5E1GA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t208
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 87
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5e1gA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5e1gA02
2HKLA 3VYPA 4A52A 3ZG4A 5LBGA 5DZJA 1ZATA 5DUJA 3ZGPA 3TX4A 3TURA 5DCCA 4A1IA 4QRBA 5K69A 2MTZA 4JMNA 4GSRA 3ZQDA 4A1JA 4JMXA 5DVPA 4A1KA 3VYNA 5E1GA 4ZFQA 5LB1A 4QRAA 4GSUA 5E5LA 3U1PA 4HUCA 4Z7AA 3VAEA 5D7HA 4XVOA 4GSQA 5E1IA 1Y7MA 3U1QA 5DC2A 5E51A 5DU7A 4LPQA 3VYOA 4QR7A 4HU2A 5DZPA 4QTFA 4K73A 4LZHA
chains in the Genus database with same CATH superfamily
1ZE3H 1NGYB 1I1AB 3MVSA 4MGXA 3ELQA 5DGQA 3ZRSA 5GGRY 3HCVB 3RGVC 2BNRB 4XOAA 1N64L 1F5WA 1DP0A 4OF6A 1SDDA 4ANVA 2MCAA 1RU9L 1T5KA 1A5FH 4F8QA 5GRJL 2OW7A 3RB7A 3K6IA 3UGEA 4MQ7A 3QZBA 2C7UB 1UZ8A 4UTBL 5IESH 2LLLA 3QJZA 3FSVA 5E2WL 3WHXB 4FTDA 3HMXH 1A6UH 2PR4H 1SN5A 4P5MA 5I6XB 4P57A 3MJ9A 1IT9L 1OW0A 4PLJD 1FFOB 2IIJA 3EBGA 1VZIA 5EIIG 5ERWB 1YEKH 4GKSA 7FABL 4PRAB 3FYIB 3TJEH 4LSUH 5EEYA 1V3MA 3RTQC 4L3EA 4S0TD 4JKPH 2GSGB 1KTDB 2W65A 3EJPA 3OKNA 3SQRA 3VG9B 2BZDA 2PPFA 4A7SA 4D8PB 3DROA 3P0GB 5DS8A 2DH3A 2P8MB 2CHWA 1VPOL 3DXAA 3FCBA 1A6WL 5EU6D 1P1ZA 4RH4A 1MVFA 5D93C 3QIUC 1HXMB 1KNOB 1Y7VA 3ELAT 1IU1A 2AVFA 4NFDA 1F3JA 1P7BA 3CSFA 5F89A 4IOIA 2CRYA 1J8RA 1BEXA 5A40E 2N56A 2XKSA 1QQDB 1RY7B 1W0VB 1Z0NA 1LEIB 1EZLA 2OMNA 5KSAA 4AIEA 4AUJA 1LO0H 4FG2A 3B9DA 4G7YH 5CP3H 3SDDA 4OZHA 3K8MA 2X10A 2PW1B 3I2CH 4OCXH 2QHRL 1JMXA 4P4KD 3O4OC 4WFED 5JOEA 4PJEB 3S36X 1U8CB 2W38A 4HXBL 1H0DB 4JGJA 3FOLB 5EF1A 2XJLA 4TYUA 5AOLA 4PRNB 1RVFL 3QFJA 3SPVB 4AV5A 1RMFL 4JM4L 2WK2A 2E75C 2CKBA 4R7DA 4M48H 2B59B 3B83A 5F9WB 5LGHH 4ZMNA 4R90H 3G6AB 4ZPTB 1A7OL 3S37H 3JVGC 2ZKHL 2YIHA 5KOMC 3AQZA 1R3KB 3JWOC 4FTVD 4G5ZL 5GXBB 4PBWD 1Z9SA 4M43L 4QHLB 5DRWA 2ITFA 1Z7JA 1IM9D 4E9QA 4EF3A 5GGQH 1OAZH 2NOYA 3PWJA 5BQDA 5HHQA 4K23L 5F2FA 3BCFA 2OX5B 1QEWA 1UM5H 2PWHA 2BHUA 2XZAH 5G4MA 3ZUCA 2OZ4L 2ZOLA 5I6PA 3S5ZA 2WV3A 5I8EA 1CF8L 1QPPA 1MI5A 4AC2A 4QRRD 4BHUI 5BXFB 1I3GH 4CNIA 1TYRA 1KYOK 1ZT1A 4DK3A 2G0KA 2H8PA 2E9GA 5C6WH 2KUTA 3RWGB 4YO0B 1KPUB 5IGXH 1GGUA 2OMUB 4IGBC 2HVBA 4Y2OB 2F1AA 4BZ1H 3SYAA 1UT1A 4F9LC 4J2XA 4UDTA 2H3XC 2X4PA 4IRSB 5L8KB 2D8KA 4OIIL 2UXVA 1F4HA 1DHKA 4NZ8A 1L0XA 5IBTL 3ZPDA 3EOAA 4U7KA 2NT0A 5DK2A 2X53A 4LVOB 3O0RH 4KHTH 4TVPD 3RX8A 2IG2H 2APBA 1HQRB 4OV5A 3KR3H 5FA4B 1E3XA 4E5XG 1ETJA 1X4XA 1CGSH 1RJYB 3L2LA 1RHFA 4NKDA 5E23A 1ZS2A 3BGAA 43C9B 1KNOA 3UEZA 3BMWA 3PV6B 5BVPL 3VGFA 1Y07A 1OM9A 2BFVH 3GKZA 1ZHLA 3S36L 5DUJA 3EJZC 4N2EA 3OJDB 4PTUA 5DZAA 5CR8A 3HLKA 2JCCA 1G4RA 3T3MB 3CE1A 3K6NA 1A1OA 4XVTL 3BXNB 3N43B 4LBEB 1RUQL 2NQDA 3CHPA 4ODBD 3LDBC 1IARB 1YUHA 1U36A 1BOGA 1KTLB 3NACH 4JGUA 4Z7WB 4DEPC 4DP8X 1EAOA 2ZNWA 1WT5A 2Y07H 1EO8H 3MLXL 1SXSA 1GSMA 2NX5A 3WHXA 3QCUL 3BWUF 2AERT 3GB7B 4WWKD 2EXTA 1YYLH 5JORA 3N0PB 3HLAB 2A4EA 5JHLH 3NABL 1ZOXA 3WN6A 5GHWL 4OAWA 4DO4A 2G9HA 3ASNB 4JQIA 5AB2A 4ZAKC 2YGPA 1L9MA 2ZJSH 4FQCL 5IB1A 1X5GA 3EGSA 5MP6H 3W11C 3OLIA 5KYYB 1JDDA 2WSDA 3DX6B 4WDIB 1XGRB 1BYPA 2EUZA 3GGWA 5I1DA 3D34A 4FFVC 1WT5C 5HGDB 4UF7C 3VQ2C 4DAGH 4AG4L 4YDIL 1OCZB 3P77B 4Y2NA 1V5JA 2RBLA 2YAHA 1MFCL 1TTUA 5J9PA 3SDCC 3EGXA 3BD5A 1P9MC 3RGVB 3BZ5A 4M62L 1DBAL 1CFSA 1OEZW 2ICWJ 3IRPX 4BXVA 3H85A 4GW5A 5LG6A 2DQUL 5MI0B 3F2LA 4PJGB 4C56D 5F7EL 2VLRA 3AGWA 3C5SB 3ZKND 5LHDA 2Z92B 4JB9L 4EVNA 4I1PA 1G7PA 5EZIH 4LE8A 1UC6A 1SMAA 4KJPC 5E6IA 8FABB 2WCSA 1E4XL 4ZTOL 3NIGE 1S7SB 4UTBA 5I16B 5HHOE 1JGUL 4QRPD 3VXUD 3STZA 2NY4C 3RIFK 3ZHNA 1QVOA 4PRPA 5MENA 4XPTL 3VXNA 5FO7A 1WC7A 4ZJ9A 4LCWE 2J20A 1NFDF 1JL8A 1DSFL 4XNAA 2YD8A 5BS0E 4ICWA 3QIWD 1AH1A 2NY7L 5IJVB 4HQQH 3DO7B 4TOYH 3F7QA 4A6YA 2MTAA 4I3GA 4LHQB 3HC4H 3WNLA 4OLXL 3CVHH 2X89D 1IAOA 3LXBA 4FZ8L 2Q2LA 4UAHA 5HGAB 3EOTH 3GRWA 3IFOB 3U0WH 4L4VD 4LRNH 1QHOA 3FULA 1WH0A 1IKFL 2Y5EA 1KIRA 4O51A 2N4IA 3FO1B 2XY1A 4WQOA 5D7JC 3T0EB 1INDL 1KWKA 2LABA 1MFVA 3GFUA 3CWGA 2VLME 4KJWC 3DIDA 4DGYH 4GSRA 4HUUB 5FYKD 2QSTA 3OZ9L 3LVTA 3N55A 1DQIA 2FBJH 3V6OC 4HIHA 3TURA 5D7IA 2AJYH 4OLWL 3D25A 5CSGA 3W2DH 4PGEA 4EZLA 1AC0A 1CLCA 4BK8A 2J12B 4Y2DB 1U8MA 5DYOB 5DVMA 5IW6B 4EMZA 4HMDA 3V6BR 4EIBA 1WWAX 2HT2C 1ECYA 4K8RC 5GRVK 5IB5A 3G5VA 3TFBA 3TJEL 5BUPA 2VRQA 1OP5H 2MPVA 2R9HC 1TCRA 2LR4A 1QLRA 1CICC 2CO4A 4EXKA 3C2AH 4MKMA 4OZFA 2X4NB 4OLUH 4LCWA 4PJ6A 2OW6A 4L4VE 2XA8H 5F7AA 3NSJA 3ZKQD 5K1JA 5GRWA 2PO6A 3ZKSD 1YEFL 3QIUB 4R4BA 3U46B 4NKOA 1Z3RA 3Q8FA 3ULUF 2WQ8A 1THAA 2H7WA 4K4KA 4U1MB 4Y5VA 1KGIA 1D7CA 4AJ0A 5CXPA 4F8TA 1HEZA 4AC4A 2RHEA 3RWCB 2I25N 1Q72H 1YEEH 2BDNL 1KXQE 2D3JA 2ZAIA 1PKQE 2FWOA 3OKYA 4FNQA 4IGBA 4OU3A 3ZYJA 4YZFF 3P40A 1BG9A 5K9JH 3VD4A 1IGML 3QXAB 3MUZ1 4MA7H 1KTBA 2YD1A 3TN0A 1F11A 4OBSA 4IJTA 4C58B 4NKOB 4G1EA 4KRPC 4TNWK 3VGHA 2HJFA 4PY8I 4NUMA 4QF1A 4ADGA 2ZXDA 2DQDL 5AUMB 3O0RL 1S5HB 2OSLA 2VLLA 2ZCLL 1TKWB 3HRZB 3NEEA 4HGMA 4G9FB 1I8AA 5AW1B 4MJHA 1OPGL 3GI9H 1MJ8H 5KN5A 1UVQA 4JFFD 1SZNA 3L3JA 3H6JA 5TGBB 4GRWH 2A9DA 4C57C 4L1DA 4NC0B 4D7PA 3QIBB 3HC3L 1XX9C 3TBCA 2QGEA 3JV0A 3LOWA 5K9QG 1PZ2A 1NCUA 1I1CA 3JSSA 3QP3A 4LF3A 5T1DH 2CBMA 4K7PL 3QRGL 1JVLA 1CF1A 1KLFB 4HK3N 2Z8WC 2RB8A 3H8NA 4YSAA 3P3UA 5FXCH 5D7IB 4TNVF 1P53A 4WSGA 5KG9B 4X9GA 3OR7B 4ENEC 5IKCA 3BSZH 3BPOB 3RA7L 4PJ9D 3KXFD 1MAJA 1R3IH 4NC1C 2FBJL 3GXNA 4HJUA 2CJ3A 1WA2X 3ULVH 1XH3B 4K71B 4TM9A 4Z7UA 2GTQA 3VFRA 2ZXCA 4WEMB 5CLTA 3V4PA 1IL1B 3OKKB 4PIRF 5EUOB 25C8L 3OQRA 4AJYV 2H1PH 1MUJA 1SYVB 3BEVB 3VNYA 3T8MA 4PGCA 3IVKA 2FEJA 1QRKA 4JHWH 3OVUB 15C8H 3F58H 2P80D 3N50A 2J1WA 3MV8B 4EDXA 4HWEH 1ZPLA 1MCKA 3PQYE 5C0IA 3RJQB 3TFKC 2IJ0C 4R26H 4L3CB 5KVMC 4DJMA 1FN4B 3SKNB 1S7XA 1KIQA 4HUWA 4JDVB 4PJHE 2IGLA 3SY0B 3QCVL 2G5UA 5FIEA 1BW8A 1TXKA 1ZVSA 1NSNL 1PG7L 4HSQA 4NQDB 5D6DC 2JFCA 1T83C 4UQIM 4WHCA 4XNQB 1CL7L 1OF2A 3BKYH 3HC0A 3M88A 4EQ3A 2CXKA 1WDAA 5TTRA 1UCBH 4EVNB 1URIA 4ZTPH 1RK0B 5CEYB 3NSXA 3GEWB 1X5XA 3P30L 3OXRB 1SOSA 4A7GF 3O3AA 4F2ME 5J11B 3VG0L 2HTKC 1SGKA 2RQ8A 4HUXB 3CSYA 2NY5C 2XFXA 4FA6A 5J9PB 3SDAD 4QXGH 4B53A 3QFGA 5JIQA 1S7TB 1KB5L 1RHHB 1S9XB 4JJ5A 4NIKB 3ES6B 4H8VA 3KYOB 1TTRA 1OCOB 1EH9A 4MYPA 1IVLA 1G6RB 4KO7A 3NT0A 1N6QH 4XE0A 1FVCB 3D0LB 4G8AC 4H1LH 3ILQC 5JZ7D 1PZUB 3L9RB 4AQAB 4FXLA 1TU2B 3PP3K 3GJEA 5F7MC 2NQCA 1PDKA 3FHAA 2VQUA 2ERJB 4CC4C 3T4YB 1YMMB 3W82A 1QTSA 2XTLA 5I28A 3I9GL 1VFMA 3QQ4B 4WF7A 3BUQA 2HVJA 1ID5I 4IOFD 3V9FA 1XAKA 5I17A 3ME0B 1KPRA 4DAGL 1FPTH 1LWRA 5JR1L 1KXVC 5SX5K 5FDWA 1JV2A 3NTCL 3IMSA 4HW6A 4AGNA 2YD7A 2OP4L 1EZSA 3X14B 4QNPE 1HNGA 3HB3B 4X5QA 4KKBC 4YHYC 3L3GA 2DQHL 4HGWB 5CLWA 3MHZA 3KW8A 1DBJL 3N40F 4MRCA 4NQXA 1IM3D 4OT1H 5I0ZA 4NAJA 2F68X 1HCZA 4M9PA 4NPJA 5GZNC 1I9IL 5AWNL 1N2RA 3ZL4L 4PGDB 4Y9CA 1GC1C 4RQQB 2DPKA 4XBEH 1A47A 3SCMB 4KWUA 1CGTA 4WEUD 4J3OG 3ZTJG 1P4IH 4HJ1A 1QFOA 3E6FB 4OJEH 4FJYA 1NUDA 2BHZA 2XU9A 4G82A 1RJYA 4TULH 3F85A 3WY4A 5FA4A 3ZTNL 4Y4HD 1BX2B 3EF4A 1TMQA 5JW4N 2IALA 5I5RA 1QFUH 1PG7H 3TO2B 1Q9WA 2JQAA 5F1SA 3REVB 1C5CH 4KC3B 2BX5A 1A3ZA 1ES0A 2PN5A 5JO5B 3JZ7A 4PJ8C 1U3JA 4JDTH 4AM0B 1LWHA 3LRLA 1BBDL 1CDYA 3B2MA 3NYKA 2V2WA 2WAQA 3C6LA 3SDYL 4QXTB 1R5WA 4K3JL 2EEFA 1K4DA 4DKAA 4CMMA 3APDA 5KSBF 3CMGA 1MEXH 2C3XA 2Z7WA 3QFJD 4WI0B 4YO0A 3DSNA 3O3BB 4GO6B 4J39A 3VFMB 4HPHA 3MO1B 4JL1A 1WVZA 5IVNA 1KWGA 3N9GH 3SE9L 5I8EB 3H9HA 5IOKA 3GMRB 3OLEA 4OSUH 2JSFA 5CEXB 3MROA 3VYNA 2X4OB 3F7LA 1H3PL 1EXHA 3IJYA 2PYED 3WLBB 3KPLB 1BQSA 2YRLA 2AV7B 4WKZB 2HX9A 1QNZH 5CHNA 2I24N 3UH8A 2Y1YA 2K78A 4WNSA 3B9KB 5FFOA 5CO1A 1AGFA 2HG5B 1BZ7A 5DUBB 2QQLL 4FFZL 5KYXB 1S7RA 3MCKB 3TBTB 3VO0A 1ZWIA 4NQSA 4UZSA 1HEJC 4N8VG 2FD6L 4M6OL 5FUOH 2OMVB 5D5ME 1JGVH 4Z7UF 4OCYL 3O4LD 1JNNH 1EX0A 1CDBA 2OSYA 3F7VA 5DJAB 1QR1A 1U8CA 5FC9A 3VFTB 5TE4L 3TO4B 1S9VB 1AY1H 3I02A 4KJQD 4OZIA 5I74C 5HGHA 2DQTH 3F83A 4XAWL 4AYGA 4NUJA 3TVMD 4MFHA 3PV7A 5AW5B 4G71B 5E2UL 5DHYA 5TPWL 2JJSC 4U1LA 2DQ6A 2J21A 3JQOB 3ARFB 1YY8A 1QFUL 2LAAA 2H0PA 2NNCA 2WLYA 3DTXB 4ZAKB 3TIEA 4ZAKA 1M6UA 3FO2B 1EJFA 5LWYH 2FH6A 2EE3A 1B0RA 3MCLL 1F3JB 3VQ1C 4UV4L 3V4PL 1MJUH 1VENA 3POHA 3U9PH 4S1RL 1FP5A 3TIDB 1AFVL 4ACPA 3TTSA 2FEDC 5GGSY 3QDGB 5FGBC 2VRAA 3LNEA 3K71B 5D6CA 3U0PA 1JZDC 4L9DA 2JXMA 1K2DB 2KPNA 3CVIL 1B88A 1OARL 4JKWA 4C4KT 3OKNB 4V2CB 3PQYA 4HYTB 3HS0C 12E8H 4NUGH 3ZGIA 3WGUB 1XTMA 2CUMA 3QJOA 1RERA 4LESA 4Z7QE 3HN3A 4WHYG 4JM0A 4ANWA 2XWEA 5AD0A 4JR9L 4A1IA 1YYLL 1I85C 2IANB 3LRGA 4IOSA 4TSBH 5DD5L 4XNYH 3APFA 2P28B 3HG1A 3RDJA 2E4TA 3VD0A 2ORBL 1RFDL 5L2KE 2WZ6A 3SDCB 1PBYA 1TQVA 2NT1A 4Y7OC 4AKOA 4YQXL 2F5AL 4I5BB 1KB5A 3HMWH 4W4OC 1KT2B 4OH2A 1A2YA 2HRHA 4Z7OE 3DLQR 1CFMA 4DTGH 3CZJA 4WI0A 1N5AA 2P3YA 2BNRA 1E4WL 4X6FB 2GC4C 2C3WA 2Q87A 1IAIM 3HCVA 1OAQH 4PRIA 3RFZB 3WUZA 2Z31A 1GSKA 4FXTA 3E3QC 4M5YH 4GB9A 2BOCA 3LN9A 3IFNH 5EEVA 1RSFA 2DQCH 1EQWA 3BGFB 4V2BA 1E9PB 4WHDA 4DGIL 1FVEA 3K1KC 2BSSB 2EH8H 3K2KA 4N0FA 5CCGE 5IV2A 5EEUA 3B37A 3VSVA 4JRYA 1BQHG 4PHZA 1BD2E 2WQAA 2HKFL 2ENSA 3WL9B 3FFCB 4XN9A 1THCA 4F7KA 1E6OL 2QZQA 1PG7W 3N5AA 4FZEL 5C08E 1CJYA 1NKOA 2BSSA 3ZDYE 5IV2B 1Y6KR 2J88L 1QSVA 2QEJA 3NCXA 5DUPL 3RTQD 3BX7C 1I3RB 1OP4A 1DVTA 1R47A 4H5SB 4IKNA 2JJVA 3SGKA 5EBMA 2YQGA 1Z9OA 4ZUVB 3I6KA 5KYUB 1QI4A 3MV11 2QGCA 4LHJB 3SCMA 2BVYA 4GEIA 4UM9A 1ZTXH 5T1KD 2RH0A 1J8SA 1MF2H 1K8IB 3QJRB 4XPHL 3HAEA 3VI4E 3EKCA 3LV3A 3BP5B 5T1LD 1GC1L 3QYCA 3TV3L 1ZT4A 2C9SA 5F96L 2OMZA 3R06B 4PWGA 1AANA 4OJCA 1OAXL 4LRIC 4PJHB 3MJ7B 3ME0A 5BV7H 1CFBA 2QDWA 1R0AH 1H15A 1A25A 2NUPA 5E6UB 4LXFA 4PY8J 4GI8A 4LP5A 4YOKA 2QVIA 1B0WA 1W0WB 2C8NA 4R4ND 5D7EA 3MFFB 4LVOC 3QRLA 1R3LB 2Q3XA 4NBXB 1WFTA 5DHDA 1MRCL 2E6PA 4Z0BH 4AQAA 5CBAA 3VXSD 4P2OB 3FFOA 3I6LD 2OZ4H 4JRYE 5HVHB 1FG9C 5AOKA 1PD6A 2ORBH 1TETH 3NZ8B 3K71A 2AK4D 3S7GA 3MRMA 4DGVL 1TTAA 3T3ME 1EEQA 5EU4B 2YK1H 5I23A 4M8QB 1ODAA 3O9WB 3BP7B 3WUWB 3CVCA 3SD2A 1U93A 4C8XA 3L48A 4KI1A 4BE5A 1U8LB 3BAIA 4PCSA 1KYDA 1O7SA 4Z7OF 3PWNA 4GMSH 3T6QC 1KEGL 4UQ9A 3STLA 4LSSH 3OXRA 3HTLX 4AZ8A 1U8QA 4X5XB 2YN3A 2Y36H 2MNUA 1AHMA 1F58L 1JBJA 2VN3A 3ZDWA 2BLFA 4OCWH 2WXRA 3RTQA 5L2KA 3L3DA 1ZD6A 2EYTB 3O6FD 3WV0A 3UMTA 4E9TA 1S9KC 1IC0A 1UCBL 3NJMA 3VFTA 3O81A 1OE3A 1D5ZB 2VN6A 4N0YH 1N9PA 5JIDA 4K5OA 4HC1L 3FQXB 4L3CA 2OMVA 2WLHA 3MJ8A 5EUKA 4AKPA 3RVVD 5HHVH 4NO2A 1LQSR 4P2YA 2JCCF 1F4AA 4ZSOB 1QG3A 1V3KA 1NCWL 3TBWB 2CGRH 1DL7H 2ZPKL 2NZ9D 3HE7D 3JVFC 4Q9RL 4CSPA 1NC2D 4ZZKA 1AKPA 1IUZA 1HX0A 1Q9KB 3AY4C 2ZUUA 3EHBB 1E4JA 3OKKA 2MCPL 5CR1A 5E4AA 5ISZB 1K72A 2Z0UA 5EO9B 3UBHA 1IBZA 1O7VA 4O9HL 3BKMH 3PAYA 4HF5L 3VFMA 3ZDXF 4L8CA 1LWJA 2XG5A 4G6KL 3RX5A 2W07B 1R0AL 2NR6D 1D6EB 3CH8A 2I07B 2ZWSA 3AQXA 4HKBB 4L29B 2AQPA 5F7NC 1EUUA 1JVKA 3AREA 2VDRL 1KB9K 3D2TA 1XH1A 4B5ZA 4HJ0C 2VDLH 3SODB 1NBVL 3CAFA 3KPRA 2GUOB 4I13B 4RVBA 1CU4L 3REVA 4YL9A 1F2XK 2VZSA 3BD3A 4PP2B 4ZYKA 1H5BA 1MN4A 3TH2T 4M3HA 2WZ0A 5E1GA 3EYFB 1MW2A 1RUAL 2P43B 2HX7A 3CFDA 3NOIA 4K9EL 5DDHB 1FSKB 4XNDA 1QSFE 5BZWB 3ILPA 4MAUL 4U1SA 5IB2A 4FLQA 3LN5A 4W9GC 5IHLB 1L0PA 1KFGA 4KVPA 4NQCB 2F8XC 4OI8A 3ZUNC 3CZFB 1TTBA 2ARJA 1C1EL 2ENJA 3I84A 1MXDA 3JUYA 4PV1C 2VC2H 1IC7L 3HAEG 1EFQA 1KN4H 2EDHA 3GHBH 4ONFL 4X6CE 3Q5OA 5J8OA 1KBKA 3BVUA 1DVSA 1XGUB 2RR3A 4CVWA 4DZBA 4G7YL 4YZFE 3HHMA 3L3GB 4PU2A 4DP1X 4ZMYA 2BVQB 4IRJD 4WCYH 4XPBH 3ROOA 2FEEL 3B6SB 4QTHB 1XCXA 2DLFH 1CIUA 4UYPA 1KPRB 5DQDH 1SXAA 2WQXA 1AKJA 1AI1L 4LCIH 3WN5A 1B3JA 4OFDA 1AAJA 4NDMA 1JZ7A 2C9RA 4PSPA 2A7BA 4JM2F 3GWJA 4UT7H 2VKXA 4LCWB 2GJZB 4UT6L 1Q0YL 4GIOA 3UERA 5B39B 1WV7T 2CO2A 4WNQB 2LGNA 5E9DA 3DV4A 3V95A 1FL5B 4XPAH 2X4UA 3FU7A 4ERSH 1FVCA 2EACA 3AABA 1UOKA 2H41A 1DQLH 5I82A 1PS3A 3D25B 3VMNA 1BVLA 4HF5H 3U36B 3GMOA 4LQFH 1S7TA 4JFXA 3UBXA 4IU2B 2AJUH 1J1OL 1KGCE 4HUXA 3MLXH 3GTTA 5EZOL 2EE0A 2E86A 2G2NA 5F96H 5AB9A 3RL2B 4ODHL 3LKPA 3BIAX 4G6AC 4B96A 3GXTA 4WENB 4L0PB 4WTZG 2IXQB 1DUZA 5D1QA 4NQQA 5EZPA 2VJ0A 3JWDH 4Z78B 2I7SA 2V17H 4YMPA 3MN8A 5HGAA 3KPSE 2R2HB 5IB3A 4BQ9A 4LSQH 1NMBL 3QDAA 4GS7B 2Q76B 1YEIH 4DUXA 1FC2D 2AEQH 2XN9E 4ONFH 5H4ZA 3BYTA 5FKPA 5HGGS 1TG8A 4XCFL 2YGVA 3RVWC 4FQIH 3MV8A 1AD9B 1FFTB 3VXNB 4AOFA 4K94L 4CKVX 2W60B 1RZKC 5KAQG 1QZNA 2P5PA 4IBLT 2P8LB 4XX5A 2QADC 3NA9L 4UV7H 5EZIL 1UWEH 15C8L 1IBHA 1OAJA 2R2HA 3P3RA 4XMTA 3GSNH 4D8OA 1N4XL 2OJZH 2WWOA 1JGLL 3QFJE 1AJ7H 5DJZA 4NNYB 1DVFB 1ETZB 4LSSL 1AHKA 3FJTA 4N8VA 4UYQA 4GKLA 1JGUH 5BRQA 5IHHA 2ZCKL 3X1GA 2R4SH 2QADB 4UB0H 4H8WH 5FK9B 1RJLB 3QXWA 2A9MH 5IFJB 4PJIA 4I88A 4FQXB 3CHOA 2E76C 5EWIH 4FFYH 3QJHA 4JZOB 5KG9A 2P5WB 1OSPH 1X7QA 3CFNA 3RWIB 1K4CA 4UINH 1RFDH 5D70H 1KCSL 4JN1L 4TTDC 2WWMC 4GS7C 4YGAB 1XF2B 1NUGA 1TOXA 1BD2D 2GJ6B 1I3GL 4NO0A 1ET5A 2DLHA 2ICES 2R0KL 4YEFA 1BFVL 4WNQA 5F6HI 2NW3A 1U3HB 1VADA 1IT9H 1M6OA 5CJ8A 4PLOB 4N90E 5AVSB 4A39A 4FG0A 4ELMA 3EHBD 5DURD 3B7TA 4HBCL 4LPXA 2DYSB 5MHSD 5A3ID 4PS7A 4MDRA 4POZD 1T1XA 1AZVA 3O6LL 1JV5B 3ROOB 1WHOA 1YUHB 2ZZUT 3P1VA 2GBAA 3HS0B 3QXAA 1KDIA 4LHUA 4MAYD 4YDJB 4ZUSA 4KK9D 5D7JB 3CFEB 4G6JL 5GGRA 1G43A 3CX2A 4QRUA 1SJHA 2B0SL 4JFTA 2O5YL 3DDGA 4K8RD 2NNRA 4JDZA 1AHWC 3PV6A 2EEBA 5GZNA 5IMLA 1E67A 1ZS8A 1AGEA 3O6FB 1XSOA 2PXYD 3V5KB 1A6VL 3LS5L 1C5DB 2KBGA 4J3OF 4NKDB 5DJCB 2D4DA 3THMH 5K9JL 3PWPB 4FL4B 5IROD 5T3XH 4EOWH 2RCSL 2MFNA 2GVYA 4TNVK 4NWTL 3D50A 4F27A 4L37A 2YD0A 1J1XL 4TTGA 4MDJB 2GJ6E 4ZUWB 3G5VB 4NI3A 5IVXE 1GTNA 3MOAL 3SZ6A 1RZQA 4QRSB 3UXFA 3VXRE 1YQVL 1FRGH 5AKVA 4P3CL 2WD0A 2WXKA 4FJ6A 4FQCH 4RMQA 3EO1B 3N0AA 4Y2OA 3C6SB 1U8KA 4JY4A 1T20B 1MIML 2AXJA 2Q8BL 3VXSB 3VU2A 2EZ0D 5SWZE 1F90H 4TNWF 4WTZA 1PJ9A 2J8UB 5JPMC 2EDYA 2VT0A 1YSOA 3DO4A 1F2QA 4APQB 1FZOA 2OK0L 1GXEA 3X1NA 1KIRB 2COVD 4O51B 3FKUS 1QEWB 1OTSC 4UT6A 2NMSA 2EECA 3SYOA 3PWJB 2Y25A 2MOVA 1DLHA 1RZ8B 2VLKA 4GP5B 2AV1B 1IZJA 2IQ9H 3D85D 1M3IA 4JG0H 4KHXL 1KYAA 2P46B 1JNHB 3OKLA 4JFEB 2CK0L 1S8DB 4MB4A 5AYQA 1UWFA 1IC4L 4Y8AA 2J25A 2IPKB 4YHLH 5KBNC 3UOAB 2R39A 5AYUL 4JHAL 3LDBB 2WVSA 4WWID 5MEPB 1MVYA 1NJ9A 1EFXA 5JXAL 1PX4A 3ULVC 5IREA 5HHNB 2WVVA 1BM3L 3CH1A 2CO6B 3CPLB 1GMIA 5FCSH 5JA8B 3UC0H 4P49A 4MAUH 4S2SA 3H54A 5IW3A 4YHOH 1CXIA 3PNRB 3CZGA 3IDJA 3QXVA 3WNOA 2HKLA 5D9SA 4HIIB 1AZBA 1C5BL 1NCDH 1XF5A 5E6IB 4H40A 3RTQB 2QPDB 3VM5A 4KMLB 3CXDL 2YKLL 2JB6A 4M4RB 1I1YA 2GIYA 5HDBE 4G83A 3D2UD 3BVTA 3I2CL 3GTNA 1U8QB 1F1GA 3FO9B 2WXLA 3U6XS 4GW5B 2WO3B 3IDXL 4TNGA 4LCCC 4HWEL 5J6HA 1G5GA 5IJCC 5DLMH 3RGVA 4PLKD 1TYJA 3OC8A 3S0PA 4HIJA 3CFTA 4A1RA 1HQ4A 2CUHA 1OHZA 1LILA 3SKMB 3B3IB 4A04A 1OV8A 2V7HA 2XICA 3WKYA 4AE1A 3DX6A 1AMYA 2LQRA 4G6MH 5IHZB 5AZEL 2W9EH 1JPSL 3CFKB 4K3EH 2J73A 3MKKA 3QJUB 4L4TA 4P2OA 4P99A 4YHZH 4ATTA 1NIFA 4CBPA 3KJ4C 1JNLH 5DQ9A 5DEJA 4CN6A 3J27A 2BP5M 2AK1L 5DVLA 1KIPA 3LMJL 1U9KA 3UCQA 3P11H 4UTBH 2IDTA 5IESL 3S35X 5JHLL 2XNAB 5LNDA 4P57B 2DIJA 5BO1L 3GPEA 1DQLL 2IAND 2ERJC 4ZI8A 4HEPA 2WM0A 2X88A 1EO8L 3X13A 5MP6L 2ZCHH 4WFFE 1YPZB 4O02H 4PJFE 2W0PA 4RDQG 4P2QA 4NKMA 3GSRB 1AD0B 2D31B 4YXHL 5EWIL 5GRYA 5E94A 3NABH 2JJUA 3D3VD 2EEAA 4GG8A 1ID2A 3MBXH 3BLPX 4PG2C 5E08H 1J5OL 3KLKA 4Z95L 1QLFB 3QZOA 4XNUL 3MI6A 5FYLD 4HKZB 3RVUC 2R0ZL 1DBKL 1C5BH 2CHXA 3H0TA 1NAKL 3SYQA 2VDKH 3BGMB 1R24B 4OJDH 5D96B 3P0VH 4JZJB 5J3HC 1QFWH 1X44A 2IGFH 5IJKC 1OGAA 4ZBJA 2X6VA 5B1KA 2DF3A 4ZAKD 5CN3A 5ESAB 1YEGL 2Z91B 4HV8B 1ZK9A 2VDKB 1R6VA 1TTFA 3AG3B 4Y4FA 2XZCL 2UX6A 2F7QA 2KZKA 1E9PA 5EC2B 1EEYA 4KDWA 4LMQI 1NGZA 2BY0A 2Y06L 4IBYA 4MNQB 4FFTA 2X4PB 4IRSA 4ORZC 3OJMB 3C75A 1U58A 3GI8L 4PLJC 1MAML 4PS4H 1NFKA 1T22A 3PXLA 5DD1L 3DOIA 2P47B 1Y18A 5D4QA 2PTUA 4HVBA 2F7RA 4PS3A 4B41A 4L0ZA 2H8PB 2BCMA 2E8ZA 4HG4J 3MRJA 4JX0A 1EXGA 4ZOCA 1MI5B 5BXFA 5FW6A 1BFSA 3QUMB 4NQCE 4OZHF 4PBDA 3B9KD 3OKOB 5DZNA 2DMBA 3G5ZA 3LQZB 1YNTB 5I1CL 4OUUA 2EC9T 2HT3C 5DRWB 2WXPA 4FDWA 1B0IA 3BSZL 1YCSA 3GBDA 4G6KH 1G5AA 3HZYA 4HIXL 5DT1L 3EO9L 3CZKA 1ZANL 2Y5QA 4NRYA 4X7CC 3MNMA 1TJIL 2B8OT 3HPLA 1S2EA 4XHJD 2YFOA 5EZLA 4R7DB 5I6XC 3UTTA 3CGTA 4GI6A 5DD3L 3E80A 2VOTA 3CK0L 2Y9RT 3QFJB 5D55A 3ZO9A 5HP5A 3U0PB 3R1GL 2QSCH 2EIZB 4LCVA 1K3ZA 4XN7A 4PJEA 5HHOB 4F3FA 2WHVA 1C16A 2X4QA 4I2XE 5HYJA 4L1BA 2IC2A 4AQEA 4WI3A 4M7JL 1EVUA 2ZG1A 4XVJH 3T1FB 4JO1L 4QI3A 1XL6A 1JN6A 1YNKH 3DMMC 4R7XA 4DZ8A 2B14A 1GW0A 3FL7A 2Q3AA 4RBPH 3IKKA 3OKDA 4LZHA 1RK1A 2I9TB 3WDHA 4AYFB 3NVQA 5DHYB 5JYLA 5F7WC 3WFDH 4NUJB 2QHRH 1AIFB 4A2HA 5I9QB 1P6FA 3HZKB 4W6WB 4Z7VF 1S9VA 4HLJA 2VQ4A 2KLTA 1SEQH 1VRSA 3OAYK 1KBPA 5E70A 4Z7WE 4XMKL 1HS6A 4G8GD 3C08L 3LKSB 5ESQA 4UNTA 3UYRH 4FC3E 1M42A 4LKXB 1JPTL 5C07A 3VFPA 3K3QA 5KEZA 5KW9H 2AJ3A 5D2LE 1BZ7B 1A9BB 4M5ZL 5L8JB 1M2VA 3GKWH 4FLHA 5KBPA 1BWMA 4U49A 3IDYC 1A02N 4JFUA 1RP8A 1VJSA 4RSVA 5D1XE 3KPLA 4F5CA 2GJPA 2VJ8A 4HJGB 1HXYA 4MAZA 5DYFA 3MBWB 3Q3GA 1EWHA 5HGBA 1GRWA 4G80B 4X8JB 5TF1L 3U4EB 2HJKA 1YMMD 2WXFA 2XIIA 1HCYA 4Q97A 1LO5A 3IGFA 4CUCA 3CVIH 4JFPA 2GIMA 2ZYIA 1QABA 2R7EA 3DGDA 3GHEH 4WFHE 2YPLB 1EIBA 4M9OA 5FB8A 3BVVA 1W72H 2GYSA 1J5DA 4W6YB 1SHWA 3P0YL 4HDIA 5CU9A 5E2WH 4ZO8A 5J11C 1QBLL 2GTZA 3WCYA 1LP9A 4M93B 1NCJA 4BQBA 3VFGL 1K6QL 5DJDB 2VDOB 2OL3L 3FYEB 4P23C 4LLAA 4PY7B 3NAAL 1YY9D 5TK4A 3V5HA 3N41B 2ESVE 4NBZB 4TULL 1GA2A 4IRSC 1PZ5B 2BIIA 4P05A 1MCPH 5LCVL 1JF1B 2X1WL 4JO8A 4KAQH 4NNXB 3PCYA 5FYLH 1M7IA 1JPFB 4NRXA 2NY7H 4LASH 2SODB 5TE4H 5K9KA 4WSJA 1O5DT 4M61A 3IDYB 1G7HA 3ESNA 1HILA 4NQDD 2Y7QA 5CZRA 4IOFC 4GUQA 4NB7A 2FRGP 1OCWH 3BUDA 3M1OA 5ITBH 1FG2A 3JT0A 4X8CA 5TQ0L 3ZZ1A 1QNIA 1SBSH 4BQ8A 5LN8A 3TEZA 3Q8CA 2YD2A 2OSWA 1QASA 4EUPH 1P1VA 2JI1A 4JDEA 1E5ZA 1KV3A 4DF9A 4NNPH 3MYJB 2JK5A 3ESPA 3P4MA 1Z5LB 4FGMA 4KNUA 4I7ZC 1OT1A 4FLOA 4O58L 3C9NB 3U30C 1UB5A 5CUSH 1YMHB 3WENA 1ND0B 2JKSA 3QG6B 1NGPL 4NZRH 2YPLE 3VFWB 1PAMA 4W9JC 2PCPA 4R96B 3VWKD 4K8RH 3OBAA 5AZEH 1CE6B 2EO9A 1JWSB 1MHPH 1N6QL 3JWNG 5EZOH 1QI5A 1KCSH 3JWNE 4PJ9B 4GSQA 2QVMA 5MERA 1FNSH 3NH7L 3REWB 3WJLA 4F2MB 2XZQH 4KVCL 3O2DA 3FPXA 3ARQA 4QYOA 3FH8A 1EAPB 2CBTA 1AZRA 1RUPL 4J1UB 4XO9A 4OW6A 4WW2B 2YKKA 4LLYA 3AU1A 4Z3HA 1R5IB 5CZVH 3KM1A 1PMYA 5JPMA 2M1KA 3ZKXB 1G87A 1ADQA 3RDTC 4JY5L 4H20L 3GM8A 5C97A 1NBYA 4FQXC 4HWBL 3FT1A 1VSCA 1A9EA 1LO3H 1UXMA 3ZMEA 1DQDL 1MCDA 3AS3A 4G9FD 5FYJL 1QFWM 3W0WA 1L9NA 1MCNA 4AL8L 3S36H 1LE9A 3ARGD 1T5XB 1W72A 4XOBA 4WIQA 1O0VA 1JZEA 4ISVA 4ZD3H 4BCXA 4JM2C 1IAIH 3ZGPA 4XVTH 3UAJA 2VL5A 4WAFA 4YR6A 5I6NA 4MDIA 3BW9B 4BK5C 3OV6A 3PHOA 3HHSA 2Y2WA 2QJDA 4WI9A 3SJVA 4X5WB 4PD4K 4Z7NB 4OJYA 1KEGH 3ARGB 3CFCL 1MW1A 3PU7A 3L3OA 4M1CD 4PJHF 3LKRB 1HL8A 2K45A 4GXUN 4IJ3B 5DWUL 2KERA 4EO5A 4M6AA 1Q9OB 1E4KA 2J1KA 2G0LA 1TT6A 3SDXF 3ZJAA 4UNIA 1JI2A 4F5CE 2XQYG 1KELH 4DWHA 1NM9A 3EJSA 1SFHA 3AQYA 3FB5A 1PLGL 4X9IA 4Z7UE 3UJTL 1ASOA 5BVJA 4UZUA 3NGBC 1YN6A 2E7LA 3ESOA 3K2MC 4RAVA 3PREA 1UD8A 5ID0A 5DVPA 1NCAL 2J8OA 3NCBB 3HZVA 4PJAB 1XD1A 4L9LB 4PV9B 5EF3A 3ASOB 1Q94A 4WFGD 1FGVL 1CD9B 1Q90A 3JXAA 4U3CA 5HI5C 5KUKA 2UYLA 3W2DL 1OB1B 4R5XA 4X4ZA 3RAJH 1IQWL 1CT8B 4KRPB 3TZVA 4UNVA 5E51A 2DJSA 5INCA 1GJIA 2FB4H 4YHKL 1DANT 2BS8A 4RIRA 2XWBA 4A7GA 4J3OC 4OSUL 3PXHA 4CSZA 2IV9A 4JM2B 5DMJB 2DD8L 5C0ND 5EC1A 4LU5L 1J9SA 4L0YA 3ILDA 4GAYA 1OT2A 2ZOOA 1QZ1A 1FH5L 4MSWB 4GAJL 4TKWA 4HP5A 4FJZA 1EHLH 3HNSL 2YC1A 4AQ8C 4ICXA 5EBLA 2GY7B 2O5ZH 5IFHH 2VM9A 4OM0L 5KSUB 1OCRB 3AB0C 1UWYA 4MJJA 4BELD 3Q48A 2PPAA 2KQNA 3STBA 1KCUH 1OB0A 4PGBA 1JZ2A 4JPWL 4X6DA 3MZGB 1P6AB 3K6DA 3UTQA 2FSDA 5F9WC 4DT2A 1N0LB 3WNNA 1YEGH 3N6YA 3RYMA 1B2WL 3SPJA 1J18A 2AABH 3RDTB 4XMPL 1C1EH 4AK1A 4WCYL 1PLBA 1E5UI 5I2IB 2EVHA 4ZFQA 3SDXE 2OTWA 5HDQL 1MRDH 4PJ9C 1I31A 4LVHB 5FM4A 5IVOA 1DBML 3E7JA 2FL5A 2YLHA 3CHQA 2CJTA 5DEZA 2W0KA 3IDIB 4KROC 1L9SA 4KH2A 5C7XL 4YNYB 3KLHC 1H6TA 3QQNA 4KZEL 4QHKI 4HULB 1V54B 4X7DC 3KPRE 4Y4KA 3UTPD 4L3EE 4X4XB 3UTSB 1WICA 3VI4A 3D33A 1NPUA 3LS4H 5C2BH 2BOBB 5J1SC 2DTSA 3A6OA 5HYEA 4LAJH 2UZIL 4KXBA 1EHAA 4F20A 2D0HA 3WN5C 3P9MB 1JAEA 3MRIA 5ENWA 4JS7A 3TC9A 4P2QE 3K1DA 5J1TC 2VM3A 1T4WA 4W9FC 3G5YA 1M1XA 3SZKC 1NEZB 4XXWA 2A73A 3UTSD 2WUCH 3O45B 1ZXKA 4NNPL 2VABA 1WIUA 1KXQA 4NUGL 4NM8H 4YK4B 2G2RB 3RY4A 2CUAA 1PCXA 2VO8A 5J12C 5IBLD 2XQBL 3S3DB 1OP9A 3TEYA 1DBBL 2H26A 1DJGA 1BZQK 5IQNA 1P2CB 3DDFA 5G55A 1D5IL 1IB5A 4QT5A 4GYBA 3EBHA 3H3PH 4G8GB 3WE1A 3SOBL 1Y6MR 1UM6L 2VSKB 3DV6B 2DS4A 1LK3L 3BZFB 2R23B 4L2YA 5DR5L 4L8BA 1FNHA 1YEHL 2Y4SA 4PRPE 3RDTD 5ICZB 1R5VB 3KYMA 3CHSA 2AFNA 3QUZC 4LP4A 1E4XH 1A4JA 3CVBA 4ZTOH 2VQ1B 5ANMA 5JDSA 2WUBH 2MCG1 1S7SA 5I16A 4KVNL 2ICWB 4D7BA 3EYSL 3HJ0A 1DLFH 3KR3L 1PFCA 1XCTA 3IYLW 2XVKA 4MJ6B 3C8HA 1B0GB 1NDGB 4LSQL 4I48A 5I1EL 2Z92A 1UJ3C 2GTWA 3BQUA 1H6FA 1KJVB 1UM4H 1FE8L 2MWCA 3BH9A 1E5BA 3IF1B 3GMQA 2MTPA 5HHOD 1FBIL 5D7KE 2G5BB 4U0RB 4DKFH 2H3NB 4PJBE 3K4AA 5D7IF 5J12B 1JTOA 2B15A 4Q4EA 4AL8C 4NP4L 2WYTA 1HSAA 4K2UL 1KEMH 2IDQA 4FQJH 4IRSD 5DK0A 3JV5A 5EOQH 4N4YB 3ZN6A 4EAEA 2JTDA 1WD8A 4GBXC 4KRPD 4PW4A 5CINH 5DZ9A 4ELMF 1P4BL 4BD4A 3F5WA 4E36A 1Q0YH 1WAPA 4R0LB 2ZF9A 1GGYA 4J7RA 2GEQA 3HUJB 1UXSA 3T4AC 1MQ8A 1A7RL 1KJ2A 1W8NA 4FI7A 1ZRUA 2Y24A 3QIWC 2Y07L 4GPVA 2EDFA 2EEXA 4MWFB 1A7PL 1RZKL 3OHXC 1LNUA 3UYRL 3SPGA 1T03H 2IAAC 3SDYH 1GPOH 4L8SA 1MI5D 3QDMB 1RIHH 4N1EA 2EE2A 4K7PH 1VCBC 3VJ6B 1PZAA 1P4LA 1XR9B 3TL5A 4BZ2A 3E6HB 5G5DB 3II2A 2BS71 3FUNA 2OM5A 1FHNA 2I7OA 2PCFA 4MB3A 1FNGA 4XR8C 5BZXA 2OMXB 4XAKD 4D94A 5JQ6L 1E28B 2DQIH 5SX5H 2A4CA 3U6XA 4MNQD 5E7FA 1V7NL 1I75A 1YN7B 4IK6A 2ENPA 3B43A 1KLGB 2BSBA 2Z65C 4P5TA 1J0YA 1EMTL 4M6ML 1TJGH 3ZO0A 4AEFA 3VW3H 1FA4A 3KBFA 3S37X 4AW7A 5TD4A 1LE5B 3MREB 1MJUL 2VLKE 3N1FC 2QTVA 1OCWL 3HB3C 2EABA 3B56A 5FYLE 1HZKA 1ONQB 2B1OA 1IAKA 2Z1PA 4K7FB 4N2FA 4MMYA 5F9JB 1R3JB 5CKGA 1RULH 1AMXA 4FQLL 1KPVA 4TUOA 5E8PB 3ZDZE 1T6BX 3VFGH 4B9YA 1T04B 1BAFH 1YVLA 3O6FC 2ZXQA 4KQ3H 3W38A 3LZFL 2F1BA 3LY6A 3QG7H 3NPSB 1BEYH 2BC4A 5D1ZA 5E8NA 4U6YA 3EAKA 5C0CA 4MXVE 3WTXA 1BOYA 2VDNB 2CCVA 3B7UX 2X42A 1E2VA 4QMEA 4X5LA 1CXFA 4BYHA 2PLTA 1V7MH 1ZVHA 1DVFC 5ID1A 3V0IA 4XWGL 3WJMA 2ZSVB 3NJLA 2B1HH 5C0BE 1UJ3B 5BW7A 3IFPA 3ZDYB 5SWQB 1GYWA 1WFIA 3IPEA 3L6FA 4LIQE 32C2B 1TNMA 5DGRA 1QSZA 3U79A 3VWKB 5CCKH 2XY2A 5L2JB 4FABH 4TUJB 5F1NA 1W15A 4JFFE 2VXSH 2JCWA 1URZA 3TT1L 3BD4A 3MUHL 4H26A 5ILTL 1EDYA 1UD3A 5KTEH 5H37G 2YXMA 4BCZA 5MEOB 4FLRA 3N85H 4XOEA 4LCUA 5BJTB 4POUB 2DWYA 2WBXA 3GNML 2YGOA 3X12B 3ZE1E 1J0ZA 3AADB 3PDOA 1GZQA 2BNRD 3WXVH 1QUNB 2CO3A 3LRKA 1XFPA 3SE4C 5AG9A 4XVSH 4LP8A 1ZGLM 2F74A 4OZHE 1G1OA 1AQKH 1UJTA 2IH9A 1NGQH 2X9XA 5BZDB 3D0VB 5K9OB 4RZKA 3D48R 4FFVD 4O2EB 4U6VH 3FB8B 3WFCL 3DX9A 4E41A 2NNAB 4YC2C 2K6YA 4BWUA 5E6ID 1IO4C 3VW3L 3TBVB 3M17B 2Y6TE 3WMSA 4BM7A 1E9QA 4URTB 2WZPA 5FECB 2PP7A 2K7QA 2CPCA 2DBLL 4O2CA 2EXYC 3BHBA 1RLBA 1VIWA 2APXA 2IOIA 3EJTA 3GSUB 5HHNA 1XHHA 2IDCA 3NN8A 4M56A 3O11A 2YQ3A 3PRZA 1AQMA 2J4WL 1P1ZB 3G6JB 2GCYA 2VSMB 2EAEA 3A4FA 3BPOC 4JFOA 4NENA 3GZKA 1IGIH 4WFHD 1NGXB 2MIZA 2Z4QA 5DZLA 2DV6A 3QWRA 4NYLA 5AAMC 4KFMA 3PWLA 2YPLD 4JFED 1NOLA 2R1WA 3D85B 1R9FA 4A7UA 4AWJC 4HZLA 5FO2A 4HS3A 3TPUA 1YO4A 2MKWA 3DUHA 2LAGB 3TCXA 3UJJH 5KVGH 1F4WL 1SJEA 3K81A 2UY6B 4JO3L 3QH3A 4J23A 2CD0A 2E4FA 4Y5YC 2WKLA 3L81A 4LLVA 8CGTA 1D2OA 3FU8A 4P5SA 2UXFA 1Z66A 4OZGE 3MXWH 2J57A 3KYKL 1DDHB 3PIQA 2TRYA 2E9BA 4XPAL 5C0EA 4NXSA 2GG1A 3LHPL 3PABA 4E42A 1MEXL 3WOVA 2H5UA 5BQ7B 3S3CB 3KPQA 1ML0A 3FBQA 4K3EL 1K9TA 5JOPD 2R56H 1SDDB 1JCVA 4KXAA 4FP8H 3IETA 2XQYA 4Q6KA 1S7UA 2JJSA 1A0QL 3RWFB 4UU9B 4JHVA 5AKTA 2BRQA 2DQGH 5GJSL 3ZHFA 3ZGHA 2FX7H 3VWJA 4BA0A 1FJ1A 3E9TA 2VN4A 4NAMA 5AKRA 5IHUL 1VFUA 3PDGA 3DXAE 1NWOA 4AI7A 2HT4C 4Q9QL 4WRLA 2YEZA 1R46A 4ZX6A 3AG4B 4U6TA 4GFXA 3WFBL 1PY9A 4AGPA 3W3BA 4U6VL 5GSRB 4RGNE 3F64A 2VL4A 1JZIA 4HS6B 4CILA 2X6MA 3PDDA 5I5IA 3CQFA 4YHOL 5A2AA 1BF8A 5FUCC 3VFUA 5I74B 5E6SB 3MODH 4H0LC 4APXA 5B3SB 5E6YA 3H4HA 1HI6B 3O4LE 4MAYB 1MFDH 5FWQA 1T0NA 3B7YA 2W88A 1DJWA 3G08B 3NGBB 4XNMA 3CC1A 2QKIC 4WV1A 4MNGE 3OL2A 4UIKL 5F9DC 2YPKB 4JN2B 3QRBA 1E42A 2R2BB 3SE6A 4B0MM 1CBVH 3JWDC 1YAIA 1NWPA 3D69A 4KUCF 4A1JA 1I1FB 3QI9B 5FCUL 2I9LA 1U42A 2BO0A 1HIML 1S7VB 4KFZC 1YNTF 3OAWA 1B4RA 1I9JH 1NC2A 4AT6A 4F33B 3EFOA 4JVWA 1Q0XL 2K9UA 4HWBA 2JVUA 5DQJA 4CVXB 2A9BA 2FSEB 4H2AA 3NFSH 4HIEB 1BD2B 4OQ1A 4XH2A 2K1MA 3LEVL 3R7QA 3NCYS 4F93B 1OARH 3WJJC 4NPYB 5F3HB 1F3DJ 3GBNL 5A7EA 4DPCX 1E9OB 1AHWB 3ARWA 4O58H 5GS0L 1P7QB 1SF5A 3M1BA 4XP1L 5GISL 2VDLB 1WJ3A 3ABMB 4HKJB 4Y16C 3F04A 5E8DL 4ZFFA 1HSBA 2B39A 5DO2D 4B9IA 4ZSOE 5C7ZA 3OAUH 2G30A 2ED8A 2QADD 4FXGA 5HVHC 1E8XA 2DEXX 2X2YA 4XMXA 5HVGB 4JFDA 4CL7A 3QEHB 4POYA 1DVFD 3ULVD 1IGMH 3DC0A 4LCYA 4DW2L 4KBPA 4PREA 2EKSB 5G4NA 2NY5H 3CDGA 3RFRA 2UZYB 3JV4A 4GRLA 2D7MA 5CJ5A 1MJ7L 2B2XH 3BKJL 9CGTA 3FUDA 4RLDA 4PJ5A 1DN0B 1OAUL 2ZX9A 5A1AA 1MCPL 1FZKB 1SHMA 3MX0B 4Y89A 1NBZB 2QPSA 4CN1A 5EN2B 2E0PA 4I9WD 2ZOUA 3NJNA 1S3RA 3MRGB 4NO5A 4QO1A 2WXIA 4P2AA 4Y5YA 1EJOL 4YHIA 3QGVA 1SLWA 2XN9D 3ABKB 4JANA 4LNRA 5D7SL 1HINH 5F7DB 1G1YA 1X7SA 4OFIA 3QQ9C 4AMKL 2IOOA 1RIUL 1KC5H 3ZTEA 4GUPB 1HIMH 3J07A 4DVBB 1WAAF 5TDNB 1F1AA 4AENB 3FCSB 2DQJH 3BO8A 3EO0B 3JV6A 4DQOL 1FAIL 3FCGA 4N0CC 5ADOL 5JNYA 4YSDA 5IQOA 3B7SA 4UOW1 4OZFG 1M05A 3ZR5A 5GS1B 2F1EA 1EXUA 1F6LL 4JK0D 1JS4A 4XTRD 1ZGLA 4C56E 5GJTL 3LYRA 2H6PA 3DRTB 3RIAF 4UIMA 1I4FB 2HN7A 25C8H 2XVGA 5CN1A 3QPKA 4RDQF 4IQHA 4WW1B 4Y5XC 4YPJA 4CVUA 4X7TA 2JJTC 3SY6A 3QA3B 3AUWB 3K8LA 4RFNC 3CX5K 4X80L 4XWOD 5EU3A 3UYPA 2HUEA 3QUXA 2Y6SD 1CLYL 3UBXG 3U9UA 1PLGH 1TZAA 4PN6A 2WSKA 3UJTH 2OCFD 4AH2B 5A2IH 4LLUB 1LK2B 2RIKA 1VGKB 5EPMA 4RX4A 2OL3B 1E4KC 3FTZA 2WZAA 3GS0A 3RFZC 3QWNA 1X9QA 4KK6D 1L9OA 1RU9H 4NZTH 5L6YH 1VESA 2EDBA 3B1UA 5DTFA 2P24A 3T65A 4PJ8A 2K8QA 1XCWA 4ZXBA 5C0JB 3VM7A 3TT3H 4MAYC 2B2XL 3BKJH 3L7EA 5IBUB 3QFDA 4ZQTA 2DYRB 3DUSA 4PCTA 1NCHA 4XPFL 2O5XL 1HOCB 3PAVA 1NANH 1SLXA 5EIVA 4N6RB 3ZL4H 5J89A 1J5IA 1BZ8A 1GGCH 4YBLB 5INDA 1JWUB 2XJKA 2X05A 4G3YH 3T4AB 2AQQA 1SJVA 3ETTA 2Z35B 4BA8A 1RQ5A 4PJ7B 5ALBL 2YRPA 1KBVA 3RKPA 3WNIA 2BNQA 1DQQB 5C08B 5B8CC 4NQCD 1NIAA 5JIPA 4G43B 5LQBL 4QOKE 4I2XB 1G7LB 1IGCL 2VZ3A 2DMHA 3ARDA 2FJGA 1KJ3L 4YN3A 2D0FA 3I50H 2WWMD 3WTUA 5EOCH 2KS0A 2QFPA 5TFSH 4TSCH 1N70A 1E2ZA 3GMPA 5T3ZH 5E6RB 4IRZA 4L4VA 2GABA 2BVUA 3KCPA 3VMPA 3HG2A 1I9EA 3B5GA 4XB7A 4APQD 1ZT7B 2WLZA 1OLLA 2GI7A 2YJLA 4J4PD 5CP7A 3BSGA 4YLCA 5JW5A 4ABWA 5I30L 2VE6B 4A6YL 4NFBA 5C0BA 4KK6C 1JNLL 4MZIA 5C9JB 2AKRA 3O6ML 5T8IA 5I73B 4UANA 1AQDB 2YJQA 1MI5E 5E4IA 2X3AA 2QVTA 4CU8A 1ETA1 3B8YA 5ISZD 3IMRA 2YQBA 1MDAA 5I19L 5LN4A 1D9KA 1G0DA 1SM3L 3CUPB 5FKAB 4M48L 5LGHL 5DJ8A 2E7MA 5I73C 1CFNB 1ANUA 2TAAA 4MQXD 4P2CG 3WY1A 3TCLA 5GGVY 1GOHA 3WFZA 5I8CB 5C0FB 2NDFA 4Y5VC 4JFYB 4PJCB 4HUVA 2F8OA 2FQGA 5DVOA 3S34L 2VC2L 2PXYB 4XMLH 1QTYT 4JKLA 4RMVA 5HVWA 5EO0B 2GSIA 2HWZL 4F37K 3IDNA 1MREL 4LARH 4N3TA 4U1NB 3IMUA 3LZQA 4DPRA 3VA6A 1E40A 3RBGA 2O5ZL 5IFHL 3II1A 4IMLA 2AXFB 1E3ZA 3WD5L 1NAKH 3FT3B 3FUEA 3QCVH 4K94H 2XWTB 5DMKB 2VMFA 4Y5XB 3IRZA 3QFDB 2R1XA 3C8KA 1XWVA 5D7HA 3MV01 4D9RD 2K4AA 1XF3A 3H53A 3HN8A 4NS0A 5IM7B 2DY2A 2Y72A 5A2KH 3HNVL 2E9JA 5DURB 4FZEH 1HE8A 1ZTXE 3CZLA 4O2FB 2FDBP 4QTIL 5HHPB 3VCLA 4RRPG 2HZHA 3HZMA 3PGFL 4IDLA 4D9LH 1JPGA 2HA1A 2XRAH 2XWCA 2XWJA 4X7SL 3TXAA 3X17A 5ADPH 3GSNB 3Q01A 2FIKB 4ELKA 4DN3H 5IVXF 2WKOF 1T4KB 4BZ2L 1NLDL 4R4NC 1XEUA 4FQQB 4AITA 1RZFL 5C2UB 2AK4B 1LD9A 2ZOWA 3EHBC 4PRHE 4FHJA 3Q2WA 5E8EA 5F6HJ 3QA3A 2AQRA 3QS2A 4M7KL 1A7PH 1RZKH 4JZNA 1JK8A 4JQXA 3FHEA 5HJGA 4LDLB 5K1VA 5ICYA 2PO6C 3BUYA 3LIUA 4QRQB 5E7BA 2L7QA 5EO1A 4JPIB 2P5WD 3BAKA 1KCBA 3BAXA 3MA9L 4QHMA 3FRPG 4MMZC 2DMCA 4MX7A 4C83A 3IJ9A 4W9LC 4PJCF 4ZW3A 3SO3B 4WHYH 3N1QC 2EYRB 4FQ2L 4HSCX 1JP5A 4NZDA 1KEML 5DMGD 2YUVA 4TUKH 2YXWA 2ICEA 3AAZA 3KPOB 2JQZA 3AJ7A 4LK4A 4M5TA 1N26A 3GSVA 3N44B 3BPLB 2Q7YA 4LARL 4YAQB 4QRPA 4Z18A 3VXUA 2V4LA 4KTYA 5T3ZD 4NQTA 2CRMA 2IWFA 4UTAL 4QAWA 5T1KB 3RUGB 5IMKB 5DRXA 1OW0C 2DICA 4W81A 5HDBB 2BH0A 1I8MA 1A66A 2ISDA 4R7NB 2BY1A 3T0DA 1P7KA 3GSXA 3E1ZA 4Q8BA 3HA0A 4K3GA 1SHXA 2NY5L 4PJ5B 3QISA 5SV3A 3FQTB 5FYJU 5B1AB 1INQA 4H1LA 2VLJA 3HRPA 4GAAA 3FT2A 1KGWA 3MRLB 5EOTA 5LO7A 1J12A 1NCBL 4MQTB 3FRPA 3WKQA 1KJ2L 4H25A 2XIDA 3FQYA 4AYDC 4OIAA 3GBMH 2XKUA 3SGDH 2M83A 2N0MA 5CM1A 1CE1H 1CLOL 1H3VA 3W39A 2COQA 1Y6NR 2V7NB 4A63A 1LJMA 4HK0A 3LIZH 3MACH 4S1QH 4HKJA 3UBFA 4P9HL 1IRAY 4KKLC 4BKTC 3VD1A 3IMBA 2FNWA 3MR9B 3B9VA 1A7QL 4B0MB 1PGRB 5IWLA 4YXLH 3VSTA 3TYFB 1QHQA 1PKQB 1BLNB 1NDMB 4FKHA 2GEEA 4R3SA 5E6IC 3V6FB 1D5MA 1SOKA 4HCRH 2NZ9C 3HE7C 2WKGA 4N24A 3SDCD 3NCFB 1J48A 2Q8BH 4WHTA 3DX8A 2VITA 2A74A 4HIEA 1RAMA 2WYZA 3F7YB 1WP6A 1JMZA 2CPUA 1IAII 3D9AL 3EH3B 5DQJB 2OZNA 3QC6X 3EW3B 1OWWA 1NCGA 4OLYL 3KYKH 5F1KC 4UIKH 2A74C 4YSOA 2IV8A 4WWOA 1BVKA 2XXGA 4QLRA 3LS4L 5C2BL 3AT0A 1AGBB 1FYTB 3L95A 4O4YH 1PF3A 1XGYH 5DEGB 2I5YH 3FTWA 3AU0A 4HWUA 3TS8A 4GSDL 4IRJB 1UA7A 3ECBA 5DR5H 3RL1A 3X1EA 4MMXB 5CP3A 5EU6A 1HI6A 4FMKA 5HY9B 1IM3A 2K0RA 3N3EA 4ZW6A 4K3HA 5FLUA 4QRFA 3VFUB 4MYWB 4JQIH 2MCMA 3ZLQC 2VERA 1NMAL 4GG6A 5DO8A 1I8IA 3EF7A 4MA3A 1IV8A 3DIFB 2Y06H 5L4IA 2ZX6A 2VDKL 3MCG1 4XMUA 1AOZA 1ORSB 3VD2A 2EXWC 2FUTA 4ZD3L 3VDAA 5C1MB 2H2PD 2X1QA 1HJCA 4AEHH 1CD1A 2OA9A 3C5JB 4BGDA 3ZT6A 4XX1E 3MLSL 2D7TH 3FONA 1MCCA 2P52A 1G7JA 3MAWA 3WTSA 2JE8A 3VRJA 5CLZA 2JIXA 1J11A 5T33H 3O4LB 3EZ8A 3AXHA 1IC5H 2HVKA 2R1YA 2GFBA 1F4XH 4NLHA 3V0AC 3H9SD 4LOUD 2D7OA 4BHUA 4M4PA 5BQ7A 4ZO6A 5CFAA 4MXWL 4KZDL 2FECL 3VFSB 1RZIA 4I0CC 3KWWB 3L3OC 3DX7B 5DT1H 1A7QH 4RRPM 2BZCA 1J9RA 4EJ1C 2BY2A 4P5KB 4UINL 2JKRM 2UWEE 3QI9D 2Z8RA 5TE6L 4XNYL 5T5NF 1JVOA 4ZG1A 4DFHA 3O41B 4BRVA 4HZLB 4F57L 1XAUA 3RUGE 3HE7B 5D1XD 2Y1ZA 3WIHH 3S98A 4PJDA 1INEL 4QXUL 5I1AA 1C08A 5J06A 2R51A 3CZEA 1A6TA 4OD2B 3G6JA 5IEHB 3MV7E 4E9YA 3OSKA 1D5RA 4OLZH 5DHVA 2P49B 2FBRA 3VRLE 3BLKA 4DKDC 3DPDA 5FFGA 5IB3B 1SY6H 1TTCA 4G9FE 4FXKC 3QIBC 4UCFA 4AY0A 1LEKB 2YO3A 4ZMXA 2BNQE 4OI7A 3V7AE 1M1SA 5L4FA 1QKZH 4MJ5B 3U1SL 5FDYA 3C5ZA 3FK3A 2VZ1A 4Y4HB 5IK3A 1A8JH 4DCQA 1BYOA 1I9RL 1CN4A 4F7TB 5HYSB 2I27N 2Q6WA 2DQCL 1ZVNA 4QWWC 1G7QA 4KKLD 1AZNA 4QHNA 4BKLB 2PW2A 5C09A 3IBOA 5D96C 3WAKA 3OGCB 2BM3A 2D03H 3WKNA 5HDBF 3MV9B 3K74B 1E6JH 5DZOA 1IM3B 1LMIA 2X40A 3NZSA 4TSAL 3DBXA 4JKNA 4Y19A 4LCUB 1NAML 3HB3D 4YC2B 2BCKA 5DJYB 1CFVL 3CFBA 5CEZE 4HFUH 2BP3A 1SOXA 3QNZA 4X4YA 2G60H 3RNQA 1S7WB 1F42A 2WPGA 3AG2B 2G75B 3LNDA 2KDGA 1TPXC 4CMHC 5EB9A 2DIAA 4KKCC 3SGJA 1TJHL 1MFDL 1YPZF 5GJTH 2LLGA 1A6AB 1JPTH 3DWTA 1GZPA 1CLOH 1S78C 1YEJH 4KPHL 1HVXA 2WIIB 4X9HA 4LVHC 4LAQH 4JW3A 2QSQA 2HTKD 1PKQA 3CTTA 1X5MA 4AK2A 3BRDA 2WY3B 1K5NA 3CCHB 3GUTA 4GY4A 3QUKA 4OTXL 3VH8B 4YX2L 1ORQB 2AEIT 2JNZA 2BP8A 3DI2B 4P23A 3SDAB 1GY2A 3EOYG 2B9BA 4X6CB 2PYFA 1XQ4A 3N06B 3BT2H 4K07A 3U1SH 4RFOH 4YDMA 1BWWA 1SXBA 5C70A 4XC1H 1KPVB 3DX2A 5KVFH 3B2DC 4OZFH 3D08A 4DCQB 4EUPB 1YNKL 3LPPA 3Q2LA 1RV6X 1T5WB 3VRLF 4Z7VA 5J1AA 3FRPB 1UD2A 1KXTA 3H7BA 1GGCL 1KUMA 4JO2L 4OCWL 5BOPA 1IIKA 3MRLA 1SF3A 3VXTB 4S11A 4H1LB 3NIGB 2VR4A 5C0AA 4B9JA 4RAUA 2CIIB 4X98A 2Z6FA 3B2PA 1I8LA 3AACA 1WFNA 3FT4B 3NZHL 3WXVL 3A4EA 1R3HB 5GZOA 1LQBC 1A6TB 4OI9A 3SO5A 4FQHB 1J9TA 3L9YA 1E5AA 3Q8AA 3ULUD 1M7XA 5I18L 2EXWD 2B0SH 1UWXK 1UUNA 5DD6B 3U7WL 3LCYA 3X3FL 3SKJH 5BUGA 1FF5A 3IJ7A 3P73B 5HSFA 1D7FA 2PXYC 3Q6FB 1PFOA 1SVCP 4X8GA 1WRFA 5GS3A 4FG4A 5FOJA 3QDMA 3KDMB 5I1CH 1MG3C 3VI3B 2NDGA 4JVUA 3WNMA 43CAA 1SQ2N 3UPRA 4IKJA 3K0YA 4LSVH 4DFIA 2HUHA 3M46A 4CKQA 5KSBA 3EO9H 2R29H 3CX5J 5LGJB 2JI2A 2ILLA 4DO5A 2MJWA 3KXFB 2HLAB 2JTYA 4HU8A 3R8QA 4RISL 3RWHA 4NZUH 4Z7NE 4UQ2A 1I9JL 3TP4A 4FXKB 1XCQB 1AO7B 2DEYX 4QRQA 5E1QA 2Y69B 2BVOB 4IJ3C 5TF0A 3BWAA 4K55A 2J7LA 2PF6A 4DGYL 2VXQL 5IG7A 4KNQA 2DQJL 3IB4A 4W9IC 1NCNA 1IJNA 2OQJA 1YQ2A 3B2VL 4JAMA 3MJ9H 1WISA 1KXHA 3MLZH 4W4NA 4C54A 1RZ7L 2JJWA 2G5BA 3QDGD 1BA9A 1EPFA 4ZRGA 1T4KA 2HRGA 4EBQH 1HKLH 3FW6A 4XOCA 1ILSA 3EBAA 5DU7A 1BXVA 2GAZB 3GXMA 4YHML 3ARBA 3VXOB 1ZLWH 2A6JA 3TBYA 4X9FA 1HHKB 4D2NA 4F7MA 3QARA 2QPEB 1W8OA 4O2FA 1TF4A 3P4NA 3VCLB 5I1IH 5JHBA 4TTDD 4YPGB 3IMTA 4KTEL 4I18A 1WHPA 1H8LA 4PRBB 1ET7A 5JHDB 3M86A 4MA3B 4BFJA 3BEWB 1JGLH 1NCBH 3MNWB 4L8DA 1NM4A 3VTTA 2AANA 4JE0A 3TVMB 4ZXBC 3QO0A 3MLRH 3RZCA 4CRPA 1QR4A 1WS7A 1DZ0A 3P0VL 4H20H 4KI5F 3NIFE 3OWRA 3BRFA 2QGBA 3WFEH 5EF0A 5GJSH 4F7PB 4I0PA 2R15A 4OF5A 3KXFE 4N28A 4DP5X 5JXAH 1O9WA 4FNUA 4NQVB 3CSTA 1KTCA 2NTFA 5IVXA 1EDQA 1BZ9A 4ODXA 1J0HA 1I3VA 1LK3H 1CZ8H 1FYTA 3OPZL 5E0QA 3V6ZB 1P2CA 4LNVA 3QDMD 1XSIA 1DDTA 3RJOA 2F8IA 4ZNEA 5KS9A 2DLGA 2C4XA 3DA0A 4HK3J 1HZHH 2J3SA 5K39A 2PKDA 4WI4A 2LE9A 3ISWA 3TFKD 1S4IA 3CD4A 2VABB 2IGTA 5JA9A 3ZZLA 2ADJB 4TMPA 2H32A 1ZDSA 4RBPK 1W6LA 2J8UF 4HU2A 2XZZA 1AQDA 3V6FA 1BLNA 4K73A 3NUKA 1F4WH 3MNZB 2QLYA 2OXGB 5GGTL 1FC1A 1U8JB 3BN3B 5ACZB 1IQWH 1HXKA 3VI4B 1X5HA 4PJXB 1ZIBA 2FATL 2J6EA 3DYOA 3G5WA 3FHQA 3GIVA 3C2SA 4X4KA 2OMYB 4Z3IA 5JHMA 3OF6A 2FO4A 1UCTA 4DSYA 3QDJE 4B7LA 3PFUA 1E27A 1YYML 4I85A 3INUL 2CHZA 4JFWA 4L4VB 2A83B 1HHIA 2VR9A 1OSYA 3DTUB 4KI5D 5H8DA 4QLWA 3FUIA 3IKCB 1PW3A 2IFFL 4PJ8D 1IQDA 2FJGB 2PYEA 3LS5H 4U6HB 4ALAC 3BP6B 3X3GH 2ITCB 1HHHA 1MRDL 4I77L 1AC6A 4JPWH 4JO1H 7CGTA 1BZDA 3MV7A 2BY3A 1MCQA 4BFIB 2IDSA 1AOHA 4NZJA 3OG6B 5DRXB 3K2IA 3B7RL 4XBGB 2K70A 3NP4A 5T1KA 5E2JA 3S9DB 1AY1L 2OTUA 2P26A 3DTDA 4YX2H 3G9AB 4PJDE 4QRPB 2FUQA 4J6RL 3VYOA 3VXUB 4G6AD 4LGSB 1SMOA 1MXGA 3S48A 2FT8A 2ADIA 5F88B 1SVBA 4WTQA 3QQ9D 1CC3A 4A7VA 4Y16A 4RSYA 1GCFA 1Q1JL 4Q6IA 1PIGA 5HPMA 1DQTA 3DVFA 3TF7C 1I7RA 2X87A 4MSWA 1T89C 4KZDH 3K4DA 3PXJA 3MMEA 3QJVB 4GAYB 2GK0B 4OKVB 3UIYA 4LSRL 4DPAX 2WWNA 5EC1B 2XWRA 1LHZA 4U6XA 3S88H 1OM3L 2CLZA 2ZONA 1ZSDA 5ECGA 2WJ5A 4PFEA 4W68A 2IF7A 1NIDA 2ICCA 2J2ZB 3FC8A 3MRRB 2C1OB 1WO2A 2AJXL 3KBPA 4ODUA 4UNUA 3ZSSA 4OGXH 2G60L 1P4BH 1W8EA 1PZDA 4UBDD 2R2EA 3EUDA 3W9EB 1XGPA 3N9GL 3DVNB 3SE9H 4UILH 4E41E 4Y1AA 4PV9A 4XC3H 2X4RA 3NQKA 2AK1H 1OAKH 4IU3A 1ZLWK 4X7TB 1IKFH 2DQFB 4X7FC 4WK2B 2NW2A 1NKRA 2PETA 2FIKA 3UEQA 4HJTA 3L5WA 4A66A 4PJ5E 1JPGB 3KGUA 1G9NH 1VHPA 5DFWH 1FNEB 3B34A 3NRQA 3BKML 4JDTL 5A2BA 4PUBH 3HHRB 5IM7A 1IGTA 2VXTH 5DUMH 3VXMD 4Z7VE 1EGJH 1M7DA 2WB7A 5I8OL 3GEFA 3WY2A 3ARXA 2R0LH 5D71H 2VZTA 2NNFA 4NBYB 5DZJA 1MWAL 4S0HA 3RPIA 5M95B 4GXVL 3QSKB 4D3CL 4XMVA 3AM8C 3DBSA 3GZQA 3HKZA 4Y5YB 3CFCH 1MH5B 4EI6B 3EJRA 5BRPA 2DYPA 1GR7A 3UADA 3VB9A 5JDJA 3F6JA 4F8OA 5D5MA 3FTGB 3QZWA 4OKDA 2Y3AA 3O6LH 3GRBA 3RI5F 3MV8D 4NM4H 3D18A 4NWUH 5B1BB 1OE1A 4D0BB 3DXAD 5E99H 2OAAA 3FQNA 1IQDB 4M62H 4F7EB 4QTFA 4AL8H 4OFKA 3ZHLA 4KKZA 2B16A 1F6FB 2VIRA 3ZDXB 1HHIB 2WTOA 4NQEE 2FHCA 1V8HA 1N0XH 3VXME 3AXLA 3B8SA 4FHBD 4JM2D 1C7TA 4HJSA 2M26A 4FXGB 2OMYA 1KENH 1TR7A 2V2XA 4A6YH 4D9QD 4K15A 3O2WH 1WLHA 5C9JA 5IMOA 2AQ2A 3APCA 3K7UA 1WBYB 2P9RA 4M1GL 4M03A 4WEEA 2L4OA 4U3SA 1NTDA 2O4EA 1HE7A 2L0DA 1W72L 2H2SD 3K2UH 4CAGA 2VZVA 3AS1A 5CIPH 3W9DB 4LCIL 3QORC 4OB5L 4ERSL 4N2OA 4TF4A 4QRRB 4H4NA 4OGXL 3CDZA 4L1SA 4WJKB 4HCIA 4Q6YA 2VRKA 1JGIA 3H2QA 1YNLH 3CHRA 3QIBD 4LLWA 2FSEA 2WAHA 4QUOA 4LLMB 5T1LA 5DI8A 2JLPA 3S3SA 1QWUA 2N7BA 4JFHD 3VXMA 3U0WL 3WMQA 1MLCA 3BWUC 3LSOA 4Z6AT 2VDOL 2C3HA 1PJWA 3GO1H 2FWSA 5DVKA 3VFOB 4E0RB 3QI9A 1C8PA 1B4JH 4J8QA 5FHBL 3CFJA 4JRXA 4N1HB 2LV4A 4LKCA 4FMFA 4YHNB 1IGYA 3Q1SL 4WV1B 4NIYE 4IEFA 2L8AA 1ZK5A 3VWKC 2W94A 4Q14A 1WZAA 4Z7OB 3L3KB 2IH3B 4MAYA 5HYIA 4LBAA 5B38B 2Y7QB 1SBSL 3CXHJ 2X2JA 2JWYA 5KVFE 4A55A 4YHYB 3T0EC 3KBEA 3SE4A 1JZ5A 2YD9A 3MRBB 5BVPH 1TJGL 3T8VA 2V17L 5GSRA 3BEWA 1TZIB 4ONOA 4ADJA 2FJUB 1I9RH 3R4DA 1U8PA 4GSDH 5CCHE 5DTFB 3QIUD 3F58L 4I1RA 1FFRA 2Z31C 2O5NA 1MCHA 3EDFA 3OX8B 1FZMB 1JF5A 3EFFB 5CJQH 2A6JB 1VACA 2YAEA 4N0UA 2GQHA 4N85A 1FCCA 2WKOA 1O6TA 3QULB 4BIKA 1B9KA 4LLDB 3IM1A 3WXWH 3U9UB 4OZGF 3SDDD 3DUUA 4LSVL 3CDYA 4RWHA 2D3VA 1XZ0B 1WFOA 2Y1VA 4Y1AE 3O9WC 4P4KA 5E1AB 4AE0A 1P6WA 3V0HA 3BWAB 2FZ3A 3LH9A 1RD6A 5JLZB 4UIMB 4M3JA 1N5YL 1JDCA 3DOSB 4YSSA 5F7LB 4E42B 1MJ8L 2FVNA 4B50A 3DX3A 2DBJA 4QDGA 3WMPA 2XLLA 5DEFA 2CA3A 3F6IA 2V9TA 3MBWA 5CWSA 5FW8A 4YXLL 4FNLL 4YDLB 3VD9A 1Q1JH 5E8OA 1R1CA 1JPST 2ATPB 2GSMB 2YGNA 1A3QA 2OMWB 1MWOA 1XSKA 2NZ1A 2P48B 4N20A 3T0ED 4EI5B 4OZGA 5LGYA 1ASQA 1RMFH 4K23H 4I3SH 2IQAB 2AC0A 3GINA 4PB0L 4DUVA 2YUZA 3VFPB 3ASWA 4PB9H 4KY2A 3MGTB 1EANA 2XG4B 1HYRC 1AR1D 2Y5TA 3AS2A 4NI6A 4PBXA 2FTAA 2NY3C 5GGUA 4JANB 4LNRB 3UACA 2WNXA 1VEPA 4G5ZH 1MIEL 2JLLA 2NLJB 2Z7UA 4LPYA 4ACTA 3ZW3A 4CDGC 4MVBC 1EZVX 1XF1A 3F01A 1CO1A 4KITB 4FCAA 4Q74A 3S5LB 1TJXA 4JFFA 1IJ9A 3UL4A 1I1AD 2EDRA 4PG9B 4W9KC 1OK0A 1J87A 1SXNA 1SEQL 3QUXC 2BERA 3MLRL 3UCRA 1HESA 2C9UA 4O2CB 4MLSA 4AYFA 5L8LB 1DO6A 1ADQL 3X3GL 2VLRD 2Y23A 4QXUH 4XCYA 4PR5B 1UA3A 5C8JB 3MNDA 3Q13A 2YFNA 3VE0B 4E5XA 1OSZB 3L17A 3QEHA 4QJ5B 4H0GA 4U7SA 3VGAC 3ORJA 2J56A 4XCYB 3SOBH 3T1FA 2LU5A 3RI5K 1E4HA 3UZQA 1DR9A 4AQEB 5FHAH 1BJ1J 4G7VL 1UKQA 2PYFB 3ULUL 2V2TB 2ZOKA 3DPBB 4BEIA 2FYYA 4XNXL 3KPMB 3GUTB 4MJIA 4BH8B 1HH9B 1UG9A 5KJ7E 3S35L 1FIEA 2KLRA 4D0CB 3HZYB 4TQEL 1RKRA 1QSEE 4ZS7L 4OUUB 4DGUA 4C4BA 3S2AA 1DUYB 1Z9MA 1YEKL 4OZGB 7FABH 4WWKB 3EOBB 2MOQA 1MCEA 4JO5A 4OV6F 1MPAH 3MOQA 3TWCL 1QPKA 2FJHB 2R69H 3BMVA 3G9VA 4UM8B 5ABDE 3BH8A 5CWSB 5IBUG 3I6GB 4DQOH 4PYHA 4YDKH 2CM5A 3QO1A 2VN7A 5KVGL 4HCGA 1M9WA 4KMTH 1QUPA 3NCMA 4OJFL 2NY3D 2HKHH 4IRZL 5DJYA 1G9HA 1K8DA 2ZSVA 1CGYA 2NYZA 3L45A 4LASL 1KN2L 1W0YT 5HTSA 3B3BA 5E1AA 4KK8D 1T89A 4RFEB 3MV9A 3PJSB 1YJDH 1SEBB 4EKJA 4XRCA 1XB6A 3WD5H 3NMEA 2ALWA 4PJFA 4WUUA 2BIMA 1A3LL 4K5MA 2YZ1A 3Q43A 1AXSB 1E90A 5I1IL 2EH8L 4FQLH 1MW3A 4WO4B 5IHUH 3MJGX 3QXDA 5FA3B 3ALXA 3SJVE 2BPBA 4BRJA 3OR6B 2LFGA 3RY5A 4JZJA 4KQ0A 1E6OH 3TEWA 1A1NB 3BQVA 4GMSL 4MS8D 5DHMC 4Y9BA 3RBSA 1JYVA 3MRPB 2AAAA 2WQWA 2JI3A 3EJQA 5DJXB 4Z76B 5FM5M 1F58H 3U2SA 1S7UB 3RWFA 4OGYH 1N68A 1XBRA 3KAAA 1YN7A 3OKEB 2DQHH 2VLJE 4HFWB 5GSVB 4LL1A 4HT1H 3BRGC 5B38A 2ADFL 4J3OH 3UMNA 4JHBA 1QYGL 5EG6C 4PRPD 1A14H 3ZR6A 1AD0A 4Y4HC 1JZ6A 2F6AA 4KJYB 4Z5RB 1BPVA 2BXYA 3BKCL 2NRDA 3ALWA 1OTTC 3OQ3B 2VJXA 3X13B 2ZXWB 2VW7A 3Q8EA 2EE9A 4XGZA 3SIKA 5I76A 2NY1D 4CC4A 4KVCH 1ZVYA 5M94B 2NUTA 4RISH 3V0FA 1TLMA 4N2LA 4RGMC 4EDWH 3LSOB 4TLKA 1VEMA 4MB1A 4HIPA 2APTA 2BW5A 3MV9E 4KZ0A 3TEUA 1EO5A 4PJ7E 3QB7C 3NCWA 2NSMA 3T6VA 2BK8A 4RGNB 2BVTA 3MRNA 3BLBA 3NEXA 3RWEB 1CBVL 1WWBX 1VB9A 4PRDA 4LPTA 1A6UL 2PR4L 2EUVA 5FCUH 3JTTA 3LPFA 3FTSA 1QFWI 3B3IA 3M8OL 4GT7A 1JHKH 4FFWD 4HXAH 3GSUA 5GS1C 3L4YA 4HIJB 5DA4A 1GJUA 1Z5HA 5JQIB 2G5RA 4XI5C 4QD2E 3KJ6H 2EZ0C 1G6RL 1GMEA 3U7YL 2Q86A 3UZVB 4JPVH 4ZFOL 5I1KL 3WTWA 3QEQE 2OXHB 5JZ7C 2EIMB 4LDOB 3HI5L 4EIZC 2DQTL 3P2TA 1SYSA 3N42B 3KL0A 3S4SG 2H2SC 2VAAB 1AP2A 3LN4B 3QUYC 4X83A 4FNPA 4HIIA 1XV8A 3D12B 1ORSA 3PUCA 5FYLL 1JNNL 3OXSA 3VXRA 4F2EA 3MRHA 3UP6A 1O6SB 5FS5A 2F7OA 1EJ8A 2VQ1A 2X1PA 2VXTL 3IXTB 4XAWH 5C0AD 4ZW5A 3QZWB 1IKNA 4N25A 3D3VB 3L7FB 1I8LC 1BM7A 2F58H 1NH6A 5EU6B 2D3NA 4KROD 4OCYH 1FSKC 1VGEL 3GBEA 3ZT5A 4AIOA 5MEOA 2X1OA 1MCLA 3K72B 2MMXA 1T0PB 2CJSA 3BWSA 1CG9B 2E74C 4HCRL 4AIZB 5DEGA 1G94A 1JPEA 1PPIA 5I1JH 4HALA 2MNWA 3MXWL 3JYCA 1CTNA 5JQHC 3LH8A 2BNUA 4TQPA 4IOSD 2J8UA 4HCRA 4H7VA 5I71C 2X4TA 3Q05A 5B8CB 1MNNA 4HMEA 2OJEA 1JZFA 12E8L 4B97A 4B3VA 5D2NB 4TV3A 3SYCA 4KNSA 2XIBA 3EYVB 3A24A 4K94C 2EILB 1TZHB 5CINL 5SWZB 3W9EA 3S2CA 4AQ1C 4GW4B 3AG1B 2O30A 1KBBA 4ODUB 4A37A 4J3WA 3UTSA 5PCYA 1T3FA 2AK4E 2J2ZA 3RX9A 5SX4I 1PYWA 3D2UB 3HPJB 2CR3A 1ACYH 1E7UA 1S9YB 1AS7A 1Y0LB 1UD4A 5TDOB 4I77H 3MMEB 4OKVA 4N2HA 4LEOB 3RWJA 4NRZA 3BUPA 1FFPA 4XBEL 6PAZA 1JYNA 2FGZA 2QPUA 1IGJA 3WEOA 2R8SH 5HPMB 2RFXA 2X1XR 4J6IA 4HLEA 4HKXB 2R56L 4AZUA 1T0MB 2CCLA 2YSSB 4OT1L 1RK7A 1AQKL 3LRHA 4QYAA 1NCIA 2ZUXA 4BFGA 5JQ6H 5ETUA 3AGVA 3GTVA 3WFCH 4HMCA 1BQHB 3NCCB 3OHXB 4M7JH 1TFPA 4UT9A 3FT0A 2ZUTA 3Q06A 1U2CA 4NP9A 4OR1A 2J5WA 2NSQA 5CS7A 2WTRB 1ASPA 4YK4C 4JKMA 1RL1A 1ZY9A 1F6AA 1BQHA 3OHXA 3MZTA 1T83A 3V8CA 1HT6A 2X6AA 3IEAA 1T1XB 1UQSB 5ITFB 2GY5A 4HA1A 3FQUB 3D07A 4U6HA 2VDMH 5ANHA 4HEPG 1RURH 3IXTA 4U7MA 2W81C 3NCEB 1A1MA 3WJLC 3NCJL 2J1YA 4PEEA 1GH7A 5FGBA 4ELME 4YBQC 1E27B 1KTJA 1OO2A 2ESVB 2G3MA 4CW1B 1XL4A 4WW2C 2FT6A 3V6OA 1BQKA 4RA3A 1TQSA 1MJJA 1Z9NA 2J5LC 3UJJL 4F8NA 3BVDB 4YHPB 5EO1B 1MIMH 3BGFC 2GITA 2MQGA 2DZEA 1YMME 4KZCA 1FGVH 5ECJE 2Q86B 3S3BB 4QEGA 2UXGA 5DK0B 3UZVA 1CT8A 3OHMB 2AI0L 5SWSD 2UYLB 3S8WA 4GUOA 4AMWA 5EBGA 3QRGH 2AMGA 2XXFA 1QYGH 1Q94B 2IAMA 3H42H 4YLBA 4FQQA 1EERB 5A16A 3HZVB 1E3FA 5IVZB 5IFJA 5CGTA 4LRNL 2Z3FA 3MBEA 3GI8H 1NGQL 3NSFA 2KZWA 3QQXA 3OD3A</