5E1GA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t208
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 87
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5e1gA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5e1gA02
5DUJA 3ZGPA 3TX4A 3VYOA 5DZJA 3ZQDA 5DVPA 2HKLA 2MTZA 4Z7AA 4XVOA 5K69A 4A52A 5DZPA 1Y7MA 4HUCA 5E1IA 5E51A 4LPQA 3TURA 4A1JA 4GSRA 5LB1A 3VYNA 3U1QA 3U1PA 4QRAA 5D7HA 3VAEA 4GSQA 5E1GA 5E5LA 5DU7A 4QTFA 3VYPA 4HU2A 4QRBA 4GSUA 4A1KA 4K73A 5LBGA 4JMNA 4A1IA 4QR7A 4JMXA 3ZG4A 1ZATA 4LZHA 4ZFQA 5DC2A 5DCCA
chains in the Genus database with same CATH superfamily
3FFCB 2OL3A 5C0BB 4WI0B 2C3HA 4Y2DD 1UUNA 1KCSH 1NOAA 2DMBA 4LLYB 2VXSH 3FT1A 2G9KA 4IM8A 1DANT 1G5AA 1JTPA 4TQPA 1KIUA 4Z8FH 1QABA 1IBHA 3Q3GA 4L1DA 4HUWB 4MDIA 1CLYL 4Y2DC 4CNIA 3BT2L 2ESVA 6FABH 5I2IA 5DJXA 3U4AA 3UDWC 1KZQA 3IJ7A 4IJ3C 3GSXB 2P8PA 1KJMA 4JFTA 1AQ8A 3MXVH 2ORBH 4EXKA 2FBOJ 3AG4B 1W9XA 3ETBF 2R0WH 4XNZC 3WEMA 3NJLA 3FN0H 1CE6B 3GSNL 3SEPA 3WNKA 3IGLA 4Z5RA 2MWCA 1ZEAL 2VOTA 3ZE2E 1QX1A 1SUHA 2DQCL 4X98A 1K5WA 3NIGB 2J4WL 2OL3B 3KS0J 1MCCA 3CFQA 1CLYH 2VDRB 3QK0A 1ODAA 5FUCE 1WP6A 4NOFA 1W91A 3ELAT 4PY8J 4QAMB 1YEIH 2BP8A 1ZK9A 5AYQA 5CWSA 1Q94B 1YEJL 2A74A 5AL8A 1SQ2N 5GJSL 5CAYB 1LK3L 1KIUB 4QOKE 3DROA 3MLRL 2WXJA 3Q3GB 4MDIB 5F1OB 1QRND 4MTMA 4CNIB 2PYFA 2ESVB 5I2IB 2WBJD 3IDYC 5DJXB 4UQBA 2HX9A 2QSCL 4NUPA 4OLEA 2P8PB 1KJMB 3GTTA 4BCXA 1NFKA 2IBZY 1BVNP 3GKWH 4XHQA 3WFZA 5B7MA 2YN5A 3F7YA 4PRDA 1V3JA 3HZYA 4DTGL 1XGYH 3MLSL 1CYWA 1T7WA 2WBJC 3O8XA 5ISZA 5EOCJ 4Z5RB 3EYUL 4IS6A 2BOLA 5GJSH 4G7YL 4X98B 5DD1L 4HAFA 5CJXA 3G08A 3MHZA 3QR2A 4XCFL 1BVLA 2J8UA 2GQHA 5JTWA 4PJBE 1JNHA 2GIYA 2BP8B 2D3LA 1ZAGA 1NCBL 5CWSB 2A74B 2YXFA 2OYMA 2V5TA 3B2VH 3DROB 1I8KA 2CUMA 4WU5A 1DVXA 3DGGA 2PYFB 2XKSA 4GKNA 4PJXE 3VE0A 3LEYL 3CN0A 3MNWA 4PJDF 2J55A 5IHUL 3S36X 5LBVA 4K94L 3IRPX 5JPMA 2DEWX 1UH3A 2QTVA 3F7YB 5EBLA 2H47C 4A6YH 1D5ZA 2QQQA 4PRDB 2NY2B 2UZPA 1YC8A 3HZYB 5ISZB 3O8XB 4OR1A 4CC4C 3Q05A 3DIVA 1CDJA 4IS6B 4M7ZC 1AR1D 1P84J 5BW7C 3WO4C 4DGWC 1MH5A 4R7NA 3KGSA 3G08B 4ODWA 1RSFA 1BVLB 2BS9A 1QFWI 2J8UB 5K33A 5IT2L 3ULUE 3UBFA 1GJIA 3IYLW 4PJ5D 4KKPA 1JNHB 3GRGA 5AYTA 3ZZLA 2EACA 2QSVA 3EJCA 2QGCA 2VABA 1QFWL 1AR1C 4I88A 2NTFA 3S36H 1URIA 3FMGL 3JXAA 4TNWF 1I8KB 2IC2A 4WU5B 3DGGB 3BWUF 4GKNB 3VE0B 3MNWB 2UZIH 3IF1A 3UG5A 5FR3A 3AU0A 5T3ZD 3H3KA 5C6WH 1BEXA 2WXMA 5JPMB 4CMMA 2EO1A 3APCA 2LVCA 5C0RH 1JUFA 5EBLB 1D5ZB 4Y7MA 3V6BR 1DQLL 4IBUA 5L7XL 3MTXA 1MFEH 5FO2A 3D39D 1EUTA 1L9PA 2WSPA 1MH5B 1KYDA 3FMGH 4R7NB 3ZMRA 4ODWB 3WOVA 1MCDA 4QJ4B 5KYWA 5AZ2L 3H9SD 3K6SA 4IRZL 2VABB 3VMNA 1S7RA 5I1LA 1UACL 2N1TE 2DMCA 3EF4A 3G6JE 1HIML 2NTFB 3CFBB 4KY1L 5KS9E 2X6VA 5JQ6L 3KM1A 2VW7A 1J8SA 1DQLH 2AMUA 3CQPA 3IF1B 4TOYL 5L7XH 3DHMA 3MGAA 2E7HA 1D7BA 4OB5H 2GBVA 1YNTF 2ICEC 4CMMB 5SV3A 4XMPL 1HX0A 1JUFB 5TD4A 1I4FA 5C0GA 2C9XA 1AQDA 4WGKA 2YXVA 2ITEA 4LVNB 2VCOA 3SDXE 4BK5C 1ERNA 4KY1H 3GLZA 4W6YB 1GS8A 2DWSA 1BG9A 3CIQA 4IKJA 3IFLL 2IF7A 5FGBC 5ABDE 4MDJA 2VDRL 5ECGA 4JRXD 4OD3H 1GYCA 4C55A 5KYWB 5SWSE 2W38A 4TOYH 3UAAA 3K6SB 5I1LB 1S7RB 3VXRA 1HH9A 2MCMA 1YYML 4HS8L 2IGTA 4MBOA 3CHXA 5E2JA 5I73B 5JIHA 1E30A 4NNXA 4TVPH 4YS4A 4MNHA 3RUGE 5GISH 3QEQE 1AD0A 3FH8A 1CPUA 4OGYH 1S6NA 4DKFL 5IB4A 3F84A 4JKKA 2HPTA 4PCTA 2DM7A 4Y5XA 1MCEA 3QB7C 4HLEA 2DYPA 1A7RH 3A6BL 3BAJA 1Z66A 1I4FB 5C0GB 1WISA 1AQDB 1NKGA 1NCAL 1OVZA 1YYMH 3NIDE 1NUDA 5GGUA 5KEZA 1REIA 1WAPA 1B4TA 1WFIA 4MDJB 1O9VA 1RUPH 1W0VA 3HEIB 4Z76A 4OFVA 4DKFH 1XBDA 5L4IA 1M3JA 1HH9B 3VXRB 1G0DA 4F1ZA 3P9MA 5ELIA 3ZTJG 5FGSA 3GO1L 2Z4QA 3SOTA 2F1EA 4O9HL 3DNKA 4L2LA 4Z78A 1WE5A 3QI9A 3MUGA 2YMTA 3Q8AA 2F58L 2L3BA 4MNHB 2V17H 1AD0B 4NNXB 4X7EC 5EFIB 4DPBX 2JKJA 1ORQA 5KSAD 2DJ4A 2RHEA 2XBDA 3KWTA 1NCAH 1IEAA 5IB4B 3N42B 1AGEA 1V3LA 1I8LC 4NBXB 3D09A 5C07A 1BZ9B 1ZPLA 3L7EA 5MP6L 2O93L 4PJCA 1E50A 4Y5XB 1BECA 2DYPB 3PXHA 4MZIA 1IE4A 4NZUL 4WW2F 4EQ3A 3UGUA 2Y07H 1A6TA 3NRFA 5GS0L 5E2VL 4L4JA 2DS4A 2E4FA 2XBZA 2X4PA 5KSAC 3MODL 2B9AA 1L7IH 3DSNA 3L95A 4N2IA 3GO1H 1PS3A 4RRPG 5GGUB 2XIIA 1QTSA 2A6JA 4M6OH 1AAJA 2VDLB 3CC5A 2D2OA 1W0VB 2DI9A 3F7RA 4Z76B 4NXKA 1T4KA 3P9MB 1T5KA 4KFZC 2IDUA 2V3DA 2H6OA 3S0PA 4JKWA 1ZGLA 5CN2A 2Z4QB 3N43F 1ICTA 3B7YA 4Z78B 2ADIA 1RZJL 2ZYHA 5KSBA 3QI9B 1I1AA 1HKLL 3ET9F 1F13A 5B38G 4CJ1A 4KROD 1ORQB 5D96B 3FJTA 1IEAB 5L2KA 2PPDA 3ZDYF 1AGEB 1AP2A 2X3AA 5DURB 4KDWA 5C07B 1KEML 3L7EB 4JRLA 4PJCB 1MG2C 4K8RH 3QIBD 4XGZA 3D87B 1AQHA 1EO8H 2X0UA 5CIPA 1A6TB 2XIBA 4N0RA 2XUWA 2Q1EA 1TVDA 4JE0A 4KROC 2X4PB 2ZD0A 1XGQA 1QATA 3DSNB 3L95B 3HJEA 2WBWB 2YRZA 2A6JB 4WWID 3SGEH 3U9PL 2O6DA 3FU5A 2LU5A 4KO6A 3ZIYA 5KTEL 3CC5B 2KYIA 2UXFA 3P3YA 5FA3A 3QIBC 4BUQA 4FLSA 2B5IC 2DBLL 3KPRD 1T4KB 5AAWC 1X9RA 1HOCA 3FUKA 1G9ML 4YHKH 1LWJA 5IVNA 2ZXGA 3N91A 1ZGLB 1NC4A 3GDCA 1W72A 5KSBB 2ADIB 4F57H 3C8HA 2YPVH 5I6XC 1I1AB 3D2TA 3IDMA 3JUZA 4YLCA 4OLUL 3P02A 5KBMA 5L2KB 4GRWE 2O6CA 3D2UD 1AP2B 3QWRA 4QRBA 2AK4D 1QVOA 5DLMH 1WD8A 1F4XL 2GIMA 3F04A 4XGZB 2M2DA 3PG2A 5CIPB 4UOW0 5GZOD 4UDUA 1IGTA 1G9MH 1XGQB 3MLWH 1X9QA 4NBYB 3ARGD 2J12B 1PIGA 4RIRA 5I0XA 1A66A 5FA3B 1TTUA 2YIHA 2Q3XA 1UUSA 5LAPA 2RQ8A 1HOCB 5GZOC 1FZJA 2XNAA 4NPKA 5J89A 3FTSA 4JY5H 2ATAA 1NC4B 1RZFH 1W72B 3ARGC 1N70A 2EYTA 2IH3A 4BZ2H 3IDMB 1U91A 4L4TD 1UC6A 3ARPA 4ZW7A 2E9JA 5FX3A 5F3BB 2D31A 1K72A 1QVOB 4QRTA 3BVUA 4OGXH 4JX0A 4NQEA 4AL8C 1JZJA 4U6VH 3VMPA 1IGTB 1QQDA 4GAAA 2XWXA 4LO9A 5ICZA 1JCVA 3W11D 1HINH 3DO3A 4QHLA 4RIRB 3BI9X 3BUIA 4BFRA 1NUFA 2IDCA 5AB0A 5C9JA 5C2BL 1AC6A 1FZJB 1RZ7L 1OALA 2XNAB 3MCLH 3VQMA 5I5RA 3A6OA 3VFWA 5AOMA 5FEBA 2BHZA 1WYJA 3L5XH 5IB5A 2JNZA 2QVFB 3MRDA 3NIGF 2EYTB 2IH3B 4DHLA 2BY3A 5L88L 1U91B 1RZQA 3H85A 2WSKA 1R0AH 3QDJA 1W8OA 3BP5A 1WFTA 4KU1A 1FSKB 2AFNA 4X2UA 3WELA 2D31B 4QRTB 1UTDA 4MB3A 4IMKA 2QVTA 3RPIA 3U2JA 4NQEB 3HS8A 1DQTA 3KJ6L 4PP2A 2ZTBA 5DMYA 1QQDB 1BOYA 5ICZB 2JIXD 3KYKL 4AKPA 3HS9A 4QHLB 4HWUA 4M6MH 2VDLL 4R5TA 5C9JB 2Z8SA 4S1QH 5IEKA 4DF9A 1SOQA 4LP5A 5J57B 3VFWB 3NJJA 4XI5D 4AXWA 3EDFA 3MRIA 5IB5B 3WKQA 5EF2A 4J2XA 5LB1A 3MRDB 4OCWH 3CMOL 1AGDA 4IGBD 3UZVA 3EOYG 1R3IL 3KJ6H 2NY4D 3QDJB 2XN9E 3HW7A 3N2JA 3BP5B 1JPGA 4IYKA 2G3XA 4QXGL 4XI5C 1CFBA 2EDJA 3RPIB 2YC1A 4IGBC 5DVNA 2I60L 4JR9H 3HPJA 1D5IL 3DUHA 4PP2B 1ETB1 2NY4C 2C7UA 5ITFA 4BJLA 1HEJC 2QJDA 1MIEH 3R0NA 2VO8A 3QH3A 3QJQB 1UENA 2CCWA 3WTVA 2VISA 2B77A 2L7UA 2HZHA 4L1TA 3VYNA 5F7AA 5IEKB 1F00I 4UCFA 3U4KA 4AXWB 3MRIB 1J10A 1FDLH 2EDMA 1UWYA 1AGDB 4P2CG 3UZVB 5JDJA 3MU3A 5T33L 2J8UF 1CXHA 4KV5F 5CZRA 3EKCA 4JN1L 1NMCB 5C3LD 1MDTA 1ZA6A 4X6EA 4AJYV 3BKJL 2Q2LA 1JPGB 4XP5H 4ZSOA 3V0FA 5GIRA 3E8UH 2YC1B 5EN3A 2DQDH 3HN5A 3HPJB 4PS4H 2N0KA 3RWGA 2C7UB 2HVBA 5ITFB 5E5MA 2XBTA 4I0CC 3T2NL 2ITCA 3B3IA 3QH3B 4X5LA 5J7CC 2VISB 2R0LH 3MLZL 4NHUA 3EOTL 1XMEB 4JN1H 2YRPA 4NFCA 4S0TD 2P52A 1B6DA 1GS7A 4WW1A 3TZVA 1L0QA 3BKJH 3QIWA 2GTWA 3TBYA 4JRYE 4JHWL 3D85D 1W72L 3BZ4A 5CINH 5DR5L 4Y0GA 1IIIA 4KK8D 2OX5A 4HLZG 4X6CA 3A47A 5DD3H 5TE7L 3L16A 3VD1A 3I6KA 4LSTH 3K80A 1FFTB 1AO7D 4HZAA 4PD4J 1ZA6B 4X6EB 2VZSA 3H7LA 2ZUQC 4PB9L 1IKOP 3JTTA 4ZSOB 3V6OE 3SDAA 5GIRB 5IROD 4NFBA 3EOTH 2WCPA 4LHUG 4LSSH 3UGXA 1AGFA 4DP1X 2VRQA 4KK8C 4NUMA 3RFRA 4Q2ZB 3VI3F 3M86A 3RWGB 3HC3L 3HNSH 3G9AB 5E5MB 2ITCB 3B3IB 3OKEA 5J8OA 2EC8A 2F2HA 5DR5H 5IROC 5TE7H 2JJSC 1J0JA 3RVUC 5D2NE 4YHZH 1RHHA 4OZ4A 4KXZH 3O3UN 1F4WL 4WW1B 3TZVB 4A52A 3QIWB 1RL1A 2DAVA 4PB9H 2G4GA 2XWJA 2GTWB 2JSFA 3TBYB 5JUEL 2LFEA 4RDBA 2GC4C 2X4RA 1FF5A 3BZ4B 3KG5A 4W9HC 2OXHA 3DGCR 4LOVA 5SWZD 5D7HA 2OX5B 3H6JA 4LVOB 1PG7W 4LZKA 4X6CB 5E9DE 1LMKA 3I6KB 3MGOA 5DT1L 3LD8C 5BOJA 4Y2LA 3TP4A 3JTTB 1QSFE 3PS6A 3SDAB 4XN5A 5D6DC 4P23D 4GAJL 4KNTA 1GSMA 1NGXA 4HGKC 1AGFB 4G7SB 3UEZA 2H1PH 2IJ0C 3VGFA 1X5YA 1EBAA 1GGTA 4AIOA 2D2CC 4M1GH 3OKEB 1NIFA 4HJ0D 1KG0A 4P23C 4ZMWA 1WZAA 1RHHB 1MPAH 4KQ3L 3BISA 2F7RA 2XWJB 1N0XH 2BLFA 1G4RA 2FJGA 4Z3TA 2X4RB 1N59A 4AKOA 5HI4D 2OXHB 1IAIM 1I8IA 3BSGA 3HTLX 4HJ0C 4CC1A 5KVEL 5F7WC 1CDCA 3MGOB 1A4KA 3UDWA 1Q1PA 4CU7A 3EJTA 5DUPL 2NYYD 3FFOA 2DD8H 5ILTL 5ESQA 2HAZA 4HHAB 1KEGH 3LIUA 1NGXB 3HLAA 4JQIA 4RRPM 5J1AA 3QA3A 5HI4C 4DKDC 2XZAL 3Q9PA 2CJSA 2DM3A 1CF1A 5LXVA 4WDIA 4X4KA 1BFTA 3JWOC 5E8NA 2WO3B 4X9FA 2NYYC 3N42F 2I5YL 4NHCH 1KG0B 5CBAA 2X2JA 1I9RH 4DKEL 1IAOA 2VZTA 2ZJSH 1D9KD 1VFBA 3O4LA 2WXPA 1YEGH 3BSZH 2ZPKH 5HHVL 2EXWC 1M2OA 2V4LA 2O6FA 2X53A 4FG2A 1DLHA 4I1NB 4TQEH 5BRZD 2AVGA 2FJGB 3GIVA 1MAKA 1RVFH 1N59B 1S7WA 3B43A 3NACL 1KPVA 1I8IB 2FO4A 2VR3A 2XZAH 2YMXL 2P5WE 1ULVA 2VMEA 1A4KB 1A9BA 1E42A 3U30C 4IJ3B 3LS4H 1D9KC 3ARBD 3W3BA 2IGFH 5ESQB 4QLWA 1AACA 1D7FA 4MQXD 1KYAA 4Q7DA 3HLAB 4UB0L 4K9JA 5J1AB 3QA3B 1WH0A 3MRQA 4WDIB 1N5YL 3C6LA 4HF5H 3VXME 5E8NB 4XP9L 4E41E 6PCYA 2AF2A 2ZOTA 3ARBC 3S6CA 4U6XA 1KUMA 4XWOD 4RWYH 3RWHA 2DLIA 4R7VA 3IMVA 3OQ3B 4PJCF 1CDHA 1NWPA 3O2WL 5CBAB 2QVMA 1OAZH 3QT2A 1IAOB 3O4LB 1VFBB 2BDNL 3SDYH 3ARZA 4KAQH 3HC4L 4DEWA 1DLHB 3U82B 1SM3H 2VN4A 3GIVB 3S3JA 1A3RL 1NLDL 1S7WB 4XWOC 1KPVB 2FO4B 1SZNA 2DWYA 2WUBL 2TRHA 3IDUA 3ZE1E 4GEJA 4EBQH 1N5YH 1A9BB 4XP9H 3K2KA 3K0WA 4AQ8C 4L8DA 3GQFA 3ATAA 1IBDA 2DI8A 4JFYA 1XH3A 3WD5L 1SY6A 2Q8BH 1MCNA 3MRQB 4MLIA 1O9WA 3NZSA 5KSBF 4L29A 4FQ1L 5C08D 4EN2A 5T5FH 3C6LB 1HESA 4CC4A 2AKRA 4WFFD 5DF0A 5BW7A 3BWAA 4U6XB 4R84A 5LXGL 4J39A 3RWHB 1GRWA 3BGMA 2QVIA 2BIPA 3EYFA 4ZOEA 3QWOA 4QHKI 4KHTL 3HVDA 5IBTL 4KMLB 1S3KL 4QRQA 1NGZB 1EJFA 5GRUL 2XYCA 4N2NA 1XL4A 4YEFA 4M29A 3NDZE 2X4SA 1P9MA 1XX9C 3ZHDA 5DD5H 1OCWL 4XO9A 1P7BA 3T1WA 4YSPA 4AM0Q 3EW3B 4L8DB 5D7EA 5LXGH 5E00A 3BPNB 2P80D 1PKOA 5JYMA 3UABA 1NLBL 5IMKA 4JFYB 1XH3B 3LKPA 5IBTH 5CD5D 4Q9QL 2K78A 4P0DA 4E9RA 1NBYA 4L29B 1X5GA 2Z65C 1XFPA 2AKRB 4M7ZB 1R5IA 3BWAB 2OA9A 3WO4B 4XBEL 1GGBL 5SWQA 1KWGA 2X70A 1DJYA 2Y7NA 3TLRA 3EYFB 2MCPH 3BGMB 3QWOB 2E7LA 3L3DA 2C3WA 1OCWH 4GSDL 4ONOA 4OF8A 2WBXA 4WK4B 5BO0D 5C0CA 5E24E 3DO4A 4QRQB 4YAQA 1AR1B 3OC8A 4M61A 1N6QL 5D70L 2X4SB 2APBA 2D9QB 4ANKA 1MKFA 5I0ZA 2BC4A 3O2DA 2WQAA 4UV4L 3UTSA 4QYOA 3Q6GH 4TNGA 1WGVA 2CDEA 3D25A 5BZDA 1OM3L 3DETD 4XBEH 5C7XL 4WKZA 5E00B 1XCTA 1GKEA 2BOBA 3DK0A 1HSAA 2EC9T 5IMKB 3ECBA 2ZKHH 3X2QB 2R2BA 3LKPB 5BS0E 3HG3A 4FQLL 3GXIA 2QEJA 5K5YA 1SXNA 2W9EL 1NBYB 3DVNA 4RMUA 3RBGA 2ADYA 1FPTL 1R5IB 1Q0XH 5SWQB 3DETC 5FGBA 2X70B 3MXWL 1Z9NA 1KZYA 3L3DB 5AG9A 3ME0A 2D7TH 5D8JH 3GS7A 4KO5A 1MCJA 5C0CB 5E4OA 1CC3A 3TH2T 1VA9A 5C7XH 1R33A 4YAQB 2IG2H 2K9FB 1KACB 43C9A 4M61B 4YHYC 1MFCH 3PWPD 4PIRF 5HBBA 3L17A 3LYRA 2BC4B 4U7MA 1IQDA 3L81A 3UTSB 3CSYA 4QYOB 5FCUH 4A1KA 3BVDB 4FNTA 1Z0NA 3D25B 4ODHH 3FSOA 5BZDB 5E56A 5FYJU 3FRPA 4WKZB 4G83A 1ZATA 1XCTB 2BOBB 2Z8VC 1HSAB 3LZOA 1BAGA 2ICEB 5TQ2L 3ECBB 2R2BB 4JQIL 4Q74A 1UA6H 1BFOA 1KJ3H 3FKUS 5L9DL 2CSPA 2RBLA 3DVNB 2BNQA 4F7KA 5CN1A 4HAKA 3RZCA 4HMCA 2CHDA 4WHDA 4KHXL 2EUVA 2GEEA 3ME0B 2R1XA 3ABLB 1TZ8A 4ODVH 5HHOE 1Z9PA 2Y5EA 4OBRA 4PUBH 43C9B 4HW6A 4OI8A 2OMZA 3SKMA 1OCCB 4LNRA 1IQDB 2QZ5A 1OP4A 4YOKA 5B39A 5DGRA 4OV5A 3CSYB 4NN7C 4GMSH 1SVZA 5GRWA 1J5DA 1GZHA 3V4VA 4L3CA 5AB2A 4XN8A 4KKNA 5DS8A 3FRPB 1I8LA 1MWAH 5EG6C 3VB9A 2ATKA 1XXFC 4Y4FD 5AENA 3P30L 1NDGA 1BFOB 1BQ5A 3LNGA 2BNQB 4LQFL 1CD0A 1HAWA 2XY1A 3TYGL 4MJHA 5L0QC 1BZEA 4OT1L 3BDBA 3VG9C 3RZCB 1J1OL 1T6VN 4KDVA 2JE8A 2NY0D 4NIYE 4Y4FC 3I6LE 4X4MA 4E9LA 3V0JA 1VJSA 5I8OL 2DJSA 2OW6A 5CCHE 1DBJL 4KNUA 3V7AE 2XVGA 2WXLA 4FNPA 3OLDA 3PV6A 2OMZB 3SKMB 1IO4C 1MXDA 4LNRB 1ZDSA 5B39B 1CBVL 5D71H 1NCNA 2NY0C 4OV5B 4LQFH 4K5NA 1AIZA 5L8LB 4PYGA 3V4VB 4L3CB 2AEPL 5DS8B 5CCGE 1MFDH 2IV9A 2CU9A 1H15A 4ELDA 2ATKB 3OPZL 1G87A 1NDGB 1SY6L 4Q9BA 2BZCA 1ILSA 5I8OH 4PWIA 2EICA 1GHFH 2KDGA 3NZUA 2ODIA 5GRVK 3W2DH 3DX8A 4DGVH 2GJ6A 3IEAA 4U2YA 5AAWA 5A2KH 1DUYA 3W82A 3O3AA 3L4WA 3SBRA 1UD5A 3GXMA 3PV6B 1U8LA 1CDBA 3DHPA 5HGBA 1LO0L 2LW3A 5EUOE 5AYUH 1M1SA 1L6ZA 1A6VL 4OLWL 1CXLA 1HI6A 1NANI 4IU3A 4PI2A 1BEYL 2P1YA 1CGSL 3QUZD 1H15B 3PUUA 2MNUA 5E99L 4LASL 1MFMA 1ZCRA 4LFHD 3EYVA 1BD2E 4X6CF 2G30A 1MHPL 3OG4B 3UEQA 1DBML 2BWQA 3QUZC 4PU2A 2V9RA 1IGFL 3DX8B 3IBOA 3AREA 2GJ6B 4OLWH 2B5IB 2GJRA 4Q4IA 3J2PA 1DUYB 4F9PC 1BEYH 3IBEA 3B2UC 3NRQA 1WBYA 3FUIA 3O3AB 4HJGA 4NO2A 1NANH 1TQBC 4GAYA 1U8LB 2IOIA 5ADOH 4YDVA 5HGBB 1FORL 2KUTA 1OT1A 1OWRM 4ZJ9A 3AMLA 4L5FE 2BINA 3VG0H 4ZYKA 1HI6B 5T3ZH 3BH9A 1RJLA 3N1QC 4IU3B 5CMAA 4AC4A 1RJZA 1XD0A 5EBWB 1DLFH 2JLPA 4JO2H 3WXVH 4C4KT 4PGZA 3D4CA 4N68A 2C1OA 1T0NA 3EYVB 2VLMD 2NT0A 1SXSA 2CRMA 2D0HA 4NC1E 3QR1A 4I3SL 4F15B 4L4TA 4JB9L 1B2YA 2JKSA 4KZCA 4ZO6A 5LNEA 3X13A 4WFHE 4JE4B 3MBED 3SE3C 5L4JA 3AREB 4FLHA 3VA6A 2X2YA 1ACYH 2R2HA 4XPHH 2JJVA 1H3TA 3CN2A 4LL1A 1WBYB 4HJGB 4NO2B 3EGDA 1JSYA 1HZLA 4GAYB 3DKHA 1IFRA 1DCLA 2NY5C 4FC3E 3MBEC 4YDVB 4HWBL 4BV1A 5C70A 1T4WA 2PWFA 2YGVA 4KI1A 5D5MA 5JR1L 4ZYKB 2K6ZA 1HOEA 3DX4A 4FERA 4JB9H 1U8JA 1RJLB 3BH9B 4WZ9A 5CMAB 5AKRA 1RJZB 2AQRA 3NJNA 1JZEA 2EH7H 4HGWA 3OV6A 2BOCA 2F18A 4IEFA 3GTNA 3Q2CA 4IK6A 2C1OB 1T0NB 4UT7H 5EBMA 4A2MA 1TETL 3IWUA 1DJSA 1PFOA 3PXJA 4L4TB 1R24A 3SQOL 5AB1A 1CFQA 2W80C 3X13B 5IHHA 1XIWD 3TH4T 2R56L 4HWBH 2JF1A 4L0PB 2VERN 3LN5A 2R2HB 2QGDA 2HLEB 4B9ZA 2A9BA 1WGOA 3EGDB 5E03A 1H6UA 2OTUB 3GNML 1XIWC 2JIXA 4ZW8A 1IZKA 4EMZA 1IVTA 1GYVA 5D5MB 2VQUA 2ZG3A 3VNYA 3V4VL 1U8JB 4XNUH 2EYSA 3AUVA 1KF9B 3GC3A 2QLVB 3CFCL 2R56H 4HGWB 2OR9H 3QUXA 2BOCB 2WUCL 3OJMB 4IEFB 5FHBH 1WO2A 4PJDE 2ZXWB 1KXHA 4IGBA 3B9EA 5CP3A 5EBMB 3LRLA 3MYJA 4H8WH 3FCTA 1R24B 3DX6A 1CFQB 4RA0C 1XEDA 4L1LA 4Y8AA 1F4HA 3P9LA 1MCSA 4IIZA 3LN5B 4MNGA 3V0GA 1S7SA 2J5WA 1BZDA 3LPGA 1HAUA 1QFWM 3T77A 2DIEA 5K9KA 1OSPH 1DQML 4F33A 3BQUA 4JPWL 2JIXB 4K0OA 4ZT1A 4OGAD 1TYRA 4YMPA 3L3OA 2EYSB 3AQXA 1DZBA 4ANWA 5CFAA 1JJUA 5JIPA 1WLHA 4EDXA 1N67A 2NNAA 3IU4L 1XTLA 4LIQE 3X12A 3QUXB 3IJEA 3ESMA 3S4SA 5C2UB 4GKOA 3CHQA 3N9GL 1YAZA 4IGBB 4JHAL 1KLFA 3MYJB 1VGEL 4OGAC 2NY4B 2B20A 3FCTB 3BKCL 3CZUB 1DQMH 1JVKA 4EI6A 1SOKA 5CNHA 4PRPD 4PMFA 4Z6AT 4X0KA 2HG0A 3P9LB 4PVLA 1RJYA 4G6JL 1S7SB 4MNGB 4NIKB 4LGPB 3OMAB 4KTDL 3T77B 1ZANH 5K9KB 4F33B 3FB7A 4PJ8D 1E7VA 5TTRA 1A47A 3PJSA 4G6FD 4AEFA 4I2XE 4ZQTA 2FT6A 3SGDI 1TZGH 3WFEH 2Q10A 1GGCL 1SBBA 3BAYA 5C0EA 1QUPA 3L3OB 4JPVL 3GXDA 1E4XL 1X5ZA 3TESA 4EDXB 1KYUA 2NNAB 4PJ8C 5DMKA 3X12B 3IJEB 3S4SB 3CDFA 3WY2A 2QHRL 3F83A 5GRYA 8CGTA 2AQ1A 3RA7L 1KLFB 3HAEA 2XWEA 4PRBA 1JI2A 4J4PA 4CVZA 4EI6B 1DSFH 3VVWA 2R4RH 2JJSA 4X0KB 4LGSB 1F56A 2BSCA 3AT9A 1RJYB 1S5HA 3IS1X 2F1AA 3SGDH 3VRLF 5F93C 1EAOA 4OSUL 4OFKA 4RAUA 1MFBH 3FB7B 4C58B 3PJSB 3AM8C 1BQLH 1B2WH 3OF6A 4U1GC 1E8WA 3L3KA 3RA7H 3FC8A 3CFDA 4DJMA 5C0EB 1IGCH 1P4UA 2E47A 4KKRA 2H6PA 5B1BB 5DMKB 2JB5L 4I89A 5D6DA 3EDEA 4CSZA 2HKLA 1A14H 2JH2A 3HAEB 3O6LL 3IMTA 4OSUH 4PRBB 1F97A 2P5ED 4N6RA 3SBWA 3GBDA 4S1RL 1MRFL 2L8AA 2V5YA 1TENA 2H0JA 3M45A 4ZAKC 4JK0D 5A6IA 1K6QL 2VR5A 3F62A 5E6UB 4MJ4A 2VXTH 2YMOA 1S5HB 1IARB 3RHWF 1AOHA 4O5LH 2F7PA 4W6WB 5FGCE 4MZ3A 2EADA 1PZCA 3DHJA 4RAUB 3ZDZB 2MNWA 1Q0YL 1Q0EA 3CDYA 2C3VA 3L3KB 1OF0A 1EX0A 1RUKH 4AL8H 3BGAA 3CFDB 5M94B 2FD6H 5FCSH 5IESL 3J27A 2DN7A 1MRFH 4FOMA 1NH6A 2H6PB 3LY6A 4YXLL 2VWEC 5CKAA 2VE6A 2GI0A 3QZPA 4KC3B 1ESOA 1YECH 3GSRA 4ZS7H 2X12A 2J72A 4XPFL 1WFMA 1CL7I 3P3SA 3CFJA 5CGMA 3LRHA 3OAZK 4N6RB 4M6NL 2KT6A 1CVRA 3IJYA 4UIMA 3ZLQC 4F5CE 2EDEA 4XVOA 2NX5E 3SJVD 4H5SA 3DXAD 3M17A 4WIQA 3U6XA 5F9AC 2C3VB 4N9GA 3MBXH 1Z1WA 3LN4B 3T3MB 4PAZA 3ZQXA 1CD1A 5I1CL 4A2GA 4XXDA 3OKKA 4MXQD 3ZY7A 4H13C 5DMIL 4LKCA 1CL7H 2VE6B 2IQ9H 3GSRB 1IAKA 1WZMA 3ZDYE 3BN3B 5A3ID 3CFJB 3KPLA 2HLAA 4R4FL 2NY1B 3ARBA 1JXFA 3IJYB 5LGYA 4EKJA 2DQGH 4GUPA 4F80A 2ZG1A 1CLZL 2WLKA 2AQSA 3QZBA 4UIMB 2R29A 4YC2B 2ZT9C 3D6GA 5A3IC 1CD8A 4H5SB 1OW0A 2CNYA 3X3GL 3M17B 1SOXA 3VXSA 4C4KO 1PY9A 4N9GB 3WEBA 1F1AA 5I9QB 3ZSSA 1SHSA 2OK0L 3ZSTA 4ZFQA 3PXLA 1CD1B 1SRDA 2J7LA 3N6YA 3CPLA 4XXDB 3X3FH 5DYOA 1EFXA 3OKKB 4AQ8A 3OG6B 2BX5A 4LKCB 1CK0L 1HYSD 1UJ3A 5F7MC 4W9LC 1IAKB 2YPLD 4D8OA 1Y1DA 4MS6A 3QG7L 1TFPA 2FBJH 1DQDL 3KPLB 4PG2A 3ARBB 5T1LA 4Z95L 4KH2A 4CC0A 3O11A 3CVBA 2MCAA 4GUPB 4U1MA 1HYSC 1MJ7L 2F53D 1HXMA 2CGRL 1PCSA 4U3SA 3DPBA 4IRJA 4XZ4A 4AV4A 1QA9A 2EXSA 1QSVA 1CK0H 5AOIA 2WB1A 3GHBL 3PDGA 1NC2A 2VDNB 4BEIA 1X4YA 2RR3A 4H0HB 4GFXA 4OM1H 3BJ91 2Z34A 3OHXA 4FN0A 4OLYL 3GJFH 4XPGL 5E1HB 4J3OF 5CZVL 4Z7NB 3BPLC 5KAQF 3TV3H 2X2HA 1MLCA 3CPLB 5DYOB 1EFXB 3NRPA 3FFCE 4NNYA 4Z95H 5C0BE 9CGTA 3F58L 1UJ3B 4B9JA 5EC1A 2E6QA 3N1MC 4LDLB 5HDQH 3SCMA 4NO0D 5IW3A 3QUGA 3O2VH 5T1LB 1SN2A 4OCNC 1M6UA 4HXBL 4P5RA 3BFQG 3OVUB 4RMQA 1UXMA 2APXA 4U1MB 3AB0C 3UTTD 1ZOXA 2XA3A 3L4YA 2DJUA 2R0ZH 1HXMB 1UOWA 4FTVD 3VM7A 2HKHH 2FZ3A 3R18A 4U3SB 4JFUA 4C4BA 3DPBB 4IRJB 1QA9B 3AC0A 4GIAA 4DW2H 3X1EA 1NC2B 4UV7H 4X9IA 3C08H 4GLRI 1BZ7A 2X5PA 4JREB 1EXGA 3OHXB 4E9YA 5CUSL 4I3GA 4G2AA 1OTSD 3BH4A 3T04D 3B3BA 1MLCB 4QTFA 2Y7QA 2FEEL 3HFFA 3NIGE 4S2SA 4NNYB 4YL4A 5CN3A 6CGTA 3S8FB 5B21A 1YEKL 4AIZA 2WVSA 5EC1B 1JF6A 3MKKA 1X4ZA 4JFXA 1SXBA 3SCMB 4Z0XA 5JW3L 3IMWA 3MLTA 4RWHA 1OTSC 1IT9L 3DTDA 4J27A 3P4OA 3SDDD 4WNQA 3T8MA 2PP7A 2A77H 1LLAA 2CK0L 5CF3A 2ESVE 5CUSH 2K3HA 4KO9A 2HT3D 2VR4A 4GLRH 3KBHE 2FZ3B 3QUMA 4UQAA 4GKZA 3WHE1 3FRUA 2D0GA 2JKXA 1JXDA 1YEKH 3SDDC 4AYSA 4J2QA 3UXFA 4XCCH 5FYKU 1BREA 1IVLA 4QGYA 2XV3A 4XP1H 2VR9A 1DQVA 2HT3C 1BF5A 3FAWA 1KCBA 2Y7QB 1L6XA 3HI1A 4S2SB 2XTJB 5E7BA 1J86A 1A25A 5F9JA 4AIZB 4QUOA 2PO6C 5F7HA 1ZLWK 2E6PA 1A7OH 3EFOA 5FYKD 2FR4A 1RY7B 4JFXB 5DS2A 5BOZG 3MLUL 1RV6X 2OLDA 4Z0XB 3MLTB 1TG8A 5D5MF 3SYPA 2EO9A 1LGVA 4ES8A 4QF1A 4XOAA 3JWOL 3P4OB 1W8NA 1WDAA 3AITA 4WNQB 1QD0A 5DZVA 4GXFA 1HNFA 5CSBA 3S37L 1XAKA 1VKXA 4MB4A 1AE6L 2LTQB 1QYGL 2IFFH 4AMKH 2OYPA 4RA3A 2BHYA 3QUMB 4GKZB 5MEND 4HQQL 4HJJH 3FRUB 4M5ZH 4CADA 4ATTA 1TTGA 1DTUA 1ZGLM 4Q8BA 2CLRA 5ISZE 1ZHLB 2OMVA 3HBPA 4QYAA 2FWUA 3KPOB 4IBVA 4P3DA 2YRBA 4JKLA 3HI1B 3K6FA 2P7TA 5C08E 1SFHA 5F9JB 2VUOA 4KV5E 4JHBA 3P2DA 4FFTA 3EFOB 4NXSA 5DQDH 5I8CA 2FR4B 4XPTH 1SVCP 4PJGE 4QF1B 5LBSH 4D3CL 4EZJA 1ZVNA 1EANA 4G8FA 3CX5J 4TUJA 1VKXB 5KUKA 4L3ED 2VLRA 5CEZD 1PLAA 1ZTMA 2R29L 1FIGL 2WNKA 4NQCD 3RY4A 5EF0A 4ANXA 5PAZA 4HG4K 4C56A 1DBBH 2RGSA 1U33A 4CADB 3Q1SH 1P4BL 4FXLA 5DRWA 2VXVL 2PNDA 2VDNL 1I7RA 1JMZA 4FNSA 3KZ8A 2CLRB 2OMVB 4RVBA 3B5TA 5HGHA 4P3DB 4XN2A 3MV7A 1G7HA 1NBCA 2NQDA 2P7TB 5IWLA 1OHZA 3ZL4H 5I8CB 1E5AA 4JM4H 5C0IA 1F42A 2Z7YA 2R4SH 3UADA 3UFIA 2DKMA 5L0QB 1UCBH 2EDFA 3A67H 4PRID 2PP8A 4G8FB 3VI3E 1TEGA 1T3FA 2X38A 4TUJB 3ABKB 2YGOA 4N86A 4AEIH 1CYGA 3GM8A 2VLRB 3VX1A 1SOSA 3EIFA 3MTRA 2DF3A 5DXWA 2L04A 1XV8A 4C56B 4BYHA 3S3SA 2CKNA 5IVXE 3WIFA 1CZ8L 2DIAA 5DRWB 1D3CA 4TL4A 5D4IA 2A6IA 3FPYA 4I77H 1I7RB 4G82A 2IDSA 3ILPA 4PJIA 1M6OA 1BPVA 2NY0B 2AANA 1AHKA 4U1KA 3RTQD 4DO4A 2BO0A 1P1VA 2Y1AA 4ZK8A 1NCJA 5HGHB 1DEEA 3MV7B 3VSQA 1G7HB 1MCLA 3ARRA 4LHJB 4XB3A 4B0MB 2YHGA 1FFNA 3IDGA 5FOJA 3O6FA 5C0DA 5C0IB 5DVKA 3RTQC 2FRGP 2H32H 3I3BA 1HSBA 4LSPL 3QXUA 1GMEA 1T3FB 2XWDA 5T1KD 1X9LA 4NCC1 4O2CA 3WMPA 2MOQA 1SDDA 3B7SA 4TLTA 1WF5A 5TDPA 1EQWA 1M1XA 3LVTA 3WIFB 1R5WA 2VZ3A 2ZAIA 2FGWL 4PSPA 1K5NA 2A6IB 2OCJA 1NCGA 3ILPB 4PJIB 2HT2D 1M6OB 1LEGA 4LF3A 4U1KB 1O5PA 1QZ1A 1B9KA 1DEEB 5F7LB 4LSPH 1PJWA 1FNAA 3KLQA 3ZDZF 1FFNB 3IDGB 3MRRA 3WN6A 5FYJE 4Z3FA 3C60A 3O6FB 2HT2C 3L1GA 4OIAA 5C0DB 3CHRA 3VXRE 1PX8A 3AACA 4TMPA 1X7SA 1HSBB 2BVYA 2CJUH 2PTTA 4IW4C 1R19A 2H0FA 4FLRA 5E23A 3WAKA 1PZBA 3P0YH 4NUQA 3SE3A 2X4TA 1BFVL 1OAQL 1LQBC 3PLYA 4O2CB 3QJUB 2EIDA 5HY9A 1SDDB 4H7VA 5JMRA 5TDPB 3QUML 1D5XA 1M1XB 1WT5C 3F65A 3G6AA 4L48A 1R5WB 1G0XA 1K5NB 3NCCB 4LMQI 4IBLT 3NTCH 4DK3A 3ARVA 1LEGB 2ZXCA 1NAKH 4LF3B 4UDTB 4GUQA 2JI1A 2CBPA 1DJZA 1IBYA 4WU7A 4FS0A 3MRRB 3PL6D 3QJOA 3C60B 3SY6A 4I0PA 1BSIA 4NSKA 1A5FL 4PJFB 5AZEL 2PTTB 3N1PC 2A9ML 3A0OA 5CO1A 3JZYA 2X4TB 4I4WA 5HDBB 5LGHL 3CZJA 3CIAA 3PL6C 5CCJA 4GMTL 1WCBA 3BAEH 5HY9B 4XHJD 3QORD 3E9TA 2CR6A 1D5XB 1UYWH 2WKOA 4H2CA 3G6AB 4PJCE 2Q87A 4LCCC 2VZUA 3RLSA 5C6TL 1G7QA 2DBJA 3MVSA 4AEHH 1ZMYA 1A5FH 4IBTA 3QULA 1F02I 4XHJC 1KTBA 3RURA 1NMBH 4WU7B 2AQNA 5A43C 1UKSA 5EORH 3H1ZA 3ZW3A 5K93A 3BKML 2DLGA 4QGTA 3FYEB 3GFUA 4BFJA 5DZNA 4I0PB 4NSKB 2E27L 4JFEA 2X88A 2VDOL 4LOEA 3VJ6A 2NNXA 4LSRH 3ZMEA 5I30L 2B16A 5KSBE 1Z7JA 4MA7L 1M7IA 4I4WB 3GEWB 1Y1UA 4YK4C 1MCPL 3A3YB 3CLEH 1WCBB 3VD9A 4CVWA 5L2KE 1H3PH 4HIQA 4GBXD 2XN1A 4K3HA 4HMEA 1RURL 3PU7A 1B0WA 1G7QB 4ZO7A 2CH8A 3KAAA 3UC0H 3V4PL 2RTTA 5I1JL 5EWIL 1KTKE 1FYTD 1WWBX 2EC9U 2VDOH 3LMJH 3QULB 5AFAA 3BJLA 4QHNA 1Q90A 2H2SD 2LR4A 2NY3D 3QJZA 3HBQA 4HWZA 4GBXC 4WHTA 4MA7H 2YKKA 2VUYA 4TSAH 1F58L 3OXSA 1DQQA 3GLDA 4PJ7E 3VJ6B 3HG1A 4K3EL 4P2YA 2NY3C 2XHNA 7CGTA 3V4PH 1M7IB 5KZCB 4XP6L 4AQEA 3QXVA 3V6FA 2CDGA 1BYNA 4KXAA 1A7NH 4XMKL 5GS1C 4LCWA 5MEPA 2B4CH 3L2LA 4P5KA 3WHXA 1F58H 1T5WA 1KXQA 2XJLA 2J3SA 1LJMA 4QHNB 2MPAH 1DJGA 3U7YH 1TSHA 2JJWA 2ZCHL 4M43H 1U8HA 4HWZB 2VDQB 1NL0H 4WHTB 4TSBH 2DOCA 3TGXA 4EOWH 3L4ZA 4H1LA 2CXKA 1RPUA 3CDZA 3T08A 3D3VD 3OXSB 1DQQB 3BUYA 3HG1B 4UINH 4HIXH 3RE0A 4P3CL 3QG6A 1NIEA 1IC7H 3EUDA 4P46A 2AJUL 3RBSA 2ZYIA 4GAGL 4BK4A 1SN5A 4XAWL 2UUDH 4AQEB 1HWGB 3V6FB 2CDGB 4KXCA 4RBPK 5MEQA 4KFMA 2J5LC 4LCWB 2LOEA 5AVUB 5TE4L 4JL2A 1I9IH 2EVJA 3NK4A 4LARL 3CLFL 3AM8A 3I9IA 4NQEE 4P5KB 3WHXB 4D7PA 1T5WB 3A5VA 2X42A 2CBQA 4KJWD 1TJGH 1U8HB 5FW6A 5I75C 4E68A 1KCRL 5BRPA 3MV8A 5G4OA 4H1LB 3DX2A 3SPGA 1PEWA 2ZOLA 2BY1A 3CDZB 2FWLB 4KJWC 4ABUA 5I23A 2P43B 1OKEA 4NQSA 5DC9B 3BUYB 3VO0A 2E75C 4U3CA 4OCSL 3QG6B 4BA0A 3TBTA 3CLFH 3H6AA 4ZAKA 2Y3NA 5KVEE 4P46B 4WO0A 3VW3H 4P9HC 5TF1L 2VSCA 3QDJE 4Y1AD 1JS4A 5HGAA 4AH2A 2UVFA 1UGKA 2XWRA 3MAWA 4GUCA 5MEQB 4HK0A 2OI9C 4PRHA 5GGSY 1QPPA 1RZ8A 2P5EA 3KVPA 1MNUH 4H8UA 3UP1A 4ZXBA 2NY5L 2XA8H 1NDMA 4U1GB 3T0EA 2AP2A 4RMVA 1OSEA 3PGCA 3UH8A 1MAMH 2WB7A 5E1QA 2C3XA 2COQA 4RFOH 3W56A 4MMYA 3HI5H 3PABA 4YFLF 4LSUH 3OR6A 4YHNA 3LH2L 4MCZA 1DUZA 1WICA 1L9OA 3MV8B 4WWPA 2VITA 3IGUA 4F8QA 4GH7B 2ZOLB 4X7CC 1TO4A 4NQSB 4WI3A 1TNMA 2C8NA 4JNXA 1CDYA 4FQHA 1EAQA 3FSVA 3TBTB 3RGHA 1P5VA 2F5AH 2NY5H 4ZAKB 3SZKC 5IHWA 1PZSA 2BPBA 5I0VA 4IOIA 4W9FC 1ZS8A 3SODB 3BRDA 3LEVH 5GRXG 5HGAB 4LPVA 4AH2B 1WFUA 1TJHH 4DOHB 4DP7X 4X80L 1DSYA 4F8OA 3NCJL 3LKNA 3DIDA 4HK0B 4LESA 3C8KA 4M4PA 4PRHB 1EPFA 3WMQA 2BH0A 3VAEA 1RZ8B 2P5EB 1J8HD 3IKCA 3DTXA 3D5OF 4ZXBB 3KCWA 2WD0A 4XO4A 1NDMB 3T0EB 2GB2A 1HKFA 2CHXA 3PGCB 2EDTA 4FP8L 1SHWA 4BFGA 2VB5A 4JDTL 4MMYB 1S78D 2EEXA 3V8CA 1L9NA 3PABB 3OR6B 5INDA 2AJXL 4MCZB 1DUZB 1PZDA 3IGFA 2VITB 3HG4A 1U95A 4OZFA 1MEXL 4PRPE 5D7JD 3ZKQD 4Z1PA 5JHDD 1TVBA 4XC1L 4JO8A 1THCA 2FX7H 4AT6A 1UXWA 4X7DC 3NPZB 2WLZA 1CFSA 1P5VB 3MJ6A 1B0GB 3POHA 4IOIB 1ZS8B 4KMTL 1IKNC 2WO2B 3DJ9A 2AXJA 4FP8H 4YHMH 4JDTH 3LKNB 4QKTA 3FQYA 3TA3A 3C8KB 3LEXA 4ZSOE 3WEAA 32C2A 5CEXA 1ZLSH 1OV8A 3IKCB 4UIKH 3WN5C 4JVUA 1F86A 3HE7D 3QP3A 1NIBA 4W6XB 1TQUA 3GI8L 2X87A 3GMQA 4XMWA 3R8BB 3ZTEA 1E5BA 5INDB 3N41B 3VFGL 3HE7C 3OLEA 1U95B 3QUYA 4OZFB 4XPAH 5ESVA 2GBTA 4M7LH 1F0LA 1QFUH 1TVBB 4DP2X 2Y4SA 4AT6B 1UXWB 2HG5A 3S4SG 3G5YA 1C8PA 2J1ZA 4DP5X 1CFSB 3TC9A 4O58L 3VSVA 3KR3H 1GZQA 2E59A 3DGDA 3MRMA 4OZGA 3QZLA 2YPLA 4G3YL 1IM9A 1NPNA 3B7UX 3TA3B 1NCDH 3LEXB 2N59A 5EZLA 3KD4A 32C2B 5CEXB 3QXDA 4LSVH 3SN6N 4Y89A 1E7UA 5DFAA 2VH5H 3P0VH 4Z7UA 4ZTOL 3GMQB 3UJJL 2A9NL 2IPTH 3DA0A 2AABH 5IHLB 3IGAA 4O58H 4QRRD 2RJMA 3IM1A 2BCMA 1W15A 2C34A 4YNYA 2E74C 1E6JH 5ESVB 4PJIF 2EE6A 1ZLDA 1MFAL 4F8LA 2C5DC 3LZFH 3ML8A 2QQLL 3ZDXE 4M8UA 2HG5B 3ZYZA 2EIEA 4DETA 3G5YB 2AK1L 3WEOA 3RVVD 4MJID 5FXCH 1GZQB 4DEPB 1SXCA 4GSRA 3MRMB 1OAXH 3QDGA 4OZGB 2YPLB 2CO6A 4LPUA 2F8XC 1IM9B 1RZKL 3MLYL 1TSRA 3AT0A 2A9DA 2LQRA 4JGMA 5EZLB 4UT6L 5F6IC 3Q5YA 3TFKD 3QXDB 4RGOH 5AW7B 4PCYA 3RVVC 5KVMC 3TBVA 1IBBA 5FW8A 2CJ3A 1MFAH 5LCVH 1ZY9A 4Z7UB 2B1AL 2V33A 5HD8D 1N7ML 2VQTA 1NICA 4FTVA 3VXUD 5I16A 3VFNA 3IGAB 1U42A 1KGCE 4NOBA 4AITA 3EH4B 2HXAA 3TFKC 3BO8A 4YNYB 4WJ5A 2GK0A 4NZTL 4ELMA 5LDSA 4W9EC 4K2UH 2GCYA 1AZRA 1UG9A 4E5XA 2FBRA 2HJFA 4IBYA 5HD8C 4UT6H 1IU1A 2JB6A 1XGZA 2DQUH 4P2OC 3SGJC 1FNFA 2CM6A 4ODXA 1TVHA 4NT6A 3ZJAA 3TJEH 3QDGB 2B1AH 2CO6B 2Z91A 1MN4A 3B37A 4I5BA 4LT7A 1I9EA 4B9FA 4P2RA 4DGYL 1GC1C 1UWEL 4B5ZA 5LN4A 4B6ZA 3TPKA 3L2NA 3TBVB 2YLKA 1DVFC 3VD2A 5HDBF 4NN5C 4LEEA 3ULVD 3H55A 12E8H 1E9OA 5B7FA 4FTVB 2XJKA 5I16B 1J7VR 2EE2A 3EDDA 4Y19D 3VFNB 1FNLA 2FIKA 3NA9H 4Y4KA 3NZHH 5E7FA 3S88H 5M7QA 1ZA3A 3BO8B 2PO6A 2YARA 3CFIC 2KMWA 4WJ5B 2GK0B 2VDKB 3O4LE 2WCGA 4XZUA 1D6VL 4G8GA 5C7ZA 4ELMB 2GCYB 4OLXL 1E5YA 1JGUH 2H1XA 4NKQB 4TM9A 3ULVC 5BV7H 3FTWA 2HJFB 4QRPD 4E5XB 5ANMA 3GSVB 3KDMA 1UWEH 2JB6B 3BFOA 1TQTA 4D9RE 2M1KA 3GMRA 1TVHB 4NT6B 1H3UA 4OTXL 1GYUA 2B0SH 1E5UI 4K7FA 4NM4H 4ZRGA 3RAJL 2Z91B 2VMDA 4I5BB 1KULA 1RUAL 5C3TA 1N18A 4P2RB 1IFHH 3RIFF 2VN5A 2X2UA 5AW4B 4OFYD 2P8LA 1YQVH 2NOYA 1OP9A 3GM0A 1CLOH 5CR8A 1E9OB 3T3PB 4P2AA 1KY7A 1OAUL 1UA3A 2QPSA 2APVA 2WKOF 5DDHA 3F5WA 2FIKB 4Y4KB 4YSSA 4Q6IC 5MENA 4KJQD 1UOKA 1ZA3B 2PO6B 2DH3A 3OMNB 4U1JA 2FHCA 4XZUB 3T6ZA 4G8GB 3ZO0A 3CVHH 2FYVA 1ZVYA 4MNQD 3MR9A 3QRGH 5ANMB 4FULA 3KDMB 5TPWH 4F2MA 1O7DE 4OM0H 5AW5B 1TZIA 1FRGL 1OCRB 4KJQC 3GMRB 3WO3B 1CE1H 3FU6A 4K7FB 1I8MA 2QKIA 3FZUD 4Z0BH 4ZUWA 4Z3EA 1YN7A 1KIPA 2FQDA 2P8LB 5KBLA 1OAYH 1QUNA 2WLMA 3TCLA 5I6KA 2KPNA 4HPYH 1ZRUA 4I7ZC 2JI2A 4OCYH 4YQXH 3S3BB 3VWJD 3FZUC 3F5WB 3LHPH 4X5WA 5DDHB 4F8TA 4B7LA 5MENB 1GYAA 3B7RL 2J88L 1ZWIA 2XQYK 4WQOA 1N4XL 5IY5B 4U1JB 2AV7A 1T04A 1PQZB 5J11B 1VADA 2X89D 3MR9B 2PCFA 4M7KL 4OIIL 3TJHD 3VWJC 4F2MB 5K9JL 1TZIB 1BVOA 1FG9C 1IFGA 4FFYH 1NCTA 2A1WH 4YX2H 1F6AB 1I8MB 4JFZL 2RAMA 2JELL 2QKIB 4ZUWB 3RWCA 4KRLB 1YN7B 3TJHC 2ILLA 1CFNA 1KIPB 2DWXA 3CAFA 4PHZA 1OPGH 1QUNB 3HI6L 4FF9A 3TCLB 4V11A 3A24A 1ZSHA 3VRLE 1U4EA 4WUUA 4EIGB 1WFNA 3BPCA 2XZQH 4X5WB 3AGVA 2Q86A 4M03A 2NW3A 3WIAA 1ZWIB 2KI6A 2AV7B 3PWJA 4BCYA 4K5MA 5DK3A 1BGXH 4HBQA 1T04B 2ZXEB 5C0CE 4Z7WF 1VADB 4CN6A 1XGUA 2PCFB 3VI4A 1V7ML 5AZUA 3F64A 1XH2A 3T2QA 3QZMA 2Y69B 1OTUD 5JHMA 3UTSE 4KKAD 25C8L 2K9UA 4K3GA 5GGTH 3L1OL 5E2TH 4BM7A 4DGIL 1MI5D 4B3EA 2EAEA 1S46A 3IN0A 3EXJA 1NAMH 3RWCB 2YJLA 3SOBH 1CFNB 1PPIA 3BKYL 4F7EA 1OTUC 3KWVA 1UD3A 4KKAC 2DQJL 1L5GA 3G5ZA 1IC4L 2CE6A 1O75A 3DWTA 3WENA 1E6OL 1LDSA 1LO3H 1VZIA 4K4KA 3LNHA 3BPCB 2B39A 2Q86B 3ENEA 4HT1H 1E4HA 2NW3B 3TN0A 4DVRL 1G9NC 3OAYH 5F1NA 3L1OH 3PWJB 2P3YA 3QEUA 5HJ3A 2ED7A 1XGUB 3ZKND 1EHAA 2EABA 2X7LB 3FO0L 3VI4B 4S1SL 5I19L 1O6TA 4JO1L 5HYEA 3BKYH 1B3JA 2DLEA 2V7HA 2XYBA 4R4BA 1LEKA 1TTAA 5D7SH 2DQHL 4GIOA 5EU6A 1T80A 2IAAC 1CXFA 2YD0A 2FK9A 4N2AA 5FKAA 1KPRA 3ZKNC 4NLHA 1UD8A 4DVRH 1OT4A 3STZA 4F7EB 4AQAA 3M6DA 3AXIA 5HDOA 2G0KA 3R06A 1L5GB 4J3TA 3G5ZB 1CLCA 1EO7A 1UFGA 4CGTA 2RIKA 3FO0H 3MOAL 3IAGC 3TN0B 1OQXA 4P9MH 1F3DJ 5F1NB 5FYLD 1JHLH 2Q3AA 2VL5A 3QC6X 3N55A 3QEUB 4FG4A 5HJ3B 4OIFA 1ZLEA 3GBMH 4L3EE 3QHZH 1OAKL 1QLEB 2JFCA 4JFDD 1ZK5A 4XPBH 3RGVD 3WNJA 2V7HB 4PTUA 4R4BB 1LEKB 2NXZD 3NFSH 5AWNL 5HYSG 5FYKL 5EU6B 5FFOA 2WTPA 5J12C 4RH4A 4OLVL 5FKAB 1KPRB 2R0KL 4Y9BA 4GW1A 3IMBA 4ONHA 3TBWA 4OFPA 3STZB 3SE8L 2WXIA 3O9WA 1M53A 4AQAB 4CSPA 3R06B 1FG2A 4BFNA 2YAFA 2EIZA 5E94A 3ARXA 3RWEA 1ZTXL 1UZ8A 4JQXA 2F15A 3AQYA 2XCMC 2X1PA 4J6RH 4R97B 1T20A 3UTZA 3K71A 4KKLD 3APFA 2QMKA 4L4VD 4X4ME 4AQ1C 3QRLA 5FYKH 5B1JC 2VL5B 3SO3B 5ENWA 1V7NL 4KTEH 3II3A 2R0KH 4X8XA 5JW5A 1S5IL 3ZVVA 2IWKA 2WZ6A 2ZF9A 4CVXA 1YPZA 4KKLC 4PTUB 1M7DA 3H3PL 2HRHA 2PPEA 3NCYS 4WUKL 4FADA 5E08H 3I84A 1SHMA 4XVTL 4GW1B 4LAQH 3JWDH 4ONHB 3TBWB 4PY7A 1EZVX 4CILA 4EZKA 1AHMA 3O9WB 5F70A 1QSEA 3ARFC 5CZKA 5JXEA 4ERSH 1FG2B 3IRCA 2EIZB 1V7NH 2WLIA 5E94B 5LNDA 4KUZL 3RWEB 4LE8A 5CEZL 1DN2A 4BHUA 1DBKL 1NEUA 1UZ8B 1YN6A 1LE5A 1LILA 1S5IH 5L6YL 4FFZH 2SODB 2V5MA 5JW4M 1T20B 2N7SA 3UTZB 3K71B 4H26A 4F58H 3KLDA 3MACH 4Y5YA 5L4MA 2GJ6E 5T3XD 2R7EA 5JZ7D 5ENWB 1PZAA 1U3ZA 3KL0A 4HSCX 3HB3D 3E80A 1XSKA 1KXVC 2VN7A 4BE5A 5JW5B 5EEWA 3QDMD 5IQNA 3ZYIA 4FFVD 1MW0A 1DO6A 1EMTH 1T5XA 1YPZB 4CVXB 4NNPL 1M7DB 5E8PA 4YK4B 4NM8L 5E6ID 3UTPD 5JMOC 2ZX9A 5JZ7C 1DBKH 1MHEA 3D51A 4HWEL 4FGMA 3HB3C 3DOIA 5ALBL 5GS1A 4HCRL 4PY7B 1U3JA 4BXSV 2CO1A 4FFVC 1JZHA 1JFQH 1P69B 1QSEB 4YVUA 1INEL 2B08A 1D7CA 1UA7A 2WLIB 1XVSA 3MC0A 5E6IC 4OZGF 1KBPA 1YN6B 1LE5B 3VQ2C 4R8WL 1A4BA 3CHSA 3W39A 1KSRA 4H26B 4Y5YB 1SMAA 4ZTPL 1M4KA 5DK0A 2R7EB 2R69L 4HWEH 3GJEA 4Z7UF 4HCRH 3INUL 5DEZA 2NY3B 3A21A 5D1QA 3X14A 3LOWA 3KXFD 1T5XB 1Z5YD 2CRZA 3EUUA 4ZMLA 5E8PB 3LQMA 2VGLM 2MMXA 4K9EH 3ELQA 1MHEB 1JAEA 5LKNA 5GS1B 2P45B 2ZUXA 1U93A 3K1DA 4TUKL 4CN1A 4U6HA 4ZTPH 3MLXL 1KGJA 1T89C 2OYKA 2R69H 2X4QA 2E9IA 3L4XA 2J20A 3ESOA 4XMUA 3W39B 4YWGL 4K23H 2UZYB 2BIMA 5DK0B 4CW1A 5I1IH 5D7IA 3W9EA 2A6KA 5MHSE 2NLJA 2WN3A 3GJEB 2WQUA 4A1RA 3R7QA 4TUKH 1JF1A 5GGQH 5D1QB 3S2AA 3X14B 3JV5A 3MLXH 1N3NB 5D5ME 1IBGL 1CCZA 4P5SA 3NJVA 4ELMF 4QTIH 1B3IA 1C5DA 4QXVA 3PV7A 5EMYA 5D1XD 2W0FA 2J5LB 4QD2E 3U6XS 1U93B 3CFMA 4XR8C 1VPOH 5C3IA 4XX1G 4GP4B 4U6HB 3W37A 3DRTA 4BFIA 4JZJC 2X4QB 4JFVA 4AMXA 4QAWA 3DPDA 3BW9A 4TPRH 1J88A 2J44A 5D93B 4DN3L 2BK8A 2X10A 1EAJA 3KPSA 2O30A 3GI9H 1IBGH 4CW1B 5D7IB 3W9EB 2AI0H 2A6KB 4YHPA 2NLJB 5EO1A 4R7DA 1JNLL 3T3PF 5DWUL 2QHLA 5CJOL 3HN3A 1JF1B 3M88A 4XN4A 1MY7A 1CFVL 3ILDA 4NKOA 3CVDA 5DEFA 4XMTA 3AXHA 4LCIH 3ZR6A 1C5DB 1F1DA 4HKXA 4JUSA 4CAGA 3Q06A 2A6DA 4B9PA 4GQRA 1AVAA 1OM9A 2OI9B 2QQKL 4DN3H 5FA4A 1KJ2A 4HIJA 3K4DA 4OD1L 1FL3A 2X28A 1FO0L 3DRTB 3FULA 4ZX5A 5AVYB 4BFIB 4G9FA 3WKNA 2ZQKA 2ZUSA 4YHLL 4MRCA 4I13B 2AQ2A 5CLYA 1E5CA 3BW9B 4NJ9H 5T1DL 4BH7A 4PB0H 4X5RA 2WVTA 3S7GA 1UQSA 4HHGA 3KPSB 4X9GA 5IKCA 1J5CA 4MNGE 4NWUH 1ROCA 3MFGB 4LKXA 2KLSA 1AR2A 4DP8X 2P4AB 1FHGA 2PUQT 4YHPB 1UWGH 4R7DB 5EO1B 1A3QA 5FUCC 2O5ZL 3BAKA 1FO0H 1T2XA 4KTYA 1NEPA 4NKOB 1IE5A 1BAFL 3UG3A 5DEFB 3FCUB 1QKZH 4YHLH 2KKQA 4HKXB 3LQAC 3ZTNH 2A6DB 5JHDA 2DTMH 2OXGA 4EDWH 3QZOA 5FA4B 1KJ2B 4HIJB 3PP4L 1FL3B 3OZLA 5K69A 2XTSA 3QQNA 3LRMA 2XETA 4G9FB 2ID5A 4UYQA 1ZXQA 2DQEH 4JL1A 2R8SL 3PIQA 4MAYD 2XFGB 3UAEA 3T2OA 2CBTA 2ALWA 4MCMA 4B9CA 2O5ZH 4BH7B 3D3VE 4U7SA 4LL9A 5FK9A 4G80A 1UQSB 4GYBA 2QTEA 3LZLA 3EJZD 1FVDA 1Z3GH 5IKCB 2EZ0D 3US1A 5KVFH 2J1KA 4MRBA 2EUWA 4OCRH 3LH9A 4H88H 2FSEA 2WAHA 2MKLC 3PP4H 3N0AA 1M42A 4JM2A 3VWKA 3EJZC 2EZ0C 1P7QA 3DYOA 4X5XA 1PZ3A 2X1OA 5JHDB 4QY8A 4WI4A 1XHHA 2OXGB 3DV4A 1PG7X 2AXHA 5EO9A 5J56B 4NGHH 3F2LA 4TSCL 4WGVB 2YA0A 4M6AA 3UJTL 3HZVA 1AFVL 1AS6A 3PIQB 3V9CA 1MDAA 3PDOB 4GXVH 1KGUA 1AS7A 3ULUD 5F7DA 1UB5A 1BFSA 5FK9B 2CM5A 4G80B 2Y5QA 5EHFA 1FVDB 1KBGL 1OWWA 1ZT4A 3G5XA 3DBSA 4GXUN 1G4MA 1B0RA 2I27N 3ZDZE 2FSEB 1N8OE 4Y1AE 5IV2A 1TTFA 3ULUC 4PREA 1FAIL 4JM2B 4IOSA 4TSCH 1YMME 1I3GL 1MRDL 1PG7H 3VWKB 1P7QB 1YQ2A 2QMJA 4FQCH 4GT7A 4X5XB 3RWDA 5F9OH 1H9VA 5E9AA 4MD4A 3MJ7A 3DV4B 4FQJL 5F9WB 2M26A 3VI4F 5EO9B 4N0CD 3D06A 3TPUA 3D05A 3K72A 2EEFA 3HZVB 1YJDC 5H37A 3SPIA 5IBLD 1QPKA 4Y16A 1E4JA 1UB5B 1VF5C 1ACXA 5F7DB 4NKDA 3VSTA 1OOAA 4MBRA 3C75A 4N0CC 1ZT4B 3NGBC 4KUCD 3G5XB 1RP8A 4D9QE 3CGTA 1BIIA 3LH8A 1AS8A 5IBLC 1B0RB 3VGAC 4FQJH 1EZLA 4HXAL 4EI5A 5IV2B 2AXWA 1D7DA 2YWYA 4PREB 4P2OA 2HTKD 1A1OA 3JYCA 5GRJL 2AXFA 4N8CL 3ULSA 1MCOL 3RWDB 3RNQA 1F5WA 3ZHLA 5EU7C 3RX8A 2MHAA 3HNVH 4OUOA 4MD4B 3MJ7B 4XC3H 3QFJA 4APQD 1RPKA 2HTKC 3TPUB 1YEFH 3K72B 2B59A 3OAUH 1OL0A 1JZGA 1DVUA 1DVFA 1E2WA 1EV2E 1E9QA 5ICXA 4FABH 3IPEA 4Y16B 1A7PH 5SWSD 4NKDB 3PPEA 2WXFA 3BDYH 4APQC 4YO0A 1T83C 4P9HH 1BIIB 1F4YH 1GOFA 2O6EA 2FQFA 3MZGB 1DFBH 3O6KL 4FX5A 4HCFA 3O0LA 4YHOH 4AYEC 4EI5B 4ZFFA 1UVQA 2AJVL 3QEQD 1OGAA 3OB8A 4P2OB 4RRPA 1A1OB 1T03L 2AXFB 4K3JH 3ULSB 4ALAL 2QQNH 5B4MD 1WV7T 3RNQB 4GG6A 2P48B 2NY6C 2MHAB 4NCC2 2OR7A 4JDEA 2G60H 1MCBA 2ZXAA 4KGJA 3QFJB 4QRPA 1KJ2L 2E3VA 4K8RC 2KBGA 2K70A 2VYRE 4WAFA 2B59B 4P5TD 4UTBA 3QRFM 1DVFB 1RIUL 3MNMA 4NN5B 1E9QB 3RB7A 5KW9H 4NQVA 2ROYA 2B3IA 5ICXB 5B38A 2VAJA 3Q7JA 2ENJA 3IFNL 3KPQA 2NQ3A 2Z7ZA 1KIRA 4Q6IA 4YO0B 4B0MM 3WHE0 5HDRA 2B14A 1F45A 5DEGA 4U3HA 3RIAF 4PV1C 4P5TC 3ZTCC 4CN4A 1G6RL 3Q01A 1JHTA 2VMFA 4QLRA 1D6EA 1NCWH 1GPOH 2QSQA 4ZFFB 1UVQB 5HTSA 3VXSE 2AEQH 1OGAB 2GPZA 5HJBA 3RY6A 3ULAB 3RVWD 3X1FA 3FH7A 3BIAX 1TNNA 2PWHA 1ZLUK 3SDCD 4GG6B 4RGNB 5B3JF 4LEBA 1FGVH 4JDEB 4DP4X 4GRLD 2XXCB 3ILQC 4QRPB 4QR7A 3P54A 2EECA 3Q8FA 3PHQA 1YPZF 3CXDL 1TEFA 2K45A 4QRRE 1G6RH 4UZUA 3SDCC 4NQVB 5EZOH 5B38B 1EGJA 4Q0XH 2JKRM 1A4JA 4RISH 3KPQB 2XG5A 1MVUA 4NKMA 1KIRB 4Q6IB 1OK0A 1VFOA 4UILL 5DEGB 3G6DL 1AKJD 4XE5B 5DUBA 1JHTB 2QL1A 4X6BA 1D6EB 3OX8A 4XBGA 2HKFL 5TFSL 2JKIS 4F2EA 5IJDC 5AEAA 3VWJA 3MRBA 3MJ9H 4WWKD 1E2VA 1EJ8A 2VXUL 5ICUA 5F97E 1RLBA 5IB3A 3RFZA 1M2VA 4WTZG 2L7JA 5A2CA 1EAPA 5GGSA 2W65A 2Z31C 4J3SA 4NWTH 2WWKT 4IHBA 4XAKE 3PHQB 4WWKC 3MMEB 3NQKA 5D7KD 3U0PA 3G6DH 1DL7H 1AXTH 1P4IH 2ATPA 3UERA 4F7MA 2ALAA 5KBNC 5GSRA 5TFSH 1YY9D 1P0SE 1A4JB 2XG5B 1MVUB 3QWQB 4UQIM 1OEZW 4NKMB 1SEQL 5TQ0H 4FJ6A 1U8KA 4LAJH 1Z9MA 6TAAA 1OP5H 5DUBB 4X8GA 2C3GA 3QNYA 3OX8B 4XBGB 1O5DT 1WC7A 3TCTA 1YY9C 4NRXA 4FYTA 2JKLA 3VWJB 3MRBB 4P07A 5J13C 4ACPA 4A39A 5CJ5A 4GG8A 5AAMC 4GJTB 5JHLA 1IZJA 1I3UA 1F8TL 3RFZB 2XTJE 1M2VB 1WQVT 1S8DA 3R19A 4UNIA 1EAPB 1E5ZA 5GGSB 2W65B 3OGCA 3U0PB 3MRGA 3LJ3A 1FL6A 2ATPB 4JKPH 4F7MB 1E28A 1GOHA 5I1KL 1Z32X 2FQEA 4GI8A 5GSRB 4FQXD 2UV3A 1HQRA 1VCAA 2WHVA 1MAJA 1MI5A 1UCTA 4IHOA 5D1ZD 5DFWH 4AE0A 1BIHA 5LBGA 5L8JB 3H3BC 2E7BA 1U8KB 1G1YA 3UZEC 5K39A 1L9QA 2F5BH 2DY2A 3QNYB 1EEYA 2FT8A 1J8RA 1C7TA 1WC7B 4FQXC 4NRXB 5H2BA 2CA4A 4HV8A 5D1ZC 3BIBX 3F7VA 5TGBA 2J73A 4GG8B 4JQVA 5E8DL 2Q0ZX 2BSRA 2X1WL 2AJYL 3LSOA 5D7IF 2XV0A 3GRWA 1S8DB 1GC1L 1Q72H 3OGCB 4Y4HA 2EIKB 1ML0A 2I7SA 3MRGB 3PQYA 1EDQA 1FL6B 3VRJA 1E28B 3MFFA 1HQRB 5I5MA 1MI5B 4IHOB 4Q89A 5IFAL 1TJMA 5EZIH 1JL8A 1OGTA 4KZ0A 4HG4J 3UGEA 2K6WA 4R0LA 5K39B 1HN1A 1P6FA 3FQ4A 5IB1A 1EEYB 1BQUA 3PWNA 4RGMC 3UBGA 3ULVL 2V2XA 5F71A 2NY7H 5H2BB 4HV8B 1L9SA 3F7VB 5TGBB 1NPJA 4JRWA 4LXFA 4ODTH 4G59C 3CUPA 5E4EC 3LSOB 2VRAA 2JJTC 2WJ5A 1BG1A 4HBCH 4P06A 4CMHB 1X5FA 1GY2A 1CGWA 4JY4A 3ARYA 1WTGT 4OF6A 4Y4HB 2J1YA 3HRZC 2FX8L 5F0PB 3PQYB 4UTBL 4R2GB 4JFDA 3VRJB 4GO8A 5I82A 4N5UA 3MFFB 1MQKL 2A73A 2R9HC 2VM4A 1JDDA 1WBXA 3BP6A 1OGTB 2ZOUA 3OJ2C 3F00A 2VLRE 4R0LB 3WIHH 2TAAA 2WW8A 3KH4A 2H45A 5E6SB 5IB1B 4WCYL 3PWNB 3GIZH 4A68A 1ETZA 5IREA 4EUPH 2V2XB 4YUEH 1LHZA 1N19A 3FL7A 2FX8H 2XN9D 1EIBA 1W0WA 4O4YL 3CSBA 2TSBA 4KITB 2OJZL 4K3DH 3CUPB 4L8SA 1JE6A 2BSBA 3MV7E 3EJRA 1B4JL 1JRHI 3CX2A 3NN8B 3QZWG 4I0KA 4I8DA 2GW5A 3IVKA 2BNUA 1CICD 5E70A 2E9GA 4JY4B 3THML 4ZNEE 1JRHL 3CSTA 1OY3B 3HOGA 2DV6A 4JFDB 2JKNA 2Q5BA 3ARFA 1HQ4A 2A73B 1I8AA 2AAAA 1JOIA 1UB6A 3HMWH 4HIHB 1WBXB 1DDHA 3BP6B 1CICC 4ZTEA 4NQDA 3UYRL 2OJZH 4HD5A 3PHAA 3QXTA 4LHUA 4X42A 1B4JH 5F7NC 3VXOA 1XL6A 4AYID 2DQIL 4CJ0A 1KXVA 4JPKL 4TYUA 4G8IA 3TVMD 1CU4L 1ZVHA 4JAMA 4YSTA 1W0WB 2O1AA 4PJIE 1OIOA 3HS0C 2XU9A 3NG5A 5DU7A 3RWFA 3WY1A 5CILL 5C9KA 3IVKB 2BNUB 2F54E 4M1CC 3W81A 4XO3A 3F6IA 2FL5A 3L54A 4ILDA 3UYRH 3CVIL 3QDMA 2IANA 4WNJA 3KYAA 4JM2F 4XXCA 1U3NA 1MJUH 2YAPA 3ARFB 4FA6A 1HQ4B 1RIVL 2BP0A 1SBSL 1X5LA 1UB6B 3CK0H 3FCBA 3HZKA 3RNKA 3JVGA 3V0DA 1TIUA 4YXHH 4BBWA 1DDHB 4FQQA 3HA0A 4KX8A 2BRRH 2D03L 3SKJL 4NQDB 2XZZA 3EFDH 4U1IA 5A7EA 2MOGA 4J8QA 4NRYA 1BCIA 4JRYD 2FLMA 1AH1A 4LHUB 3N85L 3VXOB 4PGCA 1YAIA 5IOKA 3ALXA 4ETQA 3NJGA 4G8IB 1TYEB 4JAMB 1QW9A 2DJMA 3LX9A 4LLWA 1JNNH 1RK0A 2HT4D 2BY2A 4ZFGH 4YVNA 3IJ8A 5JHLL 3RWFB 2OQJA 2ZUYA 2AQTA 1RFDL 2OTWB 2AJ3A 3V5HA 2FL5B 3JBG7 4JDVA 3QDMB 4YLQT 2IANB 5EU5A 3V8OA 2HT4C 3N85H 2AEWA 4LCVA 5F0MB 4DESA 3WXWH 4N1HB 2BP0B 3H4HA 5FYLE 3V6OC 1NFDA 3DECA 1DR9A 1WEJL 2OS7A 4FXKC 3HZKB 3RNKB 5IOPA 3HMXH 4LEXH 3QJSB 4FQQB 3VD0A 2X9YA 5HDBE 4PHXA 3DMMD 1BYOA 4U1IB 5F96L 4NRYB 1PDKA 4PW9A 1J1XL 2EDWA 4NJAL 3ARWA 3PREA 3RL1A 4KH9A 5FWRA 3OJVC 3NABH 4PGCB 1RFDH 3MRHA 2J71A 4ETQB 2X05A 5E9DD 1SUJA 5D2NC 1A0QH 1YYLH 4EE2A 4LLWB 4X9HA 1MRCH 4A7GA 4JZOA 1RK0B 4LLUA 2GVYA 3DMMC 3GXFA 3J07A 1QSFD 1AHWC 2OQJB 4D8PA 5HVHB 2YBRA 3JV6A 2AJ3B 4ZZKA 2ZCZA 3V5HB 4XP4L 4JDVB 5EU5B 1G9NH 3GLEA 2E4TA 5F2FA 5I15L 1J1XH 2EUZA 2Q8AH 4HC1H 3BVVA 2Z9TA 4JZJA 1U6AL 1J0IA 1NFDB 4P2QA 5IOPB 4ATWA 1W2KT 1A7QH 2O5NA 2YOAA 3GHEL 3JZ7A 3OSKA 1R9FA 5CR1A 1UM6H 5HVFB 1J48A 3NAAL 4HP5A 4RX4D 1KCUL 1PDKB 3RL1B 3HUJF 3MRFA 1XCQA 1Y6MR 3MRHB 2CR3A 3VGDA 2X3BA 4LRNH 2V9UA 3C6SA 4R3SA 2WWKO 1JGLH 4KZEL 4YSAA 1ACCA 1BMGA 4JZOB 4LLUB 4NI3A 1BBDL 5KYXA 1U6AH 2YKLL 4GRMA 4HPOL 4ONGL 5IQ7L 4CL7A 2KC0A 2YD5A 4D8PB 4ZW6A 2YBRB 3ZDWA 3JV6B 5IR1A 4FXGA 5AW8B 2W5PA 2B2XH 3GBEA 2DLHA 4A6YA 1WWWX 4JFEE 4HFUL 4JZJB 4GG6F 3BUBA 4P2QB 1JXGA 2BXZA 5DJ6A 3V52L 1YZZA 4HH8A 8FABA 5HGGS 3P4NA 5DUML 3IAPA 1JWUA 2DRUA 3TXAA 3FQTA 5FYLH 4I48A 1HNGA 5LQBH 3MRFB 1XCQB 3ZT7A 5E2WL 1CIDA 4FD0A 3WJJC 4MXVF 3D07A 2P5WD 3C6SB 2KL6A 4R3SB 5C0AA 4KTGA 5BXFA 3WTXA 1UM4L 4DAGH 4C8XA 2VLKA 3C9NA 3PWUA 4RFNC 5KYXB 1MJ8H 2P24A 4G7VH 1HZHL 3ISWA 1IM3A 4GRMB 3TT3H 2VNCA 3X1GA 2F19H 3B1TA 4QOKA 5E95B 4TLKA 5IR1B 1PL3A 5IVOA 4FXGB 4NAQA 1I7ZA 2NT1A 3VXMD 1OGPA 4A6YB 2FJFA 4E41D 5KVDH 1THAA 4OLZH 5CHNA 2IO5A 3D52A 4H0IA 5ACZA 1CXIA 3HG1E 2IDQA 4XWGH 5DJ6B 1GIGL 3ATBA 5IJKC 3FQUA 8FABB 1UM4H 2X3CA 5CD3A 3ARDD 2I7OA 3WSQH 3P4NB 2DZEA 1B6UA 1JWUB 4GI6A 3U36A 3FQTB 4I48B 3ZE2B 1OB1A 1EHKB 1A6WL 3H54A 4JG0L 2B1HH 2HCZX 5D7LA 5FUOH 5BXFB 5C0AB 2Y06H 2BJMH 1EDYA 4XNXH 1R6VA 3ARDC 4YLBA 3WNMA 4AJ0A 2VLKB 1KXQE 3C9NB 3PWUB 3RDTC 1NSNH 2BHUA 4Z7WE 1FE8H 4DVBA 2P24B 1FNSH 2K3TA 1IM3B 5BMFH 1O6SA 5T3XL 2JCWA 4PS7A 4QOKB 3AS0A 3DTUB 3W0WA 4RMBA 4WRLA 5AD0A 4DT2A 1I7ZB 4PJXA 7PAZA 1W8EA 3O4OC 2FJFB 3CTTA 1WZ1H 5CHNB 4TRPH 1DEDA 2UXVA 4JG0H 4PWJA 2A9AA 5DJ2A 5ACZB 5E2UL 2YN3A 4F3FA 3FQUB 4OJFL 5CD3B 4BA8A 4OW6A 3IGKA 3MQIA 1W80A 1A02N 3C5ZC 2IDTA 1OB1B 4UI2A 3DRQA 1CURA 2VXSL 2ZUWA 1ZIBA 4G8AC 1ET8A 4LRIC 5IBUG 5D7LB 5DD0H 3B9KA 1CGUA 1BA9A 4Z8FL 1E90A 4XXWA 1R34A 5D1XE 3IFOB 4RSVA 4DVBB 6FABL 1PSKL 3NSJA 1O6SB 3H9ZA 2NQCA 4FNLH 4F27A 3W0WB 2J8HA 3VXTA 3MXVL 2FX9L 4IDLA 2ORBL 5AD0B 3UAJD 3MV8E 4PJXB 1FJ1A 5LO7A 2R0WL 1CYXA 5EIIG 3UROR 1BPLB 1H5BC 3FN0L 4YPGA 3S5ZA 1PLGH 3LDBC 5DJ2B 4DSYA 1Q94A 4F3FB 1CDIA 4JFWA 4OCXH 3QAZB 3UAJC 3F8UB 5F7FA 4TNVK 2L0DA 2HVJA 2GTZA 1PSKH 4DOHE 3DRQB 3V9FA 5HHMB 1YEIL 1U3HD 4TV3A 3HNTH 1AI1L 4PRHE 2FX9H 3B9KB 3K6IA 4M5YH 3NCEB 4PJ9D 3T0EE 3ECQA 2AC0A 3V2AR 1AQKH 2CLVA 1U3HC 2WXNA 5BS0D 3M07A 3GKWL 3VXTB 3P3UA 1PZ5A 2ZYRA 2WXRA 2KZWA 1FJ1B 3L6FA 3SPCA 1I85A 4P57A 1BLIA 4YPGB 1XGYL 2YK1H 1AI1H 1JHKH 3OM3B 2HWZH 4R9HA 7FABL 4KZDH 2CGYA 2HJKA 1ZHBA 4EXPX 2HVJB 1R3KA 2GTZB 5CJBA 5FIEA 4BIKA 1CTMA 4J1UA 3NP3A 1Z9SA 4JO3H 1PD1A 1JK8A 3B2VL 1SYVB 4FRWA 4R4ND 2Y3AA 5FFLA 4PLJD 1KY6A 3C8DA 2HUHA 2CLVB 3FT0A 5DHDA 2YD1A 1U8OA 2P49B 7FABH 1PZ5B 3RUGA 3L6FB 4R4NC 4AOFA 4A6YL 4P57B 5C8JA 2YQBA 3HR5A 4PLJC 1G1KA 2AMGA 2EXYD 2YUZA 4M5TA 1Z9OA 2HJKB 1ZHBB 1PD0A 4G72B 5HHOD 3BZ5A 1R3KB 1UWFA 1XGRA 2PF6A 4UZSA 5CGTA 3GJFK 4AJWA 3DVGA 4J1UB 1Z9SB 1DFXA 2FLBT 1JK8B 3S36L 3DIFA 4EVNA 2YAHA 3PHOA 5IW6A 3RJQB 4L0ZA 4P5MA 5BVJA 3QQXA 1WBZA 35C8L 3NPSB 3W38A 2UZIL 1FI8C 1VFUA 4TUUA 1T66D 1RIHH 1ROWA 2NY6B 2UXTA 2DKUA 1U8OB 3X1NA 1VCBC 5I0DA 4HDIA 2IQAA 1TPXB 4EN3D 5C0RL 2JQMA 3RUGB 1ODUA 3IMSA 5DVLA 5C8JB 1V27A 3HR5B 4KX7A 2OMXA 4G6AD 1FGNH 5D72H 1T66C 3AJ7A 3GBLA 3VXQA 1MFEL 4MDRA 3CFBA 3D1MC 3I6LD 1P2CA 5T1MA 4M7JH 2YUWA 2NXYD 4EN3C 3WYRA 1Y0LA 35C8H 4F7PA 1XGRB 4JKNA 2LAGB 3NIDB 4U33A 3LQAH 4G6AC 5LLIC 1JMXA 1RXLA 2J8OA 3DVGB 3C09B 3NSDA 3DIFB 4EVNB 3PHOB 1HYRC 5IW6B 4BZ2A 4P5MB 5BVJB 5IUCA 1WBZB 2YEQA 3S5LA 1YNLH 4Z7UE 1TCMA 3FU3A 4OB5L 4HDIB 2IQAB 4AIEA 3QRBA 2Z31A 2ICWJ 1GY1A 1FNHA 3N40P 5C97A 4OCLC 2OMXB 4A2HA 3RB5A 2WV3A 3K74B 3VXQB 4N2LA 4DZ8A 1I3RA 1P2CB 4LPXA 3EJYD 5T1MB 3EYSL 1U41A 5F88A 3QE5A 2BSEA 1Y0LB 3FU9A 4OD3L 3QDGE 4YGAB 4F7PB 3KYMA 3PGFL 2FNWA 1HL5A 4A2DA 3CJJA 3QEGL 3ULUL 2AJSH 3EJYC 4OY9A 3ZPDA 5I5IA 2CAKA 1FLRH 3LKRA 4TVPL 3PFQA 3S5LB 5GISL 5AAMA 4OGYL 5TH2A 3EH5B 4P8QA 3EYSH 1T6WA 1ITBB 1TQCC 3S8GB 1BD2D 1F3DH 2EILB 4W9CC 2Z31B 3HBZA 1A7RL 2CO7A 4ELME 4MMZC 4YBQD 3CLWA 3PGFH 1JP5A 3I74A 3AG3B 3UTOA 1DJXA 2H3KA 7TAAA 1C8QA 3O3BA 4DZ8B 1I3RB 3QEGH 1A6ZA 2GABA 5I71B 3ULUH 1QSZA 2XTLA 4MQSB 4MVBD 3QCVH 3TO2A 5F88B 2Y7SA 5H37G 5JYLA 2VDPH 1RUPL 3UZEA 4YBLB 4W9DC 5EFIA 3WDIA 1V10A 3KYMB 4P2RE 1NFDF 1BZ9A 5EZJA 1DHKA 3MOBH 3GSWA 4MVBC 5ALCH 2FLRT 1ETJA 2BHFA 3LKRB 3QJXA 4H25A 4JO4L 3MUJA 2V17L 1YJDH 3TF7C 3PWVA 5TH2B 3FB6A 1JYNA 3O3DA 3TONA 5MI0C