5E1GA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t208
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
351
structure length
351
Chain Sequence
b'LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 87
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5e1gA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5e1gA02
4JMXA 4XVOA 5K69A 3VYNA 3VYOA 3ZG4A 4GSUA 3U1QA 4QTFA 1ZATA 4GSQA 4LZHA 4Z7AA 1Y7MA 4A1JA 2HKLA 5E5LA 2MTZA 4LPQA 5DVPA 3VAEA 4K73A 4QRBA 5E1IA 5LBGA 3ZGPA 4HUCA 5E51A 4A1IA 5DCCA 5DC2A 5E1GA 5DZPA 4A52A 4GSRA 4A1KA 4QRAA 4ZFQA 5LB1A 3TX4A 5D7HA 3ZQDA 4JMNA 3U1PA 3VYPA 4HU2A 3TURA 5DU7A 5DZJA 4QR7A 5DUJA
chains in the Genus database with same CATH superfamily
1N6QL 1T4WA 1TNNA 1OSZA 4Q9CA 1MZZA 1A4JA 1DDTA 1T03H 3DRQA 3K2UL 4XMPH 1G43A 2P8PB 2PPAA 4U3SB 4D8OA 1TETL 4WI0B 5D93B 3T0ED 2WHVA 2ZWNA 4MXQC 1A6AB 4PJDB 1LDSA 3EG9A 5D9SB 2OMWB 3LH2L 5DQDH 5E1HB 3AAZA 1DVFB 1JZIA 2CHWA 1SY6L 3WFBL 4OM1L 5J06A 2QGEA 5EZLB 4M93B 4KDVA 4M1GL 3CSBA 3NK4A 4FQXC 2EH8L 3O8XA 1X5FA 2EDQA 4PG9B 2DYRB 1Z32X 4U6HB 3BLBA 1RULH 4GRLA 4O2FB 2KI6A 3GMOB 1HWGB 3B1TA 3PS6A 2JQZA 4L29A 2ZXAA 3DGCR 3RGVC 4PYGA 1ORSB 4BFOA 3TBYA 3US1A 3SY0B 4KFMA 2ESVE 2GK0A 3GBMH 1CTNA 1T20B 1SRDA 4FXGC 1O7SA 4Q89A 5CINL 4QHUA 3TBWB 2XT1B 4CRPA 3UOAB 2VTFA 5CEYB 2MHAA 1BQ5A 1FNFA 3MLUH 4DESA 4R83A 5JW4M 3H55A 1T7VA 5KSBA 1VCAA 3TZVC 3IRZA 2YS4A 5IHWA 4YSTA 4YVUA 4F33B 2O5XH 3WEAA 1OSPL 3D1MC 1HOCB 4YBQC 5IGXL 2WNWA 5AOIA 3BEVB 5I66A 1KYDA 3RTQD 4HS6A 4AEEA 3D5OF 2P9RA 2EXWD 5B1JC 3SOBL 2Z93A 4OGYL 1NEPA 3AROA 1JCVA 4FQHB 4AYID 3O3BA 1HJBC 5SWZE 2FCBA 3CLEH 3C09C 4DZ8A 1N8ZA 1YC7A 5ANHA 4LIQE 1XFPA 2VXTH 3GRWA 4N0UA 2KL6A 4J5VA 2QLVB 5LGJA 1WD8A 5CCKH 5TQ2H 3TO4A 1BBJA 1BM3H 2OR7A 2Q3AA 1EH9A 3HZKA 4HCRH 5DUPL 2A0LD 3EW3B 4JRFA 3HI6H 3KYKH 4NI3A 1V7ML 4AK1A 4RAVB 1QW8A 3OR6A 2GEQA 4MZ3A 4R0LC 1C5BL 3KZ8A 3PWNA 4OZHB 3SE3A 3GRGA 4DN3H 4FTDA 5FYKH 4XNXL 1PZ5A 3CFCL 2AKRB 3ZDZF 2FE0A 5FF6A 1J8HE 2E7LC 1FL6B 2YD4A 1FN4B 1EZSA 3NRPA 4A52A 2LQRA 5IK3B 1AP2A 5G4MA 4JUTA 1G0XA 3AM8C 2QDWA 1A9EB 4CC0A 2ZYRA 2EC9U 2OP4L 5EUOA 1H3PL 4FNTA 1QX1A 3VB8A 1WWWX 2VR7A 1AXSB 5DFAA 2XWJA 1YC8A 4NKIL 1RMFH 4NNXA 4JG0H 5B3JF 4GI8A 2Y5TB 4Z95H 1IRAY 1MIEL 5DJ6B 1EZLA 2F9BT 2H6OA 2X44D 5CCJA 3LIZL 4ATWA 1UB6B 3DJTA 4HS3A 1MH5A 3JWNC 3TA3D 3L1OH 4Y16D 5ISZB 2OTUA 2EVGA 4ZDHB 1MJ7H 1UA6H 2DWXA 3RKDC 5KSBE 3I9GL 3P30H 4NNYA 3S3DB 2WWKT 3C2AH 4J3TA 4LARL 3G6DH 2MOGA 4X98B 2HFGL 5EC1B 3VDCA 5A2BA 1LEKB 1T7YA 3K6NA 5CWSB 1C5CH 1MDTA 3H9HA 2E9GA 1XZ0B 3GJEA 2VE6A 4Q6IC 4ELKB 5KN5A 1U8NA 2B4CC 3NFNA 2VKWA 3U4KA 2Z8WC 3CFUA 1QSEB 2ICEC 5LXGH 5H94A 4XCNB 4CN6A 4CBZA 1FYTB 4MSWB 3OGCB 2DQHH 3WTSA 5DD5H 3ATDA 5LBSA 4W9HC 2BVYA 3QHZL 1UEMA 2Z91A 1JGVL 1AQ8A 2QR0B 1CFMA 3MBEA 2I24N 4BK5A 4N0UE 3Q5OA 1W0VB 1D5BA 1TFPA 3DKHA 1V7NL 4IMKA 3SBQA 1XTLA 4IDLA 1VFOA 1XD1A 2CKBL 2CO6B 1SNRA 5F9WB 3UTQA 2WBKA 4QHMA 2BVQB 3BLKA 4K7PH 3P9MA 12E8H 2E9IA 2QSCH 2DQDH 2QVIA 3Q7JA 1NBZB 5TPWL 3IFNH 5I24A 5F6HI 1OF2B 2FX9H 4QO1B 2VDMB 2DWDB 2GSGA 5EBMA 1BVOA 3CVCA 4XCCH 3ZE1E 1ZLWK 4CADA 4HCIA 2G3NA 4DO4A 3L5WA 5BV7L 3WS3B 2J3SA 4ANXA 5D71L 3TBTA 4F80A 2BCMA 1DJXA 4QRFA 5T1JA 3MLYH 5GS1B 2UZYB 1PLGH 4YR6B 3T3ME 4HUKB 2X4QA 4PRBA 3RWHA 2FR4A 1YAZA 1OAXL 3EGDA 4LCCA 4LF3A 3GHEH 3ULVH 1HHJB 2D7OA 3FU3A 4LCIL 3ZDYE 3L5IA 3MJ7B 4R26L 4Y5XA 3GSUB 2YO3A 1G5AA 2P8MB 4P4KC 2BVPB 4CUCA 1IC7L 2IANE 1XH0A 2E56A 1X7TA 4KUCD 4JZOB 3MODH 4XXDB 2DLGA 4UT9H 1WHOA 2UZXA 1XGYH 4X5XB 3I9PA 1F86A 2BH0A 1J12A 4HCFA 4MD4A 2BP8A 1JXFA 2H5UA 3ABGA 1AGFA 1S7QA 3MRCA 4MAYB 3C5ZD 2R4RL 2UVFA 3EOAA 2WNGA 4RRPA 4KKAC 3TEUA 3EO1A 3U1PA 5D7KD 5BO0D 1DVSA 2DM7A 2PETA 3IDJA 3NDYE 4ANUA 5CJ8A 3HRZC 2WAHA 3BN3B 4FTVB 5TQ0H 4P5TC 2F15A 4OLWL 5TE7L 1NCJA 3V7AG 4UTAA 1OP3K 1EMTL 2VAJA 4JZNB 1U36A 1E40A 4L8SA 2JVUA 2F6AA 3FFDA 3QEQE 1H8NA 2FX7H 2F7IA 1EVTC 3V5DA 2OXHB 3Q9QA 1CDJA 2MKWA 3SN6N 2GHWB 1PVHA 5FHAL 5C6PB 2JXMA 5TE4L 1CT8A 2GBTA 2B3IA 3IFPA 1S5HB 3GRWH 1T5KA 3MYJB 3O4LB 4H26A 4X9IA 3FO9B 1QLEB 4JFEA 5GGRA 2JJTC 1U8JA 1M6UA 4A2GA 4F27A 2XZQH 5LAPA 1AH1A 2IO5A 4U6YB 2ZKYA 2XV0A 3BVXA 5IB2A 2OI9C 3ASWA 3MLSL 4DUVA 5D6CB 1KYFA 4HXBL 3ETSA 3I6LD 4KMTH 4AG4L 4JO3L 3HC0B 2GHZA 1T0MA 3NACL 3KBPA 3RL2A 3G5XB 1DBAH 1M7DB 2ZX7A 4HWZB 3BPOB 4I3RH 2UX7A 2XDHA 1L9SA 3GXMA 3KLKA 4G43B 2HRPH 3IXAB 3FQTB 3QWOB 4AYBA 5BO1H 3BEWB 4N1EA 1U2YA 1FE8H 3BUTA 3CFDA 4Q0XH 4IKIA 4X42A 5DO2C 2IDUA 3T0EA 1L9TA 4FQIH 4HIPA 2IFFL 3QB7C 2ZX6A 3QUYD 1ZGLP 1PNCA 3DIFB 2WXOA 3UMTA 3EZ8A 3KG5A 2OSLB 5AVQB 1A1OA 1WAEA 4DKFH 2V5TA 5CGBA 4PHXA 5GRJL 2OMZA 3KVDD 4NT6A 3KPRB 4ZK8A 4O02B 3RGHA 1BEXA 3D25B 1OTTC 2NY1B 3HHSA 1MHPL 3JWOH 4OCSL 3REVB 3T2NL 3WJJC 4ZNEA 1L6ZA 1KJMB 5FECB 2LLLA 3BAYA 4IYKA 4D3CH 2L7EA 3AT0A 2F8XC 3SQBA 3KYNA 4CC4C 1RURL 2K9UA 2VLLA 1LEGA 4FJZA 4IBZA 1AXIB 4U6TA 1VFBB 5MERA 3A4EA 1IEBA 4YWGH 1IGYB 1DO6A 2W9DL 5J7CC 3TONA 3CFQA 1H6TA 3KWXA 4JPWH 4OH2A 4PH8A 4K3EL 1ET7A 5C0NC 2HH0L 2ZYSA 3RBSA 2ZP9A 3DTUB 5CIPB 1IC4L 2VLKE 3BW9A 3WFHA 1BF5A 2ZWSA 2P3YA 2HFFA 2WLKA 4AH2A 2R0WL 3W9DA 4HIJA 5HYSG 3VA2C 3RTQA 5A40E 3WO4C 4FYTA 5I75C 5GS2H 2WVVA 5EOCH 1B0RB 4IGBD 4GP8B 1IAOB 1E6JH 3T0AA 1VB9A 2GKIA 3DV6A 4DAGH 2J8UA 1T03L 3DWTA 5DHMC 2BMKB 3ZL4H 4XMPL 2FGZA 4KI5C 4NQDD 1KTDA 5DK0A 1EXUA 5CXPA 2NY4B 3CFKB 5I0YA 1UFUA 3LRGA 5DQDL 4HIEA 3WIAA 4FXTA 3REWB 3DX7B 1E28B 1SQ2N 3VXRD 3L1EA 3GS4A 4KDTA 3LN5A 4FZEH 4KXZI 3B9KC 4N2DA 1A4AA 4X6DF 4G6FD 4BFNA 1XBDA 1BPVA 3P9LB 1RULL 1BHGA 1I3RA 4NZJA 2HLFD 4XP4H 1CIDA 1VRSA 5B1BB 4YL4A 3ZDZE 1KLGA 2WGXA 4ZTOH 4XOEA 3FT1A 2Q87A 3X13B 1T3FB 3O0LA 5AFAA 1TQBC 5DQJA 4ZNEE 5DJ2B 5CFAA 1TTAA 3GBML 4WDIA 3VWJB 5DFWH 5TDPB 1OGTA 1RHHA 4TV3A 5HHXH 1KT2A 3MLUL 1YN7B 4ZW7A 1THCA 4X5WA 3LPFA 5J11C 5B3JE 3TA3A 5IMMA 2WN3A 2O5XL 4Y16A 2BS9A 4UTAH 2COQA 4AX3A 4FKKA 5AB9A 2WZAA 3GTTA 3Q2VA 1M1SA 3DHJA 2ITFA 5CBEA 1GGUA 4FG0A 3BIBX 1AOHA 1NOFA 3T77A 3IDXL 3CN1A 5L88H 2H3NB 2R1XB 1ETZA 2NQCA 5DMGD 3M7OA 4BZ1H 4MJ5A 3FT2A 4JL1A 4XNYH 2CM6A 3CLEL 3EJRA 3ZRSA 5ID0B 2YIHA 4XAWH 5DJ8A 3L4YA 2VXTL 2CLRA 4I3SH 5J8OA 3SDDD 3B6SA 2PPFA 3QUZD 4WQOA 3VGHA 5TQ2L 5CCKL 3S8FB 1I9RH 1BM3L 4HCRL 3RVTD 3II3A 4DSYA 5AW1B 1R6VA 4A1RA 1E2ZA 1QVOB 2EDKA 2VXUH 2X4UB 3HI6L 3KYKL 2QELA 4P2OD 2CQVA 2Z31D 1G7QA 4B95C 4Y8AA 3SBWC 3Q6FA 4YGVB 1TVHB 2PYED 3G6AA 4DN3L 5FYKL 3PNWB 4Y5YC 2YN5A 5KVEH 3T6XA 2YBGA 3JT2A 3MKKA 5FYKU 2DLFH 5AL0A 2RCSL 4F57H 1HAUA 4LVHC 2GVYA 3OX8A 3PAUA 2CHNA 4M6OH 3K6OA 3WCYA 3NH7H 3QNFA 4GW1A 3SEPA 1CO1A 4JVPA 4HUMB 1RMFL 2R27A 3TNNA 4JG0L 3APDA 4J2QA 3IJSA 4Z95L 4HZ1A 3U9WA 5AW3B 3VRIA 1KY6A 1HI6A 3CX5K 3SOTA 4TQHA 5IIEA 1K8DB 4P2CG 3L1OL 1A7PH 2ENSA 5JW5B 1QSFD 3QPKA 4DEPC 1MJ7L 1UA6L 2ESVB 1HQ4B 3QK0A 2EDBA 4YHNA 5G5DA 3P30L 3GHBH 4OI8A 4IJ3C 3C2AL 3DI3B 5CEZE 3G6DL 3K72B 1H5BB 2CIIB 4JKNA 4AQAA 2D3VA 7CGTA 1C5CL 1R75A 2VLMD 4ZXBD 2NX5D 1F11A 4U6VH 4R7DB 1WLHA 4X8JA 1JV2A 2ZUWA 2CE6A 5LXGL 5B38B 4PJ8D 1RFDH 4K9EH 4EZKA 1I75A 1I53A 2DQHL 3AU0A 5DD5L 3T1WA 1G94A 1AC0A 4RDQG 1EXGA 3X1BA 1JZ7A 3F7VA 4LSVH 4W9LC 2IWEA 4ZQKB 4ZSOA 3TWYA 2PW2A 3GUFA 1YUHB 2QFRA 5E08H 1BIIA 3WTXA 4Y2NA 2GIXA 1HYRC 4PRDB 3D07A 1U93A 2B5IC 5C0IA 5KVFH 1AD9B 4JQXA 1FIGH 4ODTH 5CSZB 1HINH 3RWCB 4A6YB 2OMXA 4K7PL 5DR5H 5IEHB 2NR6A 12E8L 2QSCL 2XTSA 2DQDL 4H2AA 3IKCA 4JFFA 3IFNL 4WW2C 3QRFM 1K3ZA 2FX9L 3ZKNC 4WTZG 4JHAH 4L5FH 4XCCL 1DJYA 1JPSH 3KPLB 4KKBD 5IFHH 3CQPA 5AW8B 1CICB 4U1NB 3OXSB 1TT6A 4NNPH 1A6VH 3OQ3B 1WAAF 4GT0A 3AT9A 4IRSC 3L9YA 3MLYL 5LJYH 4NKMA 4FNRA 4M62H 2OSXA 1PLGL 1J8HB 1G7IA 5HI3D 3GHEL 3ULVL 4CGTA 3RILA 1RZ8B 1AHKA 1TCRB 5H2BA 3OAUH 3NCXA 2L7UA 4PJIF 1F42A 3P4OA 2FJGA 1CG9A 4QWWD 1A6WH 3FUIA 4IU3B 4DZBB 3RDTC 1Z5LB 3EYFB 3PQYE 1VACB 4MRBA 3MODL 3SHSA 4UT9L 2EEXA 3ARRA 1RU9H 3ISYA 1XGYL 2OJ1A 1KTRL 4AZ8B 1C12B 2C1PA 2WQRA 2MRYA 1OIOA 1AG6A 4W9KC 2FQFA 3O3DA 4KO7A 4FJYA 5KSBB 3L6FA 1EO8H 1NLDH 1S7VB 4OGQC 2XUWA 5TQ0L 1NCAH 3P2TA 2BW4A 4G1MA 3VMOA 3L3KB 1WUZA 1OCCB 5D7KE 3ZTNH 5LXVA 4TVPD 3FW6A 2Z6FA 2B1AH 5ITFB 1UD3A 2Y7OA 5BRZD 4K3HA 3KPMA 1OE1A 1RUAH 4QYOA 5JYMA 5KYNA 1SBBA 1WF5A 1EGJA 2BOLA 2FX7L 2ED6A 5ICYA 1ACCA 2H0PA 1OLLA 1DUYB 3D4YA 4WV1C 3DK0A 3D06A 5EU4A 3D0LB 5DRXB 1ZWIA 3X11A 1QUNB 1WA1X 2CO4A 3GRWL 3QIBD 4NAQA 4KXZH 3HR6A 4JFFE 2YAQA 2XQYA 1MHCB 2KLTA 3SB3A 4W6WB 3BP7B 1IGFH 5T1DH 4UNIA 3DV4A 2KKQA 2XZQL 3QFJB 4N8VB 1O9ZA 4UQ2B 1FHNA 5JPNA 4X4XA 1XR9A 4YZFE 1NMCC 3BPCB 3FQXA 3PP3H 3T3PF 1GKOA 2QLYA 2DJ4A 3W5NA 4KMTL 4TUJB 4ZD3L 5MEPA 1AP2B 4HIIB 4IGBA 4K94H 3EJUA 1DBAL 3STZB 1ZAGA 4I3RL 2DWYA 1K8IA 3T3MB 3AG2B 2HRPL 3NJLA 1ED3A 3MRMA 3INOA 5BO1L 1TG8A 3BT0A 3APMA 4Q0XL 3SZKC 3ZDYB 4N0YH 2WIIB 1BXXA 2FJHB 4JM4H 3S37H 2EH7H 4FQIL 1UJTA 5G2NA 3ETBF 5ABAA 1FZOB 2B8OT 5TE6H 5FA4A 2IANB 4TLTA 4HS3B 3TBSB 4B50A 3MU3A 3VJ6A 2Q2EB 4DKFL 3VXRA 5KBKA 1GKEA 5MEQA 1BREA 5HI4D 5I19H 2F58H 1RZIA 1A7NH 3EFFB 5LN8A 2WMPB 3ES6B 1TMCB 3MBXH 1ZD6A 3ZKQD 2NY3B 5FM4A 3JWOL 2NUTB 4GXUN 3U9UB 1FFQA 2DZEA 4D3CL 4NEHB 4HKJA 3ARWA 1TR7A 2YSSB 4OFKA 2E6QA 2YRZA 1DVYA 3LQZA 4WSKA 4YWGL 2AEOA 2WXLA 3QCUH 4PJHF 2VSDA 5DMYA 3Q1EA 4P4RB 4JPWL 3QHTC 3WS6A 4OFDA 1KXHA 4L8BA 2AV1A 4NQSA 3V4PB 5I0WA 3G5VA 3SGKA 3QEQB 5JMRA 1U8KB 5E00A 4UZUA 2V5SA 4H8HA 3FCTB 1A6PA 3EF7A 4GJTB 2EDDA 3OZLA 3IS0X 2A4EA 3MYZA 1E43A 4KROB 5AVXB 5DJDB 4ZS7H 4MA7H 1M71A 2EIZA 2EUWA 5DD3H 3W11C 3LQAH 2VGLM 2QPDB 4G7RB 4JVUA 4LOFA 5EOCL 3HI5H 3KLHD 4RZCA 2FEEI 2JJSA 1E6JL 2YBRA 4PJFF 4EMZA 2WBJC 2HX9A 3P4MA 1FH5H 1HXYB 4DAGL 2F1BA 4N9OB 2FBRA 1QLRB 1U91B 3FMGH 3ZL4L 4RGNE 1T1XB 1SF5A 4KK8D 3PFQA 1QD0A 4IQHA 4KKCC 4HOMA 3DO7B 3RA7H 4PRBB 3QUZA 3IVKB 3PPSA 4RDQF 4QXGH 5E4IA 3SO3C 2WM0A 5H35A 5LAXB 1S6NA 1L7IH 1CLVA 4ZMNA 2Z31A 5C8JB 4KRMB 4Y5XB 4K4KA 3LRLA 4FZEL 4APXA 2BOCA 4FQLH 2JB6A 2AJZB 1IGCH 2PYEA 5CU9A 5D2LA 3JVFC 4LCYA 2A9DA 1JRHI 4J4PD 4HF5H 1OY3B 3GJFH 1YECH 4XP4L 3VGFA 2B2XH 2NNXA 4S0TD 1JD7A 4ZTOL 1RZGB 4GUPB 5KSAB 4PI2A 1T5WA 1Y0LB 4GRMB 1FJ1A 4H25B 2G2NA 4TNGA 2HT4D 1TPXB 1JIBA 1S5IH 1I85A 4KKPA 3BPLC 5HHME 5HHXL 1GW0A 3KLAA 1OAQH 3UZVA 2L0DA 1TU2B 3QYMA 3MCLH 1NCHA 1LE5A 3VVVA 4WFHE 1Q9OA 4UTAL 1QSFA 1TENA 5CMAA 4XVTH 5EOQH 3LJ3A 5ESQA 2QSQA 1W80A 2WP3T 5ESAA 4J3XA 1XGTA 5L88L 4CILA 5AKRA 1FVDA 1NGYB 5HD8D 2C4FU 1SQMA 3BAIA 4BZ1L 1TTUA 2VLKB 4XNYL 2V2XB 4ZXBA 2NX5A 4Z7QF 3BRFA 1P1VA 4OW6A 3T4YB 4BQCA 4P57B 4BKTC 2HN7B 5T5FH 4XAWL 4I3SL 4PJ8A 1WIPA 1AXTH 4ICXA 4I8DA 1FZJB 1YDPB 1DCEA 1I9RL 4JAMB 4U1IB 1VDGA 2CKNA 5MHSD 3RZWA 1SXCA 3I6GA 2CGZA 1T7ZA 2VXUL 1Q0EA 3E6FA 4ZZKA 3NFPB 5E6ZA 4MHHG 4JDZB 1ZOXA 4KY1H 3IMSA 1MFUA 4GXVH 3CWGA 5FFOA 5CILH 2EKSA 1WGOA 4M8RA 2EIJB 5KVEL 3PFUA 4EN3C 2MEJB 4AJ0A 1JZHA 2DLFL 1JMZA 1Z9NA 4F57L 3NFSH 3V0AC 2AXHA 4D0BA 5D2LE 4LLMA 5EEXA 2XXCB 5DJAA 2VWEC 3CC1A 3RI5K 3WKYA 1N12A 3GHPA 2QJDA 1LO2H 3NH7L 3D12B 4H8WH 2BNRA 3LXBA 4P5KB 2RGSA 1IC1A 3RUGF 1BJ1H 3W57A 2DLTA 1Z9PA 1WAAE 1GGTA 3GT6A 2CD0A 1ZTXE 4AGMA 4D0DB 1GSMA 3U2SB 1QG3A 3OM3B 4KY2A 4ZOAA 4NT6B 3GSRB 5B4MD 3ZDZB 3UAAA 1ZS2A 1KG0B 1A7PL 3VM7A 3OJVC 3ELQA 4KOBA 3HG4A 2ZTBA 5C0AD 1JK8A 1E5AA 1WQVT 3BSGA 3KYNB 3GHBL 2G3ZA 4OGZA 4PJIE 3TN0D 1ETA1 5DMJB 1QSFE 4WI8A 2IEPA 4K71C 3A4DA 1MEXH 1NTDA 3QO1A 5AW6B 1H8OA 4U6VL 1WFUA 1JV5B 4KXAA 1KJ3H 4N5ED 2W65B 2B7DT 3GSNA 2AEPH 5I1LB 1RFDL 3KE0A 4HISA 4K9EL 2UXVA 2P8LA 3BW9B 3WFHB 1DBKH 2ALAA 4Y9FA 2ZF9A 4HMCA 3HNSH 2O93L 4LRIC 4LSVL 3HLKA 4CVUA 2VITA 1U3ZA 3RGVB 5E08L 3OAZH 3VD0A 5BJTB 4FQJL 3FHQA 2ZOWA 3UGXA 4DPCX 1NGQH 5I76B 5KVFL 3DK2A 4ODTL 1FIGL 1HINL 1V3JA 4L48A 43CAB 4CN1A 1CF1A 2J20A 3S36X 5E4EC 5DR5L 3DV6B 2OM5A 1TKWB 3FONA 3LKOA 4ZAKB 4XMTA 3LZQA 4ZODA 4F7CB 4EXPX 3CQFA 3ARGB 3DARA 2J1KA 4JHAL 4L5FL 4PRHD 5FKAA 4EOWH 1KTDB 4WIQA 5FO9B 1JPSL 4MMZA 1EXUB 5IFHL 3RJQB 5CBAA 3ULUD 3QIBA 5J6HA 3PHOA 4NNPL 1A6VL 2V8MA 3HKZA 3OMNB 1EFXD 2GT9B 2P7TB 3CFBA 2P24A 4M62L 3II1A 4AENA 1UTDA 1MCOH 4E9WA 3S37X 4MXVE 1T1YA 3AS3A 2GC4C 3APNA 4PYHA 3TM6A 3V52H 4XNDA 1LNUA 3FT4B 2Y1VA 4RFNC 1RSFA 3VFOB 3JV4A 5AW0B 1I1AC 4C4UA 4ETQA 2BNRE 3OAUL 4MMXA 1OARH 3KJ4B 3A6CH 4J2XA 3GINA 2VR5A 5LQBH 1A6WL 3T3PE 4POZC 3WTUA 1WFJA 4PGBA 2DI7A 3UTSD 1K5NB 2RB8A 1ZHLB 1UWEH 3G6JF 5EO1B 4F9PA 1G9EA 1RU9L 4G6AC 3D09A 2X41A 2VUKA 5EZJB 1O5PA 4JY6A 4YSUA 4XI5D 3ULVC 3GM0A 1RHHB 4KC3B 4N6RA 1FFOB 3QEGH 1HN1A 3QG7H 4PHZA 3WLBA 1GYWA 3O8XC 1EO8L 1NLDL 4KX7A 3SDAB 4GRLC 1NCAL 4FG6C 1DN2A 1J5DA 1J8KA 3BZ5A 1QTPA 4DH2A 4XBEH 2H8PB 3T77B 2B1AL 2JH2A 2PNDA 2Z4QB 3QAZC 1HWHB 4UQBA 5CGYC 1RUAL 4G82A 2P1YA 2EZ0C 3EIFA 1AHWA 1B88A 2WTRA 1XSJA 3DSNB 4OFYD 2NY0D 4GQZA 3ZTDC 4ZI8A 3CHRA 1BXAA 5B7EA 1XMEB 3QULA 3M45A 4KVNH 1N5AA 2DTSA 2CLRB 1TVBB 5D96B 2NNRA 3RPKA 5M7QA 2DLIA 1KIQA 3B6SB 5F7EH 3GXIA 4N0FA 1GSKA 4X9GA 1UASA 2JCCF 3CG8A 3TO2B 4ODWB 4W9IC 1IGFL 2YD7A 3D4GA 3MX0A 4LSDA 4C83B 5T1DL 1JRHH 4FXKA 3SD5A 2X9YA 1BZ8A 3CBRA 4FNSA 2D31A 2V4LA 3RX7A 5BCAA 3LZLA 4RFEB 1V3KA 5FA3A 3G6AB 4FE9A 3WAJA 2R69A 2I25N 4QR7A 5JIMA 4Q6IB 3V0VA 1KPVA 1FNSH 4Q6KA 3CLFH 5T8IA 4I48B 2DM2A 4R6UA 1A9BB 5GISH 2JI3A 4ZFOA 4K94L 3BSHA 3CFEB 1CS6A 3GMPB 5DI8B 3TO4C 1CFSA 5C1MB 2XLLA 1V54B 1A6TA 4UILH 4PJFE 1NZRA 2NQ3A 1QPPA 3EOYG 3KWVA 4N0YL 3MV11 1TZAA 3DVGA 3MOAH 4JM4L 4M48H 3S37L 5JORA 2EH7L 2NZ9D 3SE3C 1HHKB 4NPJA 5F8QC 5BZWB 3Q8CA 4FFYH 1NCTA 3LCYA 1HI6B 3D08A 2VSCA 1BFTA 3NZ8A 3PQYB 1CYWA 4YSQA 2UYLA 2BLFA 2WQSA 1D3CA 1LYQA 4L9LC 3VGGA 3VXTA 4CAGA 2HJLB 4PWGA 5I19L 3CZNA 2F58L 5G5DB 1A7NL 2Q10A 4HIHA 3WJMA 2XA8H 3MBXL 4OVVA 3CZLA 3UGUA 2ICWB 3OQRA 4J4PA 4DPBX 2WK2A 4RRPG 2NY2C 1MRDH 4FLQA 3W56A 2R9HD 4LFHD 3QJHB 1QI5A 4PWJA 2YD9A 3CV5A 1Q9WB 3T6ZA 2WO3B 1VEMA 7TAAA 4AL8H 4JDVA 2EIBA 1L3WA 2AABH 2D9CA 5C0CB 3QCUL 3KPOA 4RCAA 3ZZSA 3Q5TA 4MX7B 2PW1A 1LLAA 1E9QA 1VENA 4PN6A 3DTDA 2IWKA 4AUUA 1BIIB 2UY6A 3JWOC 3UCRA 5FR3A 3HZVB 3B9EA 4HG4J 4TVPH 5C0IB 2IPUG 1GYCA 2WXMA 2XICA 4ZS7L 4MA7L 1EJ8A 5DD3L 4JFFB 2DOCA 3LQAL 3RWIA 3A4FA 4CW1B 3HI5L 1NBYB 2DIEA 3UZQB 4PP2B 2JB5H 1LEIA 4ENEC 2CK0H 3KWWB 3HRZB 2NW3B 4N2HA 3AB0C 1FH5L 4LLWB 2CLZA 1R3IH 1FHGA 1HEZB 3MBEC 4AGLA 1I7RA 1ZHKA 3WXWH 4KQ0A 4HS8H 4U0QB 1OD7A 3RA7L 4IMKC 3OAYH 1JZ3A 2VZOA 5ERWB 4S1DD 1Z9MA 4QXGL 3NCFB 3MQIA 2B1HH 2WNXA 1L7IL 2Z7ZA 4W70A 4BZ2H 4L8CB 1NANI 1AGBB 4FQLL 4YC2C 1IGCL 1U8HB 4AT6A 4Z76A 1MWAA 1TMQA 5EWIH 5FV2A 5IB3A 5HHNB 1YECL 1YSOA 2B2XL 1VEPA 2VLRD 3RNQB 2ATPB 3L3JB 2CALA 5E8EA 4LCCC 5EIIG 1FCGA 3GZPA 1ZT4B 4IBTA 3A5VA 4V2CB 3THMH 1S3KH 5F0PB 3F85A 1S5IL 3QPQD 1X4YA 1UFGA 2XV2A 1FG2A 4XP5H 1OAQL 4N2EA 4PV9A 4BD4A 5GS3A 4YHYB 1Z1WA 4H8VA 3RUGE 1NKRA 1LO0H 3OAYK 3JUZA 4GMSH 1HKFA 4I9XA 2PP9A 1PZDA 4XVTL 1BX2A 2XXMB 5C0AA 3I74A 4NRZB 1R24A 4KTDH 3TN0A 2C7UB 2KZBA 1KENH 1R3LA 1TITA 1E4JA 1FNLA 3G9VA 3JTSA 2ARJB 3INUH 1ASPA 3NJMA 3TESA 2BIPA 3SKMB 5FO8A 5T5FL 3W9EA 1FL5B 4H0IA 4AVJA 4ZOEA 4ZOCA 3DV4B 1AXTL 3RHWK 4DCQB 2PXYA 1BM7A 4B3VA 4L8SC 2MPAH 3U4EA 5FUCE 1WYJA 3QXAA 4WJ5A 2R69H 3TYGH 1JF6A 2YD3A 3A23A 3C6LD 4KY1L 2XXFA 3R8QA 4GXVL 3D0AA 1MFVA 2J2ZA 5CILL 3P40A 4WFED 3I6SA 1PNDA 1ED3B 3UYPA 4PJAF 4H1LB 5DJCB 3WE1A 5K1JA 3H0TA 3EJYD 3QJRB 3NFSL 1ZMYA 2P46B 4PRHA 1HH6A 9PCYA 2FH6A 4PD4K 4R2GD 1FAKT 5I2IA 5GSRB 1LO2L 2QSTA 3A0OA 4H8WL 5FA4B 2F53B 5B8CB 5JHDD 5AYTA 3RFZC 3CIQA 1A64A 5E56A 6PCYA 2EQDA 4OLEA 4YNYA 4KBPA 5KTEH 4WKZA 1YQVH 3VYOA 4P99A 1O6VA 3F6JA 2F7PA 3OSVA 4AMKH 5IROD 1DQLH 1TSHA 3L54A 4AM0B 1LO4H 1F56A 2RBLA 4XN5A 2AQSA 2WLIB 1E5UI 2P5WD 1E8WA 2ZCKH 1XZWA 4G2AA 4IBLT 1KXVA 4XN8A 1NCOA 1Z3GH 3T0EC 4JHZA 4PWFA 4X7FC 5KUKA 3L3OB 1XF4A 3LVTA 5C0JA 5EDXA 3FU0A 2V5RA 2H32H 1MEXL 2CO1A 4X8CA 3QDGD 1E5BA 5ICUA 3H1ZA 3QORB 4UU9A 5C0AE 3QCVH 2GIYA 2QL1A 4YVNA 2V2WB 1KJ3L 5AYQA 4H20H 4P2AA 3E7JA 3TU6A 2AEPL 3C8HA 5J6GA 3NSXA 4J8RA 1DBKL 2VR4A 3FQUB 4ZUUA 5C0DA 4AYSA 5I6XC 3HNSL 4KX8A 2UY7B 1IBBA 4IRJD 5H8DA 3HN8A 3MNVB 2PCYA 5DRWA 5HYEA 4NC2B 1AR1D 1TQBB 3H85A 2D3LA 4HUVB 1SVCP 1NGQL 2VZTA 5C6WH 5IUCA 3IPBA 1KPRA 3P3UA 4AW7A 1DQJB 4QHKJ 3S5YA 4S0SD 3VWKB 1PW3A 2NXYD 3R0MA 4OFYA 2WZ6A 3P4MB 3RVXD 3ZKSD 2GTWA 1QA9A 4XNMB 3BZEA 1JGLH 1KSRA 1V8HA 4EOWL 5ESVA 3GXFA 2C4FT 1T22B 2GJ6D 2ZJSH 2DMKA 2KHAA 4KXDA 3MCKB 2IFGA 2H0EA 3C60B 4PRNA 1SEBB 4DP0X 4BUHA 3KDMA 3EBHA 1J1XH 4PRHE 2ZXDA 3PWVA 3TIEA 3RNKB 3RTQC 1MCOL 1I7UA 2ZCLH 5H35B 1KXTA 4GQRA 2X2IA 3QYCA 3ULUE 3GQFA 2JCCE 3V52L 1SM3H 5DURD 3GSQB 5AG8A 5GRZA 3DO4A 2JSFA 4NRYB 3UPAA 1ZVSB 1FGVH 2RACA 4LCYB 1OARL 2E74C 1MWAH 4F7TB 3A6CL 4AGNA 5LQBL 4JHWH 3BZDA 1BVNT 2BW5A 3D30A 3VI3A 5MEOB 4GSQA 1SHMA 1UWEL 3L1FA 5ABZA 5FYJD 2A0LC 5BUAA 3TVMA 2G5UA 4IHOA 5EEZA 5GGVY 1X5ZA 1FF5A 2F8OA 4KDTC 3R7QA 4Y19B 2KDYA 3QEGL 1F6AA 4FNQA 4L2LA 4LPTA 3QG7L 3EFDH 5HYSB 3IDNB 3I75A 4L3CB 4JG5A 5EEYA 4PJIB 1C8PA 3BP5B 2FEEL 2GABA 3MJGX 4C4KO 2R23A 3QQDA 4PJBA 5I1AA 5M95B 3TT1H 3OKOA 5J13C 4XBEL 1E3FA 5F1KC 2OZ4A 5F9DC 3UTTD 3GBDA 4LNVA 3OKLB 4G42A 2X4OB 3QHFH 3QIUB 1RZJH 2DL2A 3QRGH 4DW2H 1BOGB 3LZRA 2VZVA 1CLZH 1O7DE 1SMOA 4KVNL 3H6AA 5F96H 4JREB 2NY6D 5LO7A 1NBQA 3TA3C 4L0PB 5F7EL 4Y16C 4WLCA 4NO3B 4QI3A 1UKSA 5INDB 1P1ZA 3GF8A 4ZMVA 4YGAB 4R9HA 2P43B 2BSCA 3LNDA 4JFPB 4J27A 1UM4H 1E4KA 4CKVX 3PL6A 2WTPA 3L3IB 2VC2H 3F05A 1PSKH 2X2YA 4I89A 2OLDA 5KAQF 1RKRA 4UDTB 1S7XA 2ZUQB 1FNSL 3ABKB 3IN0A 3WNIA 2YLKA 3CLFL 3SCMB 2ED9A 2VDPB 2VQ1A 1MCPH 3U9PH 4LCWE 4GG6F 3BWAA 5I1DA 2R4SH 3OMAB 3FB6B 4QHLB 4ZZFA 4WUUE 5C0RH 2B16A 1G7LB 4UILL 2HPTA 4EI6A 2BNRB 1VGKA 4PI0A 4WWKD 3KYMB 5E70A 4RWYH 1F1AA 3MOAL 1NC4B 4M48L 1I8MB 2C9VA 1J9TA 1PYWA 1ZV2A 4LGPB 4PTUB 4FFYL 1W8EA 4YFDB 2OYLA 3T3PB 5BOPA 3U36A 2OYMA 4PLOB 3RWJA 5E24E 2X1OA 3AU1A 3QXDA 1I8UA 2HJFA 3KEHA 1MFAH 4HJUA 5DK2B 1BA9A 3HE7D 1D5RA 4P46A 5E2TH 5F9AC 3F65A 2XA8L 4DP9X 4HX1B 4EI5A 2PR9A 2XV3A 1MRDL 4M5YH 1IV8A 3IGKA 1T0PB 3QO1B 2DN7A 2JELH 4X5RA 2VLRA 4KRLB 4ODUB 2PYFB 1F02I 4PIRF 2EDEA 4AL8L 5IZ7A 5EU7C 3QUMA 1HHIA 4M9OA 2AABL 5B1AB 1MJJB 2Z3FA 3MCG1 1OAKH 4PSRA 1CQKA 5T5NF 2IMNA 5F71A 5ABDE 3P9WB 4MTMA 1MLCA 3I84A 5FXCH 2WJ5A 4Z7OF 2VJ0A 5HDWA 4ICWA 4I13B 1GOFA 5BV7B 4HXAH 3ZVVA 4LSSH 4KK9D 1JI1A 3NN8B 1DLFH 3ZHFA 1SXSA 4X6CF 2OMUA 4RMSA 1XD0A 4JFDD 4TVPL 3IMBA 4KHXH 3DTXB 3LDBB 4JRYD 4BQ9A 4MCMA 2VMDA 5DS2A 2XQYG 2ZUTA 3T65B 1QP1A 2A7BA 1DCLA 3C5ZC 1M7IB 4PJHB 1F4WH 2JB5L 2YFNA 2FO4B 3MR9B 1TJMA 5CEXB 1LP9F 2CK0L 3FTXA 3VXMA 1J11A 4WSGA 1I7ZA 3FQNB 1R3IL 4XZ4A 2YRBA 1R5WA 1T7WA 1Y18B 1ID5I 3T04D 4L3ED 4V11A 3WXWL 4JRXD 3CC5A 3GZKA 4HS8L 4OGAD 4NENB 3DPBA 2XBTA 2CO2A 3UBXA 5A6LA 3TF4A 4RGMB 5FCUH 2H47C 1WZMA 2EINB 1H3XA 4JQXC 2R83A 3RX9A 4ETQB 1RUMH 3LQAC 2B1HL 2HXAA 1KLUB 4Y1TA 5F8RC 1FNGA 4DO6A 5I30H 1QNIA 4BZ2L 3FTWA 3WXVH 3C6LA 1OHZA 2YGQA 4PJFB 4DOHE 3FRUA 5DJZB 5EWIL 4GSUA 1FYHB 2K7QA 1QHOA 4IBVA 5CP3H 2MQGA 4UIKH 3PV6B 4PJAE 3PUCA 1TZHA 1SZNA 3AQDA 4PBDA 1N4XH 3ZQ9A 4LDCA 1P6FA 3R8BB 4DK5A 2CUHA 4F15C 1E30A 5A7BA 5HVHC 1W16A 3THML 1S3KL 1PKQE 4IW4C 3VFRA 5JHDA 2EE9A 5DDHB 4BK4A 4PB0H 3FTSA 4QT5B 4N2CA 4QRSB 4BUQA 1UZ8B 5J1TC 1NFIB 3VYPA 2YAHA 3HG2A 4XP5L 4EQ2A 3TH4T 3LOWA 4UANA 1DANU 2DQCH 5IROA 1E50A 1LO0L 1SYSB 1ROCA 4GMSL 1JZ2A 1P7BA 2GG1A 1I1YA 2P5WA 2OZ4H 3F7KA 3LAFA 1TDQA 3NCCB 5DEZA 1MCNA 1BVLA 5AKTA 4ZRGA 3VFMB 8PAZA 4KTDL 4LLQA 4DJMA 1KENL 5FOBA 5JNYA 1XGRA 1FDLH 3KXFE 4NBXB 3QUYC 3INUL 3QDGA 2GTZA 4N0FB 2CJUL 3TNMA 1X9LA 3K91A 4KPHH 3KM1A 2OJEB 1MLBB 1A22B 3QS2A 2CIKA 2LTQC 4XMZA 3QAQA 5AW4B 4PGEA 4QRRD 3VXME 5DFVD 1V5JA 3BJ91 2MPAL 1OGSA 4DKTA 4LNRA 1MHHA 4KKNA 4JDEB 4S11A 3X1NA 4K3JH 2R69L 5KVDL 4WK0B 1RZKH 3TYGL 3V0VB 1E4WH 2N4IA 5FIEA 1AQKH 4NZTH 1BZ7A 4ZFOL 3MRRA 3O9WD 2X4SA 3ULSB 3FRPG 4Z7QB 3CN3A 5EDSA 5BW7A 2JK5B 4ODXB 2BVTA 2V3FA 1NIEA 2GJ6A 1J87A 1GL4B 1JWUB 1N2RB 5CP7B 5IQNA 3NZHH 3VRLE 2P44B 5JPNC 5F7HA 2NW2B 1R17A 1A0QH 2WUCH 3T0VA 3BIKA 5KYXB 3D48R 5KTEL 1QSVA 3ILQD 1ZXKA 2QADD 1V55B 1YQVL 4RQQB 4IGBC 3MFGB 1QKZH 3MRLA 4X6BA 1F3DH 4BSVA 4AMKL 3AQXA 1DQLL 3KGUA 1LO4L 3MROA 3MJ8B 4G8AC 5JHDE 4B27A 3GD1C 3KLDA 5L8JB 1OB0A 4AZUA 4TNWF 1UEYA 2ZCKL 2XKNB 2Z0UA 5JPMC 5C2UB 4L1SA 1KWKA 2HAZA 1Z3GL 5M94B 4OZIA 5FB8B 1CFTB 1XH1A 1VSCA 2P5WE 2Y1YA 5AUMB 5BZDA 3SO3B 1UXMA 3RUGB 2YPLD 3QCVL 4WAFA 4Z7AA 4ZOBA 4BKLB 5B7MA 2ZICA 4H20L 2E3VA 3IAQA 4AJVA 4D94A 1TQCB 1E67A 4Q58C 4C59B 2EUZA 3ARFB 3W0WE 3KLQA 3UIYA 5A6IA 2CSPA 2AAAA 1TEGA 5CLWA 2J43A 3ARVA 2HLFC 1FFTB 5EHFA 5EF2A 2GBVA 4B53A 5BXFA 1M6OA 4XO9A 1SYVB 1UXSA 2VISB 2YPVA 3FT0A 4I18A 4MD5B 2F8IA 2BZ7A 1CE6A 1GGYA 3TV3H 1IC0A 2HT2D 4LESA 5FV1L 3UTTA 4K5NA 3S5LA 4NS0A 3F5WA 1CBVH 5I23A 5J12B 1HWWA 3W1ZA 1AZNA 5F3BA 4HMEA 4AIOA 3WS6C 4AEHH 4EVNB 5IMLA 1IEAA 5T1LD 1JGLL 1T66D 2EDOA 1I7RB 2ERJB 3SGKC 3CVHA 5DUML 4LXFA 3B3BA 1HX0A 2ZJSL 1M05B 5D2NC 3OXRB 3FB8A 2EVJA 2OKMA 3IF1B 1J1XL 3ZO9A 1E5CA 4OF3A 2YEVB 1ZLVH 1NCNA 2ZCLL 2Y22A 2D7TH 4HJSA 3V4LA 2BHFA 3M8OH 1AE6H 3FC8A 3RI5F 1LE9B 3SYCA 4GAGH 3ZMNA 1SM3L 1XIWA 2FUTA 4ZMQA 1OGAD 4KZ0A 4GQ9L 2ITEA 4QJ3B 2YOAA 5DMGC 3GBNH 2Y25A 3ZT6A 1FGVL 1YEKH 1MWAL 2HPOA 1OM9A 3OHXA 1KY7A 1QWHA 3QJZA 5FO8B 5JUEH 4FQQB 2QKIA 4JS7A 3IFOA 3GMMB 1MWOA 1USZA 3SDDC 2ZXQA 3QUZC 3MLXH 4NBYB 2R2HB 3BXNA 3R1GH 3RVTC 1IGTB 1PBYA 2XN9B 3PE9A 1P2CB 3H3BC 4GG6E 4P2OC 3BP6B 4MA8H 4WWKA 3NIGF 4OZIE 2Z31C 5JO5B 3FAWA 2X89D 2BXYA 3KH4A 1CN4A 1RI8A 2H4EA 3EFDL 4W9GC 4TNEA 4BQBA 3VYNA 4L3FA 3LN4B 4Z0XA 2Z34A 1JWSB 4X8GA 3TT1L 3WNMA 4Z78A 2PUQT 3POHA 3G6JB 5EOTA 4D8PB 4DVBA 4JY4B 4KTEH 4F8QA 1BVZA 1R3LB 1JL8A 2R59A 3WG7B 3CHXA 4HULB 3QHFL 3ZGIA 1MI5E 1RZJL 3QRGL 1KIRA 4DW2L 5GGSB 5ICZA 4GAYA 3K4ZA 1CLZL 4RNRA 4X0KA 1INDL 1QBBA 5F96L 2X4NB 3EH1A 1XF5A 2AJUH 3NCJH 2Y1AA 2OULB 1OALA 2BNQE 3FN0H 1J9QA 4NC0B 4R7NB 5ALBH 2PXYB 3F00A 4FHJA 4CSTA 2DQMA 5SWSD 4Y4KD 3SY6A 1ZLSH 2JWYA 1EHXA 2FWOB 5ID1A 5KS9F 1BFOB 3V7MA 1ES0A 1KTBA 1RH8A 1UM4L 4B5EA 4Z7OE 3GMLB 1RK7A 2VC2L 2CBPA 1L9MA 1PSKL 4K71B 4JFDA 4Z6AT 4ZO6A 1UOVA 3UC2A 2QPEB 3BFQG 1CL7I 4ZXBC 4X6CE 5CZVH 2AJ3B 3VFSA 4N90E 3ML8A 4NO0D 4NQXB 1MCPL 5KSUA 3U9PL 2K8QA 4PJ8C 1GW6A 3ZL2A 1HH6B 3TBVB 2OR8A 2R4SL 3FUDA 2JCCB 5BS0E 1S7UB 5ITBH 5C0RL 2VJXA 3Q9PA 3ZHLA 1XH2A 4FLSA 5T3XH 4UAOC 1LP9E 3GGWA 3LKNA 3EJZD 3LKRB 4JRXA 5FM5M 2GSIA 1JGEA 3FB5A 4RWYL 4Z77B 2Y6TE 2LFEA 4N2NA 4YNYB 2R29A 1I8IB 3OJDA 3KCWA 4WKZB 2DEYX 4Q9RH 3NSDA 2C8NA 2GK2A 2PWDA 5I8EA 1CBJA 4HG4K 1MFAL 3VXQA 3EKCA 1X9UA 1LM8V 3FO2A 3H9SD 4KTYA 5E2TL 5F44A 4KKBC 3UBGA 1GMEA 1XF4B 4GUQA 3J8F7 5IJVA 2MOVA 4M5YL 1S9YA 1JK9A 3D6GA 4W9JC 2YOCA 4WK4B 3S96A 3D18A 2JELL 3EYOA 4M5TA 4PJGF 4W4OA 1MVFA 5FYJH 3IWVA 3NJJA 1MG3C 1R3HB 4CVWA 5HI3C 4RFNB 1Q0YH 1U92A 3KAAA 3UO8B 3UJIH 3QZWG 3CXDH 5CJXC 3PRZA 2FSEA 2ZAGA 3VD2A 1OAKL 2XV6B 2Z7WA 3CU7A 5MI0B 2OCJA 3EXLA 4IK6A 4QWWC 4OSUH 4NERA 3MLTB 1ACYH 3QNXB 1P4BH 4HXAL 4LSSL 4A7GA 1JZFA 1DLFL 3WDJA 3MGOB 3WENA 3GDBA 1NC2A 3FKUS 1OB1A 4KHXL 1T04B 1VJSA 4RESB 4EBQH 2BNUA 3MJWA 1IM9D 4OUUA 2DEWX 4KXBA 4JFDE 2Z9TA 5C2BH 1F4WL 1S4IA 2KZWA 1KLFA 3FU7A 4IMLB 4PBVC 3U46A 4Z7NF 4PRNB 5CU5A 3HZ3A 4WGWB 4Y4FB 3LEXB 5DJXA 5IR1A 2NPLX 3KPQB 3MOBH 4QRRA 5FCUL 3MFFB 1RUML 4EIGB 1ZHBB 2PCXA 4LCWB 5IB5A 5I30L 2RTTA 3VSTA 3UJJH 1Q0XH 4WUUB 5HY9A 3WXVL 5AD0A 1XBRA 3TPKA 5FDWB 3CVIH 4MMZC 4YDMA 1S9XB 3O9WA 5JHLA 5J0BA 3QIBC 2XPYA 1F13A 5J1AB 1N3NA 2ZNXA 4GO8A 4L4TB 4UIKL 3TVMB 4WHTB 4XXWA 1SFDA 1N59B 4AV5A 4PVNA 3L5HA 3V9CA 1K85A 1H15A 1N4XL 4ZFQA 3BAJA 2HRLA 4YSDA 4ES8A 3RZCD 2DQGH 4LL1A 4MMXC 3WFDH 3H7LA 5C09D 2HT3D 4XX5A 4K8RH 1AOZA 4PB0L 4ZX4A 2ADFH 2QGCA 3QQDB 4YS4A 5JA9A 2X87A 2VIRB 2C9XA 2EIEA 2J25A 4YDNA 2DQCL 5LGHH 1UCTA 3PLYA 4FGMA 3SO5A 3R06B 2OZ4L 1YMHA 3QFGA 3FPYA 4OCRH 5IEKB 2WTOA 3KWTA 4KI1A 5J3HD 1X5XA 3IDIA 1KB5B 3K7UA 3LRKA 1FDLL 1EPFA 5IB4A 3MLWH 2JI1A 4PQXA 2YPLA 4MNHA 5H4ZA 1PEZA 4KPHL 4RRPM 2YWZA 2GFBA 4P2QD 4ENZA 1LO5B 4YIQA 3MUZ1 5HI4C 5C97A 2EKJA 2GUYA 3P3TA 1GJWA 3S97C 3PL6B 1CURA 3OKKB 5C92A 2OL3A 5L6YH 3GIVB 1I1CA 1Q8MA 1VFAB 4HJTA 4FXLA 4M5ZH 1YNTF 1IJNA 3A6BH 3FO1A 1X44A 1RZKL 2Y06H 3H3PH 1E4WL 3K1KC 1JPFB 5FLUA 2VQ1B 1AQKL 2G5BB 3MV7B 4NZTL 4OLUH 2IAMD 1C08B 3FUKA 2R0LH 5DS1A 1E27B 4B97A 4JFOB 1G6RA 4NHUB 1S7WA 1IQDA 3U30B 5TH2A 1UA3A 1T80A 4QKTA 3T0XA 4JPKH 5T1LA 2ETWA 5D4IA 4FXKC 3B4NA 3BESR 3ARDB 2RH0A 1HH9B 2FYYB 2BWIA 2FGWH 2K7PA 1A4KB 4FLOA 3WNLA 2AXFB 3NZHL 3QDMB 5ICXA 5L0QC 1CTOA 4FFZA 4J7RA 4XHJD 5D7JA 4F37K 1PDKA 3D34A 1A0QL 2WUCL 1AQMA 4EE2A 1QLFA 5K9OA 4R4ND 1VKXA 2RIKA 5D7IA 3Q13A 1P69B 4UDUA 3KLHC 1QKZL 1OGAA 1QRND 2A83B 1IAKB 4PJAB 3AB0B 4F1ZA 5E8PB 3K81A 5KYYA 1L9PA 4E36A 4LBEA 5FFGA 2H6PB 4KK8C 2ITCA 1PKQB 1EDHA 3QFDA 4WO4B 2WW8A 3GBLA 2ICWJ 1HHIB 2EP6A 2V5YA 5EU5A 3QUML 2WY3B 5LUMA 3C9NB 5C0FA 2E7HA 1MCHA 4HKZB 3E3QC 3PHQB 2X89A 3NDZE 3UG4A 4PJ6A 5FCSH 5D1ZI 1CL7H 3HZYB 1E4HA 2OX5A 3WBDA 2DBJA 4J4PC 5AOLA 2CJ3A 2LE9A 3KXFB 1ASOA 3TH3T 4XN2A 3BKCH 1I1FA 3RHWF 4U31A 2VAAA 3FBQA 3HMXH 4LT7A 2CM5A 1MQKH 2BFGA 4MB4A 3TV3L 3EXJA 4M7LH 1R3JA 1UVQB 3QUGA 3EYSL 3LRMA 3M1BA 1T7XA 2WXNA 3DVNA 5HJDA 3T1FB 2HT4C 4ZYKB 4APQA 3VXMB 1OT4A 1IC5H 1QQDA 3DROB 4MCYB 4AEHL 5D7LD 4WNQA 2G0KA 1F3JB 4J3OH 3N40F 1R5WB 4YK4C 4LVOC 1B4LA 2OBGA 5B3SB 1TZIA 3DPBB 1EV2E 3SJVD 1H8LA 1OOAA 1MY7A 3ZQDA 2CA3A 5A1AA 3P4NA 4XP1H 4CA4A 3QG6A 2WINA 5SWSA 2WUBH 4Y4KA 1DUZA 5CGMA 5E95B 2D7TL 3M8OL 1BIHA 1AE6L 2TSBA 1IAMA 5DYOA 1R47A 3O6KL 4GAGL 3BRGC 1F2XK 4UQCA 4ZUSB 5HD8C 1SPDA 1LQSR 4MDIB 5KS9E 2EYSA 4MBOA 3GBNL 2MTZA 1U8MA 2B3RA 1YEKL 5JHLH 1ACXA 1LWHA 5JUEL 2J6EA 3ME0A 5FUCC 2BY0A 3BH9A 5E6IB 4N2OA 4ORGB 3MLXL 1WGVA 4L1BA 2EIMB 2CHDA 3R1GL 2EACA 1JI2A 4MGXA 4NI6A 2V9TA 3FYEB 1W15A 4DP6X 3QC5X 1VIWA 4MA8L 3QR0A 3RWEA 4BHUI 2HB0A 2IDQA 1PQZB 4AE1A 3QH3B 2CPCA 1P4LB 1RAMA 3SDXF 1N67A 2CBTA 3LH8A 1A7BA 3KNBB 1KELH 3G5YA 3CSPA 1I1YB 4A2HA 5AYUL 2DQFB 3H9SA 1BLNA 3KGTA 1H6EA 2YAFA 2D03H 4JM2F 4U1MA 2IBGA 4PBXA 4HUXB 4DTGH 1FSKB 1N19A 4KTEL 4HV8A 3R4DA 2W94A 4QF1B 4HWNA 4PV8B 5C07D 5CKGA 4UM9D 3W0WB 2WLMA 5CJQH 3UDWA 3EJJX 1D5ZB 2HVBA 2KYIA 5B4MC 1DSWA 5I5JA 2AJUL 3NCJL 4HJIA 1OTSD 2ZZUT 3FN0L 4P23B 4PJGE 5ALBL 5HHQB 5KEZA 3MNDA 1X9RA 2GAZA 1TCMA 4LGRB 2W60A 1B4RA 5EPMB 2OL3H 1ZLSL 2O61B 4F20A 1AJ7H 2ZOLB 2ZWZA 3TN0C 3EYVB 1KGWA 5FGCB 1OSEA 4JN1H 5ALCH 3AJ7A 1RZJC 4QHNB 1WK0A 1NKOA 5CZVL 1G6RH 3VQ2C 1IFHH 3MV9E 5EIIB 1C16A 4B9PA 1KGIA 5KVGH 4N5EC 4YDIH 2MQ0A 4W4NA 4E9XA 2AEIT 1YYCA 1QW9A 2QEJA 4YZWA 2F0CA 1QMUA 3NCEB 4MRCA 3LKSA 1ULVA 1EJFA 4XE0A 5ITBL 3FB7A 2QGDA 4LPVA 4OCLC 3LB6D 5T3XL 2ATAA 4R7XA 4Z7NE 5MENE 3VXOA 3L3DB 4JJ5B 4XVSH 4JFQB 1FL3A 4YDLC 5EZPA 4AEFA 4X6BB 4Q9RL 5SX5H 2CBOA 2D7QA 4NQCB 4HK0B 2XPZA 2K3TA 2OMYA 1JPGA 1K5WA 2EYTA 4G8IB 5KYWA 5FYLE 5H4YA 4OIAA 3PIQA 1K6QH 3WY3A 2PR4H 4GG6B 4TUUA 3RE0A 4OZIB 3NIDE 3ULUC 3MNZA 4E5XG 5HXMA 3CZSA 1DO5A 1FUNA 4MDRA 5D4QA 5JDJA 5ANMA 4H13C 4M1DH 4XMWA 2WO4A 5FYJL 2YAOA 3SKJH 1A6ZA 2DAVA 1WBZB 2W0FA 1Q0YL 2QZ5A 3E8UH 3UJIL 2YARA 4WU5A 3CXDL 3EJCA 2OK0H 4E9RA 1J7VR 1TJHH 2KLSA 4OD2A 5K59E 1JNLH 3RZCA 1AY1H 5C09A 5F3HA 3WIFA 2HG0A 1KBGH 1BAWA 3VD4A 3QI9B 4OSUL 4X9BA 1XEDA 4KZEH 1KXVC 1MI5B 1ACYL 4JPIB 1P4BL 5ETUA 3V6FA 4FKEA 4DN4H 4XN7A 4MNGA 1J9RA 3GMNB 2B59B 2BNQB 3WN6A 3MRPA 4Y2OA 4KK6C 4XI5C 4XNBA 5D7EA 4EBQL 5IMLB 2GITB 1I1RA 4F7PB 2AFNA 5I8CB 1U8IA 1KCUH 5C2BL 3CVHB 2P26A 3FB8B 4NIYE 1D5MB 3MJ9A 5IJDC 4Z7OB 4ANWA 3F7YB 4P2QA 4MA3A 1DEDA 1R4XA 1NJ9B 2Y24A 4X6CB 3MOBL 2OCFD 1O7DC 3AXLB 2HVKB 5HHOD 1XIWB 4TLKA 3I9AA 3B2XA 1L5GB 3DXAD 2D3NA 4M02A 3IJHA 4AE0A 1FZKA 2CDGB 4A7VA 2NY0C 4E0RA 1HCYA 3T8XA 3UJJL 5BS0B 1Q0XL 3LNFA 3B2MA 2IBBA 1RJZA 2IAMA 3CVIL 1LWRA 1CIUA 1LP9B 2RAMA 1U8CB 2X42A 1QHQA 4L4VD 1J10A 4W81A 4EUPA 1NUFA 1WTGT 5B39G 3HLAA 1MVUB 4HZAA 4MYPA 3BAEH 4DUXA 3CFMA 1JFHA 5CCGE 3LKPA 4E42A 4HWEH 1FORH 4RBPH 3X12B 2FH8A 2EXYD 3QUHA 2ZIDA 2G2RB 2DQGL 3WFDL 3BVNB 4H0GA 3AG4B 2ADFL 3LYRA 2DI8A 2K70A 4JG9A 2C26A 5HHVH 3DUUA 1DQQA 1QRNA 3CDGA 4TLSA 2OMVA 4XBGB 3BHBA 3F62A 2WYHA 2BSTB 3IT8D 5C9JA 4FA7B 4I87A 4N8UA 4OCRL 1HT6A 5KG9B 1XB6A 1TNMA 3CZJA 4HU2A 3LV3A 5KBLA 3HPLB 2NZ9C 3WSQH 3D2UB 3F6LA 3MLWL 5D5MA 3SKNB 1I8AA 1DDHA 3L2MA 2FVNA 3FBKA 5AOKA 4JKLA 5KYUA 3RJDA 4YSCA 2WNKA 2LGNA 3CMGA 2M8XA 3T2OA 3ZU8A 1BMZA 1PF3A 1GGCH 2ATKB 2WKOA 4MZRA 5DZPA 4KRPB 1J0HA 1AGDB 3VRJB 5L6YL 3FFCE 2BCKA 1AANA 4HEME 4G7SB 3SIKA 4B9IA 2XWZA 3PXLA 4R84A 2VO5A 2R9HC 3PWPD 4M5ZL 3A6BL 3RPIA 1T2QH 2Y06L 3H3PL 3MRNA 3JV6A 1T83A 3K46A 4FHKA 2PWGA 4OLUL 5KSUB 3QEHB 2CR3A 2R0LL 3VFPA 5I1HH 4OKDA 4FLHA 3X14A 1FVCB 5D7LA 2XN0A 4G71B 4JPKL 5L2KD 2VW6A 4NYLA 1Z5YD 2G9HB 1E4KC 2FGWL 4TVSa 3OJDB 3SJVA 1OAJA 1AQDB 4TUOB 3D7PA 1BQHG 1RZKC 1MN4A 1BV8A 2XBDA 2HVJA 4BINA 3C5ZB 1KJVB 2ZAIA 3PDOB 1VADA 3DMMD 4MMYA 1BVNP 3ZDXF 2IPKB 2GIMA 1P0SE 2KZKA 2ZKHH 5EU6E 1DSFH 4Q2ZB 2VMJA 1I4FB 32C2B 3V5KB 1S9YB 2VMEA 3G5ZB 4J3BA 1KIUA 2CHXA 3CZFB 3N43F 2ODHA 5EBWA 1JN6A 3GSWB 2L7JA 4S1DC 1U92B 2FZ3A 4LCUA 3WY4A 3GSOA 5DJ0B 1OVZA 3DX0A 3BN9D 1K4CB 5HJ3A 4BRVA 2X6UA 3HOGA 3ETBJ 5TDNA 3ARBB 3ZYOA 1CL7L 2QQQA 3NPSC 3FFOA 4XCEB 4HJJH 3FZUD 2FEJA 1AVAA 3W2DH 2A4ZA 2K6YA 4JKPH 4B0MB 4EI5C 2VXSH 3NK3A 1Z9SB 2EABA 3QUXB 1RLWA 2ALWA 3SDXE 1DLHA 2AP2A 1BYOA 4UINH 3U0TB 1JYNA 3HMXL 4QRTA 1MQKL 3MUUA 4OUUB 2F19H 2ROYA 4M7LL 3PU7A 4MDJB 2Z1KA 2R7EB 3DX8A 1DVFD 3FU7B 4BSWB 4TPRH 2BOBB 1ZSDB 1IC5L 5C07A 2LLNA 3QPQC 3HVNA 3HE6A 3MJ9H 4KKZA 3UABA 1JDCA 2XVKA 4YDJA 1G87A 5DJXB 2G75B 3GJFB 4N20A 3L3HB 1ODUA 4XP1L 3WKMH 2WUBL 1O6SA 1ESOA 2TAAA 4YN3A 1DFBH 3IDGB 2DKMA 3ALWA 4U6XA 3SJVE 3QUYB 3SE9H 1YAIA 2Q20A 4OZGA 3IB4A 2BZDA 4P07A 3ECBA 5JHLL 4UYPA 2OV0A 1TZGH 5E8OB 3L8QA 4WI2A 1G4MA 3C5JA 2X7LA 4FFWD 3CPUA 4AQ8A 2KPWA 4KKLD 4WGVB 1UQSB 2ZUXA 2GUOA 4HAKA 1S9KC 4NXKA 2AQ2A 4WVRA 1A65A 4B3EA 3IETB 3LSOA 4F7MB 5LVEA 4LO9A 3L9EA 1JVLA 2OTPA 3C6LC 4JLRA 3FN9A 1BFVH 1GYVA 3H2WA 5KBMA 4XVUD 1DN0B 1PZ2A 1LMIA 3IXTB 4N2LA 4MAUH 4FULA 3EJYC 3WMQA 1RP8A 4N2IA 2OXGA 3RWDA 2D03L 3Q05A 4DTGL 3FO0H 3IGAA 4AQ1C 3IDIB 2ITDA 2PO6A 4R2GC 2GCYA 4NKOB 4LLUA 4JGUA 1XCQA 3GXPA 5GGVH 3C5SA 3NIGB 3BH8A 4GW5A 1GA2A 5HYFA 4RIRB 5CJQL 4OCNC 3PY9A 3ZN6A 4ZPTA 5IB1A 5IVZB 3L9RB 5IROC 1XGUB 4HGWA 5CHNA 5I1KH 3S34H 1NEZA 2DM3A 2RD0A 4FG4A 1H3TA 4XZUB 1KFAH 2IGTA 3MNWA 4ACTA 4JDTH 4G1EB 3VMNA 2OL3L 4NQDB 1P7KA 5HGDA 5IUSA 2P5EB 3B83A 5D7SH 1AJ7L 3NJNA 4LEOA 5ACZB 5GSVA 4F7KA 4FFTA 1VFMA 3VA6A 3ESMA 1JAEA 5ALCL 4JN1L 3V4VH 5HGHB 3RYMA 3LY6A 3LZNA 5E7BA 1AAJA 4W6YB 1IQDB 3EOTH 1G6RL 4G80B 3WEBA 1IFHL 5H37H 5KVGL 2I9TA 4FA8A 1LGVA 4YDIL 1BBDH 5LN4A 3E8VA 4HUWA 1M57B 4G6FB 5CD5D 5J9PA 4DPAX 4Q4IA 2C5DC 5ISZD 3EGXA 3JQOB 4NDMA 4MA1B 1H3GA 4XTRD 5D7JB 4IRJC 3I02B 5KS9B 1S8DB 3L4XA 2DRUA 3HCVB 3SPVA 1EO7A 2OW7A 1AR1C 4XVSL 1J5OH 4LOUD 4OQTA 4AYFB 1LVEA 2G60H 4HPYH 3QA3B 2GBAA 2MNUA 1ITBB 3DXAA 3EH5B 3PWLA 3T09A 3GUTB 3MRJA 2NXYC 5BW7C 3LNEA 3RVXC 1QSED 4LBEB 3UXFA 3LVEA 3TIDB 3CDCA 1KZQA 2H26A 3DHMA 4HW6A 4FD0A 1K6QL 2ITCB 5D2NB 3ZE0F 3CTTA 4L4VA 4G6KH 1BQKA 2C9RA 2F54B 5J6SA 1CDGA 3DJRA 4M1DL 5I5MA 3QQ4B 1ZA6A 3SKJL 1HHHB 4J1UB 1B0WA 1T0NA 2QPFA 3E8UL 3ESNA 2LABA 3O6FD 5IOPA 1GS8A 4X4YA 2N7SA 2OK0L 2VDNH 1TJHL 5INCA 1JNLL 15C8H 1BVKA 1AY1L 2J57A 5HDBF 3BCDA 4UZGA 3S6CA 4KZEL 2PP7A 1RZ7H 3SDDB 3UPRB 3FRPB 1ND0B 1THAA 4RAHA 4DN4L 2BSBA 3ILPA 3VFVB 2VOTA 4GBXD 2YD2A 3DDGA 4LKCB 4PJGB 2GJZB 2IC2A 4APQB 1AZUA 5I0DA 2H1LM 3B1UA 4HC1A 4UV4H 2ADJA 1HYSD 2AXGA 3UYRH 1CD1B 1KCUL 3BGMB 3DBXB 4ZMYA 1NCUA 1WWBX 3V4UH 1HC1A 2CCWA 4LLVA 1UADC 1QR1A 1QRKA 3H42H 4NQEA 3RVVC 4AV0A 1XGPB 2YC1B 4QXTB 3NCYP 4I18C 1UJ3B 4WI5A 1S3RA 3MV9B 4C54A 1RJLB 5CLZA 4WFFD 1MFMA 2XFXA 4BRJA 5A2FA 4Y1AA 2CJSA 2A6JB 3RL1B 4LLYB 1C8QA 3VI4A 1ADQA 1NGWB 5HGAA 4EAEA 1I82A 4MAYD 1HCVA 3QQNA 3PAYA 3S8WA 1FO0A 5I1CH 2FIKB 4YHZH 2NY6C 2WLYA 1ZHNB 5DHVA 3BAKA 5I17B 4Z7NB 4JZJA 5MENB 1QTSA 4FTVD 1GTFA 3FCSA 2H1PH 4HCGA 1S9VB 2DS4A 3HAEB 4OF8A 1L7TL 3K6FA 3BAEL 3ILEA 5L2KA 4B9GA 4WFGE 3WE6A 4YHPA 4AIZA 4QRQB 4PLJD 3VGDA 2AJSH 4HWEL 1ORQB 1FORL 2HJKA 2VL5B 5C70A 1M7UA 5GXBB 1KUMA 2QV4A 3P0YH 5IESH 4YHKH 3P3RA 3D69A 3KPNB 3MUHL 3OHXC 3OBAA 5I1IH 4HSCX 5HHVL 3GKZA 3DMMA 4ZNCD 4HU8A 4KX9A 3FT3B 2RA1A 5JOFB 4M9PA 2VDKH 3QDJE 3ZDXE 1SBSH 1U95B 4GSXA 4WWKC 3U25A 3TA4D 4PW4A 1CJYA 3EDEA 5BVPH 4NO5B 2WXKA 3JTTA 3WSQL 1V10A 2NTSP 3NABH 3IPEA 3IBOA 5F6IC 1IBGH 4LDEB 3ROLA 3FOMB 2J56A 4IU2B 2Z92A 4EIZC 4S2SB 1A1MB 1DQDH 1IARB 2MIZA 3CBJB 3GSXB 1WDAA 3HE7C 3N41F 5DJYB 1GGCL 4UUJB 5FM5O 4M7ZB 3UZEA 4WNSA 4BYHA 4MXWH 2IOMA 2VLJD 1OCOB 2P8PA 4NQEE 4U3SA 4WI0A 1T2QL 4J3OG 2D2CC 1A6AA 2VDRH 4PJDA 5F72S 3VH8G 2F1AA 4I9WE 1AIFB 1SEQH 5KZCD 4YSSA 2I7OA 4Y1AE 4GKOA 1DVFA 1HXMB 5I1HL 4X6FB 2HWZH 5EZLA 1NEUA 3OMZA 2ZXBA 3OKDB 5A2CA 3KPRD 1B0IA 1R19A 1W9XA 4HLEA 2LVEA 4PREB 4PG9A 4U6HA 4KK9C 1CDIA 2XCMC 2NY1D 1XSKA 3CN2A 4O2FA 4QYAA 1UB5B 2X12A 1YNTB 3H3KA 3HJEA 1UUSA 1FFNB 2A9BA 3N1GC 5L2KE 4EO5A 3VM5A 1ORSA 2X3BA 1F4HA 1BAFH 5D1XB 3WTVA 3SY0A 5IV2A 1T20A 4E9VA 2L3BA 2ZKHL 3HVDA 3QXTA 3V6OA 3TBWA 4IRZA 1DSFL 1EHNA 5GGTA 5CEYA 4ODVH 1N70A 3VX0A 4C47A 4D9QD 3ABMB 1OP4A 3JXAA 4HD5A 4OGAC 2AEQH 4F33A 1CD8A 2R2EB 3EAKA 2GW5A 3PXJA 1HOCA 4MQXD 2EE0A 5BRZB 4CVXB 4DGYH 3BEVA 2VZUA 3TURA 3SZ6A 4X4MA 1GJIA 4AV4A 4Q56A 4S1QH 1KBWA 4XCYB 4M8VA 3EJTA 3FU8A 4HJJL 4FQHA 4JFXB 4N3UA 3W2DL 2A9AA 3N2JA 4XNQB 5GHWH 1HZHH 4JKPL 3SYQA 5IW1B 4M3JA 2KPNA 3OB0H 1EXHA 2V5MA 3UAJD 1GR7A 1HCZA 3LQMA 1CK0H 4UINL 3PF2A 3N91A 4ZX5A 2F19L 2NY4D 3KR3H 4NFBA 2IXQA 1J0ZA 3AG3B 4YSPA 2AS5M 4AITA 4ESKA 4TPRL 4Z3HA 4RAVA 4LHQB 4PJDE 3MJ9L 1RV6X 4OZHA 3FFCB 3QIWB 1XDTT 3RDJA 2Q8BH 3TJHD 2VDQB 4GLRI 2AKRA 3NBNA 1KCVH 1QZNA 1FN4A 1RPQA 1KYOK 5IK3A 4XPAH 5EF3A 5D1QE 3WKML 5JIPA 3ATBA 1A9EA 1J8RA 5F7FA 1S7SB 1W72H 5DZOA 1DFBL 1HL9A 4CMHC 1ADQH 4N9GB 2MQCA 5KWYC 4OZ4B 5F9JB 3SE9L 1ROWA 1NGXB 3VWJD 3OLDA 2CRZA 4F8LA 2Y7LA 1INEH 3S88H 2Y5TA 4GKSB 4L4JA 1KEGH 3SPJA 1DE4B 5DJ6A 1NSNH 2IH3B 4PRIE 4XMKH 4DKDC 3QZWB 1TZGL 1PZCA 1UB6A 3F12B 3BCFA 4NZ8A 3CDZB 3D39D 1ZA3B 5DFVC 5DD6A 1RLBA 5ISZA 2ARJQ 1RK0B 1W6WA 4ZDHA 2MQ3A 3N9GH 4U1JB 2CO7B 5HYQB 2SODB 3ARSA 2DI9A 4XNZB 2H41A 5EU6B 4W9FC 3UTPE 4C57C 5BQ7B 1QNZH 4X98A 4FOMA 5AOMA 3QQXA 5EC1A 1LEKA 4WZ9A 3H7BB 1BFVL 1N68A 1XZ0A 3N50A 5D7HA 3O9WC 4ELKA 3BHBB 1DFXA 4XPTH 4X4ME 4MAUL 3QEUB 1QSEA 3DECA 5AVVB 1SJEB 3G3LA 4XCNA 4XXWC 1FYTA 2R39A 3BKYH 3T8MA 3OGCA 4LAQH 4Y2DB 3FO0L 5F1IB 1F6LL 1YNKH 3L17A 5JIHA 2QR0A 1PZ3A 1GCFA 3ZE0E 4OZFH 5GGVL 1RY7B 1QZ1A 3DOSB 4G3YH 3UBFA 1FZMB 1IE4A 1IL1B 3BZ4B 2QADC 3ILQC 3O2VH 2CO6A 2X2JA 2GEEA 2W0LA 4NN7B 3SDXB 1WZ1H 2BVQA 3B56A 5I1KL 4X4KA 3S34L 5I26A 1FNHA 2VN7A 5E9AA 2AV7A 3T4AC 1NBZA 2X3AA 4XC1H 3UAEA 1KFAL 1OF2A 3F7QA 3D4CA 3QZMA 1E3ZA 2DWDA 3LH9A 4KHTH 4OZHE 4QO1A 4Z7UF 5K9KB 5DTFB 4JM2B 5ACMA 5D7SL 1MCWM 3MRNB 4JQIA 3FSWA 3I9IA 4Q9BA 4U4BA 3WS3A 4QLWA 1KNOB 3RX8A 3ZKXB 4AM0Q 1OZUA 4JB9H 5I0ZA 2ZXGA 1IBYA 4M8UA 3OG4B 3V4VL 4P5SA 5GS1A 2UZYA 1QUPA 1R46A 2HKHH 4YBHA 5AOJA 3BKMH 1BLIA 4I7ZC 3SKOB 1BBDL 1HHJA 4PMFA 4M43H 1OPGH 1LDPH 3GSUA 2XXGA 2ESVD 2DF3A 2YA2A 2P8MA 2BVPA 1WVZA 7FABL 5EEVA 2CAKA 3ZYJA 4GXFA 5ISZE 3IDYC 4JZOA 4N2BA 4Q97A 1C5DB 2HT2C 4XXDA 1J5OL 3AFLA 3WEXB 2G60L 1VADB 4HPYL 1A4CA 5DXWA 4YLCA 3PP4H 4X5XA 3ZE2F 3WTYA 4ZO8A 2E9JA 2HLAB 4J3OF 1A8ZA 4IRZH 5GGTH 3HZMB 3IAGC 2XPGB 4A1IA 4YLBA 1T66C 4GIAA 1BG1A 1NL0H 2JKXA 4ZMWA 3ETTA 1T89A 3FCUB 4G6KL 4N6QA 4FTVA 4A04A 4IIQB 1U8QB 1FYTE 5SWZD 1LXMA 5HJ3B 5J1SC 1EDQA 4JZNA 5TDNB 3HNTH 3ZIMA 5AAWA 2OW6A 2X6CA 2UXGA 5DD0H 2HZHA 3NSYA 5I74C 2VDNL 4PTTB 2OXHA 15C8L 3BVVA 4HWBA 3TEWA 3H53A 3JWDC 2VQTA 1RZ7L 2A1WH 3P1VA 1S5HA 4EI0A 1NIBA 4OJFH 3MYJA 3O4LA 1OCWL 2GI0A 3DIDA 4JPQA 4XGZB 1UGKA 5DF0A 4PJCF 3AABA 4Z3EA 1AO7A 3EYUH 4N0RA 1J8HD 3BO8B 3ARYA 2BS8A 3VG9C 4N2FA 4UV4L 3WN5B 3ZZLA 4U6YA 5T3XE 4EQ3A 3UYRL 2J5WA 1CDHA 3G08B 5FPIA 2F68X 1ZDSA 5D6CA 2CRYA 1YPZA 3V4UL 3HC0A 1PEWA 4HHAB 3G5XA 1MFDH 1CGVA 1M7DA 3H42L 2QKSA 2IBZY 3ZTJH 1MNNA 3PJNA 1QBMH 4G43A 4I85A 2WQVA 3IXAA 5C0BB 2XY1A 3QWOA 5ECJE 4PCYA 3BEWA 2B15A 5E6YA 4LP5A 1HNFA 1NCGA 3ECBB 1F4YH 4G8EB 2YK1H 5AEAA 5EULV 3F3HA 4Y4HB 5I1CL 1U6AH 3DIFA 4YHZL 3HS9A 2OSLA 2EVFA 2D3JA 4U33A 2H1PL 1JGDB 4Y4KC 2VERN 5F6HJ 3KPRA 3K5SA 2UXFA 4O02A 3D25A 2PCFB 2Y07H 3MV8E 2CXGA 2AJSL 4Y5VB 1CPUA 3REVA 5FECA 1KJMA 4JLRB 4FYSA 3P0YL 2XTJE 5IESL 4YHKL 1AZZC 2ZYHA 1VFBA 1XSOA 1KB9K 5I1IL 2VR8A 2X5PA 1IGYA 2F7OA 5I16B 3PGDB 4AXWB 2F7QA 1UWXK 3NJHA 3O0RH 3HUJF 1JGVH 4GLRH 1SBSL 3CX5J 5CIPA 3N0AA 1SXAA 3EJZC 2PPDA 3O4LE 3IN2A 1UA7A 4TQPA 3RP1A 5E9DB 1B3JA 3TV8A 1AO7E 4ES9A 4WENB 3NABL 3MSPA 1IBGL 2CCVA 2IH9A 1NPNA 5FUZH 1YLBB 2EE6A 1B0RA 1DQDL 1IAOA 4GIOA 2ZXEB 1P7KB 2VDMH 2Q1EA 2K4AA 2XVBA 4PGZA 2VR3A 2K78A 1ZVNA 1YPZE 4LVNC 5GSVB 4MXWL 2BMKA 2WB7A 4QJ4B 1WS7A 3UAJA 3WNNA 2JIXB 3UDWC 2VDRL 1PX4A 2CDEB 4X50A 2XX1A 2XG4A 2R1WA 3CFKA 1SEQL 2IAND 3N85H 3ZT7A 2P28B 3KJ6H 2HWZL 3ZHDA 3REWA 3DX7A 5F3FA 5B1CA 5K1VA 4HQQH 2M1KA 3WDHA 4BM7A 4M1CD 1CF8H 2G4GA 3P9LA 1ONQB 2NY3D 3UTSB 2J71A 2YUWA 4P5MB 4HLZH 2C3VB 2A4CA 1VGEH 2Q8AH 5AWNH 2WJ7A 4WJKB 5EA0H 5GS0D 1KJ2B 3X13A 3QUKB 1JS4A 1T3FA 4C56B 3BKJH 1BAFL 5DJ2A 2KQNA 1NCBH 1ICTA 3EH4B 4FI7A 1WA2X 2ZXCA 2CJTA 3D9AH 4FHBD 4PLKD 3VWJA 2VMFA 3QZBA 5TDPA 1UYWH 4ODVL 4QXVA 4WEEA 3ECUA 1MIMH 1YN7A 3QEQD 3OR7B 5TGBB 1S2EA 2VZ3A 3U7YH 2AEQL 1T1WB 4QRPE 4A39A 4A68A 5LG6A 2PMZA 1WBYB 2JF1A 4KDWA 2CDFA 4KROD 4FQ1H 4DGYL 6CGTA 4G8FB 1QR4A 3MDJA 4L1TA 3VTAA 4WEMB 3L9BA 4ZS6D 3HC4H 1WCBA 2APSA 4PRAA 3VFUB 4S1QL 3QDJB 2W95A 5CR8A 3ZDXB 2BC4B 2J72A 4WWOA 2NY5C 4PVMA 5GHWL 1E90A 1HZHL 4DQOH 4R5VA 4NX0A 3BUDA 1JUFB 1G6VK 4KH9A 3T9WA 3N43B 5ID0A 2N3JA 5DA0B 1KDJA 5K93A 3KR3L 4YMPA 3UG3A 4MKMA 4HUUB 1QVOA 3BWUF 2X4UA 1SVZA 1XR8B 3F58H 5IHHA 3RZCC 1IEHA 2HT3C 3BUYA 1FQ9C 4CVZB 3GXDA 3IFLH 4YGVA 1TVHA 4YDVB 1YEWA 2Q8BL 1KCVL 2XWCA 3GKWH 4MLIA 4XPAL 3O81A 1E9OB 3ISRA 4A7TA 1L9OA 5DVLA 1RZPA 4O00A 3VW3L 4PR5B 1OT2A 1W72L 2D8KA 5H37G 5KSAD 4M6MH 4EZLA 4E5XB 5E03A 4BJLA 1ADQL 1AZCA 2WKGA 4FF9A 1UKTA 1UD2A 3VD5A 1BZOA 3FH8A 2EDXA 2F7RA 1E42A 2X09A 3H9ZA 1INEL 3T6VA 3S88L 1KEGL 2G3XA 3GRBA 3GLZA 1NSNL 4DEUA 1MFEH 4XMKL 8CGTA 4R5XA 1K8DA 1JYVA 4YHPB 5JW5A 2B77A 1SN2A 3CVDA 3M17B 4NPKA 4HBCH 5CLYA 2UUDK 4ZMTA 3N9GL 2ESVA 3DX6B 1HQ4A 3MO1B 3DX3A 5CGTA 3BQUA 3VB9A 1RURH 1QI3A 3CQQA 3UCQA 3K72A 1M9SA 1H5BA 5FK9B 2CIIA 1MAMH 3KMDA 2IAMC 4B9YA 3QQ3B 1OAUH 2VLKD 4GFTB 4XPTL 2FJSA 2A74B 4XMVA 1EERB 5B38A 4KKRA 4UQ3B 3ZE2E 5CIPH 3BKYL 3DUSB 5HJGA 4LAQL 4FA6A 1QWNA 3HHMA 2W92A 3DRTB 1YNKL 2I85A 2AANA 2WO2B 3IE4A 4ZQKA 4XHJC 2WCSA 2BSSB 4G3YL 1YUHA 1B2YA 3ROLB 1Z9OA 2Q3ZA 2O6PA 5ILTH 4PRDA 1KF9B 3FF8A 4R4NC 3O2VL 1AD9A 5D70H 1M4KA 5CSZA 4GAFB 5EFIB 1WZ1L 4JK0D 1TIUA 1YEEH 4XP6H 2BVEA 2VN5A 2XWDA 4A6YA 5IEHA 1RIVH 5DC4B 3LXAA 3MMEA 3O2DH 4XC1L 3D87B 3QSKB 1K9TA 2EO1A 4KHTL 3QNZB 1KV3A 3MV01 3VGAB 1MQ8A 3RIKA 1LHZA 3BUBA 3H2QA 3IMVA 3KPLA 3KPPB 1CICA 4U1NA 3OXSA 3N42F 2QQNL 1MREH 4JB9L 2OAAA 2R2CA 5B39B 3PCYA 2YQ2A 5JLZB 1DVZA 2HKHL 3JWNG 2ARWA 1J8HA 3BKML 3EFOB 4NUMA 1Q9KB 3MKGA 5D1QB 1RZ8A 4YEFA 1TCRA 3I2CH 1PD6A 2XKSA 4M43L 5JHMA 1OPGL 4UM8B 1NAMB 1LDPL 2JKIS 2Q7YB 2JKTM 1M2VB 4PS8A 1ZATA 2DWEB 3OZ9H 4IU3A 1IKFH 4IM8A 4DZBA 3IRCA 1F1GA 1Z5LA 1T83C 3EYFA 1VACA 1QPXA 3NGBB 3JZ7A 1WSST 4PRIB 3KWUA 5IV2B 5I9QC 3PP4L 4NO2B 1GYAA 4AZ8A 1C12A 5EO9A 4YQXH 3WAKA 4F8PA 4IRZL 4JHUA 5GGTL 3N3EA 3HR5B 3TTYA 4F2ME 4A2EA 1NL0L 5EF1A 1YCSA 1BECA 1FI8C 1S7VA 4J6RH 3VACA 2FHCA 3HS0C 3L3KA 3T71A 3PJSB 1ZGLB 1U3JA 1SJMA 2FHFA 4ABQA 2C7FA 3IDXH 5ITFA 2FO1A 3HNTL 4WCYH 5DD0L 4OJYA 3UJTH 1M3IA 3X3FH 4JJHA 4ZAKD 2X0UA 1DUYA 3U7WH 2NYZA 1AFVH 3ARGD 2O5YH 3D0LA 2A1WL 5DRXA 3ZE0B 3B9AA 1QUNA 1CD9B 4CKQA 1NUDA 4OJFL 3MA7B 3DGGB 5FWQA 1MHCA 1Q38A 1L6XA 4R90H 3BP7A 2IXQB 4JMXA 3EYUL 2R56H 3MTXA 2LAGB 2R0ZH 3HUJE 3QFJA 4N8VA 3W37A 4UQ2A 2YEZB 3EUUA 4WU7B 5HI5D 1BQHB 3BPCA 3GS0A 1X7QB 4M56A 1JF1B 5HDBB 4FLRA 2APXA 4TUJA 1OP5H 2NZ1A 4KRNA 2J5LB 2RCSH 2DH2A 3HIZA 4HIIA 3STZA 1MFDL 3UTZA 3S7GA 1QBML 3HN5A 3MLPA 5CO1A 1OT1A 3O3AA 3ZPDA 3COOA 1RUQH 1NIFA 2FYVA 2WIIA 2FJHA 5DK3A 2D0FA 5AVRB 1F4YL 3HE6C 2YK1L 1JFQH 1FZOA 3POCA 2IANA 1U6AL 4WTXA 4U05A 3SDAD 1OTSC 3TBSA 2QMJA 2ZSWB 4IOIB 5CEZD 5DD6B 3FSVA 4MWFB 4OD3H 5JR1H 4NN6C 3EFFA 2WMPA 3ES6A 5E99H 1IAII 2Y07L 1YEHH 3QNYA 1WFMA 4PGDB 2NUTA 3U9UA 1XGQB 4O2CB 2WQWA 1E6OH 4X9HA 1OV8A 2YSSA 3WGVB 2O5ZL 2KBGA 3B7UX 5L9DH 3UEQA 4CU6A 4G72B 1MCWW 1NIDA 3S0PA 3LEVH 5IF0B 4P4RA 3O0RL 1MHEB 3F7PC 3AZUA 3V4PA 4IRJB 3QEQA 1U8KA 3OKMB 3LB6C 4KVCH 3FCTA 4UOW1 4OIIH 3P3YA 3K8KA 2X70B 5DJDA 4K23H 2NXYB 3QFJE 4FNPA 2AV7B 5FUZL 4GNKB 5HPMB 3B7SA 3RVUD