPJA 1TUBA 2WSSG 4NR1A 3JD4A 3CCUV 3CD6V 3BCCH 1XBLA 4H0LB 3HPLC 4F6EA 2P4VA 3RYHA 3OUSA 4LFAO 3JARA 4X20A 2QA4V 1FFXA 1M56B 1AI6A 5A9GA 3IAYA 2JK5C 2QWPB 4O4HA 3SYAA 4MT8A 3CC2V 2DYRB 2E74B 4TV9A
chains in the Genus database with same CATH topology
3IC7A 2JDIG 3FKSG 4MVOA 4BIZA 3T4ZA 4R7CA 2Q67A 1L1FA 1BHAA 1I5YA 2ZXWB 1QBZA 5EC2C 5IYCO 4JTDB 3QNEA 1YIJV 3SPGA 3CC4V 2UXNA 1EBOA 2WPDG 3LDEA 4GX2A 1M57C 3P32A 3LNMB 1CP9A 1YHQV 5GW7A 3CMAV 4JASA 4G2KA 4QIWF 4UUJC 4JTCB 1VQ8V 3I55V 1NVPD 5HFLA 2IJIA 2IJJA 1JVMA 1M90W 1SRYA 3K0GA 3CCRV 4LC1A 2Y69B 4DXWA 2DQ3A 4P9PA 4U7NA 1FS0G 2YEVA 2IU0A 1VQ4V 1QVFU 1NBMG 3ABLC 1CEZA 3K04A 1I5XA 3CCVV 2P90A 3I56V 2BOCC 2EJRA 3STLC 2EIJC 1JX9A 2QTOA 1WPXA 5L3BA 2QE7G 1BL8A 2ZDIC 1R3KC 5EBLC 4XDLA 1KC8W 4MTGA 4QPKA 2ZR3A 3RVYA 1VQ6V 2PI4A 3W7WA 5IY5C 5KA5A 3QO5A 1W2BU 1S77D 1AJNA 1PL0A 1YJWV 2IJHA 1ZWIC 4EKWA 3RW0A 4MVZA 3ZRWB 3RVZA 4R50A 5LHIA 2A0LA 3HB3B 3MD0A 5EBMC 3B77A 5KA6A 1V55B 3CP1A 4XDJA 2P67A 1GM9A 2EIKC 3FYIB 5LGTA 4JAUA 2EILC 3CCEV 2EINC 3CYOA 3IFXA 4UV8A 3AG1C 1K97A 3OW2U 4CBCA 3ZRSA 2EZPA 2YEVB 3H01A 3T2MA 3AG3C 5B1AC 3E83A 5B1BC 1OCZC 1RM1C 4R6ZA 4WCEV 2HG5C 4CZZA 3FYEB 3EHBB 4GT1A 4JYBA 3OGCC 4UVBA 3SYQA 3CPWU 3SYOA 3VBBA 1J95A 1K5QA 2K1EA 3K03A 5LGNA 3SPHA 4MVQA 1SESA 1S72V 2WLHA 3ZMSA 2HJFC 4MSWC 2WLKA 2ZR2A 4F4LA 2WLLB 3OEHG 5FL7G 1GKFA 4PA9A 1JOYA 1WLEA 5CMUA 3QO8A 1KP3A 3ZN1A 1M56C 3OMAB 3E8BA 3AG2B 5EK0A 2EIMC 2WWWA 1MSWD 2QM7A 3E8FA 3MHHC 3W7XA 5B3SB 4U7OA 1AJQA 3X2QB 3CCQV 1COWG 2ZXWC 4RQFA 1S0VA 1K33A 3LSSA 2XNDG 1GM8A 1GTOA 4BIUA 4GX0A 4JTAB 3ABKC 4Z1MG 1VQ9V 5H6QA 4Q20A 2HLDG 4YXWG 1VQPV 3FB8C 2QKSA 3AEIA 3SPIA 3CCJV 2NNUA 4WFFA 1H8EG 2P6JA 4X88A 3LSQA 1KP2A 1W0JG 1N8RW 4KUMA 4UXNA 4HZ3A 1LNQA 3OM3B 2HR3A 1E1QG 5L3FA 2HKOA 2JJ2G 2Y69C 3LDCA 4QJFB 3W7TA 4TSFG 2D3OW 2XAFA 3JD2A 3T4DA 1GMGA 1THZA 1H38A 3B8MA 3DTUB 4G28B 3WG7B 3ZRWA 3LDDA 3ETDA 2IJKA 3DGEA 3FB6C 4J9ZB 3OMNB 4RUEA 3OUFA 5IYDO 2JEUA 3AG4B 1VQOV 3TCUA 2QM8A 3CC7V 1Q7YW 1NH2B 1R3LC 3CMEV 3F5WC 4RAIA 1G4YB 3E8GA 3ASOB 2IH3C 4MVRA 2OTLV 1G8MA 3JD1A 1HWYA 1H8HG 3K08A 1Y66A 4L87A 1NJIW 1FXKB 5DN6G 3IGAC 1K8AW 1BHBA 2XAQA 4RUFA 5L3DA 4GX5A 2B1IA 3BEHA 1V55C 4TT3G 1KKDA 5L3GA 4GX1A 3CCLV 2DYSB 2OCCB 2GHYA 2ATKC 3STZC 2WLJA 1QLEB 3PJSK 4E2LA 3G4SV 1PD3A 4BAYA 3R65A 1OZ0A 2IU3A 2UXXA 3QO7A 2WLLA 4JGSA 2ZQMA 1VQ5V 1OCOB 1NR1A 1GO3F 4BW5A 4WFAV 4PA4A 1DF5A 1YTFB 3CCMV 2AHYA 1MOFA 2DQ0A 4PA7A 1Q81W 2IH1C 1Q82W 2KB1A 2WLNA 2HVJC 4N23A 4PDRA 1ENVA 3GWOA 2LFRA 2Y48A 3D36A 4HYOA 4HAMA 4MS2A 3LUTB 1DTOA 2FTKA 1NKDA 3D3IA 2W6IG 3F7VC 1K73W 1TUEB 1S3JA 1ORQC 3SYPA 5C93A 5L3EA 1UJWB 1SERA 2YSUB 1RPRA 4LCUC 2X0LA 3CCSV 4WFHA 4H37A 2X6CA 3T1CA 3BY6A 2Q68A 3ZMUA 3AG2C 1F23A 2R9IA 2Z5UA 4FK5C 5BZBA 1VQNV 2P7TC 5B3SC 5H9CA 1VQ7V 4PDLA 5CBHA 1KECA 4PA6A 3ZMZA 3G71V 3E2EA 1B6QA 1K9MW 1F4NA 3OR6C 4FMTA 1XL6A 3K79A 4JYCA 1QCEA 5CA3A 2EILB 3B8NA 4PDMA 2DYRC 4MW8A 3ABMB 4UVCA 1BMFG 1FXHA 2EBOA 3A0RA 2XAHA 4MVUA 1AI5A 3K9AA 3TETA 3ZRVA 5B1BB 2C2AA 1ROPA 3ETGA 3E35A 1PNLA 4UV9A 1K3EA 1FFTB 1YI2V 1QVGU 3F7YC 1K7DA 4WFBV 1FXKA 3ZMTA 1AR1B 1MABG 1GK9A 1SETA 3ZCCA 3M99B 2LP7A 2OT5A 1W0KG 2M7WA 4LP8A 3AG4C 2DWEC 1K4DC 2Q69A 1JJ2U 1CPYA 1NH2D 3ZJZA 4TWKA 2Q6AA 4ZBMA 1GM7A 1XL4A 2DW4A 1AROP 3OR7C 3ASOC 3KG2A 2X6AA 3ABUA 4GCZA 4ASUG 1V54B 4FIPC 1PNMA 1SZTA 4FPPA 1R73A 4RO2A 3OE7G 1QR9A 5KUMA 1K34A 1F51A 4JPRA 4MTFA 3ASNB 1AJPA 1OCRB 2HFEC 2EIMB 1OCCB 5CN0A 5CBFA 2QEXV 3ZMVA 4ZKIA 3CXCU 1E1RG 1AI7A 1MG1A 3E89A 4MVMA 3G6EV 2OTJV 4XDKA 4N21A 5EC1C 5CBGA 2DYSC 3ZIAG 2OCCC 2GSMB 1YSCA 2XASA 4KP4A 2NLJC 1QLEC 1DLBA 3OEEG 3TK1A 4WFGA 3ZRXA 1JQ0A 3GB7C 3WFVA 5LGUA 2A9HA 3K3WA 3ABKB 1OCOC 2WLMA 1PNKA 2H94A 4WF9V 1E79G 1YTFD 2ZDIA 2JIZG 1JPXA 2XOKG 2JEXA 3ABTA 4UVAA 4XBFA 1YJNV 2JJ1G 1H2GA 3K0DA 1DF4A 3K06A 2V7QG 1NQTA 3SYCA 3SPJA 1IXMA 2DWDC 5B1OA 2MK3A 4X89A 1M1KW 1M57B 2EZOA 2LFSA 4G27B 2HVKC 1EZJA 4P30A 4PELA 5LHGA 3JYCA 3OMIB 4JF3A 1NR7A 2V1DA 1NVPB 4X8AA 2IW5A 5L3CA 3ML0A 4H33A 5DM6V 1VQLV 2XAJA 3ABLB 1PKXA 3ZN0A 3E86A 1FXVA 4PDVA 3UKMA 5E1AC 2EIJB 3OAAG 4QE9A 2WAMA 2X6BA 1K5SA 1KQSU 4FJCC 1OHHG 1Y4MA 3E8HA 3P30A 2B5UA 3SPCA 2X7RB 4MVSA 3ABMC 3FB5C 3MHSC 5H6RA 4J9YB 1F4MA 1RPOA 4MTXA 3NXSA 5IY5B 3W7UA 3JD0A 5J9PC 2PI5A 3SJQC 3X2QC 3EFFK 4WFEA 3ETEA 2WLIA 2BOBC 4QNHB 2AHZA 1Q86W 4P9OA 2W0FC 2CK3G 2R9RB 3FB7C 3W7SA 5IYBO 1JCHA 4PA3A 2EIKB 4JAVA 5IDJA 4RQEA 1S76D 2ITDC 2XAGA 1YITV 2EINB 3OFNG 3AG1B 4DO2A 4LBEC 3JD3A 2F43G 1KD1W 1AI4A 1VQMV 1R6KA 1P7BA 1YJ9V 3AG3B 1R3JC 5B1AB 2ZD9A 1OCZB 1RM1B 5KUKA 3RBZA 1V54C 1M9NA 3UM7A 1EFRG 4QE7A 1K4CC 1VQKV 3WG7C 1P4RA 3ASNC 1OCRC 1QR8A 1QLNA 1OCCC 4QPJA 2WSSG 4MTOA 4I5SA 5LBQA 2B1GA 3JCZA 4I9WA 3JD4A 2Z3YA 3CCUV 3CD6V 4KFMA 3VOUA 2A79B 3HPLC 5HFMA 2WLIB 3OUSA 2H8PC 1R6NA 5LHHA 5EBWC 2QA4V 4MW3A 1M56B 4OXSA 1AI6A 5B1NA 1R3IC 1FXKC 2ITCC 4P2ZA 1S5HC 2JK5C 3SYAA 4MT8A 3CC2V 2DYRB 1K92A 2W6JG 4R8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVO A;  3E8B A;  3T4Z A;  4R7C A;  2Q67 A;  3SYC A;  5EK0 A;  4LCU C;  3SPJ A;  2EIM C;  5EC2 C;  2DWD C;  4WFH A;  4JTD B;  3E8F A;  4H37 A;  4X89 A;  2X6C A;  3T1C A;  3SPG A;  2Q68 A;  4G27 B;  2HVK C;  3AG2 C;  2ZXW C;  5BZB A;  3LDE A;  4P30 A;  2P7T C;  4GX2 A;  3JYC A;  5B3S C;  1M57 C;  4PDL A;  3LNM B;  5CBH A;  4PA6 A;  4X8A A;  4GX0 A;  4JTA B;  3ABK C;  4H33 A;  4UUJ C;  3OR6 C;  4JTC B;  1XL6 A;  3FB8 C;  2QKS A;  3SPI A;  3E86 A;  4WFF A;  1JVM A;  4PDV A;  4X88 A;  3K0G A;  3UKM A;  5E1A C;  4DXW A;  4PDM A;  2DYR C;  4MW8 A;  4QE9 A;  2X6B A;  4P9P A;  2YEV A;  4HZ3 A;  1LNQ A;  3ABL C;  3E8H A;  3K04 A;  3SPC A;  2BOC C;  2Y69 C;  2EIJ C;  3LDC A;  4MVU A;  4MVS A;  3STL C;  2QTO A;  3ABM C;  3TET A;  1BL8 A;  3FB5 C;  3T4D A;  1R3K C;  5EBL C;  4J9Y B;  4G28 B;  4XDL A;  5J9P C;  3LDD A;  4MTG A;  4RUE A;  3FB6 C;  4J9Z B;  3SJQ C;  3X2Q C;  3F7Y C;  3OUF A;  3EFF K;  3RVY A;  4WFE A;  2WLI A;  3TCU A;  2BOB C;  4QNH B;  2AHZ A;  4P9O A;  5IY5 C;  1R3L C;  2W0F C;  3F5W C;  2R9R B;  4RAI A;  1G4Y B;  3E8G A;  3FB7 C;  4LP8 A;  1ZWI C;  2DWE C;  2IH3 C;  3AG4 C;  4MVR A;  4PA3 A;  4MVZ A;  3RW0 A;  4EKW A;  1K4D C;  2Q69 A;  3RVZ A;  3K08 A;  2ITD C;  4R50 A;  2Q6A A;  4TWK A;  3ZJZ A;  2A0L A;  1XL4 A;  4ZBM A;  3OR7 C;  5EBM C;  3ASO C;  3KG2 A;  2X6A A;  4LBE C;  3IGA C;  4XDJ A;  2EIK C;  2EIL C;  4RUF A;  4GX5 A;  2EIN C;  1P7B A;  3IFX A;  1R3J C;  3AG1 C;  2ZD9 A;  3BEH A;  1V55 C;  4RO2 A;  1KKD A;  5KUM A;  5KUK A;  4MTF A;  4GX1 A;  3RBZ A;  4CBC A;  1V54 C;  2HFE C;  5CBF A;  3UM7 A;  3ZRS A;  2ATK C;  3T2M A;  4QE7 A;  3STZ C;  3AG3 C;  5B1A C;  2WLJ A;  1K4C C;  1OCZ C;  3E83 A;  3PJS K;  5B1B C;  3E89 A;  4MVM A;  4R6Z A;  3WG7 C;  2HG5 C;  4XDK A;  3ASN C;  5EC1 C;  3R65 A;  5CBG A;  2DYS C;  1OCR C;  2OCC C;  2WLL A;  1OCC C;  3SYQ A;  3OGC C;  2NLJ C;  1QLE C;  4MTO A;  3SYO A;  4I9W A;  4WFG A;  1J95 A;  2K1E A;  4BW5 A;  3K03 A;  4PA4 A;  3GB7 C;  3SPH A;  4KFM A;  2AHY A;  4MVQ A;  4PA7 A;  2A79 B;  2A9H A;  2WLH A;  3HPL C;  3VOU A;  2HJF C;  1OCO C;  2IH1 C;  2WLI B;  2WLM A;  4MSW C;  2WLK A;  3OUS A;  2H8P C;  2KB1 A;  2WLN A;  2HVJ C;  5EBW C;  4F4L A;  4MW3 A;  4OXS A;  4PDR A;  2WLL B;  1R3I C;  2ITC C;  4P2Z A;  4HYO A;  1S5H C;  4MS2 A;  4PA9 A;  2JK5 C;  3LUT B;  3SYA A;  3K0D A;  3F7V C;  3K06 A;  4R8C A;  1M56 C;  1ORQ C;  3SYP A; 
#chains in the Genus database with same CATH topology
 3T4Z A;  5CA0 A;  4IHJ A;  2Q67 A;  4R7C A;  1L1F A;  1I5Y A;  4J41 A;  1YIJ V;  4LF9 O;  3LDE A;  2HJD A;  4GX2 A;  4EEQ A;  4LF8 O;  1M57 C;  1G1X B;  3CHX A;  1BCC H;  1TUB B;  4JAS A;  3SJB C;  4JZ2 A;  2RQ6 A;  3H1K H;  4G2K A;  1N34 O;  2IJI A;  3RYH B;  1HW7 A;  1M90 W;  2Y69 B;  2DQ3 A;  3JAR B;  4X20 B;  3ZHU A;  1FFX B;  4P9P A;  1FS0 G;  2BTQ B;  2IU0 A;  3R66 A;  4DR1 O;  3K04 A;  1CEZ A;  3I56 V;  3IC9 A;  3STL C;  1VF7 A;  2QTO A;  2QDO A;  5L3B A;  2QE7 G;  1BL8 A;  4TV9 B;  1LUW A;  5CA0 B;  1VQ6 V;  1Q6U A;  5AG2 A;  4EKW A;  3B77 A;  3B40 A;  4XDJ A;  3ZED A;  3FYI B;  2EIK C;  5LGT A;  3JAW B;  3N2K A;  2EIL C;  1Q43 A;  4U3F H;  1MSD A;  1K97 A;  2R72 A;  4EB6 A;  4B3S O;  1Q6I A;  4CBC A;  3OW2 U;  2EZP A;  4J7K A;  4R6Z A;  4LF6 B;  3AK1 A;  3A0H Z;  1YCI A;  4JV5 O;  3CPW U;  4UVB A;  4DV1 O;  5JCO A;  4O2A A;  3BA9 A;  3FD9 A;  2ETN A;  2Y4T A;  3SPH A;  1S72 V;  1OV9 A;  3S3W A;  4FFB A;  1SQX H;  3GVM A;  3M7M X;  4ZI7 A;  1O9H A;  1WLE A;  4B08 A;  3QO8 A;  1M56 C;  1Y67 A;  3N2K B;  1P84 F;  1PM9 A;  3FX7 A;  1MSW D;  3E8F A;  4EB6 B;  5B3S B;  4U7O A;  3B4S A;  5CA1 A;  5H2F Z;  3LSS A;  2XND G;  4BIU A;  4DV5 O;  4B3S B;  2Y4U A;  2RMK B;  2XT9 A;  1VQ9 V;  4O2A B;  2DN9 A;  4YXW G;  4J7Z A;  1VQP V;  2QWQ B;  3AEI A;  4FFB B;  2NNU A;  5BR8 O;  4KUM A;  4UXN A;  4ZI7 B;  1E1Q G;  3WB0 A;  2ADP A;  3UQ8 A;  2Y69 C;  2ZIN A;  2XAF A;  3T4D A;  1GMG A;  4PV1 B;  4GZR B;  3DTU B;  2IJK A;  3K5M A;  3AG4 B;  4EFE A;  3RYC A;  3F5W C;  5CA1 B;  1G8M A;  2Z0A A;  3O65 A;  5GTI Z;  1BHB A;  1QQC A;  2XAQ A;  4RUF A;  5L3D A;  5LL6 Y;  4GX5 A;  1M93 A;  4ZIB A;  4TT3 G;  1KKD A;  2YIB A;  3STZ C;  2WLJ A;  1YF2 A;  2F93 B;  3C3T A;  1OZ0 A;  4K3A A;  4BR6 A;  2ZQM A;  1VQ5 V;  3HR0 A;  5BR8 B;  1UFI A;  3JAM N;  3S3X A;  1GO3 F;  3MAQ A;  1VIB A;  2CGO A;  4PA4 A;  1DF5 A;  4YHH O;  2IH1 C;  2KB1 A;  2OIG A;  4JI2 B;  2K9P A;  2JGD A;  2Y48 A;  4HYO A;  4IGG A;  4MS2 A;  1PV0 A;  1NKD A;  3F7V C;  1TUE B;  1ZL8 B;  4NB5 A;  2YSU B;  2YI8 A;  4LFC O;  1IBM O;  2X0L A;  3CCS V;  3IJ4 A;  2ZT9 B;  1JFF A;  2N04 A;  4JI4 O;  2R9I A;  2ZM6 B;  4FK5 C;  1PP9 H;  1VQN V;  1S5L Z;  1RP3 B;  5B3S C;  4PDL A;  3SDL A;  3ZMZ A;  1P49 A;  3RN4 A;  1HDJ A;  4FMT A;  1EN6 A;  2WA3 A;  5JCO C;  3E22 A;  5JH7 A;  4MW8 A;  3ABM B;  5JVD A;  1URF A;  2JGD B;  4YHH B;  1AI5 A;  4X1Y A;  1SQF A;  2ILM A;  1ROP A;  3THO A;  3H9V A;  1XMQ B;  1YI2 V;  1QVG U;  1D5A A;  1U97 A;  1FXK A;  1AR1 B;  3ZCC A;  2LP7 A;  3AG4 C;  1P7G A;  2XTA A;  3TXQ A;  4LFC B;  1IBM B;  1K4D C;  1NH2 D;  3JAT A;  1GM7 A;  3OR7 C;  3ABU A;  5FLX N;  2ZKO A;  2RN9 A;  1XI1 A;  1AR5 A;  3OE7 G;  1QR9 A;  5KUM A;  3ASN B;  3E22 B;  5JH7 B;  1OCR B;  4DRX B;  1OCC B;  5JVD B;  2QEX V;  4ZKI A;  2OTJ V;  2E3C A;  4B3M B;  2CTQ A;  1YSC A;  2XAS A;  4KP4 A;  1U96 A;  4X1Y B;  4CH6 A;  3OEE G;  2HP8 A;  3WFV A;  2RDC A;  5LGU A;  2WLM A;  4JI1 O;  4QGP A;  2Q5Z A;  1HR0 O;  4WF9 V;  1E79 G;  1YDX A;  4JI3 O;  1YTF D;  3HKC A;  1JPX A;  2XOK G;  2QWN B;  2CDY A;  1N36 O;  3JAT B;  3K06 A;  4X1I A;  5CB4 A;  3ETQ A;  3SYC A;  3CX5 F;  2BCC H;  4UCT A;  2QWO B;  2EZO A;  2D2C B;  2LFS A;  4Q6G A;  2HVK C;  4AHC A;  3N2G B;  2ZIO A;  3WU2 Z;  2IW5 A;  1XOU A;  1FJG B;  3ML0 A;  4GYC B;  4ICG A;  3RYF A;  2NR5 A;  4AQY B;  2HHH B;  4DR3 O;  3ABL B;  2UU9 B;  4JYA B;  3ZN0 A;  2F66 C;  2WA4 A;  2EIJ B;  2DOS A;  2UUA O;  2X6B A;  5IJ0 A;  1B3Q A;  3HKC B;  1OHH G;  4FJC C;  3E8H A;  3P30 A;  2B5U A;  5LP6 A;  4MVS A;  3ABM C;  4X1I B;  1KBH A;  2CH7 A;  3U11 A;  1XEQ A;  5FPR A;  5IY5 B;  3W7U A;  1BS3 A;  3JD0 A;  5CB4 B;  3SJQ C;  2EJ7 A;  4WFE A;  3ETE A;  3L71 H;  2BOB C;  4QNH B;  5EYP A;  2GTS A;  4X65 O;  3FB7 C;  5IYB O;  2ODM A;  1JCH A;  4JAV A;  1S76 D;  2XAG A;  2CTP A;  1YIT V;  2EIN B;  3LSU A;  2F43 G;  1GN6 A;  3RYF B;  4YY3 O;  2Q7G A;  1P7B A;  3DC5 A;  1RM1 B;  3B09 A;  5KUK A;  3JSN A;  1EFR G;  5IJ0 B;  5LMU O;  5LP6 B;  3WG7 C;  3J80 N;  2EX3 A;  3K59 A;  4DR3 B;  3ASN C;  1OCR C;  3K5L A;  1OCC C;  4NXM B;  4MTO A;  2UUA B;  1XIL A;  3JCZ A;  3AK2 A;  4FM1 A;  5KHJ A;  1AP6 A;  2QSA A;  4GUN A;  1EN5 A;  5F2V O;  3WB1 A;  5EYP B;  4DV0 O;  1KKC A;  2H8P C;  1R6N A;  2QKA A;  5JJJ B;  4MW3 A;  4OXS A;  1FXK C;  3PN1 A;  1S5H C;  4D7T A;  2W6J G;  4R8C A;  3IC7 A;  2JDI G;  4MVO A;  4X65 B;  1XHZ A;  5LA6 A;  1PPJ H;  1BHA A;  2ZXW B;  5EC2 C;  4CH5 A;  5IYC O;  3QNE A;  4DR6 O;  5ITZ A;  3KCX A;  4NTY A;  2UXN A;  1IDS A;  1SS3 A;  1SQG A;  1CP9 A;  4DW0 A;  4DV2 O;  5GW7 A;  4CC6 A;  1KUQ A;  3CRQ A;  4JI5 O;  5LMU B;  3VQV A;  4EFB A;  1WB7 A;  1FD9 A;  2UUC B;  2IJJ A;  2JS5 A;  2ZIM A;  1SRY A;  4B3T O;  4OPH A;  3ABL C;  3CCV V;  1UPG A;  2BOC C;  5D5Q A;  2EJR A;  4JI7 O;  2EIJ C;  1JX9 A;  1AP5 A;  3ZHQ A;  1Q3E A;  5IYZ A;  5EBL C;  4MTG A;  5LA6 B;  3RVY A;  3JSL A;  5IY5 C;  5ITZ B;  1S77 D;  3CSX A;  3CEI A;  3P3N A;  4E4E A;  1AJN A;  1YJW V;  2HEP A;  2IJH A;  5FNV A;  4MVZ A;  3ZRW B;  2CE4 A;  4X1K A;  5LHI A;  3HB3 B;  4B7K A;  4DR6 B;  5EBM C;  5KA6 A;  2VRZ A;  1GM9 A;  4JAU A;  1VEW A;  2EIN C;  1QNM A;  2QKC A;  4UCO A;  4DV2 B;  2LQT A;  2UXB B;  5B1B C;  4JI5 B;  2KQX A;  1RM1 C;  1TGO A;  1HNX B;  3SR2 C;  4WCE V;  4IL6 Z;  2HG5 C;  4CZZ A;  3EHB B;  3JAS A;  4DR5 B;  5IYZ B;  3SYO A;  5LP6 C;  1NTZ H;  1K5Q A;  4DV4 B;  1XNQ O;  2PUS A;  4JI7 B;  4JI6 B;  3ZMS A;  4W4L A;  2WLL B;  3OEH G;  1DGS A;  4PA9 A;  1A32 A;  1KP3 A;  4X1K B;  3K5O A;  3E8B A;  3AG2 B;  1WP7 A;  2OYQ A;  1VAR A;  2QM7 A;  1YZB A;  3W7X A;  3X2Q B;  2CTR A;  2ZXW C;  4RQF A;  1I7F A;  1GM8 A;  4IYI A;  1WN7 A;  4LNU A;  2BTQ A;  4UCU A;  3JAS B;  1LUV A;  4GX0 A;  4JYY A;  2GBO A;  5H6Q A;  1ZUQ A;  4DW1 A;  3WB2 A;  1WNS A;  1YEW A;  2HLD G;  5KHG A;  5KAF Z;  3SPI A;  3EVK A;  1H8E G;  1KP2 A;  5BMV A;  2AZ2 A;  1LNQ A;  1XNQ B;  1ZTE A;  2HKO A;  3LDC A;  4QJF B;  1THZ A;  1H38 A;  3ETD A;  3DSQ A;  2N05 A;  3OUF A;  1Y74 A;  5IYD O;  4DUY B;  2QM8 A;  3JAW A;  4K35 A;  3CME V;  5IJ9 B;  3E8G A;  4LF6 O;  3VQY A;  1AR4 A;  5KHH A;  4LH6 A;  1GN3 A;  2OIE A;  1Y66 A;  4L87 A;  4LNU B;  1NJI W;  1KYO F;  3BA8 A;  5DN6 G;  2DE0 X;  2UXC O;  1K8A W;  4B3R B;  2F4V B;  4DK1 A;  2B1I A;  2YIA A;  3G67 A;  1IXB A;  5BMV B;  2PF4 E;  1QLE B;  3PJS K;  3SGI A;  4BAY A;  1IVS A;  4DV6 B;  4JGS A;  4BW5 A;  4WFA V;  2AHY A;  1Y74 B;  1Q82 W;  2R9A A;  2EUL A;  2WLN A;  4PDR A;  3D8C A;  3GWO A;  2LFR A;  3D36 A;  1S3J A;  1N0J A;  1BQ0 A;  5C93 A;  2ARH A;  1UJW B;  2LGW A;  4YIO A;  2QM4 A;  2YXL A;  3QTC A;  4H37 A;  2Q68 A;  3HKD B;  2UXC B;  3AG2 C;  1F23 A;  2Z5U A;  2KSD A;  2P7T C;  4PJ0 Z;  5DED A;  2V4D A;  2E5L O;  2KG7 A;  3E2E A;  2VQE O;  2ZNJ A;  3KCY A;  1AB3 A;  4J42 A;  2ADQ B;  3KZI Z;  5CA3 A;  4J7J A;  2DYR C;  2JRI A;  4UVC A;  4FLW A;  3K9A A;  5KHI A;  2C2A A;  1PNL A;  2ZCE A;  1K7D A;  4I4T A;  3ZMT A;  5LYJ B;  5H5N A;  1W0K G;  4LP8 A;  1QU7 A;  2VWJ A;  1CPY A;  3ZJZ A;  2DW4 A;  3Q4H B;  4AIL C;  2KG7 B;  3KG2 A;  4PD4 F;  4GCZ A;  1VF6 A;  4FIP C;  3K58 A;  1SZT A;  1R73 A;  2Q8V A;  2E5L B;  4JI2 O;  1PL4 A;  2VQE B;  1AJP A;  5LXT A;  2AZ0 A;  5CBF A;  2EIM B;  3FAV A;  4WBN A;  3ZMV A;  1MG1 A;  3G6E V;  1MMM A;  4LFB O;  4N21 A;  2OWO A;  5CBG A;  5GON A;  3ZIA G;  1QLE C;  3GB7 C;  2CAZ C;  3K3W A;  4I4T B;  3ABK B;  1ZL8 A;  2Q7E A;  2ZM6 O;  5JWP A;  4DV7 O;  1R1B A;  1IBL O;  2JEX A;  4XBF A;  2JJ1 G;  1H2G A;  3K0D A;  1DF4 A;  2V7Q G;  4CS3 A;  2Q0A A;  1NQT A;  3BFR A;  4BIO A;  2DWD C;  5A2Q N;  1EN4 A;  1M1K W;  5LXT B;  2ZE6 A;  3FAV B;  4WBN B;  1NTM H;  3D3Q A;  5LHG A;  2XHB A;  4JF3 A;  1NR7 A;  2YIB D;  1NVP B;  4X8A A;  5GON B;  4CS2 A;  1XMQ O;  4X64 O;  4UCV A;  4JI8 O;  2UXD O;  3J81 N;  3QG5 A;  4LFB B;  1PKX A;  4U3J A;  1HNZ B;  1FXV A;  5J2U A;  3UKM A;  3AK3 A;  4J11 A;  1K5S A;  4NTW A;  1KQS U;  3SPC A;  1SC5 B;  3A2F A;  5H6R A;  2R70 A;  1Z2G A;  4DV7 B;  3D36 C;  2PI5 A;  1M4U A;  5J9P C;  1IBL B;  5EZY A;  1H2M A;  2MW2 B;  2Y0P A;  2FL4 A;  1Q86 W;  2RNB A;  2W0X A;  2R9R B;  3H1I H;  4B3M O;  4UCS A;  3L74 H;  3JAK B;  1IBK B;  4PA3 A;  4DYL A;  5IDJ A;  4RQE A;  1GRJ A;  5KAI Z;  2ITD C;  4HNA A;  3RFR A;  4DRX A;  1EZV H;  4DO2 A;  4LBE C;  3JD3 A;  5E79 Z;  3CB2 A;  2VQF B;  1R6K A;  2H3O A;  1YJ9 V;  3AG3 B;  3UCS C;  2ZD9 A;  4U3J B;  3G80 A;  5J2U B;  4GLX A;  4X64 B;  3CWB H;  4OX9 O;  4JI8 B;  3L70 H;  4AI8 A;  4F6R A;  1X59 A;  2FB5 A;  4LF5 B;  2UXD B;  1P4R A;  1QR8 A;  4ZOL B;  2B1G A;  4I9W A;  4HBN A;  2Z3Y A;  5EZY B;  4O2B A;  2A79 B;  2N74 A;  5HFM A;  1XNR B;  5LHH A;  5B1N A;  1JA8 A;  1KMI Z;  1FJG O;  4HNA B;  4NXN O;  3N2G A;  4AQY O;  2HHH O;  4BIZ A;  2UU9 O;  3OTO B;  2PYJ A;  4JYA O;  4FVM A;  4H13 B;  1H2L A;  1GN4 A;  3OD4 A;  1HNW O;  1VF6 C;  3CC4 V;  1I0H A;  1EBO A;  2WPD G;  4F6R B;  1NI8 A;  3P32 A;  3LNM B;  1YHQ V;  1NZ6 A;  1QHT A;  3ZHV A;  4OX9 B;  1WA8 A;  4JTC B;  1VQ8 V;  1XDC A;  4O2B B;  1JVM A;  3K0G A;  3CCR V;  4LC1 A;  1F7Y A;  1LR1 A;  1NBM G;  1I5X A;  3L75 H;  1OJH A;  2LW1 A;  3ZHT A;  4XDL A;  4CS4 A;  1KC8 W;  4NXN B;  1JMK C;  3QO5 A;  4JI0 B;  1PL0 A;  1ZWI C;  3RW0 A;  1T5E A;  3RWR D;  2YIC A;  3APQ A;  5K1X A;  4NXM O;  2A0L A;  4LWS A;  1HNW B;  4GKJ O;  3MD0 A;  1V55 B;  2OCH A;  2P67 A;  1NU1 H;  1BGY H;  1WA8 B;  3CCE V;  2KKW A;  1WPB A;  3CYO A;  3UO3 A;  4UB8 Z;  3T2M A;  3AG3 C;  3E83 A;  2YDE A;  2CGN A;  3FYE B;  3SYQ A;  3OGC C;  3BRC A;  3VBB A;  2K1E A;  2AXT Z;  3K03 A;  5LGN A;  4MVQ A;  1BT8 A;  4RWU A;  2WLK A;  2ZR2 A;  4F4L A;  2XUM A;  1N33 O;  2LW7 A;  3BVO A;  1GKF A;  4CH3 A;  5CMU A;  3DC6 A;  3H1J H;  4LWS B;  3OMA B;  4YJ3 B;  3I5D A;  2UUC O;  4FLX A;  2WWW A;  2BSK A;  3TGU H;  5B5E Z;  4GKJ B;  2IBZ H;  1AJQ A;  1VP7 A;  1COW G;  1S0V A;  1K33 A;  1N0N A;  2QTS A;  1BSM A;  4UB6 Z;  4O4J A;  2YC0 A;  3CJH B;  4JZG A;  1TVK B;  4JTA B;  4Q20 A;  3FB8 C;  3HKE A;  3CCJ V;  4WFF A;  1GH6 A;  3LSQ A;  4H44 B;  3OM3 B;  4DR2 O;  2HR3 A;  5L3F A;  4TUY B;  2JJ2 G;  3H1H H;  4TSF G;  2D3O W;  4I9Q A;  3JD2 A;  3OTF A;  3ZRW A;  3UT5 A;  1N33 B;  3LDD A;  4RUE A;  3FB6 C;  4J9Z B;  3OMN B;  1VQO V;  2BSK B;  3CC7 V;  2UXB O;  4RAI A;  1G4Y B;  1HNX O;  2PY5 A;  3ASO B;  5IE9 A;  4MVR A;  2OTL V;  3JD1 A;  3A0B Z;  4Z2W A;  3K08 A;  4DR5 O;  2PGG A;  4O4J B;  4DV4 O;  3IGA C;  3LNN A;  4JI6 O;  3HKE B;  2A7W A;  1V55 C;  2FML A;  2CUG A;  3EXA A;  2OCC B;  2GHY A;  2GTA A;  3U0Z A;  4E2L A;  2F1M A;  1PD3 A;  1Z5W A;  2IU3 A;  2Q7H A;  2WLL A;  1H2N A;  4X62 B;  4D6T H;  3UT5 B;  4DR2 B;  2BTO A;  1Q81 W;  4NTX A;  3HKB A;  1J5E B;  1XMO B;  2HVJ C;  1I08 A;  4N23 A;  3APO A;  1ENV A;  3H1L H;  3T1H B;  3LUT B;  2FTK A;  3D3I A;  2W6I G;  1K73 W;  3SYP A;  5L3E A;  1SER A;  1RPR A;  4WFH A;  3P3P A;  2X6C A;  2A3Q A;  5LMN O;  4CC5 A;  3BAB A;  5DEC A;  1VQ7 V;  5CBH A;  4PA6 A;  4OGQ B;  2Q73 A;  1B6Q A;  1W59 A;  1K9M W;  1F4N A;  3OR6 C;  3TXS A;  4DUY O;  5JJN B;  4UCR A;  1Z5V A;  1QCE A;  3HKB B;  2EIL B;  5GTH Z;  4PDM A;  5KX5 A;  4TQF A;  2CTW A;  1BMF G;  1FXH A;  2XAH A;  5IJ9 A;  2B9Z A;  4I55 B;  3TET A;  3ZRV A;  4B3R O;  1SA0 A;  2F4V O;  3B2E E;  3C90 A;  4IIJ A;  3CRR A;  3E35 A;  1FFT B;  4FM0 A;  4TOI A;  3M99 B;  4GKK B;  2JGU A;  4I50 A;  2DWE C;  3ZX6 A;  4DV6 O;  1JJ2 U;  2Y0I A;  1ZX3 A;  2Q6A A;  1V9P A;  4ZBM A;  5KLV H;  3ASO C;  1YXB A;  4LF4 B;  4ASU G;  5TIS Z;  5LMN B;  1PNM A;  1F51 A;  1KU9 A;  2P5O A;  4DK0 A;  2HFE C;  5KX5 B;  3E89 A;  4MVM A;  3K57 A;  5EC1 C;  2L35 A;  2OCC C;  3CRM A;  2GSM B;  1MA1 A;  1SA0 B;  2NLJ C;  3TJT A;  4IIJ B;  2GUZ A;  3ZRX A;  1JQ0 A;  1Q8I A;  2F95 B;  1SQQ H;  2A9H A;  2LJ2 A;  1D5N A;  3OGI B;  1Y6X A;  4X9Q A;  1PNK A;  2AW9 A;  1MNG A;  1FYJ A;  2ZDI A;  4I50 B;  4UVA A;  1YJN V;  1TA8 A;  3HKD A;  4O4I A;  1WAZ A;  5KHK A;  1L0N H;  4TQD A;  3SPJ A;  2MK3 A;  2NN4 A;  4O4H B;  1AVM A;  4PEL A;  3QF7 A;  4LFA B;  3VQX A;  5EIB C;  3UO2 A;  3OMI B;  1I94 O;  2V1D A;  4IHJ B;  1TAE A;  2YUA A;  4H33 A;  1VQL V;  2XAJ A;  2GUZ B;  1NS1 A;  3RYI A;  1L0L H;  4Z1V A;  1US6 A;  3E86 A;  4PDV A;  4QE9 A;  2WAM A;  3J7A U;  5LYJ A;  4J80 A;  4LF9 B;  4LF8 B;  3FB5 C;  4O4I B;  4J9Y B;  3NXS A;  1DK1 A;  3X2Q C;  3Q4H A;  1N34 B;  4LR3 A;  2LGQ A;  2WLI A;  2AHZ A;  4P9O A;  2W0F C;  2CK3 G;  3K9S A;  5JJE B;  1GAX A;  3CXH F;  4DR1 B;  3DXR A;  3OFN G;  3AG1 B;  1B04 A;  1AI4 A;  3RYI B;  5B1A B;  2QJ1 A;  1I94 B;  1OCZ B;  2AGA A;  1HP8 A;  1XQ8 A;  2G38 A;  2FYU H;  1M9N A;  2Q4P A;  4QE7 A;  1K4C C;  1M5I A;  1YVW A;  1VQK V;  4PI2 A;  5BXZ A;  2YXY A;  4K0K O;  4I5S A;  5LBQ A;  2BE3 A;  3MDS A;  2Q9L A;  4KFM A;  2RCV A;  3VOU A;  1D2D A;  5C8Y A;  2WLI B;  4FLV A;  3A8T A;  3O9O A;  4DUZ O;  5EBW C;  1R3I C;  2ITC C;  4P2Z A;  1SKV A;  4FZ0 A;  3ZHR A;  1K92 A;  3L72 H;  3DXR B;  3FKS G;  4L8J A;  4JV5 B;  3SJC C;  3SJA C;  4DV1 B;  1HNZ O;  1QBZ A;  5IT9 N;  1KB9 F;  5FPO A;  4JTD B;  3SPG A;  2JS3 A;  2GV9 A;  4DV3 O;  5KMG A;  4CH4 A;  3RT3 C;  3CMA V;  3L9D A;  4QIW F;  4UUJ C;  3FFQ A;  1SQV H;  3I55 V;  1NVP D;  3ZS8 C;  5C8Y B;  5HFL A;  3JCU Z;  3ICX A;  1IBK O;  4D7S A;  4DXW A;  4K0K B;  4U7N A;  1QVF U;  2YEV A;  1VQ4 V;  2P90 A;  2P4K A;  2YI9 A;  1N4C A;  1SF9 A;  3OT7 A;  1WPX A;  3JAK A;  2ZDI C;  1R3K C;  4DUZ B;  2VQF O;  1N32 O;  4DV5 B;  4QPK A;  2JVD A;  1L8D A;  2ZR3 A;  2PI4 A;  3W7W A;  4W4K A;  5KA5 A;  4KL1 A;  1W2B U;  4LF5 O;  1BQZ A;  2FKX A;  4PHZ A;  5KMG B;  3RVZ A;  4R50 A;  1H2K A;  1EM1 A;  3CP1 A;  3T1Y O;  1ZLZ A;  3RYC B;  4DV3 B;  4YJ2 A;  2YID A;  5LOV A;  1XNR O;  2ZE7 A;  4FLT A;  3IFX A;  4UV8 A;  3AG1 C;  4ZOL A;  2A06 H;  3ZRS A;  2YEV B;  3H01 A;  5B1A C;  1OCZ C;  4K8Z A;  2M6Y A;  3OTO O;  2P06 A;  4GT1 A;  3BHP A;  4JYB A;  1NT2 B;  3KKY A;  1J95 A;  4JAA A;  4OPA A;  4DR7 O;  1SES A;  3CS5 A;  2WLH A;  2F23 A;  2HJF C;  4MSW C;  4IYH A;  1N32 B;  4FLU A;  5FL7 G;  1CXZ B;  1JOY A;  3ZN1 A;  2E75 B;  4YJ2 B;  5LOV B;  5EK0 A;  2EIM C;  3MHH C;  3T1Y B;  3CCQ V;  1XRE A;  1GTO A;  3ABK C;  4Z1M G;  2QGN A;  1JFF B;  2O57 A;  4BWA A;  2QKS A;  3ZBH A;  4JI0 O;  2P6J A;  4X88 A;  1W0J G;  1N8R W;  4HZ3 A;  4DR7 B;  4JI4 B;  2L6L A;  1VMG A;  3W7T A;  1IX9 A;  3RGB A;  3B8M A;  4G28 B;  3WG7 B;  3DGE A;  4FFK A;  2JEU A;  3TCU A;  1Q7Y W;  1H2S B;  1NH2 B;  1R3L C;  4KXR A;  3K5N A;  2IH3 C;  1G6U A;  1HWY A;  1H8H G;  1RSO A;  1WP8 A;  4FM2 A;  1FXK B;  1IZ3 A;  3BEH A;  5L3G A;  1SZX A;  3AG7 A;  4GX1 A;  3CCL V;  2DYS B;  2ATK C;  4FLZ A;  1Y76 A;  2UUB O;  3G4S V;  1FAF A;  3R65 A;  2UXX A;  3QO7 A;  1ZAU A;  1OCO B;  1NR1 A;  3GWK C;  1YTF B;  3CCM V;  3CRA A;  1MOF A;  2DQ0 A;  4PA7 A;  4YJ3 A;  3N27 A;  4HAM A;  1DTO A;  1ZSP A;  1RSO B;  1ORQ C;  4UFZ A;  3JAL A;  1BZK A;  1R6T A;  3CJH A;  4LCU C;  4X66 O;  1Q5O A;  1TVK A;  1NTK H;  2E76 B;  1VF5 B;  4I7Z B;  1Q90 D;  2RJZ A;  3BY6 A;  3T1C A;  3ZMU A;  4JI1 B;  4B7E A;  1HR0 B;  5BZB A;  4O4L A;  5IWA O;  4I0X A;  1Y76 B;  4JI3 B;  4DR4 O;  5H9C A;  3CE2 A;  1KEC A;  3G71 V;  5D5P A;  1N36 B;  4TUY A;  1IUR A;  2UUB B;  1XL6 A;  3K79 A;  4NVP A;  4JYC A;  4A5U B;  3B8N A;  5JQG A;  4IT5 A;  5K1P A;  2EBO A;  3A0R A;  4MVU A;  4NKG B;  5B1B B;  3JAL B;  1GN2 A;  2IM9 A;  3ETG A;  4KHP O;  4UV9 A;  1K3E A;  5B66 Z;  2LO1 A;  2ZNI A;  3F7Y C;  1FKA O;  4WFB V;  2GDS A;  1MAB G;  2VS0 A;  1Q6H A;  1GK9 A;  1SET A;  2OT5 A;  2M7W A;  4FZ1 A;  3G6B A;  4O4L B;  4I0X B;  2CH7 B;  3L73 H;  4X66 B;  2Q69 A;  3BPZ A;  4X62 O;  4TWK A;  2P22 C;  1XL4 A;  1ARO P;  2X6A A;  5IWA B;  1V54 B;  1J5E O;  4DR4 B;  4C7U A;  5J2T A;  2PTM A;  4FPP A;  4RO2 A;  1XMO O;  1K34 A;  4JPR A;  4MTF A;  2DMX A;  5CN0 A;  2YXH A;  5JQG B;  3ZHS A;  3T1H O;  2ZE5 A;  3CXC U;  1E1R G;  1AI7 A;  4XDK A;  2Q0O C;  2DYS C;  1DLB A;  3BAA A;  3TK1 A;  4WFG A;  4YIP A;  3U10 A;  3C3S A;  4YY3 B;  1OCO C;  2YS8 A;  2H94 A;  1XUQ A;  1SQB H;  4LF7 O;  1BE3 H;  4KHP B;  2JIZ G;  3ABT A;  4ABM A;  2VWK A;  1JJO A;  1WB8 A;  1FPO A;  2PZS A;  4ZHQ A;  5J2T B;  1IXM A;  1SQP H;  3M8A A;  5B1O A;  4X89 A;  1M57 B;  1S5J A;  4G27 B;  4DV0 B;  1EZJ A;  4P30 A;  3JYC A;  5EIB D;  1XHX A;  4NYK A;  4BW9 A;  5L3C A;  1B06 A;  1JR9 A;  5DM6 V;  2QR4 A;  4I55 A;  4PI0 A;  4TV8 A;  4GKK O;  5E1A C;  3OAA G;  1Y4M A;  3QVN A;  5BY1 A;  2X7R B;  4LF4 O;  1RFY A;  3MHS C;  1O9G A;  4ZHQ B;  1F4M A;  1RPO A;  1X4T A;  1AIL A;  3F5T A;  4MTX A;  3CRC A;  4LF7 B;  2QWR B;  3EFF K;  3W7S A;  1MZF A;  3VQW A;  4J10 A;  2EIK B;  4B3T B;  1MZE A;  3NR7 A;  4LH7 A;  1KD1 W;  1WJZ A;  1VQM V;  2PYL A;  1R3J C;  4K8X A;  4TV8 B;  2ZE8 A;  5FNV B;  4FLY A;  3RBZ A;  1V54 C;  3UM7 A;  2DJV A;  1QLN A;  4QPJ A;  1TUB A;  2WSS G;  4NR1 A;  3JD4 A;  3CCU V;  3CD6 V;  3BCC H;  1XBL A;  4H0L B;  3HPL C;  4F6E A;  2P4V A;  3RYH A;  3OUS A;  4LFA O;  3JAR A;  4X20 A;  2QA4 V;  1FFX A;  1M56 B;  1AI6 A;  5A9G A;  3IAY A;  2JK5 C;  2QWP B;  4O4H A;  3SYA A;  4MT8 A;  3CC2 V;  2DYR B;  2E74 B;  4TV9 A; 
#chains in the Genus database with same CATH homology
 3IC7 A;  2JDI G;  3FKS G;  4MVO A;  4BIZ A;  3T4Z A;  4R7C A;  2Q67 A;  1L1F A;  1BHA A;  1I5Y A;  2ZXW B;  1QBZ A;  5EC2 C;  5IYC O;  4JTD B;  3QNE A;  1YIJ V;  3SPG A;  3CC4 V;  2UXN A;  1EBO A;  2WPD G;  3LDE A;  4GX2 A;  1M57 C;  3P32 A;  3LNM B;  1CP9 A;  1YHQ V;  5GW7 A;  3CMA V;  4JAS A;  4G2K A;  4QIW F;  4UUJ C;  4JTC B;  1VQ8 V;  3I55 V;  1NVP D;  5HFL A;  2IJI A;  2IJJ A;  1JVM A;  1M90 W;  1SRY A;  3K0G A;  3CCR V;  4LC1 A;  2Y69 B;  4DXW A;  2DQ3 A;  4P9P A;  4U7N A;  1FS0 G;  2YEV A;  2IU0 A;  1VQ4 V;  1QVF U;  1NBM G;  3ABL C;  1CEZ A;  3K04 A;  1I5X A;  3CCV V;  2P90 A;  3I56 V;  2BOC C;  2EJR A;  3STL C;  2EIJ C;  1JX9 A;  2QTO A;  1WPX A;  5L3B A;  2QE7 G;  1BL8 A;  2ZDI C;  1R3K C;  5EBL C;  4XDL A;  1KC8 W;  4MTG A;  4QPK A;  2ZR3 A;  3RVY A;  1VQ6 V;  2PI4 A;  3W7W A;  5IY5 C;  5KA5 A;  3QO5 A;  1W2B U;  1S77 D;  1AJN A;  1PL0 A;  1YJW V;  2IJH A;  1ZWI C;  4EKW A;  3RW0 A;  4MVZ A;  3ZRW B;  3RVZ A;  4R50 A;  5LHI A;  2A0L A;  3HB3 B;  3MD0 A;  5EBM C;  3B77 A;  5KA6 A;  1V55 B;  3CP1 A;  4XDJ A;  2P67 A;  1GM9 A;  2EIK C;  3FYI B;  5LGT A;  4JAU A;  2EIL C;  3CCE V;  2EIN C;  3CYO A;  3IFX A;  4UV8 A;  3AG1 C;  1K97 A;  3OW2 U;  4CBC A;  3ZRS A;  2EZP A;  2YEV B;  3H01 A;  3T2M A;  3AG3 C;  5B1A C;  3E83 A;  5B1B C;  1OCZ C;  1RM1 C;  4R6Z A;  4WCE V;  2HG5 C;  4CZZ A;  3FYE B;  3EHB B;  4GT1 A;  4JYB A;  3OGC C;  4UVB A;  3SYQ A;  3CPW U;  3SYO A;  3VBB A;  1J95 A;  1K5Q A;  2K1E A;  3K03 A;  5LGN A;  3SPH A;  4MVQ A;  1SES A;  1S72 V;  2WLH A;  3ZMS A;  2HJF C;  4MSW C;  2WLK A;  2ZR2 A;  4F4L A;  2WLL B;  3OEH G;  5FL7 G;  1GKF A;  4PA9 A;  1JOY A;  1WLE A;  5CMU A;  3QO8 A;  1KP3 A;  3ZN1 A;  1M56 C;  3OMA B;  3E8B A;  3AG2 B;  5EK0 A;  2EIM C;  2WWW A;  1MSW D;  2QM7 A;  3E8F A;  3MHH C;  3W7X A;  5B3S B;  4U7O A;  1AJQ A;  3X2Q B;  3CCQ V;  1COW G;  2ZXW C;  4RQF A;  1S0V A;  1K33 A;  3LSS A;  2XND G;  1GM8 A;  1GTO A;  4BIU A;  4GX0 A;  4JTA B;  3ABK C;  4Z1M G;  1VQ9 V;  5H6Q A;  4Q20 A;  2HLD G;  4YXW G;  1VQP V;  3FB8 C;  2QKS A;  3AEI A;  3SPI A;  3CCJ V;  2NNU A;  4WFF A;  1H8E G;  2P6J A;  4X88 A;  3LSQ A;  1KP2 A;  1W0J G;  1N8R W;  4KUM A;  4UXN A;  4HZ3 A;  1LNQ A;  3OM3 B;  2HR3 A;  1E1Q G;  5L3F A;  2HKO A;  2JJ2 G;  2Y69 C;  3LDC A;  4QJF B;  3W7T A;  4TSF G;  2D3O W;  2XAF A;  3JD2 A;  3T4D A;  1GMG A;  1THZ A;  1H38 A;  3B8M A;  3DTU B;  4G28 B;  3WG7 B;  3ZRW A;  3LDD A;  3ETD A;  2IJK A;  3DGE A;  3FB6 C;  4J9Z B;  3OMN B;  4RUE A;  3OUF A;  5IYD O;  2JEU A;  3AG4 B;  1VQO V;  3TCU A;  2QM8 A;  3CC7 V;  1Q7Y W;  1NH2 B;  1R3L C;  3CME V;  3F5W C;  4RAI A;  1G4Y B;  3E8G A;  3ASO B;  2IH3 C;  4MVR A;  2OTL V;  1G8M A;  3JD1 A;  1HWY A;  1H8H G;  3K08 A;  1Y66 A;  4L87 A;  1NJI W;  1FXK B;  5DN6 G;  3IGA C;  1K8A W;  1BHB A;  2XAQ A;  4RUF A;  5L3D A;  4GX5 A;  2B1I A;  3BEH A;  1V55 C;  4TT3 G;  1KKD A;  5L3G A;  4GX1 A;  3CCL V;  2DYS B;  2OCC B;  2GHY A;  2ATK C;  3STZ C;  2WLJ A;  1QLE B;  3PJS K;  4E2L A;  3G4S V;  1PD3 A;  4BAY A;  3R65 A;  1OZ0 A;  2IU3 A;  2UXX A;  3QO7 A;  2WLL A;  4JGS A;  2ZQM A;  1VQ5 V;  1OCO B;  1NR1 A;  1GO3 F;  4BW5 A;  4WFA V;  4PA4 A;  1DF5 A;  1YTF B;  3CCM V;  2AHY A;  1MOF A;  2DQ0 A;  4PA7 A;  1Q81 W;  2IH1 C;  1Q82 W;  2KB1 A;  2WLN A;  2HVJ C;  4N23 A;  4PDR A;  1ENV A;  3GWO A;  2LFR A;  2Y48 A;  3D36 A;  4HYO A;  4HAM A;  4MS2 A;  3LUT B;  1DTO A;  2FTK A;  1NKD A;  3D3I A;  2W6I G;  3F7V C;  1K73 W;  1TUE B;  1S3J A;  1ORQ C;  3SYP A;  5C93 A;  5L3E A;  1UJW B;  1SER A;  2YSU B;  1RPR A;  4LCU C;  2X0L A;  3CCS V;  4WFH A;  4H37 A;  2X6C A;  3T1C A;  3BY6 A;  2Q68 A;  3ZMU A;  3AG2 C;  1F23 A;  2R9I A;  2Z5U A;  4FK5 C;  5BZB A;  1VQN V;  2P7T C;  5B3S C;  5H9C A;  1VQ7 V;  4PDL A;  5CBH A;  1KEC A;  4PA6 A;  3ZMZ A;  3G71 V;  3E2E A;  1B6Q A;  1K9M W;  1F4N A;  3OR6 C;  4FMT A;  1XL6 A;  3K79 A;  4JYC A;  1QCE A;  5CA3 A;  2EIL B;  3B8N A;  4PDM A;  2DYR C;  4MW8 A;  3ABM B;  4UVC A;  1BMF G;  1FXH A;  2EBO A;  3A0R A;  2XAH A;  4MVU A;  1AI5 A;  3K9A A;  3TET A;  3ZRV A;  5B1B B;  2C2A A;  1ROP A;  3ETG A;  3E35 A;  1PNL A;  4UV9 A;  1K3E A;  1FFT B;  1YI2 V;  1QVG U;  3F7Y C;  1K7D A;  4WFB V;  1FXK A;  3ZMT A;  1AR1 B;  1MAB G;  1GK9 A;  1SET A;  3ZCC A;  3M99 B;  2LP7 A;  2OT5 A;  1W0K G;  2M7W A;  4LP8 A;  3AG4 C;  2DWE C;  1K4D C;  2Q69 A;  1JJ2 U;  1CPY A;  1NH2 D;  3ZJZ A;  4TWK A;  2Q6A A;  4ZBM A;  1GM7 A;  1XL4 A;  2DW4 A;  1ARO P;  3OR7 C;  3ASO C;  3KG2 A;  2X6A A;  3ABU A;  4GCZ A;  4ASU G;  1V54 B;  4FIP C;  1PNM A;  1SZT A;  4FPP A;  1R73 A;  4RO2 A;  3OE7 G;  1QR9 A;  5KUM A;  1K34 A;  1F51 A;  4JPR A;  4MTF A;  3ASN B;  1AJP A;  1OCR B;  2HFE C;  2EIM B;  1OCC B;  5CN0 A;  5CBF A;  2QEX V;  3ZMV A;  4ZKI A;  3CXC U;  1E1R G;  1AI7 A;  1MG1 A;  3E89 A;  4MVM A;  3G6E V;  2OTJ V;  4XDK A;  4N21 A;  5EC1 C;  5CBG A;  2DYS C;  3ZIA G;  2OCC C;  2GSM B;  1YSC A;  2XAS A;  4KP4 A;  2NLJ C;  1QLE C;  1DLB A;  3OEE G;  3TK1 A;  4WFG A;  3ZRX A;  1JQ0 A;  3GB7 C;  3WFV A;  5LGU A;  2A9H A;  3K3W A;  3ABK B;  1OCO C;  2WLM A;  1PNK A;  2H94 A;  4WF9 V;  1E79 G;  1YTF D;  2ZDI A;  2JIZ G;  1JPX A;  2XOK G;  2JEX A;  3ABT A;  4UVA A;  4XBF A;  1YJN V;  2JJ1 G;  1H2G A;  3K0D A;  1DF4 A;  3K06 A;  2V7Q G;  1NQT A;  3SYC A;  3SPJ A;  1IXM A;  2DWD C;  5B1O A;  2MK3 A;  4X89 A;  1M1K W;  1M57 B;  2EZO A;  2LFS A;  4G27 B;  2HVK C;  1EZJ A;  4P30 A;  4PEL A;  5LHG A;  3JYC A;  3OMI B;  4JF3 A;  1NR7 A;  2V1D A;  1NVP B;  4X8A A;  2IW5 A;  5L3C A;  3ML0 A;  4H33 A;  5DM6 V;  1VQL V;  2XAJ A;  3ABL B;  1PKX A;  3ZN0 A;  3E86 A;  1FXV A;  4PDV A;  3UKM A;  5E1A C;  2EIJ B;  3OAA G;  4QE9 A;  2WAM A;  2X6B A;  1K5S A;  1KQS U;  4FJC C;  1OHH G;  1Y4M A;  3E8H A;  3P30 A;  2B5U A;  3SPC A;  2X7R B;  4MVS A;  3ABM C;  3FB5 C;  3MHS C;  5H6R A;  4J9Y B;  1F4M A;  1RPO A;  4MTX A;  3NXS A;  5IY5 B;  3W7U A;  3JD0 A;  5J9P C;  2PI5 A;  3SJQ C;  3X2Q C;  3EFF K;  4WFE A;  3ETE A;  2WLI A;  2BOB C;  4QNH B;  2AHZ A;  1Q86 W;  4P9O A;  2W0F C;  2CK3 G;  2R9R B;  3FB7 C;  3W7S A;  5IYB O;  1JCH A;  4PA3 A;  2EIK B;  4JAV A;  5IDJ A;  4RQE A;  1S76 D;  2ITD C;  2XAG A;  1YIT V;  2EIN B;  3OFN G;  3AG1 B;  4DO2 A;  4LBE C;  3JD3 A;  2F43 G;  1KD1 W;  1AI4 A;  1VQM V;  1R6K A;  1P7B A;  1YJ9 V;  3AG3 B;  1R3J C;  5B1A B;  2ZD9 A;  1OCZ B;  1RM1 B;  5KUK A;  3RBZ A;  1V54 C;  1M9N A;  3UM7 A;  1EFR G;  4QE7 A;  1K4C C;  1VQK V;  3WG7 C;  1P4R A;  3ASN C;  1OCR C;  1QR8 A;  1QLN A;  1OCC C;  4QPJ A;  2WSS G;  4MTO A;  4I5S A;  5LBQ A;  2B1G A;  3JCZ A;  4I9W A;  3JD4 A;  2Z3Y A;  3CCU V;  3CD6 V;  4KFM A;  3VOU A;  2A79 B;  3HPL C;  5HFM A;  2WLI B;  3OUS A;  2H8P C;  1R6N A;  5LHH A;  5EBW C;  2QA4 V;  4MW3 A;  1M56 B;  4OXS A;  1AI6 A;  5B1N A;  1R3I C;  1FXK C;  2ITC C;  4P2Z A;  1S5H C;  2JK5 C;  3SYA A;  4MT8 A;  3CC2 V;  2DYR B;  1K92 A;  2W6J G;  4R8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...