5E1GA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t208
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
351
structure length
351
Chain Sequence
b'LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
molecule tags Transferase
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
total genus 87
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5e1gA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5e1gA02
4JMNA 4QRAA 5DCCA 5D7HA 5LBGA 3ZGPA 5DC2A 4ZFQA 4K73A 4GSQA 5DZJA 4GSRA 5DZPA 4Z7AA 5E5LA 5K69A 5E51A 4QTFA 3TX4A 5DVPA 5DU7A 3ZQDA 1Y7MA 5E1GA 3VAEA 4A1IA 4LPQA 3VYNA 3VYOA 4GSUA 4HU2A 3TURA 3U1PA 4JMXA 4LZHA 3VYPA 3ZG4A 4QR7A 1ZATA 4A1JA 4HUCA 4A52A 2HKLA 5DUJA 4A1KA 3U1QA 5LB1A 2MTZA 5E1IA 4XVOA 4QRBA
chains in the Genus database with same CATH superfamily
4HD5A 3CVIL 3BAEL 5IOKA 5C0FB 2QQNH 3LPPA 1CWVA 3FQRA 2F7QA 4NWUH 4UILH 5F9JB 4PBDA 4DFHA 4OI9A 3LQAH 1GZQA 3GFUA 4NRZB 4YDLC 5KBMA 5IHUH 3QJHB 1DUYB 2YQ3A 3K8MA 4J3SA 1CR9H 4HYTB 3H2WA 3CVDA 3HI5L 2EACA 1FVEB 1G1KA 1ES0A 1ERNA 2EH7H 1R6VA 3E6HB 5D70L 1E2VA 2Q3XA 1WISA 4HAFA 3GF8A 5FGBA 4GW4A 5HI3D 1J5OL 5A16B 5ALBL 3U0TA 4HIEA 4RFOH 1A3RH 4UIKH 4WEUD 3E8UL 3NJFA 5IVXA 3G08A 5KWYC 3VGEA 1FN4A 5T3ZL 1R5WA 3S48A 2MTPA 3X12A 1W91A 4GOSA 3QUKB 4I4WB 1Q9KB 2GAZA 4K7FA 5E5MB 3MAWA 2TSAA 3ZTJG 4ZTOL 3ULSA 6PCYA 5AAWC 4G8GE 3PS6A 1DQQA 4OCRH 1NMCB 3RPBA 4BKLB 3MNZA 5FDWA 5DGRA 4JREC 2P49B 4TVPE 5TDPA 4D0CB 3ZDXE 4AJWA 3VU2A 2XTJE 4U0RB 5TFSH 4OGXH 3HE7B 5GS1A 1JAEA 3IS1X 4LSQL 3IGFA 1BMGA 4R96B 3FSAA 4HK0A 1KGXA 2XA8L 1N8OE 1X9RA 4LPTA 5K69A 2Y7LA 5I1HH 3JYBA 1GXEA 2FE0A 2RHEA 3T8VA 1FYTE 1KF9B 5C0CE 1RL1A 1DLHB 4M8VA 5IZ7A 2A0LC 3RKPA 2ZXBA 1L9SA 3F00A 3IWVA 4NBXB 1YQVL 4XMKH 2FGZA 5D1QA 1KTLA 5HDBB 4TLSA 2H32H 2BVPA 4WDIB 4PJDF 3WTTA 3NDYE 1F00I 3WD5L 1FJ1B 4GMTL 3VFWA 4U1LB 5DHVA 3MLXL 1FAIH 5KYWB 2H45A 1XF4A 1JNLL 3EHBD 4PRPA 5FKAB 4ZPTB 1MEXL 1WE5A 3HS0A 5EOQH 3IDNA 3ARFA 1UKTA 1DBBL 3ZKXB 3S88H 1IMHC 2YEZA 3IDJB 1SEBA 1FC2D 3I02A 2LLLA 1BMZA 3U2IA 4X8JB 3TO4D 3ME0A 4LLMB 3EJUA 4I4WA 4IDJL 4H0GA 2YEVB 4XVUC 2HZHA 4JFEA 4M7ZB 4XO4A 1NANI 2EIZA 3VFRB 1D3CA 3MV9A 4FL4C 4TUOB 4XH2B 2WAHA 1IKFL 3LZOA 5KSAD 3FFOA 2NSXA 3SPVA 2FGWH 4OTXL 4A1JA 5I6NA 3BKCH 5C3IA 3GHBH 3MA7B 5E6IA 5CCGE 3ZN6A 2YD7A 3O81A 3D2UB 3OLIA 1FP5A 4AC2A 1S7WA 3C6EA 5C0JB 2Z34A 3MRFA 4NPJA 1UURA 3NQIA 1IC5H 1NGYB 2V7NA 1RUKL 1Q9OA 1CTOA 3OAZK 1TYRA 2Z9TA 5CGBA 2J8OA 5D5ME 2R1WA 1A7OH 5HYJE 4JJ5B 1U92B 4EO5A 1L9RA 2HRLA 3Q8BA 4IU3A 3KPQA 2OYLA 4WWKB 1FFNA 4L8SC 4XWGL 1NIEA 3C5JA 1HNGA 5GGVH 1RIHL 1BF8A 4LEXH 5DDHB 4OGAC 4YHZL 4JO4H 8CGTA 4PJDE 2WINA 3AY2A 3EZ8A 4GRLC 3WY1A 4BH7B 3IFLL 4CN4A 1DVUA 1N9PA 2CO7B 3BQVA 1HHJB 2AEPH 3DXAB 3CCHA 5I18L 3MNDA 1KB3A 3POCA 4LHUG 3UAAA 1EHLH 5BQ7A 4Y88A 5GJSL 4KKPA 3A3YB 4R84A 1CK0L 4NKIH 1WZMA 2EJ1A 4MHHG 2OV0A 4M7LL 2DWYA 4PWJA 5LXVA 4NDMB 1F2QA 1IJ9A 1AZZC 3MPCA 3JV5A 5CEZL 5IVXE 4FP8L 2DYPA 2OJEB 3SDDC 3BUIA 4UTAH 3LNHA 3QRFM 3SDCD 4N2EA 3DURB 4H1LA 1I7ZA 5HHME 3GSXA 2I5YL 4HC1L 3F05A 3IJSA 1AQKH 1B3JA 1JGEB 2WGNB 3GMMB 5I23A 3W9DB 1Z3GH 4AYFA 3VFTA 1JPTL 4UINH 1PZSA 3VXUB 1CD1A 3MNVA 4YLQT 5D1ZI 2V4LA 2E27H 3EYQD 5IUCA 1ZT4B 1N19A 4HQQH 2WO2B 3T08A 2EXYC 1FAKT 3FQUA 4MD4B 1T22A 2AEQL 1IKOP 1WIOA 1ZEAL 5F88A 3ZIMA 3PDOB 3L4ZA 5D7LB 5BS0A 1Z5HA 3VFOA 4Z7QB 3GZOA 2FJSA 3NCJL 5IHZB 3NEOA 5AW2B 4JQIA 4L3EA 1S3RA 2DIAA 3T2NL 2HFTA 1MCNA 4MXVE 1UXSB 3ULUD 1MWAL 1B6UA 3N42F 1MCKA 1JE6A 4RGOH 4PJXF 5IVXF 1F11B 4HCRA 1Y18B 3HAEG 1A6AA 1VACB 5JO5A 1IEAA 2BO0A 1KBVA 3C2AL 4S11A 5K9OB 4YXLL 3ZQ9A 5DTFB 3EJSA 4IDJH 3QH3A 3WFDL 5B1BB 3VXQB 2ZPKL 3LMJL 2C3WA 4L0ZA 1M7XA 5JXEC 3JZ7A 4LSVH 4YLBA 4CBZA 3RWEA 2BY0A 1I1CA 2DLFH 4OJEH 4FXKC 2PXYA 4DCQB 5CGTA 1Q1JH 3DECA 1KNOA 4WV1A 4UT6L 5C0DA 4C8XA 4PR5A 3QDGD 3TIEB 4ZX4A 3M07A 5DVKA 5AW9B 5E8NB 2CHNA 1GOHA 3M88A 2I69A 5HYSA 5F21B 5I73C 1JZ6A 1DVQA 4B7LA 1R3JA 1NGPH 3KM2A 3SKNB 4R7VA 4TVPH 4IHOB 4Q9QH 1YECL 3IMSA 1DO5A 3B9VA 4AMKL 5SX4H 4JGJA 3B7UX 4R7XA 2XHNA 4Y4HD 4YL9A 5KANG 4G1MA 3GI8H 3QUYD 4ELKB 1KBBA 1XZ0B 2FYYA 1PAZA 4M5SA 4UZSA 2FX9L 4JKPH 4X0NA 5KSUA 4U6XB 5BQDA 3UC0H 1KYDA 5MEOA 1Q38A 4YHNB 4NNXB 3S36X 3AQZA 3PJSA 5KVDE 1T0MB 3L7EB 1XH3B 3ZTCC 3STLB 1IGIL 4MJID 1PG7H 5CP3H 3A47A 4JFHD 3WLWD 1YN6A 2OXHA 3S3PA 4JFZH 2FNBA 1BD2E 3T8XA 1XDTT 5DJDA 3ZQDA 35C8H 4I18B 5DHDA 4PRIE 4UAHA 5AYUL 4U6HB 3MNMA 2FJGB 3L5HA 5F7YC 2KC0A 4H8PA 3P4LA 4LSUL 4N2MA 1NDTA 3IAGC 5DMKB 5MHSD 2RAMA 3NACL 1SMOA 2Q0ZX 1IO4C 2V3DA 2DLIA 3X13A 3ARFD 1BZDA 1IQWL 4TNGA 4Q4EA 1MJUL 3QRGL 1I9JH 1ZJBA 3JWNG 5TQ2L 2ZUXA 2V6HA 4FD0A 5H35B 4Z7WB 3PWPD 1B9KA 1VEMA 5DJXB 4FHJA 1ZCRA 2HPTA 1FZMB 2KYIA 1T04B 1GS7A 1H5BA 3UTQA 4WU5A 2HT2C 2AAVA 2H8PA 3O2VH 1W0YT 2XX0A 1OSPH 2ED8A 4P06A 1OCWH 4X6BB 5TE7H 4GY4A 1MFMA 3KPPA 1Q0XH 4WEMB 4RVBA 4IOFC 4IRZA 5TPWH 3VH8A 1NL0H 2IALB 4QKXB 5FDYA 3FFDA 4IOSD 1BLIA 1HC1A 2ERJC 4JFPB 3K0YA 4UT7L 4YNYB 2FNWA 4PJGA 3VXNB 4AH2A 4NM4L 3OZLA 3CD4A 1VF5C 4XN8A 1UH3A 3GSUB 2QSCH 2AJSL 4X5WA 3CDGB 5DHXB 2IEPA 3KNBB 3WNJA 5FA3A 5AYTA 3TBCA 3O6ML 4TSAH 1J18A 5EFIA 3U6XS 4WEEA 4PD4K 4AGNA 2KBGA 1LDSA 2MOGA 4CU8A 4JBSA 2NOYA 1A6VL 3FT3B 2XBTA 4PJGE 5I1CL 4JRWA 1CC3A 5DVMA 3MJ9L 1G7PA 1KJVB 1TETH 1KEML 3FU0A 4X6FB 1BBDL 4BZ1A 2HTKC 1L7TL 3RPIA 3MOBL 1ZSDA 4N0RA 2C3VB 1OP5K 1IAMA 3L4WA 1WS8A 4QWWD 4WFHE 1UJ3B 1EMTL 5AZ2L 5HHMB 1VEOA 1NDMA 2CLVA 3MRPB 3P30H 4K7PY 4KK9C 3ULVF 4XBPA 1M7IA 4KJWD 1U8MA 2AABH 1CS6A 3BYTA 1MW1A 4LU5L 4O4YL 2Y7MA 1RUPL 4LSVL 5C0BD 2ENQA 3Q5OA 2IPTH 1U3HC 2X05A 5IGXH 3B7SA 3UP6A 2GK0B 1KIRA 3TBWB 1H9VA 3HZMB 3PXLA 1JFQH 2UY6B 4FQIL 4R2GC 5E4EC 2OS7A 3TNMB 5ISZA 4YXKL 1E28B 5A6LA 5D2NB 3RB7A 1YDPA 1MCBA 3WHE0 3DOSB 3WIIL 4MA3A 2O6CA 4TSBL 2O5XL 2UZIH 4HKBB 1PQZB 4PN6A 2EYRA 1S7TB 3UG4A 1FNGA 1NGPL 3K74B 3QJFA 3HI1A 1WSST 2C7FA 3TO4A 3HC3L 1PDKB 3RIKA 3C09C 1PZUB 3SQBB 5D70H 5I6LA 2ATKB 5D71L 4EXPX 2EDHA 2YPLB 3L48A 2R15A 5GGUA 1XF2A 2O5NA 1QI3A 1F86A 4DKFL 3HPJB 1WFTA 2FO8A 2G60H 2IWGA 1CG9A 1XF3A 1GGBH 1ETZB 5CXPA 3D4GA 4K2UH 2AMGA 1L9OA 3VXSB 2HX8A 3AS3A 5FM5M 5SV4A 2P7TA 1WF5A 4MMZC 5I15H 2DTMH 3H7LA 4JM4H 3U4AA 3W81A 5SWSB 4X2UA 2BNUB 4AQ1A 1UADC 3ERXA 4XVJL 5CWSA 3MV8A 2CIKB 5ID1B 3KVPA 4L5FE 4MYPA 4O51A 3E38A 2A74A 4JO3L 5B1CA 1EFXA 2H2SC 4P23B 4YUEH 2ID5A 3D48R 4XP1L 1KGWA 1CN4A 1OM3L 1YNKH 3VFMB 3WJMB 2P4AB 3S37L 2AQQA 1JWMA 4MSWB 2P80D 3VCLA 2QQNL 3DJSA 4NKDB 4EDWL 3HNTH 2J5LB 5LCVL 2CU9A 4NX0A 4P9HH 4ETQB 3PDDA 5DJ2B 1U8LB 5EUOB 1CDHA 32C2A 3KLAB 5JMRA 1IBBA 2MFNA 1VFUA 1NOFA 1S7RA 4ZUVA 5CEXB 3HS9A 1T83A 5ICYA 5JMOC 2X4SB 2A3TA 3R18A 3PP3K 2CRIA 3KPSB 1RURL 3QZBA 3ZSTA 3IVKA 4ZXBC 4IJ3C 3NFNA 4QTIL 5IMMB 3OAYK 2VRAA 2ZKHH 1HL9A 4JG9A 5T1MB 4AZUA 5ES4B 5IIEA 4M4PA 4PBVC 1X5XA 3V5DB 1PIGA 3SB3A 1CFVL 5C09E 4KTEL 4YDJB 3U2SA 1G7HA 2JVUA 1MHHA 2DJ4A 1N64H 1E43A 1DJZA 4LEEA 2XTJD 1C1EL 5FYKH 5BS0E 1J1XL 2EXWC 3FUMA 1XGTB 1LMIA 4IOIA 3QRBA 4M5ZH 4E9TA 3QDJA 1A8ZA 3D0AA 1A6PA 4FFVC 3VD0A 5TQ0H 3O3EA 5JIDA 1EVTC 3F01A 3MRDB 5T1LA 2N01B 5CEZE 1TSRA 3U7YH 4ANWA 2WCSA 3QZWG 1NA8A 4ODXB 1E6OH 2E9JA 3LS4H 4QRRB 4LSTH 1MCFA 2NT1A 4HX1A 4FCAA 2WUBH 3T0ED 3BH8A 3W11D 2WQSA 2MCMA 4Y19A 5FYJU 3FCGA 3G6AA 4IM8A 3QS3A 1TNMA 3ASNB 3BDYL 1DQTA 1DQML 2HTLC 1UWFA 3GS7A 2YO3A 4NFCA 5DHYB 4B60A 1LK3H 4QRUB 1FAIL 2FX9H 2HJFB 3HS0C 3F8UB 4XBEL 3GTNA 4MCZB 4HPOL 2VN5A 2YD6A 3KE0A 5E2VH 5TE6H 1TJIH 4QAMB 2XQBL 3IMWA 4PB0L 1IE5A 1U3HA 3PFUA 3HC3H 5EEXA 3L6FB 1QBMH 1IBDA 2VDNB 3UZVA 3QUMB 1UZ8B 4JM2B 3OKMA 1NCBH 3K8KA 3CAFA 4NFDA 5GRZA 3LPGA 4ZXBD 4YDIL 5I17A 1A02N 3JVFC 4M6OH 4EN3C 4XRCA 1AGEA 4NO0A 5IOPB 4KWUA 2YUXA 1NJ9B 4PJDA 1S7QA 4AQ1C 4UQBA 4AJVA 3CZJA 4LAJH 4NQUA 1G5AA 3GMRA 4G9FA 5I71C 1KTDB 3GLZA 5LBVA 3L3JA 2ZX9A 2FD6H 1BX2B 3NCCB 4Y5VA 1E2WA 4LPCA 3NFPB 5IVOA 1I3GH 4Y2DB 1FZKB 1OD9A 4KRLB 4LB8A 5EEVA 1QD0A 2ADJA 4PLKD 5A2AA 3QFDA 2WXLA 5HVHB 4I77H 4RNRA 1EJFA 1KIPA 3E9TA 1JV2B 5D1XC 4TQ8A 4E9LA 2OK0L 2K8QA 2FBOJ 4UT9A 4Y4FC 3QIWD 1EEZB 2MSPA 1ET7A 2A9NL 2A4CA 5C7XH 2NZ9D 3RJDA 1SXCA 2YD3A 3MTXA 2QQKL 1UOWA 3K46A 3T1FB 4FULA 5E6RB 3U46A 3ARWA 1GC1C 1I1FA 1XGUB 4CSSA 5JHDA 2Z4TA 4R5TA 5FCUH 2AJSH 1MUJB 5D93B 1JGDB 4HMCA 5J57B 1C9SA 5E99H 3QDMB 5AKSA 4NKMB 1NQBA 1RXLA 2AI0L 1R46A 4PJ9C 4DK6A 5GGTL 2NQCA 4F9LC 5L8JB 1UQSB 3LKSA 4BD4A 4N6RB 3SQOH 4PRPE 2N7SA 1EAPB 4L9LA 5F6IB 1F3JA 2J6WA 2P26A 4EN3B 4Y2DA 1RFDL 4WNSA 1R75A 3UIZA 2CLRB 4H5SA 4OLVL 1TOXA 4MVBD 2CHDA 1MNUL 5BZDB 2QBWA 5JW5B 3FTVA 5GRYA 5DO2D 3MRKB 4ZMWA 1QBLH 1KFGA 1C1EH 5FYKL 4O02B 3SKOA 1KJ3L 2DWXA 1WICA 2WANA 3S3DB 5GS3A 3FTGB 5B3SB 1PZ5A 2WNWA 4ZXBA 1SMAA 2E7CA 2NSQA 1GKEA 1WEJH 4TNWF 1RIVL 4LLDA 1XEDA 4UYQA 2QADD 4RRPA 1HYSD 2KHAA 4H20L 4I89A 1KIUA 2YAEA 4RQQB 3R8BB 1FNHA 2BRQA 1P7QB 1T3FB 4HZLA 1G1OA 4LF3A 4XWOD 4D9RE 1CF8L 5DJ6A 1ZIBA 1OP3H 2AEWA 4ZOCA 3VFSB 5F7AA 1EA9C 1IM3B 2IBBA 3WUWB 1CXEA 3WOVA 1AYOA 3E3QE 1A3ZA 1NCAL 2FHCA 2X70A 4ORGB 2ZG1A 4QRUA 1ZLUH 1CLOH 1G7QA 1W8NA 2MPVA 3OR7A 4QXVA 4FQXA 5HJ3A 1SXSA 4I85A 4AYEC 4ANKA 4ECNA 1F4AA 5HGBB 3ZHDA 5KS9E 1IZKA 2JCCF 2F19L 5D9SA 1CLYH 5CMAB 3L2MA 4HX1B 2DQMA 2CXGA 3AB0B 2YQBA 4CJ1A 2ZUQC 3QARA 4PJ8B 1DQJA 4QWWC 2NXZB 2ZOLB 3AITA 3P4OB 3PRZA 1MRFL 2XQYA 1BECA 1HXKA 1GYAA 1TR7A 2XLLA 3DROB 1MH5A 3PQYB 1WWCA 1F3DJ 4G7SB 3FUEA 3LSOA 1JK8B 5MEQB 3FO2A 5T3XH 1R3KA 5HVFB 4EN3D 1KLFB 2WWOA 1R5IA 3ARBA 4MASA 4PRHE 5T3XE 4M02A 4HJ0D 5DQ9B 3FT4B 2BS9A 3SCMA 3FRUB 4DW2L 4GG8B 2CIIA 3QE5A 5D5MA 4W1TA 5HYJA 5JHLH 3B2VL 4FL4B 5DZAA 4F80A 4AYID 5HYIA 2ADGA 2CGZA 3GB7B 4KJYA 3STZB 4XVTL 4TPRL 5HHMD 1YY8B 3R19A 4GG6B 1EHNA 4P5MB 2G9HA 2YHGA 3V5KA 3DHUA 5KANI 2KUTA 5IP4A 2BOCB 4Q56A 1INDH 4GXVL 4X6EB 5GZNC 4LCCC 3HNTL 2NY3B 4ILDA 2FLBT 4MCNA 2JKRM 4HIHB 1DJXA 4OD3H 4OT1H 1UC6A 3SDXE 4FGMA 4WJ5A 1ACZA 4NM4H 1QRND 1ND0A 3ELAT 5EUOA 1K2DA 3MV7E 4GW1B 2VXQL 1Z9SA 3SDAC 2F54A 1ILSA 2CUMA 2FWUA 3UBXG 1BREA 2CNYA 4ZTPL 4HVBA 2DKMA 4JG1L 3CLFL 3MNWB 4Y16A 4H8WC 2R2HA 4GUQA 3FO0H 4E42B 2NY7H 3V4UH 4LCIH 4HKXB 1BQUA 4M5ZL 2B1HL 4O51B 5B8CC 1L7TH 5CP3A 1QABA 3GLAA 3WMPA 5AVYB 4CADA 2A9AA 1RZ7H 4XMPH 4XN1A 1HHIB 1DLFH 1KCBA 3VSUA 4DSYA 5F6IC 5AVXB 3P9LB 4LU5H 2BVOA 2XQYG 3VA6A 1WBXB 1J9QA 5B38B 2I60L 4B9YA 2EDFA 2CM6A 5JHDD 4I48B 3B43A 3DSNB 2DYSB 3V4PH 1T5WB 4M29A 1J8KA 4YBLB 2VLME 1KTJA 3OB8A 2ITFA 2K78A 4WSJA 3LH9A 4NJ9L 3SDCA 4HUUA 5B39G 1JHTA 3V4VA 4P4KD 3WDJA 2JJWA 1RSFA 4UB0H 5LAXA 2NUTA 4Z3FA 4ZFFB 3G5ZB 4TNVK 2C34A 3FN3A 1DANT 3L3DA 2YWYA 5DQDL 1J9CT 1S9VA 2KZWA 2B5IC 3CVIH 4O58H 4PJ5D 3N1MC 3NJXA 5EU3A 2H3KA 2X4OA 3K4DA 3FO1B 1RZJH 4GQPH 4OVUA 3SDXF 4AG4L 3FB5A 4NXKA 3ECWA 5GRWA 5DJAB 4GUPB 1HCZA 2GSIB 2V7HA 2H6PB 2A6DA 2IPKA 2ICCA 3CFEB 1PU0A 1SJVA 4CNIA 1D7CA 3DMMC 5AVRB 1KB5L 2WXJA 3I9IA 2CDGA 3CFEA 1ZLUK 4U1NB 4ZOEA 5I71B 1M2VB 3GXFA 1T7VA 1IARB 5AW5B 1KPVA 1CYGA 3HBZA 5ESQA 4RLDA 3DSFL 5DFTA 2VSKB 4L1TA 3QXDB 4R4BA 3AUWB 3AWEA 1NGZA 2VZ1A 3SDAD 4YHKL 5TE4H 2R23B 4HUUB 3V4VB 4OLEA 4YHYB 1TVBA 4CGTA 2FCBA 2PYEE 2YJLA 1XBRA 4OZIF 1OPGH 2XDHA 5FYJL 1AJ7H 5B22A 4PMFA 4UBDC 3QIUD 2QHRL 1KB5B 2J8UB 3S97C 3S8WA 5D7JC 5IHBA 2XWTB 4PY8J 2OX5A 2A4EA 3F6JA 4QJ5B 4B96A 3S7GA 2YSTA 2HSIA 1EQWA 3D39E 2X3CA 4R4NC 3K4ZA 4UWQB 3VXRB 4J3UA 3OMNB 3MV9D 4Z95L 5T1DL 4EXKA 3HRPA 3PQYD 4KBPA 1KGUA 5EORL 2E7HA 4NUPA 3WXWH 4AL8H 4EZLA 2BSEA 1QVOA 4GAJH 2BRRL 3ZSSA 1FCCA 4C47A 1FG9C 4GBXB 3IN0A 1G6RL 2W0LA 2CLZA 2NTFB 3N1QC 2WTRA 2EKJA 4G59C 5GHWH 3T04D 3VFVB 3D25B 4M8RA 4GW5B 1A9EB 1IGYA 3WMQA 1UGKA 4JUTA 1MIEH 1P0SE 1VGKA 2VITB 1AO7E 3M1OA 3PWPA 1JD7A 2VL4A 1YMMB 2AVGA 1E27B 3RVXC 1RPKA 2NQ3A 4QD2E 3T65A 43CAA 4BK4A 4OF6A 5I9QC 2VXTH 2YPLD 5FHAL 1KCRL 3WN5B 4KU1A 1WFUA 2BJML 4UZUA 5B39B 4WWOA 1HINH 1ZANH 1FYTB 2X6AA 4P5MA 4YSCA 4N2BA 3TEZA 3GSNL 4DO4A 1CFSA 2E0PA 1RY7B 1TQWA 3S4SG 5IQOA 5G4OA 3IJ8A 4P0DA 2FX7L 3BO8B 4GG8A 3LH2L 4WI2A 1GHFH 1GC1L 2RALA 3DO7A 2ISDA 3ILPB 3FFCB 3QJUB 3QVAA 4PWFA 5I75B 1O7SA 3FO2B 5G5DB 4N22A 4OB5H 2VDRL 2QADB 3ENEA 3ARDD 3CC5A 2OM5A 5KSBB 3BKJH 1XX9C 3KGSA 3IE4A 4PS4L 1C5BH 5KVFE 5MEOB 1E4WH 1ZMYA 2VMDA 2ZOLA 1WA1X 3OKDA 3P4OA 4GPVA 3SY0B 4XCCH 3LVEA 1NCCH 2Q87A 1R4XA 4DGVH 1F4XL 5HTSA 1TVHB 5H2BA 3L3IB 3G5VB 3QK0A 4A39A 4AK2A 3QZOA 2B2XL 4P2RA 4LSSL 4NSKB 4LVNC 1IIKA 4GRLB 3UTPD 3MUGB 5I18H 4MYWB 4QXTA 2GTWA 3GRGA 3CHSA 4FG6D 4JK0D 5FLVA 1A7NL 4I2XE 4YPJA 5C8JA 1RZJC 5D8JL 1HYSC 3TYFA 3FB6B 1K9TA 4LRNH 5E8DH 5E8NA 5JORA 1IM3A 5PAZA 3EG9A 4PI0A 4OGQC 1SBSH 4PR5B 3UEZA 1N6QH 2JELH 3KLLA 3X17A 1S8DA 2BW5A 3MOQA 4LF3B 3AVEA 4GKOA 2APBA 1PJ9A 4GXUN 5IJKC 2CXKA 2WXRA 1DVFB 4PRHD 1IL1A 1SXZA 1TZHA 4NRXB 3AQYA 4WLCA 4C55A 5HYQB 4BBWA 5E00B 4Y4FA 3K6DA 3DV6A 4YE0A 1LMKA 1OTUD 1RUQH 3SJVD 1NGWA 1OAQH 4HGKC 4E0RB 3QIBC 1MVUB 4BFIA 4LQFH 1QMUA 1AQKL 2MH4A 4C83A 5KOMC 4O02A 3WTWA 3GKZA 2WK2A 3HJ0A 3LQMA 3EJRA 2WWKT 5JW5A 1M9SA 3FB8B 3CFJA 2SEBA 2B7DT 5FUZH 5GRVK 4BFEA 2OP4H 4HQQL 2CBPA 3EOTL 2V5MA 1TJXA 1VGEH 3DJTA 1NIFA 3OAZH 4UV7L 2F6AA 1ZHBA 1IU1A 1S78C 3PDOA 4KAQH 4W9HC 4FEIA 5F88B 5EZJB 4XBGA 5ACZA 2PXYD 4EIUA 5ICXA 3QYNA 5CR1A 2CG9X 1E8XA 1SJHA 3TWCL 4GQ9L 1HQ4A 2A99A 2BM3A 5CIPB 3O0RH 1CD1B 4LAQL 3LCYA 1K4CB 3UP1A 3W2DH 2XN9D 1JTTA 2HVJB 4QRRE 2BMKA 3E8UH 3VGAC 4UOJA 3C6SB 5JPMA 3FH8A 4X42A 2X6VA 2O4EA 2DL9A 3ML9A 1N0LB 2YXVA 3RWCB 5B3JF 3V79C 3ZMEA 3DURA 5IESL 4BHUA 5IF0A 3RKDC 1SM3H 5DMYA 5EU7C 5FS5A 2OJEA 2FIKB 2VAAA 4BGLA 4HSQA 2CO4A 3KVQA 4PJIA 3CH1A 4MFHA 3WFEL 1RV6X 4HLZG 5CO1A 4QRBA 4KKCD 1ZV2A 3ZT7A 1ODUA 4L1BA 4WUUA 2Y7SA 1G6VK 3EFDL 3GHPA 5I1KH 1Z6JT 1QRNA 2EE6A 3O41B 3KPMB 3QJOA 4G42B 3H42L 4NO0B 4C56A 2D7TL 2R1YA 1XTLA 2E6JA 4KXBA 4KK5C 1TYEB 1R1CA 3TH3T 4GMSH 3X3FL 1FFQA 2X89A 2Z7UA 3ZG4A 3IPFA 3TO2B 3NRFA 1KN2L 2XTJB 4AIEA 1B88A 2NW3B 1FO0B 3EH3B 4NP4L 2H0FA 1RUKH 4OFPA 4Z3TA 4AQ8A 2CJUL 5DR5H 2GJ6E 3VD5A 4HJEA 3DVGB 3ZDYF 3KGUA 3GMPA 2MQ3A 5HYJD 1N0LA 1V5JA 4F8TA 5E1GA 2NYZA 3IXAA 5D2NE 4G72B 4OCYH 3ULUH 3C5ZD 4R5XA 5I1DA 1WZ1L 3T0WA 4BK5A 3MRFB 4JFZL 3FQTB 1INQA 4GSDL 3RURA 3ZHFA 1RZ8B 5EO0A 3RU8L 1X5ZA 3UPAA 3KPRE 1Z5LA 3LNFA 3QIBA 4EI6A 3OVUB 3P9MA 1X5HA 3QI9A 3VFNA 1ZTXH 3ULVC 3UG3A 4M3JA 4NQXB 4NAMA 3GBMH 4LCCA 2RD0A 3ZTDC 1K72A 1BZ9B 3AM8C 5TQ2H 3BP4A 2ICES 5K9QI 4OQTA 2WZ6A 4GRMA 4WO4D 3FU5A 3OKLA 2VDPL 4PJEA 5GS0L 4UV4H 1ZLSL 1BQLL 1GR7A 3WHXB 1FSKC 2EDBA 2VC2L 3ESMA 5BVPH 4CN1A 3NEEA 5FB8B 1JNJA 3EH5B 3SE3C 3QCUH 2OCCB 3KPRB 1V55B 4LEXL 5JIMA 1JIBA 4PG2A 1WD8A 3AY4C 4DAGL 4HLJA 5I30H 4PREA 4QOKE 4UOW1 5BZXA 1JMXA 2X4TA 4M48L 2R0KL 4L3FA 2P47B 4N2LA 3P3YA 3DV6B 4OF5A 4F7CA 1U0QA 2W92A 4UOW0 3FTZA 4OM0H 4OLYL 3FUJA 5E70A 1B0GB 2C4FT 5JZ7D 3TURA 3WS6A 2BJMH 4BUQA 32C2B 3BP5B 1NOAA 4NQEE 3BSHA 3IDUA 4A52A 4LCIL 5JDSA 3UAJD 1AE6L 3DMMD 1IT9H 4LCWE 4NKDA 3KW7A 3L4VA 4PTTA 2ZXCA 1W72H 4Y4KD 5C8JB 5JHBA 1Y0LA 3KYMA 4MD0A 4DPCX 4MDIA 5F89A 4HULB 3OLGA 1I3RB 1I1YA 5SWZD 3GBDA 4QXTB 5EU6B 1OV8A 1QRKA 1JZ5A 2Y2WA 3ZOAA 1R5WB 3RNQA 4M1CC 1YAZA 2DZEA 3EDKA 4B0MM 2EEFA 4WWKD 2VISB 3KYKL 3G5VA 1EZUA 1FNAA 1ILUA 2AGJH 1GC1H 1TZOA 2F58L 1UUSA 3MZGB 3N43B 4PH8A 2XFGB 3L45A 3MV7D 1IAOA 4M7LT 2EC9T 2EVHA 3GI9L 3H9SA 1CG9B 4HKZA 4N1EA 3GBNH 3DX0A 4JLRB 1OAXH 5BRQA 2AJZB 4NZTH 4AM0B 5C0AD 4L05A 1NFAA 3NDZE 3H42H 1YNLH 2Y7OA 4X9YA 1XF2B 2YPLA 4V2CB 2EC8A 5DVPA 5T8IA 2PTTA 3T3PE 2Q8BL 5E9AA 1FA4A 1ET8A 3GD1C 4DKDC 2L7EA 1A6TA 3KDPB 4YFDB 1KBGL 5C0CD 2YWZA 4M8QB 5T1JA 2BFVL 2YFOA 5C0NC 1G0YR 1IFGA 2VDQL 4JHBA 4FHBD 5J3HC 3HOGA 1I7TA 1CE1H 4OJFL 2DD8H 2RCSH 4PV1C 1L9PA 3NZ8B 4UQ2B 1CFMA 4NO5A 4MQXD 4L8BA 1PBYA 2D3LA 2NY6D 43CAB 1LE5B 3KPNA 1E27A 3L9BA 1NCWH 1V8HA 3L7FB 3Q8AA 3SDDB 3MGTB 5IMKA 2MCPL 2GJZB 3PWNA 5H37G 1XGRA 4L29A 4PJ9B 3NTCH 1OP3K 3AADB 4QYOB 4XCYB 1IGYB 4J27A 4LNRB 5J6HB 1A9EA 1SXNA 4Y5YA 3W56A 1N6QL 2J88H 4ZX5A 1DBJH 1QFWM 3D0VB 3L3OA 1AGDB 3FQYA 4JY4B 2V2WB 1HHKB 4HS6A 1KGIA 4FQLH 2ADIA 4MBRA 2C3VA 4P9ML 1QVOB 5JNYB 2YSSB 3RZCD 1JWUB 1HILA 3R1GL 3GSNB 3VQMA 4HPHA 3CTTA 4E41A 3AT8A 4K94H 4GI8A 4LKXB 4NCC1 1PSKL 5J9PB 1DYZA 4KY1H 3CV5A 2VZUA 3KPLB 4AUYA 4WKXA 2PR4L 2R83A 2WN3A 3I9AA 1U8PA 2Y1AA 3C6LA 1Q0XL 1MREH 3D30A 3OWRA 4LLVA 1CIDA 2WLNA 4DWHA 2WLYA 2VLRA 1KXQE 3E9UA 2IH3B 1QLFB 4JFPA 1MXGA 2W91A 4JX0A 4G7YL 2NY4C 4U3HA 5CLXA 4MX7A 3N41F 3L4TA 4FTDA 3LHPH 1EJ8A 4D8PB 4HJUA 5F7LB 2BDNL 5GS2D 5TPWL 2AQPA 2WN2A 5E2JA 3BUPA 4S1SH 1VSCA 2X9WA 4NS0A 4R4BB 5C9KA 1EXHA 4NC2B 1L6XA 4LLYA 4PJAF 4O02H 3ML8A 5AW1B 4WU5B 3DTXB 1S9XA 2Z7YA 1IFHL 1H3TA 3HLAA 4XZUB 5EUOF 3EYUH 5LQBL 5F3BB 2V0AA 1XT5A 3G5WA 1PCXA 4E9SA 1EEYA 3HFFA 3IMVA 4HISA 4OZHA 2P5WA 5L2KA 2F8XC 4PGEB 4BA0A 1NEPA 3IWUA 2X4OB 1UGNA 4LSTL 1NCDL 2L7JA 3NSCA 2HMIC 2WUCH 4KGJA 3BP7B 4ONFL 2QVMA 2G5BA 2F58H 1NCCL 4U1IA 4EI5D 4LZHA 1U4EA 3FRPB 4HUVA 4GIOA 2QQLL 4KFZC 4H0LC 4KJPD 4KRPD 2ZWYA 3FT0A 4ESKA 3HG1E 1G7LB 1YY9D 3PJSB 3X2QB 5A2FA 1FPTL 1AR2A 3QFJE 3DUUB 2EDDA 4WY7H 4UNVA 4BE5A 1G0DA 3PJNA 7FABH 1ADQA 1QTSA 2H32A 2ZF8A 4L0PB 4NWUL 2JTYA 1HKFA 3WS3A 5IEHA 1JZ4A 1XGPB 1Z9LA 4EI5A 2YA2A 3H7BB 3L5IA 1OTSD 4G7RB 2CUHA 1AD0A 3E1ZA 1JN6B 2HLFD 2UZIL 4IHOA 2FO1A 4BWUA 4TTGA 2VZTA 4XBEH 5DS8A 3IB4A 1E4JA 2VXVL 1UCBL 3KL5A 4LP5A 2P43B 1CBJA 3BQUA 3JT0A 4X5QA 4Y16B 1DFXA 2Y1ZA 3TGXA 5EZPA 2JCCA 3F6LA 4EUPA 1J8HD 5F0PB 5CFAA 4WI8A 4TTDC 5I6KA 2UY7A 4AVHA 4EDXB 4NUJB 5J1SC 3LRSB 3FW6A 2DW5A 1CPUA 1RU9H 4F92B 1ITCA 3Q2CA 1YJDH 3UH8A 1JNNH 4K3JH 4LVHB 1CCZA 4LLWB 3J7HA 3B9EA 4BEIA 2VDKB 3JWNH 2YMXL 4X6EA 3RIAK 3MA9H 4FQ2H 4OIIL 2VC2H 2D4DA 1A21A 1N59B 4ATWA 3SDYH 3QXUA 3RTQD 5AB0A 3EBAA 1W6WA 4FFYH 4H1LH 1DDTA 4KJYB 3STZA 3WFHA 3DETC 1GCYA 1I1RA 2IV9A 5C08D 4YDKL 3VVVA 3DRTA 3QDGE 4MRBA 1IGCH 4QRAA 1OHZA 4JRLA 3AS2A 1F5WA 1T5XA 1EHAA 4KY1L 3GSRA 5DQ9A 1YNKL 5ESAA 4GKLA 5FECA 2JJTA 1R3KB 2FZ3A 2F1BA 3KJ4C 1BJ8A 3R06A 3Q01A 1ID5I 3G7TA 1HSAB 1IAKA 5HY9B 4JDTH 3RWFA 1LO4H 1VRSA 1J48A 3NCYS 3U36A 2Y06L 1FVDA 3DBXB 5FFLA 2EDMA 3KEDA 1RJLA 1F4WL 1FZJA 1N67A 1WVZA 1CGSL 2DL2A 2HKFH 2OMVB 4QRPE 3OKOB 3F04A 4P2QA 1JYVA 1JPFA 3JWDC 4UIMA 5SWQB 1PEWA 2YRBA 4YR6B 3MNVB 4Q2ZB 4FQ1L 3DJ9A 4G7VL 1SUHA 1DCEA 1B2WH 2ZF9A 2FQFA 2AITA 1UB6A 5GISH 5EMYA 5J9PA 2OCFD 5JLZB 1OVZA 5D7JB 4PRID 1AACA 4GKSB 1OARH 1JWUA 1ZHKA 2KLTA 1NCHA 3OXRA 1YC7A 2X70B 4ORGA 3DUSB 4E9XA 4GEIA 4JFSA 1IZJA 3NUKA 4FLHA 2QMKA 3HUJA 5C92A 5BRZD 3ARZA 2VR5A 4ALAC 4QHMA 3NJNA 1MAML 3MBXH 5ITFB 1TJHL 2JKJA 2X4PB 4D7BA 5CLWA 3S35X 4ODHH 4IW4C 2Z91A 3BVNB 3CN0A 5CS7A 3RDTB 2Z1KA 1NFDA 1XGRB 5BJTA 2XN9E 3CHRA 4LOEA 3QQ4B 5AUMA 1C7TA 3MCLH 1T0OA 2YRLA 4IGBA 4B53A 4XP5H 1S2EA 3NESA 4BZ2H 3FHAA 3MV01 1OM9A 4R97C 2WLJA 4P5RA 1CQYA 3IDGA 2G9KA 3T09A 3DXAA 4NT6A 1D2PA 1SDDA 5DO2C 1JNHB 5JOFA 2AEPL 1INEH 2B1OA 5KOVC 2UWEB 2ZX5A 5SWZA 2BPBA 4XHQA 4YSRA 4LSRL 2EQDA 3OV6A 3INUH 4ODVH 1IBYA 4OQ1A 4Z7QE 3P0VL 1MCOL 4HH8A 5DUPL 3LD8C 1LO0H 1H8LA 1C8QA 1N64L 3NIGB 4OM1H 4XNXH 4AGLA 5CSZA 1MFEL 1VB9A 2E76C 4PIRF 2HFFB 3NSJA 5BXFB 3QG6B 2Y3NA 2RGSA 4JE4B 2OULB 2G5UA 2EE9A 4FAAB 2IDTA 3WXVH 3I3DA 5JZ7C 1OCCB 1GIGL 3WJJA 4KZDL 1A65A 1JGDA 5CD5C 4MNQB 1ZLDA 1TU2A 5DK2A 2DIJA 2BSRB 2XZCL 4MAYB 1Q94B 3BI9X 4GH7B 2KH2B 5MENA 2OI9C 1F6AA 1N8ZB 4HWEL 4FNTA 4RGNB 4XPAH 2BCKA 1TO4A 3HRZC 4JRXE 3DXAE 3FOLA 2CKBB 2VUKA 3NN8B 1FNLA 1G7IB 1ORSB 3MLZH 4PMEA 1P4IH 4QTFA 3QUYA 3MRIA 5IROD 4JJOA 3QZWA 3F7YA 1GAFL 4N6QA 2IC2A 1Y0LB 3KYMB 1M9WA 1J1PL 3R0MA 4PJFF 5SX5H 5FGSA 4NN5C 4N87A 3BC9A 3LPFA 4FNQA 2X38A 4HJ0C 5SWZB 3VH8G 4PRNB 3U1SH 1JHLH 1GL4B 3CX5K 5DQJB 3CVHB 1MVFA 3GMRB 4W9ZA 3TVMC 1L4IA 1MCIA 1JGLL 3GJFK 4GT7A 2ALWA 4LSQH 3L95B 3NABL 4TSCH 3VQLA 5DRWA 3CFTA 1FLRL 3E8VA 2C26A 4OIFA 5IOPA 2ZOOA 3O2DA 5MHSE 3S34H 4JFFB 3A6CL 4NHCH 1IT9L 2K7PA 4HK0B 5BVJB 2WMPA 3CFKB 1UOLA 4KHXL 1XL4A 1HEHC 5EIIB 3BUQA 4XOAA 5CU9A 3N85L 5C08A 4ZOAA 1IC7L 4JG1H 3HZYB 2AV1B 5FDWB 4NHUA 3O9WA 3OM3B 2FD6L 4BKLA 2IQ9H 1U91B 2YXFA 3N06B 1TUPA 4G5ZH 1WBYB 3OKLB 5L88H 1NCDH 1F42A 2OQJA 3ABKB 1TZIA 2OA9A 3SE8L 4GRMB 4JR9H 2ENJA 4YBQC 2P8MA 1GH7A 3LVTA 1G9MC 1CDBA 2WZPD 3TZVB 5SX4I 2NR6A 2ZCLL 3S5ZA 3SBWA 4K23H 4NQXA 4XMPL 3V5HB 2BHZA 4DUWA 4PJFE 2IOOA 1U42A 5GJTH 2LGNA 3F7PC 1XCTA 2VMCA 3JWNE 1PG7X 5EO0B 1JPFB 1SXAA 1UYWH 3SJVB 2RBLA 5IB4B 5C07E 3PE9A 3VD2A 4WK2B 2GTZA 2AXFB 1ES0B 4UMGA 4JPVL 1BVLB 3T6QC 1MFUA 4PJCE 5EF0A 3QNYB 4AEFA 5CN3A 1IAKB 1U21A 2LT9A 2Z7ZA 1YEEH 4IOIB 1CLVA 3GMQA 2XIBA 3NJIA 2X2HA 3P2DA 2JLPA 5C0FA 1MHHB 4XWGH 3SGJA 4DVBA 1RZKL 2L04A 1AKJA 4PVBA 3WFHB 3GO1H 5T1MA 4GKZB 4X7TB 4J1UA 4J4PC 2VDNL 1HL4A 3CQQA 2ZUQB 1RU9L 3QXAA 2ZYRA 4M7LH 5HPMB 1WCQA 2IDQA 1YEIL 3FOMB 4AMWA 1VPOL 4OZ4B 4PS3A 4ZO6A 4YDZA 1TQUA 3H4FA 4ADJA 2ZUUA 1E4KC 3FMGL 5ADOL 4PYHA 3MV8D 4HS8H 3UMTA 5AB9A 4DW2H 4G8EA 3QRGH 5CLTA 5KN5B 1YJDL 5CEZD 1E9QA 2TRYA 1QYGH 2C3XA 3AAZA 4NYLB 4PJXA 2UY7B 1UB5A 4APXA 3QHTC 4EDXA 1QR1A 4FI7A 1A6WH 3KPOA 3C60C 1XWVA 4MAYC 4NQEB 3V0VA 3W0WE 5INDB 2IAND 2APTA 3NRQA 3Q0HA 4W9CC 1KJ2B 2GVYA 3UJJH 4Q9RL 1W0WB 1R33A 3QIUC 4BSJA 1BOGB 2A74B 3QW9A 3AW5A 2NXYB 4FLSA 3QJRB 1V3LA 1Z3GL 3N50A 5C9JB 4YGVA 4KC3B 4CILA 3REVB 1BFTA 2HWZL 2J8UF 3A4FA 2P5WE 5L2KE 3ULVD 4ODTL 2P7TB 2A74C 4NCC2 4ZUSB 4K3GA 4CVXA 3WLWC 3EOBB 1TU2B 1RQ5A 2GPZA 3BHBB 1T21B 5IBLC 1CFTB 5C7ZA 5D1XD 1AXSB 4R97B 1WFIA 3L4YA 1XSOA 2AJVH 2WXNA 4HUXA 4MXQD 1A6UH 4F2FA 1AR1B 3TTSA 5I5JA 4ONGH 1EJ6A 5F7HA 5FW6A 3A6CH 3SO5A 1NWPA 2N7AA 3QPKA 4WHTB 2GCYA 1TJMA 2ZSVA 4P9MH 1PVHA 5IWLC 3UTSE 5IHWA 5T5FA 2PP8A 1GGCL 1EEYB 4DQOH 4RGNE 4NAJA 2KL6A 4EZMA 4V33A 3B2VH 4PVNA 1P5VB 3IDGB 1H19A 5IV2A 5LDSA 1UEYA 4XZUA 4JUSA 3QHFH 3C6LC 1QEWB 3IF1A 3GTTA 4Z3EA 2I24N 1DVXA 5JPNA 1ADQH 1GJIA 3NK3A 3HZMA 3LPOA 2W65A 3TNMA 3CSGA 4TQHA 1DVFA 4JPIB 1F4XH 2EEDA 1IFRA 4TNFA 2XUWA 2EEXA 1JCVA 1ZGLB 3LNEA 2DDQH 3F7RA 3TV3L 3KMDA 3KR3H 3P3UA 1ZD6A 2X4QA 1M7DA 4AGMA 5J0BA 2XG4A 2APWA 4JN2B 5C09D 2YA0A 3PUUA 3ZKQD 2CHZA 2VLMD 3M1BA 3TEYA 1JRHL 2BNQD 5IQ9B 5GRJH 3IDXH 4F57H 4GKSA 4AZ8B 1X7TA 1MW0A 4S0SD 5E6SB 4YHOL 1SZNA 4U4IA 5J5EA 2R0LH 1V7NL 5GGQH 4AUUA 4LDLB 3KPLA 1MHCA 3MRJB 1W15A 4AY0A 3U6RA 1GOFA 4RSYA 3MXWL 1PEZA 3ORJA 2WYIA 3EOAB 5I8CB 2V2XB 4KKRA 4KK9D 4K2UL 4E41B 4AZ8A 1I8LC 4UIMB 3NCBB 3EAKA 5C0AB 4JZJC 4P2QB 3H9SD 2YSSA 3MVSA 3MRGB 3HKFA 1MLCB 3K6SB 4HS6B 2O1AA 4NQCA 1KLGB 4PGZA 4JY4A 1AQ8A 2ZUSA 4DOHB 1WP6A 4WCYH 5KSBA 4K73A 2IQAB 5HY9A 1D5MB 3HPLA 4OCMC 1A8JH 4OKVB 4WZ9A 3LEVL 4W9GC 1A64A 2YD8A 4M43L 4KPHH 4ZAKB 3P11L 3H2PA 2O6DA 2AK1H 1CE6B 2VXSL 3F65A 3AXIA 1PX4A 2DI9A 3C8DA 1GAFH 2LTQC 1J0KA 4AL8C 1CJYA 1HH9B 2VDKH 4LQFL 5F9OH 4Q8BA 2DH2A 2V17L 2OP4L 1AKJD 4MQXC 3WXWL 4K8RC 3PHQB 4KZEL 4ZFOA 4Q9QL 2FHFA 3V6ZB 5FYKU 4ZUTA 5B39A 1N59A 2BNRE 2AW2A 5DCCA 1MHPL 2DBLH 1KZYA 1ID2A 3MRHA 2QVKA 1MSPA 3L08A 3TH2T 2ENPA 5E7FA 5DZLA 4GQ9H 1DVFD 1EGJL 4IBYA 4PAZA 4KO5A 1F4WH 2JJTC 3LRLA 3RVWC 5K33A 5JW4R 1OAYL 3IU3A 4GAJL 5DGQA 4IRSC 4F58H 4A2EA 1YZZA 5C0GB 2C9VA 5EIQA 4ZYKB 5ADPH 2WXHA 1AXSA 2WTRB 2AJZA 1UCTA 1XIWD 2CO3A 3QR2A 3GSWA 1UH2A 4EUPB 3D3VA 3ULVH 1T7ZA 5LNGA 4D7PA 2D03H 4TRPH 5IB1B 1UM4L 5DC2A 3UCQA 1XZ0A 1HSBA 4HKJB 5EU5B 4JQIH 1KY6A 1A4KA 2BK8A 4G8IA 3APDA 2CQVA 1YPZF 2VWEE 4G80A 1D5ZB 2XIIA 2ZUWA 3NGBB 4OAWB 5D7KE 3ZIYA 1I1YB 3U7WL 4OF8A 4DEUA 1FHNA 5JXAH 1FL3A 4R0LC 4CW1A 5K9JL 2BZDA 5KBLA 1FH2A 4MD0B 1CDCA 1KB5A 2K1MA 2NY0C 3V6FA 4P07A 4QJ3B 1EX0A 3CDZA 4TL5A 1UB5B 1QR1B 3HVNA 3E1F1 4LBAA 5MERA 4I2XB 5DC9B 5TE7L 5BV7C 5IMLB 4M1GH 2G5BB 5KTEL 1BEXA 4Y7OC 2XBDA 4NEHB 1Y07A 1MG3C 3DYPA 2Y25A 3IMRA 3QXDA 1TPXB 5FGBC 5IJBC 1P4LA 4UT7H 3QC6X 4U31A 4PJ8D 4IBVA 2P5WB 3O6FC 5L2KB 4TVUA 3ZUCA 3QJSB 4JFDA 1G9ML 4YXKH 1HDMB 3N40P 4KKLD 5DRNB 1VHPA 4NOBA 4OCYL 4P2OD 4Y4FD 3LNIA 4M5YH 3SDAA 5K59E 3KPRA 4WO0A 2V7HB 3S5LB 1LK3L 4CC4A 2JQAA 3MBED 2Q76A 3OJVC 4XC1L 2GBTA 3DGGB 2VIRA 5F6HJ 3FK3A 4MB4A 5JW4N 4HSCX 1I8KA 5EU4A 5MP6L 3BUYB 4G83A 1DE4A 1IM3D 1S9YB 3KXFE 5ADOH 3D33A 3BT0A 2FSEB 2Y7QA 3DX3A 4KI5F 1A6ZB 3Q9QA 2A0LD 2BZ7A 2EO9A 3QNYA 3IMBA 1JPEA 1WIPA 2C3HA 4EAEA 4PUBL 3ARSA 3QXTA 3HNVH 2ZXWB 1NKGA 3OTTA 4BRJA 3A23A 4WI3A 3BCFA 1WBXA 3HR5A 3HC0A 2BVOB 2FEDD 2YA1A 4AE0A 2BP0A 4LLVB 5CJ8A 4PWKA 3QUGA 3VXUA 5F96H 4AW4A 1BGXL 4NC1C 5F7EL 1FHGA 1SLVA 4J4PD 3TZVA 4M6NL 3DBSA 1SUJA 3RHWF 1GGTA 4H13C 5EBWB 1TZIB 1XSIA 5C7XL 2J44A 4MJ6A 4UV4L 4OCRL 5K1VA 4YXHH 5FGCB 1IE4A 4OJCA 3QQ9C 2XY2A 4WUUE 5I0XA 2CBTA 4OLZH 3QJTB 4IMKC 5D8JH 3VWKA 1XQ4A 5FCUL 1MFEH 4PJIE 5D7EA 1H3WM 3NJJA 4IKKA 3M17B 4UV7H 4Y5YB 1WAAA 4I9WE 2OTWA 1T0NA 4JFFA 4L29B 4PJ9A 4L2LA 2VERA 2YUWA 5KAQG 4KQ4H 4OZFA 4MHHI 2MKLC 2JH2A 1T7WA 3L3KB 5TH2A 4I3SL 1HHGA 1QRNB 1D9KA 5DRWB 2R9HD 4LZKA 1MN4A 1SJMA 4Y2NA 4UTBA 3CCHB 2R56L 3I6LE 4LGRB 2EXTA 2EYSA 3RY5A 4HLEA 1QI5A 5DS2A 2AF2A 1XO8A 2Q6WA 3CUPA 3WFEH 3SPGA 3S88L 5HDBE 3N9GL 3CBJB 3M86A 1QNZL 5TD4A 3CIQA 3APNA 5C07B 3SCMB 4UU9A 1SHXA 4G6MH 3D52A 3LIZL 4KMTH 5IESH 4A7SA 3B9AA 1U3NA 3LXAA 1X6NA 4FHKA 1EFQA 3I2CH 1LO5B 5E2UH 1G7IA 1ORSA 4JFTA 2ODIA 2BMKB 4JLRA 2X2IA 1T1WB 3X3FH 4X9BA 1AH1A 4XAKD 4YSDA 1O5PA 1OY3B 1UASA 4UDTA 2W9DH 1IAOB 4OFQA 4XAWH 4AMXA 5MENB 4OLXL 5I1KL 3OC8A 2EVGA 5F1NB 2C7UA 5D9SB 3OX8A 1DDHA 5ICXB 5IWLA 43C9B 1KGCE 4Y89A 4JM2D 1ZHBB 5CJ5A 3ZYIA 1PPIA 4XPBL 1S9KC 3DARA 5IBUB 4FXKA 3ABZA 3AZUA 2A38A 5CIPH 4EIZC 3OR7B 3D06A 4Z5RB 1YUKB 3H9SE 2QGDA 2YEZB 1JUFB 3NOIA 2R0LL 3MLUL 4PRPB 4M03A 5F1SA 5JDSB 4NLAA 1BZEA 1VFBA 1CXIA 3VTAA 4KDVA 4N2FA 4WW2B 3RUGA 4U7MA 5C0CB 2YAQA 3QDME 1RJZA 4UQDA 3P3RA 1GTFA 1ZSHA 3GPSA 4V1DD 4JGNA 4IGBB 4JHWL 1DJGA 4F7CB 1PLGH 1WS7A 1BXAA 4LLDB 5DRXA 4A7UA 1W2KT 3CIAA 2LU4A 5EEYA 2WOYA 1VCAA 3GK8L 5SX5K 1PZ5B 3BVNA 1R0AL 4WENB 4UM9D 3FCSA 1X5LA 3IU4L 5ITFA 1X9LA 1EZSA 5D7LE 4A7GF 6PAZA 5T3XL 4HXAH 3Q5TA 3WNLA 3BDYH 5F7BA 3ALPA 3O8XB 4MKTA 3FB6A 1BGXH 1VAHA 5CJXC 1MFVA 1ZHKB 2EIMB 2XX1A 3CSPA 2KQMA 4D0DB 4HPOH 3FH5A 4K7FB 4MNQE 5E5MA 3VVWA 3I9PA 2H2PC 4BJLA 1NBCA 3QCUL 4QOKA 3LX9A 4LCCB 3RVUC 5C2UB 5F0LB 4NM8H 1XF1A 4BZYA 4N8UA 4NQTA 1MUJA 2XVLA 5GGTA 2VB5A 2WKOA 3VD1A 5JQIB 1U8OA 3U46B 1T5KA 4DT2A 1JHKL 4PD4J 4M9OA 2OMTA 3D85D 1Z32X 4JZNA 1RJLB 5A6MA 3O6FB 5F1IB 1EEZA 1RP9A 3OHXB 3V9FA 3RWFB 5CF3A 4ZPVB 1U3HD 3QJHA 2DQIH 5D1ZD 4U1MA 1JDCA 1GZQB 5DJ0B 1QYGL 3QFDB 3EO9L 3L4CA 1CDIA 3LZPA 2WNXA 3GMPB 2XXMB 3B3IA 5ESAB 5AWNH 3PQYE 4TN9A 1F3DH 3FULA 1S5HA 2WO3B 4OGYH 4KDWA 4ZRGA 4RMRA 5GS0H 3EO0B 2R0WH 5KJ4A 2I60H 2DM2A 2EVIA 5TDOB 1E6JH 1LNUB 1E67A 1WAPA 2XI9A 3PP4L 3NGBC 4N2HA 3DRTB 4FYQA 2NW3A 1R3IL 2MTZA 1GYUA 3GI9H 1EO8L 2CK0L 3AACA 4M1GL 1MCPH 2L7QA 4BXVA 3ARGD 4PJDB 3N5AA 4GB9A 1FO0H 1MCJA 4JVPA 4FZEL 1T6WA 1UUNA 2DLFL 5ANMB 5KVFL 3S8GB 1FI8C 1EO5A 4GW5A 3CN1A 2VLJA 1FNEA 3M17A 3NCYP 4M6AA 5CZRA 3TBYA 4N9GA 2EP6A 2VH5H 3HA0A 3FAWA 2IG2L 4FF9A 4PJIB 4IBUA 4G8FB 1F4YH 2VT0A 3CFUA 5DC4B 5I1GL 5JQ6H 1HCFX 3L4UA 4K8RH 5K5YA 2NY2D 4NNPL 4LLAA 3HE6D 5AVZB 4PJEF 5IREA 3ZKXC 4R0LA 1NCAH 4C56E 5I74C 3DDFA 4OLVH 1WBZB 4GXUM 4B50A 3SSGA 4OBSA 1SOQA 3BAJA 1HXYB 4JO4L 3H4HA 3B5GA 2QHLA 4JHAH 4P2AA 2HVJA 1OT2A 4LHQB 4PGDB 4PUBH 1MHEA 1UM5L 2EDJA 1M3JA 2DEWX 3MLTA 4LRIA 4OJAA 2ZP0T 4QGYA 4HWBL 5T5NG 5D2LE 5F72S 1WEJL 3MU3A 1AS8A 1BJMA 3G5XB 1KCUH 2FR4B 1FZOB 2B4CL 1YPZA 3MMEB 4FQXD 1NLBL 4XBGB 1TVBB 4GQZA 1SHWA 1NCOA 3IK2A 2OXGA 4DERA 2OMWB 4K94L 5B1AB 4D8OA 4KROD 3B7RL 3QIWC 1U8NA 4AYBA 3DX2A 3Q1SL 2D4FA 1FE8L 4MLSA 4UTCA 3UBXI 2ICWI 4Z95H 1ZS8A 4J3XA 3DGGA 1H0DB 4XMLL 4I9XA 5F7DB 1NEZB 3P2TA 1RZGB 2I5YH 4OCXH 3L9RB 2BFVH 3EADA 5DVLA 4HIXH 2Y22A 3ZKND 2VR8A 1YAIA 3FSVA 1PD6A 4MS8D 2WXQA 1BIHA 4OT1L 1BEYH 1XMEB 5DJAA 2UZXA 2EE3A 1T2QL 4XI5C 3T0VA 2GYSA 2NZ1A 4Y4FB 4GXVH 4LLYB 3US9A 5LJYH 4K07A 1S7RB 1JGVL 4ZTPH 4KVNH 4MTMA 2P5WD 5L2KD 1JZDC 1XH0A 3NJLA 2IANB 3GUTA 1MDTA 3UEQA 2F7PA 3UADA 2PTVA 1D7FA 1D6VH 3RL2B 1FYHB 1WIUA 2OZNA 2XKNB 3ZVVA 3MJ8A 3RGBA 2J6EH 4KJWC 2FT7A 4S10A 2WVSA 3D07A 3LMJH 2IAAC 1E5CA 3MV8B 3WFCH 4F9PC 2OKMA 3CDCA 3I2CL 3WSQH 2X09A 2AJUL 1X3DA 2F5AH 1FVCA 2C1PA 3BPCA 3H3PL 3QQNA 5LGHH 3S96B 5GZOD 5H2BB 5D1XA 2CAKA 1I1AB 4HKXA 4YEFA 4BWTA 2QVTA 1ZATA 1UD3A 3BP6B 3DGCR 2CPUA 1ACYH 3GSNA 5EOTB 3OKDB 2F53E 3VXSA 3DPDA 4A6YH 3CMOH 1U8IA 3EYVB 1RULH 4NB7A 2W8CA 2QT6A 4XN5A 3AREA 4IIQA 1NM9A 2ICEB 4ICWA 3T9WA 3V4PL 2E7LA 2D7OA 3WN5C 3QZNA 2IPTL 5IGXL 5CLYA 4R5VA 1K8IA 1JF5A 1N0XL 4KUZH 2WO4A 3H85A 4XP4L 1NGXA 3BEVA 3VYNA 3PGCA 1KPUB 1QWUA 4EUPH 1TTFA 2VGLM 3HNSH 3QJFB 3HG1D 4L8BB 4BV1A 3W1ZA 1OAZH 3BAYA 3RJOA 1S7TA 3UO8B 3QFJD 4PLJD 4NGHH 4OLUL 3DPBB 3OJ2C 4ZFOB 4BFRA 4Q9CA 3ZL4H 3DX8A 1NCIA 1TQCC 3KYOA 4BCXA 2WP3O 2FWSA 1UG9A 2B9AA 4ZSOE 1L3WA 2ZXGA 4A2MA 3NZUA 4PWIA 1KPUA 1RHFA 2X0VA 2Z8WC 1GJWA 2OR7A 4PV9B 2AFNA 1HIMH 3BH9B 2GI7A 3D87B 2Q3AA 2XVBA 1CFNA 5GIRB 3RX9A 2VXUH 2WZ5A 1YEHH 3BAWA 1QSFE 4WEBH 1AGBA 3IU4H 3VXRD 1HEJC 1XGYH 2CLZB 3T6VA 4N25A 5F96L 1HTYA 2LU5A 2FH6A 1Y6MR 4K3JL 2BIHA 4O2FA 1DQJB 1GOGA 1JPGA 4D3CH 2J3SA 2JB6A 5B7FA 3JYCA 2B15A 1A14H 3ET9F 1AO7A 3PWPE 5JPMC 4J2XA 1EO7A 2QEJA 3VB8A 3CNKA 1YUHA 4QRSA 1FGNL 12E8H 1WHOA 2BWIA 2GTQA 4QDGA 3BN9D 3L5WB 2OSLB 4KX8A 4LEOA 2V37A 2XWTA 2ZZUT 3BVTA 2VUYA 3GSUA 2XKNA 4NENA 3TWCH 5IW1B 1PL3A 4PTTB 3I74A 4F5CA 1N4XH 3VX1A 4P3DB 1JMZA 4G9DA 2FQDA 4EKXA 3GMNB 5ACLA 5E1AB 4XVOA 5L0QC 3GZQA 2VSDA 5TTRA 3QORD 4RDQF 3HBPA 3INOA 4KH2A 1F13A 2R51A 2QTEA 2OYMA 2CCLA 5EEUA 2ROYA 2CJ3A 4FOMA 1EUUA 4H7VA 1OCRB 3MX0B 4PJHA 4CRPA 4XGZA 2AHIA 4PJFB 2W65B 3LZRA 3AY4A 3ALXA 3PREA 5TF1H 2XWXA 1XR8B 4K3DH 3RWDB 3UJTL 2ESVB 2ARJA 1QEWA 4Q74A 5B3JE 1CXFA 2PO6C 3EDJA 5EWIL 2WLLA 2YMXH 3TA4D 4MD5B 4B97A 1NWOA 4X80L 3IKKA 4DN4H 2WB7A 2VR7A 2I85A 3RVUD 2HLAA 3ATAA 4UNTA 4LXFA 2F7IA 4OD1H 5L2JB 1RZGA 5CEYA 1I1AD 4GUPA 2J6EL 2NCEA 2AV7B 1H0DA 1WD9A 1FFOA 4HDIB 5T1DH 1OAJA 2KS0A 2WSPA 3DIFB 4PJEB 5TDNA 3ROOB 4WF7A 5I5IA 3JWDL 4D9LH 5HGAB 1MAJA 5SV3A 1JFQL 1JHTB 3BP4B 3C8HA 1DCLA 2OXGB 1T1XB 2KLSA 1UD2A 3RHWK 2CA4A 4NWTL 4XCFH 5EZIL 3QO1B 3EOBA 4QIRA 5AZEH 1T1ZA 3S0PA 3V4VL 4O2CA 5B38A 3QP3A 1ZA6B 4JPQA 3T1FA 2Y5EA 5T3ZE 1THAA 3LEYH 3VDAA 4MVBC 1P7BA 2E5EA 2QVIA 4V11A 1JZHA 5CZXD 5DYOA 1INQB 1KBKA 3BOVA 3ZDYE 2R4SL 4CADB 2UXGA 4G1MB 1OP9A 5I1DB 1I9RL 4N0CD 4X99B 3SGJC 2LVCA 1N18A 1CXKA 1SN5A 3RIAF 1SEQL 2WXOA 2NY3C 4GI6A 5D71H 1A6VH 1HNYA 5I1CH 5CJQL 3OJMB 4JFWA 1NBZB 3BRFA 3CPLB 5JR1L 2H9GA 2CDFA 2VR6A 1E40A 1HVXA 1BX2A 1BVKA 4JAMA 2V5RA 5E1QA 2X9XA 1FO0A 3KWXA 1KTDA 3KH3A 1NSNL 2WQWA 5BOJA 5IM7A 2UYLA 2DQFB 4NCDA 3I50H 4KKBD 4Y4HA 5CZKA 5BMFH 1S7QB 3N04A 3RWEB 4Z1PA 1LEIB 5ANMA 4QRQA 1GIGH 4KITB 1SHMA 3T77B 3WY4A 1JZGA 1OL0A 2WWMC 2HT4C 3F58L 4OFDA 4ORZC 1RAMA 2HFGH 3H3KA 3IRPX 1NFKA 2ITCB 4TL4A 4ZW7A 2DJUA 5HGDA 2PN5A 5D7IA 4YSQA 1QSEA 1ZWIA 2Y24A 2H1XA 2Z31C 4R4ND 4UT9H 2PCPB 3VFGH 1U3HB 1ZDSA 4XHJC 2QJDA 3MLZL 1LNUA 2Q7NA 5LXGH 25C8H 2D2CC 2JSFA 4LK4A 4B27A 2CIIB 2ZCKL 1CFBA 4HCRL 3WE6B 3ARGC 2R7EA 1K8DB 1SQ2N 1ED3B 2DQUH 4NQCD 4TQPA 1D5BB 2DYPD 4FQJH 5CSGA 2GEQA 2WQAA 3K4AA 3M6DA 3CSFA 3SN6N 3OB0H 3UERA 3C6SA 5BS0B 5FC9A 4PWGA 2DIBA 3KYNB 2XWJB 2AXFA 5C3LD 2D3JA 1QSVA 1SYVA 2D8KA 5D1QC 1XB8A 5AW4B 5C09A 2X2JA 2DQIL 5D7LD 4AQAB 3G6JF 1SYVB 4CKQA 5AG9A 5I8OL 2ARJQ 1J8HE 3L2NA 1O6VA 4KK6D 4ZW5A 5D4HA 3O0RL 1ZE3H 2IQ9L 5FYKE 2BIOA 4N90E 2P8MB 5F7NC 3KAAA 3WIFB 5GSVB 4NC0B 1OGTB 1YEFL 1F1GA 5AKVA 3N85H 5FWRA 2WBXA 2VRQA 1I7ZB 1LP9E 2SEBB 2XWBB 3CHXA 3V2AR 1BPVA 3ZMNA 4BQ9A 1DQLL 5CAYB 4PG9B 1WFMA 4NKQB 3TF7C 3FB8A 1KCSL 4XWOC 4Z7OE 4PRIB 1AHMA 4YO0A 3FYEB 1RK0A 3QPQD 4NNYA 2V5YA 1QSZA 1QZ1A 4GP4B 4JB9L 4NQDE 1BAWA 4V1DB 3U4BH 3WFCL 4A68A 1IC0A 1O6SB 2WMPB 3CFKA 3PL6B 4BSWB 1U8JB 1XIWA 2DQJH 5E4OA 4AQOA 2F8VA 3GNML 4MXQC 3D50A 4HOZA 2W80C 4WHYH 5L7XH 2MOVA 4GRWH 5GZNA 5JIPA 2YAMA 5DRXB 4QHNB 3T3PF 5ICYB 4JKLA 4NRXA 3D8MA 5E7BA 2H2PD 5JOPD 2DQTL 4C4BA 4UILL 3TN0A 2E9IA 5E9DE 2N1KA 4U1GC 1LL1A 4RISH 2ROXA 1LQSR 3BIBX 3HZVA 1R19A 3QUZD 4W93A 4ZT1A 2VDML 3ZQWA 4KTYA 4Z6AT 3CPLA 2VDQH 4L9LB 3ZE0E 4CU6A 1SXBA 1LYQA 4FXKB 1J5OH 1XEUA 3ABGA 4U1GB 4M5TA 4HHGA 3RU8H 1E6JL 2AJ3B 3PP4H 4ABUA 5ID1A 2VJ0A 4WCYL 3ABMB 4NSKA 4Z7UA 5H4YA 4IIZA 3TOPA 1NAMB 2ZCLH 4DN3H 5DURD 1D9KD 5FKPB 4BQCA 3MXVL 3K0WA 2OMZA 4U3SA 4GAAA 4Z18A 3BEWA 4M6OL 4UDTB 1KLUA 2NYYD 1OGSA 1T1ZB 1G9HA 3SZKC 4V1DE 3MLRL 3ZGPA 4TUOA 2Z92B 1BLNA 3PGFL 4WTQA 1C12B 3QG6A 4MQSB 3DX9B 2BWQA 4KQ3L 4GRWF 4PVMA 1ZIAA 1T7XA 2DKSA 3C5ZC 5E6IC 4B7IA 1FBIL 2GT9A 3IDJA 5F9OL 2J2ZA 2A9NH 3RFZC 4Y5VB 3KXFB 5AYQA 1WFJA 3PIQB 1FNGB 1FJ1A 1KWGA 5CEYB 2WQUA 1BZOA 1WITA 4MJ4A 3UROR 2IANE 4QY8A 3TJHD 2C9UA 2Y36L 1CL7I 2I7OA 3DOSA 3CZSA 2KLRA 3GO1L 2RACA 4BK8A 3ETTA 4LIQH 4MD5A 3GC3A 4TNWK 4JDVA 4GSDH 1SY6A 3C60B 2ESVA 1OGAE 5AUMB 3T4AA 4OZFB 4N1HB 4PJBE 3X11A 3B1UA 2ZSWB 4PY7A 2B3RA 1T0NB 3VI3B 2Z91B 5CP7B 3JV0A 3GRWL 3WDIA 5ADPL 4J2QA 2PW2B 2VXQH 3Q44A 5F2FA 3TC9A 5KYXA 2DQEH 4UMSA 1NC2D 4I3RH 1KBWA 2HMID 3QJXA 5FCSH 1UACL 1TKWB 3HHMA 2Y5QA 4EKJA 5D1QD 2HN7B 2BX5A 3MRRA 1MF2H 1GYCA 3RIFF 4HJSA 4YWGH 1Y1UA 5HD8C 4NENB 4RSVA 1DEEA 5D7JA 1DBBH 4MJ6B 4G82A 1Q9KA 2GAZB 3W39B 3QIUB 5BV7H 4OCXL 3VG9B 4H20H 2BSDA 4DP0X 2OK0H 2ZOUA 1OP5H 1RCYA 1KJ2L 2NY6B 5KJRL 4LSPL 5I2IB 3AG2B 1JPGB 5HDRA 1THCA 3OPUA 1BIIA 4JO8A 2FDBP 3FQ2A 1EAJA 3DBXA 4JCMA 4W4NA 3WTXA 3RTQC 1M6UA 1QP1A 1UZ6F 3SKMB 5KTEH 4H0IA 3M46A 2Y7QB 1JF1B 1TO5A 3VGGA 1G7JA 3TBVA 1SYSB 1AQDA 2DDQL 3LZQA 3TV3H 3WD5H 1YNLL 2IDUA 4NRYA 5F8QC 4WUKL 4ZMAT 4N24A 2GUOB 5AQ0A 4IRJC 3SZ6A 1CLYL 1JXGA 1CTNA 3BIKB 5F9WC 1S6NA 1FZMA 1KBGH 3ARYA 3BQUC 3V5DA 3GYRA 4U1NA 3QQ3B 4G5AA 1MDAA 3Q3GA 2OL3B 2I07A 3DPBA 1QACA 5EB9A 3WN6A 3S5YA 3X13B 4K5LA 2GSIA 3B83A 4XO9A 1TEGA 1M53A 3OAYH 2G5RA 1C8PA 3HC4H 5IKCA 1XAKA 2X6CA 3RDTA 1BYOA 3N6YA 5LGJA 1KN4H 5C3TA 3ZGHA 2O5ZL 3G5ZA 4YHKH 5T5FH 3F58H 1YG9A 4CBPA 5BUGA 1K8IB 1TCRB 2B39A 4RH4A 4N2GA 1DBKL 3KLAA 4Z7OB 5I6XC 3Q8EA 3ZDXB 4LPUA 1KYOK 4F37K 2VZOA 1T5WA 3AREB 2HAZA 4IIQB 3L7EA 5DVOA 2IF7A 4Y9CA 1OSZA 2EVFA 1HHHB 2WXPA 2Y1VA 4EEEA 1U8IB 3FB7A 4CSTA 3HI6L 2W0FB 3PPSA 1PMYA 4B9FA 5EBMA 1YEKL 1UZ6E 2Q9OA 3LXUX 4XXWC 1SBBA 5DWUH 4MJIB 3DV4A 2D31B 3VXSD 5I0VA 2AZAA 2L8AA 3ARGA 4ODWB 1GPOL 4R4FH 4U1JA 3S96A 3UDWC 4RA0C 2YD5A 2DF3A 5EU5A 1BVNP 1DVTA 2NSMA 4X6DB 2CR0A 3PAVA 5EU6E 3PHOB 3SKNA 5E23A 2ARWA 2Q3ZA 4E42A 2F18A 1M2OA 2LTQB 5M94B 3V0WL 4TUUA 3BVWA 2L0DA 4UQAA 5EOCJ 3TS8A 3E6FA 2P44B 4WV1B 2XVKA 3ALWA 3O11A 1E5AA 9CGTA 3VTTA 3F2LA 3BAIA 5LVEA 4GG6F 2YPVA 2K70A 1JDDA 3GRWH 3FBKA 3N1FC 3TCLB 1GA2A 2QSCL 1I8IB 4LPQA 1AXIB 1D6EB 1NPUA 2D2OA 1M56B 2XXCB 3L9YA 3QUXC 2Q8AH 2PKDA 2A1WL 2VW4A 3RFZB 5JUEL 1OE1A 3SOBH 3ZRSA 3EYSL 4P59H 4ZTOH 3FBQA 1OTTC 2BLFA 3KGRA 5ABAA 3V5KB 3ZY7A 1DHKA 2GSGB 1TQSA 3FTXA 2IDCA 3FQ1A 1QFUL 4WHCA 4QOKD 1MAMH 3MBXL 3UTTB 5B1JA 4NI3A 4I1NB 4JQIL 2CHWA 3TA3C 1CLZH 4E9VA 4CDGC 1G9NC 1A47A 2QV4A 2PR4H 2LABA 1J0ZA 3TESA 3CZFB 1ZS8B 4WSGA 4DGIL 1LQBC 2BNQA 3GS0A 1KLFA 1CTMA 3G5YA 3U9PL 3ZDZF 3F84A 8PAZA 2E9GA 1LEKA 4G43A 4D8PA 4LPVA 2LU7A 4N8VG 4DGWC 5E9DA 2NX5B 3O4LD 2OMWA 3MSPA 2CLVB 1ZVSB 2EDLA 4FYTA 3BGAA 2W9DL 4IMLB 4MD4A 4N2OA 2EDTA 4AJYV 2DMGA 4XMKL 3UCRA 3NFSH 5C6WH 2FR4A 5J1AA 4OSUL 1I9EA 1W16A 1TQCB 1SOKA 1D5XB 4I8DA 4O02L 4XMTA 4YEEA 3GHEL 1U8PB 3SPJA 7FABL 1YVLA 1JWSA 2C9XA 4HIIA 4MXWH 1M7UA 1MEXH 3HR6A 2B1HH 3RL1B 4GG6E 3CN2A 2PPFA 1KBPA 4CSPA 3PWUA 2WTPA 3FU8A 3GSOA 4LKXA 1WBZA 4YHMH 4TMPA 2HT2D 1TQVA 4DEPB 5J13B 3BCDA 3GKWL 4P4RB 4P46B 1WRFA 1RVFH 3SCMD 1P4BL 5FO2A 3EFFA 5AW8B 3WUWA 1N70A 5GGSY 5B8CB 4ZQKA 4AT6A 1AGDA 4JQVC 4YE4H 4OZHF 2BOLA 3WY2A 1F90H 2FL5B 3CDFA 1JPSL 1AHWC 3WV0A 2VLJB 3NJGA 2QQLH 2AVFA 1KIUB 2F74B 2D9QB 3FONA 2BP8B 5KSAB 2VDQB 5IMKB 1OPGL 2AQSA 3H9HB 2BIQA 4WWNA 2OR9H 4GAYB 3PV6B 4M56A 3B7TA 1R0AH 4ZXBB 4UQ2A 3LD8B 4IJ3B 5CN2A 4WJKB 3TA3B 2ESVE 3ILQD 4XODA 3SDDD 1AANA 3DOHA 2QVFB 2H1LM 2P5EB 1T7YA 2NNXA 2JFCA 3WY3A 3NIDE 4YAQB 4UM9A 4K15A 4TLKA 4Q0XH 2VOTA 3PWLA 3IDMA 4EQ3A 1FFNB 2ZUVA 3B3IB 3L9EA 1P1ZA 2R1WB 4M1DH 4MAZA 2ED6A 3JVGC 3U0WL 2Y36H 4HU2A 2VWEC 1J10A 3ES6B 3LN5A 3RLSA 3VMPA 3TO4C 3X1FA 4JNXA 3OLDA 1P53A 1RH8A 3DVIA 3O6MH 4G70B 4J8RA 1UVQB 2XZQH 3SPCA 3EGSA 5AD0B 4RMSA 4CVXB 4YVNA 4AV0A 4PJ7E 5ICZA 3RX5A 5DS1A 1X4YA 2WIIA 4U49A 1WC7B 3T6ZA 4Y1AD 3MRMB 3PGDB 4ISVB 4IU2B 1G4RA 1MQKH 4FA8A 3K2KA 2EIZB 2QPDB 3FUIA 3QEGH 4Y1AB 1MJUH 4Z77B 7TAAA 1Y7MA 4OCWH 1D7DA 3FCTA 1A1MB 4WTXA 4F2ME 5I19L 2X40A 5IB3B 4D0DA 3MBEA 1SEBB 3S2AA 3CHPA 1XSJA 4AJ0A 3T6XA 3O2VL 2X3BA 3IE9A 4WK0B 5HSFA 5TGBA 5D1ZB 1XF4B 1PKOA 4QRFA 5TQ0L 4NN7C 5KVFH 3O8XA 3OB0K 3VFWB 2A77H 4G6ML 5E0QA 4ZMLA 1TSHA 1EMTH 5AZ2H 3BP5A 2WV3A 3AU0A 2DLGA 1U30A 1CYXA 4OZGB 2BNRD 2QLYA 4M7ZC 1L0QA 2AQRA 1NJ9A 2A9DA 3JBG7 1Q9WB 4G8GA 4I0KA 3PUCA 1J5IA 4U6VH 4ETYA 3V6OE 1IQDA 3QNXA 1G6RB 2WYHA 2HKFL 3VXQA 3K3QA 3KJ6L 4UNUA 5LGKA 3QUMA 3QIWA 4PW4A 2OMYA 3RUGB 1WV7T 1A6AB 5EF1A 4YHIB 5F9WB 5GGVY 3WHXA 1VPOH 3PHSA 3WCYA 3D4CA 3QRLA 2JLLA 3ZK0A 2DIEA 4HJTA 3VRLF 5AAMC 5DUML 1OQOA 3B2DC 1GW0A 3CZLA 4P23D 1RUQL 1AGFA 3EIFA 4N0FB 4JM4L 4Z8FH 5I0DA 2GIXA 3QZPA 3RBGA 3WNPA 2XKSA 2YPKA 1X7QA 3I6GB 3QIBB 3FN0H 3MRQA 3FQUB 5JOPE 3A0OA 1G7MB 3MJ9A 3U0TB 3OBAA 4JHVA 4W9DC 1QHOA 1A4CA 4FFZL 4ZX6A 3BQUD 2TSBA 4WI7A 1FUNA 1JL8A 5LN8A 3JWOL 3WNNA 1KTBA 3QZLA 2XXFA 1J12A 1XB3A 4KTGA 1TJGH 4HUNB 4OD2B 3GQFA 4HXAL 2ZP9A 3WKNA 3GI8L 4NHUB 4GBXC 4LARH 3FKUS 1G9NH 1ORQB 4QRTA 3GSQA 4DP2X 1EANA 3GIVB 1QQDB 3TEUA 3W3BA 2G4GA 4QHKJ 5A7BA 1AMYA 1X6LA 4M48H 1FCGA 3GLEA 3UC2A 4MDRA 1A7RL 3ZJAA 4A6YA 3OR6A 3LYRA 1XCQB 5GQBA 2HKAA 5CGYD 4F2EA 3IVKB 1QZNA 3C08L 3TCXA 4GO6B 3LKQB 4E5XB 3W5MA 4APQB 1Q72H 1GZPB 4I0PA 3T71A 3KPMA 2X4SA 4E5XA 1AI1L 4KO6A 2GKIA 4KK8C 3APCA 4UQIM 2XWRA 1TNNA 3BGFC 3BSGA 3D4YA 2N56A 4AE1A 2G2RA 4XPTL 1LO3H 3KPRD 1SLXA 3WMSA 4ETQA 2AJUH 2F5AL 4QRTB 4U05A 1B0WA 1DFBH 1PKQB 4NKOA 3QEUA 1MCWM 1E65A 2H5UA 2XKUA 2NNCA 5FIEA 5D6DC 4J5VA 2VO8A 4WWKA 1MELA 4LCUB 4OCSL 3RTLA 4FADA 4OD2A 4PJCB 5IJKA 3ZL1A 1WGVA 4XP9L 2H4EA 3D5OF 3D1MC 1RMFH 1PZBA 3Q8CA 3PNWA 1PTZA 1FSKB 3FOLB 4L1LA 3Q1EA 4YBQD 3FSWA 1K3IA 5LWYH 3FUFA 3NK4A 3TIDA 1KB9J 2J20A 1NL0L 3VXOA 1FLRH 1ZJAA 3HR5B 5A7EA 1X7QB 2NPLX 3I6GA 4MB3A 1O7VA 1ROCA 5HI5C 2LAGB 4F27A 4L8SA 3LKOA 4MCYA 3FSZA 2HFFA 3N43F 1OWWA 3KJ6H 3ME0B 4HV8B 2P48B 3K6IA 4I9WD 3A21A 4LLMA 4X8JA 4XPFH 4EIGB 3ULUL 2OL3H 1HE8A 1HKLL 4LE8A 3GKWH 4OR1A 5HJDA 1D5IH 3O6LH 1H3VA 4GKNA 3D08A 5KYWA 4XBMA 1ZLVH 1GW6A 1CGTA 1VADA 1JNHA 3BJLA 3ARTA 4B95C 3VXOB 1E8YA 5CR8A 4RWYL 5D1QB 3QIWB 1JZ2A 1OTSC 4MMYA 1IGJB 2R4RL 3NA9L 1HQRB 1BW8A 4JFDB 4CL7A 3WO3B 1MNNA 2YD0A 3HZKB 1G6RA 5A3IC 3BDBA 5HYQA 4UQCA 1EIBA 3D3VD 3Q6GH 2PCFB 5J6GB 4BKSC 3HC2A 5BO1L 3VXTB 3QJVB 4AKOA 2PMZA 2K4AA 2VW7A 2M2DA 1CT8A 4D0CA 2BS71 2IADB 2E9WA 3SDAB 1F4HA 5D1ZA 3SKJH 3BXNA 1MOEA 2ZNWA 3BD4A 4FJ6A 2YLKA 2G2RB 2NY0D 4X6FA 1AFVH 4N2NA 1KT2B 2IWFA 3DI2B 4IK7A 3BVDB 5DMIH 1FL3B 5F70A 5JLZA 4CVUA 1XGZA 3FCTB 4AVIA 3FRPG 4BGDA 1DP0A 1KGCD 3AG4B 4DK5A 4P2RB 3MO1B 4Z3JA 1A1OB 4IU2A 1FN4B 2F53B 4X6CB 5LG1A 5LKNA 2YPVH 1HT6A 3OR6B 5IBUG 4A6YB 2R1XB 4Z9KB 7PAZA 2OMVA 4FFZA 3UAFA 4DKFH 1WWWX 4KUCD 4JRXD 1FVEA 3VGAB 1D6VL 2AC0A 3U36B 3FMGH 2VSCA 4KVCH 1K6QL 1PW3A 2C3GA 4KHTL 5DUBB 3B34A 4X6BA 2I9LB 2FJFB 2YGPA 2YXMA 5IY5B 2EICA 1OQXA 2PYED 4MA1C 4XPTH 1CLZL 1IAIM 3MFFA 1BQLH 1QFWL 3MRHB 1OZTG 3FJTA 5JA8B 3DMMA 3S37H 5IB2A 4Y8DC 2V3FA 3IXTA 5GGRA 3U83A 3DMMB 1G7MA 1P1VA 5LBSL 1GPOH 4R4FL 8FABA 1OAXL 2XTJC 4XNUH 2OJZH 3WKML 4F3FA 4R9HA 4ELME 5A40E 5AOJA 2V9TA 3WO4B 3CLWA 4FFVD 2I9LA 4S1RL 4DVRL 1W8EA 2EDXA 5A2CA 3EJZC 3D25A 1N7MH 2A6KB 3A6BL 4X6CE 4WWKC 1PZCA 4QLWA 4DZBB 1Q8MA 5I5MA 5JYMA 2CRMA 2H47C 3PWVB 3L54A 4FMVA 5EA0L 1JNLH 3WIHA 5E1IA 1EJOH 2GFBB 3UTZB 1P2CB 4PCYA 3SGKA 2VDOH 4UAOB 3VXPA 3NH7H 1CLOL 5DXWA 5B7EA 2F53A 4OH2A 1V7NH 1WJ3A 2DS4A 3O8XC 1P6WA 1A7PL 3SE4A 3K71B 5FO8A 2OW7A 1KJ3H 4XP6L 4EI5B 3LQAL 3QDGB 3HMWH 4WV1C 4LOUC 4X4KA 3WS3B 5I6XB 4X4MA 5T1KA 4CMHC 3DUUA 4HUCA 5IQ9A 4DP8X 1EZVY 2V9RA 1TPXC 3U48A 1WDAA 3P40A 5DUMH 1BOYA 4C54A 1JYWA 3UPRA 2XG4B 2RIKA 1JVKA 4EQ2A 1IC5L 2WNGA 1T6VN 2P5EE 5M95B 1WYJA 3BP7A 5BOPA 3QXVA 4M6MH 5E8EB 2VM3A 3C5ZA 4JRYE 3D0LB 3GXPA 1ZHLA 3PY9A 4WAFA 5CD5D 2JQZA 2JJUA 4PGEA 3MBWB 3SBRA 2JXMB 4MNGB 5CM1A 2KI6A 2XG5A 1J8HB 2P24A 3HCVB 3OQRA 1EHXA 4OLWL 5JQHC 5JW3H 5HYEA 5TF0A 2K0RA 1WG3A 3FU7B 1FL5A 3OJDA 1MPAL 1IC4L 4J8RB 3FO1A 3OHMB 2O61B 2X89D 5EZLA 3BZ4B 5E9NA 3TV8A 1LHZA 1PIFA 2E27L 5K1NA 3CXHJ 1I8IA 4QF1B 5AFAA 3LKRB 5L0QB 3HHSB 1FIGL 1B0RA 3I75A 5LAXB 5IHZA 2LFEA 2NRDA 4R2GD 3A67L 4MX7B 3UL4A 4D9RD 4X5LA 4XXCA 3JUZA 5D7LA 3E6FB 3TTYA 1FIEA 1DBJL 4NZJA 1CD8A 2E4FA 1P7QD 1ROWA 4RFNB 4QTHB 4LDOB 1NMBL 6CGTA 3L16A 4OFYA 3NCJH 4AV5A 2JKWA 4JO5A 1JG9A 3EGDA 4LSDA 5E1HB 4CJ0A 3C6LB 5HHXH 3NPZB 1I4FA