5E1GA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t208
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
total genus 87
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5e1gA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5e1gA02
4JMNA 3ZQDA 4QR7A 4A1IA 5DU7A 5DZJA 3U1QA 4A1KA 4ZFQA 4HUCA 5LB1A 5E1IA 1Y7MA 3U1PA 5E51A 5DCCA 3TURA 4QTFA 4Z7AA 3ZGPA 4A1JA 1ZATA 2HKLA 5DZPA 4GSUA 4GSQA 5E1GA 5E5LA 5DUJA 4XVOA 5DC2A 3ZG4A 4GSRA 4LPQA 5LBGA 3VYOA 5K69A 4K73A 4QRAA 5DVPA 3TX4A 3VYPA 2MTZA 4A52A 3VAEA 4QRBA 3VYNA 4LZHA 4JMXA 4HU2A 5D7HA
chains in the Genus database with same CATH superfamily
4JMNA 4KU1A 1JGUH 3BGFC 1Z0MA 4FMKA 3RY6C 4Y4KA 4XXCC 1XR8B 2CGRL 3CZJA 4QRTA 4NM8H 1DFBL 2DQJH 3L6FA 4P46A 1BZ7A 3ESMA 4XPTL 1MI5D 3MACH 3SY6A 2J3SA 1EEZA 3IJEB 1A7OH 4TUOA 3IJYA 3R06B 3O9WD 1KXVC 1NQBA 3F00A 4LCVA 3QULB 4PGBA 1ED3A 3VA6A 4ABVA 2M26A 1IL1A 1K8IA 2X4SA 4N24A 4P2OB 1SLVA 4HJSA 3ML8A 4Z7NF 3F5WB 3FCUB 5KG9A 1OAUL 5EBLB 3QCTH 3LHPH 4QRFA 3RILA 2H3XC 4P48A 3UP6A 2L7QA 4L3CA 2OSLA 1ZVSB 4LHUD 5ESVA 5C0JA 5J9PA 5DJZB 3WFDL 1O7DC 2AV7A 3CG8A 3EJZC 2WLIA 4P23C 1I7UB 1MQKL 3QWRA 2FSEB 3M7OA 4N85A 5EH1A 1E5AA 4FERA 1XZ0A 2GUYA 4HLZH 2O4EA 4X5XA 2DQIH 3NVQA 2C9QA 1VDGA 3ZR6A 4XPBL 5DO8A 5IMLA 4FZEH 3RFRA 5F6IB 1LXMA 1J9SA 2C3VA 3QDAA 2ETWA 3HZKB 4WI2A 2L0DA 3G5VA 5GRUL 4WNSA 3GHEL 4FKKA 3ARGD 5FF6B 4G8IA 1QEWA 5E9AA 1UT9A 1WK0A 2ZSWB 1UOVA 3FT3A 4MD4B 3D18B 5ICYA 5IIEB 4TUUA 3RIKA 2APXA 5DLMH 3V4VA 2CIIA 2FYVA 4PP2B 5HVHC 4HK3J 3IE9A 3L3GA 4FRWA 3CU1A 5LCVH 1TFHA 4GXVL 3MNVA 3PGCB 2JQZA 4WW2A 5BUAA 2ZAHA 4OSUL 3BRGC 1CFBA 2Q3AA 1MG3C 1CZ8L 4X6FB 3DXAA 3T2PA 3LB6C 4PJ8B 5DLML 4RZCA 5E2WL 4XP9L 5C3LD 4OBRA 4KZ0A 5JOFB 1P4UA 3O6FD 3OF6A 4F80A 1OAUH 4JFYA 4AGQA 3T4YB 2F15A 1NGPH 1PZ3A 3BOVA 4HUUB 4PRBA 1RZJL 2PYFA 3EYOA 1ADQL 1UEMA 3GSUB 1I8LC 3MV8E 1P7QA 3WTVA 3THML 1RKRA 1KELL 4NERA 3DVIA 1YRKA 3HI6L 5E7BA 1WT5C 2C4FU 5GHWH 2UZXB 4I77H 4X6CB 4TUKL 4D9LL 3I75A 1WF5A 4P23B 2AEPL 2EC9T 3MJ9A 5TPWL 3TBWB 3ZHFA 3RVVD 2LTQB 4B5EA 5I30L 1DEDA 4AWJC 3UAJA 4YWGL 1WISA 2G3ZA 2IOMA 3LZOA 2N0MA 4IBYA 2CNYA 5HGHA 3BKCL 1KCVH 3FUMA 4BGLA 4M9PA 1T6WA 5T1DL 2E27L 1GKEA 3HUJA 4WI4A 3OB0H 4L1HA 5GGRB 4CC0A 1UJ3A 2IBGA 4U1MA 2B16A 3UH8A 3LRGA 1U8JA 2QJDA 3FU7B 1J48A 2DH3A 1JGVH 1JFQH 1MVUB 1GZPA 3QQ9C 3BD4A 2RCSL 3QIBA 3ZYZA 4YGAB 4OFYA 3NIGB 4OZGE 4XE5B 1KENL 2NY2D 4QD2E 1PZUB 3U36B 2YD0A 3TOPA 3IU3A 2PYEA 4AH2B 2GTWB 4FQQA 4BFNA 4H8WC 3CDFA 1FNFA 2CK0H 2JH2A 5IESH 2ADYA 1T4KA 4JFHE 3RZCC 3U0TB 5GRWA 4UBDD 4D0DB 2H47C 3BHBA 2E75C 3PAYA 5DMJB 1A4CA 5GGVY 1MDTA 5D2NE 3PPEA 3QT2A 2VQUA 3DO4A 3FTWA 3GSNA 4L8SA 1LO5B 3QG7L 2AKRA 1QBAA 2NX5A 5F1IB 5LUMA 1ONQA 3BAEL 1XSJA 4JFHD 4YIQA 3PWPA 5L2JA 4KNUA 2V5RA 2WSDA 3GIZH 4NZTH 5J12B 1UXSA 1HKFA 5F9JA 1NLDH 3F3HA 1SLUA 4L5FH 4LPUA 1G6RA 5KSBF 1TMCB 3D4ZA 2Z7UA 3IGAB 4FJ6A 3ZTNH 2B14A 3QRBA 1FI8C 4UT6L 5C07A 1AC6A 3VFRB 3X11A 4X6DA 1NLBL 4J6RL 1KCRL 1E90A 3TBTB 1DHKA 2CUAA 2JB6B 1ESOA 4ZX5A 4UQBA 5HGHB 3UTTA 4QGTA 3G6AB 1HL5A 2DY2A 5DZ9A 3VRLF 2GSMB 3NEXA 4ANVA 2JVUA 4FULA 4HUNB 4FXKB 2H2SC 3FQXA 4NKMA 4CMMB 3SJVD 5KYYB 4JM2B 1PLBA 1H5BC 2MQCA 5A16A 1K3ZA 3GSXA 3WGUB 3WO4C 5IHZA 4Z78A 4PJEE 4WZ9A 1EGJL 1ICTA 4JFTA 3VXTA 1EJ6A 3NZSA 4WHTB 3FCTB 2SEBB 3M17A 1HXMB 2P5WB 4X99B 3OAUH 1NFDA 5HGAA 2AC0A 2WLKA 3IGLA 3IVKA 5F7FA 2KYIA 2UWEF 2X6UA 3BN3B 5L8KB 4D0BB 3O3EA 2HH0H 5DZLA 2AQ1A 2YWYA 1JPSH 2XICA 3U6XA 3BYYA 3DX8A 5JIIA 3TV3H 1A3LL 4MJ4A 5IQ7H 2IMMA 1SJEA 1IFRA 4YSUA 4QEGA 1CXFA 1SLXA 3KYOB 1T4WA 2A9AA 2CA4A 2Y7NA 3EBGA 4FCHA 4XP9H 5DJDB 2Y7SA 2PCPA 4LSTH 3DVGB 4ZXBB 2XN9A 4U1KB 6CGTA 2AJXH 3CFJB 4BFIA 1XF3A 4IEFB 1SHXA 4O58H 3L3IB 3U2IA 1D9KA 4OLVL 3MRKA 5LGHL 2E6PA 2F74A 1IGCH 3WOVA 4NPKA 5SWZA 1JNHB 3ULUL 4M8QB 2OCFD 2G75B 3S35X 4F8NA 5GGRA 1ZXKA 2XV3A 2YRBA 1QLEH 5AZUA 4LBAA 2GIYA 1PG7H 3VRJB 3HJ0A 1I31A 2P5PA 4XODA 4AYGA 3VXMA 4LSSH 2OJEB 3QQDB 5I5MA 5IHLB 5JW4R 1CFSA 3MU3A 4DVRH 3PFUA 1P4IH 4F7CA 2E7DA 3GKWL 1CLYL 5I5IA 5IB4B 4O02H 1R3KA 3FRUA 1MWOA 4ZO8A 3NJJA 5CUSH 4Y89A 5E1AA 2C4FT 2J5LC 1WA0X 3GXPA 5FFGA 3KGUA 1A02N 3L3KA 2WZAA 5E8PB 4A2GA 1XMEB 4LLVB 4ONGH 3MODH 3B6SB 2EKSB 4OD2B 3PF2A 4LVNC 3HE6A 3QSKB 3WXWL 4J5VA 1J5HA 5IF0B 4QMEA 2K1MA 1NC4A 3BT2H 1AD9B 1FNEB 3ARGB 4TS6A 1ZLVK 1KEMH 2OULB 4MZIA 4QI3A 4LNRB 1Y18A 3PWVA 4KC3B 7PAZA 1Y07A 2FO1A 4BQCA 5D2NA 4CADA 3TFKD 4P5TB 5FYKD 2Y06L 4JKMA 4LL9A 4L18A 1OKEA 3JWDL 3UJJH 1LTXA 2B1AL 3LH2L 1YEJH 1F00I 1UM4H 1NCBH 4K94H 2CKBH 1UWXK 4YXHL 4DGVL 4HJ1A 3RVUD 5B39G 43CAA 3TF7C 3Q44A 3QQ3A 1JGLH 4GSRA 2UZYA 1NOAA 1NLDL 3FOMB 1IAKB 1YNTA 1IC1A 4YBHA 1N5YL 1KCSL 3L3DB 1MFAH 1Z3RA 4Y19E 5IB1A 1KCUH 2WZPD 4R26L 3DNKA 4GLRI 5C07E 1UGNA 1FNHA 3T0ED 2JLLA 2IG2L 4BELD 4L1DA 1IJ9A 4ELMA 1BSIA 3RWFB 2DRUA 2A6DA 5I0DA 4M43H 1KYOJ 3SDDC 2OZ4L 4EXPX 3BUBA 3MV7E 3DGGB 5D7IE 2LAAA 1Z9LA 3TNNA 3V6OA 3ZE1E 3QZOA 4N2AA 4R4BA 4CMHC 4HEMA 1RK1A 1FVCB 3LXAA 5MENA 1X7QB 2H26B 1LHZA 1RZJC 4O9HH 3V0VA 3M8OL 2YQBA 3LIZL 1BFVH 1OGAE 1ML0A 4JPWH 1QBMH 1R34A 4W9IC 2EH8L 5KOMC 4PJXF 2O61B 1JV5A 4G3YH 1HHHB 2E0PA 5CJQH 2QQNL 3SQBB 1I1AC 4V1DD 4G6AD 1UZ8B 3BP7A 2BY1A 3L3HA 2VKWA 4CSZA 2X1QA 1V7ML 2UY6A 5DUMH 4P4RB 1G6RB 4JG9A 3GZPA 5I6KA 3IJYB 1WTGT 1OPOA 4XXDB 4A7UA 2FX9L 3QYMA 2GUOA 1AXSB 1J8HA 4RQQA 3WCYA 3MZGB 5CHNA 4M02A 4FHKA 5H37G 4PB9H 5A6IA 2V5TA 2RD0A 4HUWA 4U33A 1A64A 1VFBB 2ENJA 2HWZH 2VDLH 5KJRL 2WXRA 2QKSA 3AGWA 3FU8A 3DI2B 4ODXB 1N2RA 1ZVNA 2R7EB 4RMWA 1JZ8A 3ZPDA 1UUSA 3U1PA 3H3PL 5EPMA 4Z95H 5IOKA 5GRZA 4N2GA 4EZMA 4FNQA 5LG6A 1THCA 3FQUB 3L1OL 3T3PF 1F4HA 2NZ9C 2EACA 1FSKB 4C83B 3O8XA 3UAFA 5GRVK 5HDBE 1P4LB 3QNZB 1WZ1L 2ZOWA 1NGZB 2QL1A 1AD0B 2IDCA 2YO3A 5EV7A 1AO7A 2AITA 1V55B 4KK5C 4FFVD 1FRGL 3RAJL 2UWEA 3F7KA 4J3XA 4AIOA 2YPLD 2MH4A 3ZKNC 4ZNCD 2YEQA 5KVFL 3ZE0F 3KLDA 1BW8A 2K6WA 2FWOA 3V0FA 2QVTA 3LZFH 4B50A 1ZHLA 2J55A 4HULB 1UFUA 2V9RA 4DCQB 3JVGA 4U1MB 1I8KA 4Z0BH 2CGZA 3RGBA 4KZEL 4OM0L 2ZOLA 4N0UA 3D52A 4FX5A 1UA6H 2FZ3A 1PJ9A 4YE4H 2XIDA 5B39B 3T5WA 4KQ3L 1OK8A 4WI0A 1F11B 4ORGA 5FHAH 3MLTB 2ZYSA 1BF5A 5F1SA 2AK1L 4WFFE 4D3CH 2EICA 4OIIH 3AC0A 3IYLW 4IYKA 4LSPL 4JNXA 5L9DH 4KO6A 2DMGA 1I8MB 3P3RA 1DBBH 1CQKA 2XPGB 3HC0B 1UA6L 3PRZA 4XP6L 3GD1C 3S88H 2ENQA 5DZAA 3U9WA 4XP5L 1KBKA 4K8RL 4K7FA 4QNPE 3WIAA 5CSZA 2V8MA 4LOVA 3LIZH 2AK4D 3PIQA 1MCSA 3EUDA 1IAIH 3X12A 3UTQA 2JJSC 5C9JA 2E6QA 5BV7B 5EA0H 4Y8DC 2J1ZA 3DBXA 4X6CE 1FORL 5D5MF 1ZLUH 5HVGB 3BUIA 4V1DB 4UAHA 4Z9KB 1VHPA 1IBFA 2HCZX 4GJTB 1WZ1H 5L2KB 5AB2A 2WTRA 2ZX8A 1A2YB 1S5HA 2A9DA 1ZHNA 4QUOA 2HVJB 1SM3L 2BCKA 2EE0A 4IIQA 5I2IA 2WHVA 1NEUA 2OLDA 5SWQA 1XF1A 3TYGL 4Y1AD 4MD4A 5ABZA 5KUMA 3LNIA 3IDMA 3HR5A 3RL1B 2Y7MA 3KDMA 2HWZL 4JPIA 5B7FA 2V5YA 3VFGL 2XRAL 3QHZH 1L0PA 5HDQL 1OM9A 4H20H 4O5LH 4F2EA 5LAXB 1CFQB 4RFEB 4JFOA 3LRMA 3QCUH 4LDLB 4LEOA 3JTTA 4BZ1L 4KJPD 2YBGA 4OFKA 5F7EL 1R5IA 1KJVA 3MRRA 2F53B 3HAEA 3K8MA 3FT2A 4LE8A 4MWFA 3LKPB 4WUUE 4YHYC 2FJUB 2YD6A 4GG8A 4NC2B 4WAFA 5D7JC 3GMLA 4BDVA 1T83C 2HT2C 1IM3A 4FLSA 4DF9A 4HDIB 1OTTD 2GG1A 3IMTA 1N12A 3QCUL 4RNRA 3QUMH 3ECVA 3ULVF 5T5FH 2NY0C 2FT8A 4JPVL 4MVBD 3BP4A 4XNBA 3SYCA 35C8H 3TFKC 3OG6B 5HI4C 2ADFL 3QWOA 3EDFA 1NC4D 1MH5B 4LPWA 2ITEA 3NP4A 3S34L 1YMME 1VKXA 3J2PA 1T66C 3MV7B 1PLAA 1PLGL 4N6RA 4I0PC 4KZDL 3BMWA 1U93A 3B2PA 3Q2CA 4LQFL 1DBBL 4Q89A 2QSVA 4ONFH 3FAXA 1U33A 2ZUQC 3V4LA 1C7SA 1J5OH 3NJGA 1CGUA 3TEUA 5J56B 1G7JB 2WZPA 2EIMB 3WUWG 4ZMYA 1R3KB 3KBHE 4GSDH 2W65B 4XO8A 3BUQA 4XBEH 2DQCH 2WCGA 4U4BA 5PAZA 1BA9A 1RP8A 4NQVB 3TIDB 1A6AA 1ZIAA 3O6FC 4X4XB 1F3DH 4QXVA 2CKNA 2KT6A 3T0EB 4E2OA 4F2MB 2XFGB 2PO6B 5J13C 1DVTA 3LZLA 3GMOB 1BG1A 1CE1L 3ZL2A 3ULVC 4ZSOE 4P9HH 3ISWA 4AOFA 3STBA 3S8FB 3CLWA 3QEQB 4R0LB 3L4XA 3OR6A 3MDJA 5EB9A 3SYOA 3MA9H 1Q4NX 5CZKA 1PKOA 4NN7C 4OJCA 4KQ3H 5EIVA 1GS8A 3CDZB 4P8QA 1FJ1B 3OKDB 4CW1B 2HRPL 4WI5A 1ERNA 1U3HB 3K6NA 3PUUA 1CGSH 1JNNH 1WITA 2I7SA 4N8UA 4PLJD 5AZ2H 3X1GA 1S7QB 4RIRB 5TE6H 1VZIA 3WY1A 1J5DA 3AXHA 4GO8A 1P0SE 2WGXA 5D2LA 1GJWA 1W8EA 1Z6JT 2EDLA 2WXOA 1NBYB 1PD6A 2EYTB 3MLYH 5HHNB 3N40P 5T33L 4J1UA 4N4YB 2XX1A 3F58H 1KG0A 3KPOA 4UTBA 4WY7L 3NZHL 1NFDB 4E9RA 4TVPD 2J72A 3OR7A 4YGVA 4CC1A 3HE6C 3FF7A 4JUSA 5DD5L 5I8KL 2QADC 3MUGA 1AGEA 1PQZB 4DFIA 3GM0A 1UACH 5AAWA 2AJ3A 4DUWA 2CLZA 3JYCA 3WFEH 4UQEA 2DQIL 1T89C 5JIMA 1P4BL 4OJYA 5D4JA 3W39A 3HPLB 4RMTA 5SWZE 1KJMA 1PZ2A 4IW4C 3ARBA 2H2SD 2Q7NA 4ERSL 2IFFH 5DJ0B 1M3IA 1RH8A 2XZZA 1WSST 2QLVB 4WKZA 3Q1SH 5C0GB 4F8TA 3BAJA 1EXGA 4PRDB 2Y7LA 2Y7QB 4MAYB 2KLRA 3TCTA 2C3HA 3UTTE 1GCFA 3MXVH 1BPLB 4BBWA 1VCAA 1EDHA 3SDXE 3UC0L 3ZQ9A 4S0HA 1IM9B 4Z76A 3KHQA 4WHDA 2NZIA 4DKDC 1I82A 3HMXH 5HY9A 5I1IL 2MNUA 3HOGA 3EYSL 5C0DB 1KY7A 3AQXA 4Y5YA 1S7VA 4EJ1C 2YQ3A 3DA0A 2I07A 3O6ML 1SEBB 1VFOA 4AMKL 3N40F 4ZMXA 3AACA 3WO3B 2ENYA 5IR1A 1DL7L 3OC8A 4HWBA 1BOYA 2OK0H 3UJIH 1R3JA 3RVUC 1QTSA 2F8OA 2R83A 2QHLA 4LVOC 3RWJB 3G5YA 4P2AA 1JZGA 4H7VA 2OMTA 3T6WA 4QJ3B 4PRNA 5JIHA 4C54A 4HHAA 3H6AA 1D7FA 3TZVA 5IG7A 4AZUA 3BC9A 1CU4L 3DK2A 2O93L 3QXAB 3HCVB 4OI9A 4B7LA 3B43A 2P44B 3WY3A 2Y36H 5T3XD 3B56A 2R56L 3U36A 2XWEA 3H7BA 3NQIA 4ZAKD 1K4CB 3GI8H 4UM9D 2LU5A 2WWOA 5EU4B 3U9UB 1ZGLA 1PG7X 3BPOC 1YNKH 1MVUA 1KCVL 5SWSE 3I6LE 3NK4A 4B7IA 3WLWC 2D0FA 4H44C 1EEUA 1DVFA 2XLLA 3IRPX 2E4FA 3K1KC 4AENA 1ILSA 1HC1A 1VZHA 2VRKA 5KUKA 3IMWA 4U1NA 3KBEA 2DLHA 2HN7B 3GIZL 1EMTH 4K9EC 5L8LB 4ODVH 4GFTB 1UD6A 1OE3A 5EO9A 5JO5B 5DYOA 1SQ2N 5E8DL 5I6MA 5E2TH 4XNMB 5HP5A 5SWZD 2BVEA 2Z7WA 4NEHB 3VWJD 3DECA 2CK0L 2VJXA 1VFUA 2DLGA 1GJUA 3QI9A 4KK8C 3C8KA 1TQTA 4U6XA 5E70A 5HI4D 3MJ6A 3VMOA 3FN3A 1L0YA 1Y6KR 5G2NA 3EFFA 3ZDXE 1BEXA 1LWRA 5DRZA 3T4YA 3QDGE 3SDAC 4YXKH 3V6ZB 1S9KC 2XXMB 1GZHA 4PJGB 3PJLA 2P5ED 5H2BA 3NSJA 2VIRB 2YEZB 4ZK8A 4AEIH 9CGTA 2GHWB 1KOAA 1T6BX 1MCPL 3ZMRA 2AABL 4NZTL 1T1ZA 3GBMH 3TO4B 3BMVA 4PTUB 1OT4A 2A3TA 2WO4A 3VI4A 1AGFB 1BM3L 2AVFA 4BZ2A 4YHMH 1LWJA 4YDLB 3ARWA 3B5GA 5DU7A 3HG2A 1SPDA 3ML9A 1XGYH 3PV6A 3DSFH 1ZLUK 5GZND 4PLOB 2YRPA 2ADJB 3BPLB 4L9LB 1X7SA 4OJEH 3BRDA 2HLFD 4NS0A 2E4TA 4M93C 3K80A 2XETA 3UAJD 2N3JA 4UINH 4PJFA 2CK2A 4XVOA 3BKMH 4J7RA 2V8LA 1HH6A 1D2OA 4E36A 1NJ9B 2VR6A 1N70A 2QV4A 3ARVA 3N0AA 4OD1H 3OXRA 1AO7E 3SDAA 4HIEB 2P8MA 5A6MA 1DO6A 3LN4A 3D2UB 4RGOL 1K5NA 4M7ZB 2XQYA 3K4AA 5AL8A 3HFFA 1E50A 1R0AL 5CWSA 3T0XA 4U1IA 5GGQH 1HCVA 2ZOLB 4N0UB 1TJGH 4F57L 2F0CA 4A1JA 4DESA 1LWHA 3S3SA 1KXTA 2LVCA 4OZHA 5FKAA 1MCPH 4TNWK 1F90L 5F9OH 3D50A 1FIGH 4O02B 3KM2A 4LHUA 4OCXH 1FUNA 2AV7B 3JWOC 5DJZA 1KB5B 2R0ZH 2VLJD 4GSXA 1QWNA 4WWID 2VMJA 5AW1B 4M8RA 1PCSA 1MELA 1DSYA 4FNSA 3CXFA 3AG4B 4YBQD 1MFEL 1W72A 3BEWA 4ZAKA 5AUMA 3OAWA 1ZANH 5DZVA 4LSQH 3RWGB 1IAOA 4Y5VA 4KKAD 3VFVA 2XXGA 1H6UA 3HNSL 1EGJA 1H15B 5J3HD 1CXLA 2D2CC 1MCFA 1XIWA 1G9HA 1XD0A 2OMZB 3DIVA 2XBZA 3L6FB 4M8VA 5FYLL 1M4KA 5D8JH 4DIXA 3MI6A 2H8PA 1I9JH 3RZCD 2O30A 5FV1L 5C3TA 1BIIB 3VXPB 1BDYA 2J5WA 3IDNA 2PTTA 3ECBB 5IW3A 5I1JL 1NBQA 5IT2H 1PX3A 2IAND 2VW6A 2Y07H 1OIOA 3BZ4A 4G42B 4FNRA 4BQ8A 2P7TA 5K5YA 3CFKB 3HC3L 2PABA 3KLKA 3TO4D 2XWBA 1XD1A 1W80A 5E23A 4ZMAT 4R2GD 1UWGL 5AW7B 4GKSA 3WN6A 3QA3B 3UYPB 2F8VA 3H9YA 3NRPA 5CINH 1MCJA 3U2SA 1B88A 4XNZC 1ZVYA 3GMNB 5FUOH 2FNWA 2BOCA 2G3MA 2C3WA 1O5DT 5DVKA 4OZHB 1ZGLM 4ZTPL 4X9FA 4QCIA 3W0WD 1SDAB 1I1FA 5F7MC 2Z8WC 2IXQB 3I85A 3QDHA 5D9SA 3U7YH 1G9NH 1Q9OB 1KEGL 3WE6A 1EAOA 5K1JA 1AY1L 4GKOA 1UVQB 1WD9A 4R3SB 4YHZH 3BQUA 2BFVH 5BRZA 2BJMH 2R2CA 5A6LA 1NBZB 2QR0B 1QHPA 3MFGB 5ALCL 2P24B 5ES4B 4NUGL 1XGQB 3DMMA 1R0AH 5T8IA 2CKBB 2B08A 3FT1A 1H3PL 1JZIA 3IDYB 2MHAB 1O7DE 3BZ4B 3QUYA 1GAFH 1SXSA 3UTOA 2JK5B 3SODB 1ZY9A 1AZUA 2X4OA 4FQCH 1BQLH 3IN2A 4OIIL 5KBNC 3EYQC 1HTYA 2XC8A 4KHXH 3V0EA 3DO7B 1CDIA 4P0DA 2A38A 4XXCA 2Y2YA 4RA3A 4HPYL 4MBOA 2O5NA 3HHSA 2HJFA 4FP8L 4BA8A 1SLWA 2Y25A 3GQFA 5EZLA 5KSBE 3WN5C 3VA2C 1IFGA 1UM5L 2ZICA 3C09B 4PJ9D 5CD5C 3JWOL 3V79C 3RPIB 1YC7A 4XP5H 3QC6X 1USQA 1E3FA 3QEQE 2Q8BH 1W6LA 2Y1AA 3L4YA 2ZXGA 4I3SL 1NINA 1IARB 3GIVB 1AD9A 1FNEA 3ARGA 2IPKA 4JREB 1R17A 5DRZB 2FJHB 3PNWB 2XU9A 1FORH 1S7TA 2FD6H 4OCWL 4OLUL 3ULVD 2WXJA 2YSTA 2GJ6A 1GYWA 3TURA 1MHPL 4NUJB 4OJAA 4WFHE 1FH5L 2HG5A 3DMMC 4JDEB 1J9QA 3US0A 2D03L 2EYRA 4NJAL 5AYUL 2FK9A 2QVIA 7PCYA 3RTQD 1KIRA 4HJUA 5G4MA 1K6QL 1JHLH 2J25A 2X87A 3UG5A 1P5UC 5I6PA 1N8ZB 4Y9EA 1ECZA 4NQSB 3FT4A 2HT4D 4FA8A 4UZSA 1ADWA 4Q6IC 1M2VA 2DYPB 1XH1A 2QPEB 2WQ8A 1J8SA 1S7SB 3ZDYB 1XF4B 2R0KL 1TCRA 2D03H 5AYUH 1C12B 4JKNA 3D25B 4NQED 3IDIB 4MSWA 2X2YA 3ROOA 4OFQA 3L4ZA 4L2YA 2G60L 3MREB 4QDGA 3FTGB 3DX2A 1NJ9A 1Q72H 5E2VL 5LG1A 1E8WA 3HLAA 1E9OB 1FPTL 3SDXB 2IWEA 5EU4A 3U9UA 5M7QA 2BVYA 1TTGA 4JKPH 4X7CC 43C9B 2WQWA 3KPSD 1D5IL 4JQIL 5F72S 4L9LA 3O9WB 1TKWB 5I17B 1NBVL 4TOYH 2BDNH 2VJ8A 5C0AD 4MZRA 4F7EA 4H25A 3W2DH 2JELL 1K85A 3EOAA 5DJDA 2HTKD 1CGTA 4HKZA 5I1LB 4NQUA 1HYSC 3EYVA 3CFTA 1DQDH 1Q0YH 2W59A 3BVXA 4JPSA 4N6QA 3CE1A 5SV4A 4YBLB 5IVXB 2NYYD 4MXVF 2VDKB 1GYAA 2BK8A 3ZGPA 1X4XA 2RHEA 5B1AB 4JFQB 3DK0A 3HJEA 3UTZA 4NFCA 1PS3A 1TTCA 3TT3H 4D0BA 3SE8H 1OWRM 1A6WL 1MG2C 3PCYA 1IAII 2FIKB 4J3OH 2AV1A 4XPAH 1XHHA 1MW0A 4OI7A 4NQSA 4G11A 2QPUA 3O8XD 2DI9A 2EO9A 2OP4H 3IFPA 4URKA 3H6JA 3VAEA 4ZI8A 4KY2A 2L3BA 4XAWL 2BP5M 2WJ7A 3JWNG 1BWWA 4JFPB 4MDJA 4R7LA 4MXQD 1ZLSH 3HZMA 4Z7QF 4HCGA 1BQ5A 2BNQE 3IGFA 1T5KA 2WSPA 4OCSL 4PJDA 4PMEA 5LWYH 2EVIA 4XXWC 1JGLL 1MW1A 2C9AA 1P1ZB 1MJ8H 4PWEA 4F7KA 3BXNB 3D7PA 5HGBB 2VXTL 1FL5B 4JJ5A 4DEPC 4AEHH 3WHE0 1K4DB 2W0FB 4JN2B 3TBTA 1YN6A 3PQYA 4ORZC 5JDJA 1F13A 1UT1A 5T3XH 4DP4X 1FAKT 4Z7IA 4U1JB 2MKWA 1E4KC 3HE7B 4FXLA 4OGAC 4IMKA 1DVZA 5LDSA 5EUOE 3Q5OA 3CK0L 4ZT1A 3IGAA 4FEMA 5I73B 2HJFB 3NDYE 4L05A 2DLEA 4IRSA 1AGDB 3S5LG 2DIBA 4RMQA 4JG1H 5DSCA 3FHAA 2AJ3B 3CVBA 3CZSA 5D93B 5EA0L 2VITA 4DZBB 4JJHA 4ZW6A 5C0ND 3LPGA 4IOSA 1CC3A 2O26U 3S5ZA 3VQ1C 4V33A 5D1XA 3OZ9H 2O6PA 4JM2F 4KKCD 4EDWH 5BQ7B 1JGUL 1D6VH 3DYPA 4MA8H 1B4LA 3MFFB 5KVFE 2X4NA 3A6CH 3QHFH 3ZTEA 3QJXA 1AZNA 3LKSA 2R27A 4JAMA 1YO4A 4EUPG 1HINL 4D0DA 1IC4L 1QKZL 1E7VA 1N7ML 1IJNA 1Q9OA 5ACMA 4LSVL 1U3HA 2ZUXA 3GO1L 4UQDA 2IOOA 3UP1A 4F7MB 2XQYK 2X4PB 3TCXA 5E4AA 5AB1A 3NFSL 3IU4H 2NTSP 4MYWB 3FU7A 2XVGA 3FT9A 2F7RA 4ZPVA 3DSNB 4LLYA 4PW3A 4R2GB 3QUKA 4FZ8L 4OQTL 4H1LG 2PCFA 1O9ZA 2XY1A 4B95C 3T71A 12E8L 4BINA 3I3DA 2EDWA 1ZDQA 4Y9GA 5I18L 3EO0B 4ANXA 2O5XH 2FNBA 5F97E 1KTCA 4DP0X 4UNVA 4PD4J 5JPMB 1BBDH 3P2BA 1FRGH 1TDQA 5ERWB 3AABA 4CMHB 4PCSA 3ZDZB 3FQWA 4NYLA 1JSYA 2TSAA 3QEGL 4L29B 5E99L 3UX9B 4JAMB 4QOKE 5GISH 5LN8A 4OFPA 1RMFL 2CZNA 3WELA 1MF2L 5I0ZA 5DMGC 2W07A 4AZ8B 1G7HB 1TEFA 4FQXA 2PNDA 3SDYL 4ODHH 3L81A 3MV11 4K3GA 4NUPA 4XVJH 3GNMH 1NEZA 3G5WA 4YSSA 1MJUL 1OP9A 3MBEB 3MFFA 2BVQA 2CO7A 3HS0C 4P4KD 5EBWA 2VSCA 3H9SD 2EP6A 3HI5H 4TRPH 5EZJA 4P5SA 4HXBH 4A2HA 2ESVB 1GYCA 3C8HA 2DQDL 3FFCA 3N04A 5DVNA 1DVYA 3F7YA 2YFOA 1PIGA 4Z7WB 4KKBC 1GZQA 4FYRA 5H35A 2DBLH 5I75B 3FSWA 4RIRA 4B6ZA 4JHAH 2ZP8A 1KB5A 2QDVA 5C8JB 5LKNA 1CCZA 4RGNB 4XCYB 3K6SA 2KI6A 5DHEA 2D3JA 2FEEL 1N3NB 3MRIA 1GGCH 3IBOA 1KXTB 3TJEL 1C9SA 4JM2C 2X53A 4F7TB 4BYHA 3RJDA 4DEUA 1J5CA 3ZJAA 1ZT4B 4BD4A 2VXVL 4X4KA 1BVZA 1YN6B 2OTUA 4G8IB 4JQXC 3X1BA 4RDQG 4F3FB 3OMAB 1NFIA 2ERJB 1OAQL 2ORBH 4GBXB 4MDJB 5F6IC 1HHJA 4I13B 2F7OA 4GKNA 4N8CL 5EC2B 3NGBB 1I8IA 4Y2DB 1CK0H 3BVNA 4KFMA 4LP5A 3CPLA 3IDMB 4LRIA 2IWGA 1QHOA 4PB0L 3TU6A 3ZRSA 2QKIC 1QMUA 3M1CA 2WBXA 4ZQTA 5DZJA 5D1QE 3WFZA 1TO5A 5HVHB 3UBXB 5EUOA 3DURB 1I9IL 3VFTA 5BOZG 2DTMH 1OSEA 4HUVA 2FIKA 4AMKH 5DWPA 3VMNA 2EE6A 3T1FB 4BIKA 2EIBA 3QJHA 2CBOA 5I5RA 3RI5F 3DUSA 4H25B 4P2OA 2WKGA 2BIMA 2ZF8A 3HMXL 4J3WA 4PV1C 3EYVB 3AQYA 1A47A 5DJ6B 3D85A 4OLEA 4XBGA 2XZAH 5F7YC 2YLHA 2D7QA 2ARJA 1JPFA 1YNLL 3TASA 1N6QH 2X10A 4TUOB 2AQQA 3K72A 2ILLA 5F7DA 4BZ1A 3WTYA 2K9FB 2P8LB 3BUPA 4HS8L 3C09C 3MO1A 3DX0A 1HEHC 5GQBA 5EEYA 4U6XB 4ONHB 3B7YA 2VGLM 2DMKA 3N2JA 4XNXL 4R7NA 4U7SA 4IU2A 1BMZA 4AM0Q 1OAYH 3X3FH 3FQ2A 5EO9B 3LQMA 4B97A 3VFWA 4M7JH 2A6JB 4NN5B 5BO0D 2DYPA 4P23D 2BIPA 1MRFL 5E6ZA 4UUJB 4UTBL 5AW6B 3FRPB 5HDLA 2AEWA 1RSYA 3QPQD 3TT1L 4XC3L 5JHLH 4HIJA 5F0MB 2EIKB 3OC5A 4XNAA 1GOFA 4RWYH 3DVFA 3EJYD 5CLTA 3TN0D 5IQMA 1GH7A 1CFTB 1IEBB 1P9MA 2AFNA 1QATA 3ATDA 1DQJB 4MX7B 2BP3A 3N44B 4Q6KA 3CBKB 3CLFL 5E8OB 4GUOA 5FYJH 1TJIH 4Z3IA 4KXBA 4EIZC 1ZGLB 1C8PA 4NNYB 4X42A 5EU5A 4DGVH 4JN1L 1M7IB 4Z7UF 5I1AA 5FYLE 1JPFB 3QORA 3OGOE 2IFFL 5JOEA 1FNGB 4HU2A 3CIQA 4WCYH 5IEKA 1AKPA 1XQ4A 1QTPA 1F0LA 1EHLH 4I2XA 3A23A 1G9MH 4L2LA 5TQ0H 3NJVA 1MCEA 4RMVA 3QS2A 2YAMA 4N8CH 4MBRA 2NY1B 3PWJB 2NY4D 2F19L 4MZ3A 3VI3F 5GZOC 1WVZA 4NO3A 4TSAL 4ABUA 2QSQA 2DF3A 4XMPH 3KPMA 5B22A 3F64A 4FFZH 4K7FB 3ET9F 3S36L 4DFHA 1ZE3C 4GAJH 3CXHJ 5BZZA 5TPWH 2YD1A 1FL6A 4B96A 1XGQA 5TE7H 4HWZB 4A2EA 5C7XH 4HKXB 3WTWA 4BXSV 1FFPB 3VFSA 2BXZA 2PPFA 4H13C 4JREC 3UDWA 4QRRE 3NPSC 5C0AA 1VB9A 2RMNA 1EJOL 2BS9A 1UVQA 4BJLA 4A7VA 1FFOB 4WDIB 4Y4KC 3T8XB 5CGYC 3NIFE 1A7BA 2VQ4A 3QIWA 2M2DA 3VWKD 3PREA 4PW4A 5E2WH 1YMMD 5GRUH 3ULUH 4GO9A 2AF2A 4BK5C 3HB3C 1UOWA 5ILTH 3W39B 2BIOA 4IBWA 2DBJA 3L3OA 1ETB1 1IILE 1NL0H 3BX7C 4M03A 4G7VL 2CRMA 4MB1A 4N2FA 4OZ4B 2MPAL 2XZQH 5AYQA 3ZK0A 2AJSH 4JLRA 1KB5H 2KDYA 5JHDD 5FHBL 3OAUL 3GGWB 3JWNC 1F4YL 3MUGB 4U49A 2V9UA 1I53A 1XF5A 4TUKH 1XXDC 1QPPA 4QHMB 2HLEB 4MJ5B 3KJ6L 1R3HA 2IMNA 2YKLL 1XL4A 3P69A 1KYAA 1L0QA 1PBYA 2WUBH 4A38A 1A3LH 2HUHA 4GW5A 1JV2B 1KPVB 2EE3A 2DQGH 3NG5A 3CFIC 2XNAA 2E27H 1VEOA 1EMTL 4GIAA 5FO9A 1DVQA 3AQZA 4N2MA 2ATAA 2K7PA 3HI1B 3PAZA 1DQMH 4MJIE 1HZHH 4AT6A 5CJBA 1INDH 3QCVL 4RQQB 1OP4A 4CW1A 3ZOAA 4FL4C 3WL9B 3HNVL 3CLEL 3JXAA 5EOCL 3M8OH 3V52H 1AIFA 2NY2C 1NCBL 4JG0H 32C2B 2A9ML 4DKTA 4NO5B 2YGVA 2AHIA 1JHTB 5K93A 1W72B 3KPRA 4YS4A 3GYRA 4N68A 1A6VL 3C60D 2GBUA 4F9PA 1LK2A 3NRQA 1CU4H 5F1NA 4WI3A 2J6EL 3SPGA 1IGMH 4X8JA 2EDBA 5CFHA 1V54B 3IXAB 2R4RH 1WZMA 1OTUD 4PCKA 1FVCA 4XX5A 5HHMD 3FRUB 4UM9A 3HB3D 4D7BA 2O6DA 1M7UA 2RA1A 4LPQA 1WP6A 5FO8A 4U1IB 2UUDH 4IRJD 4O4YH 3F62A 1I85C 1NCCL 1LDSA 4JBSA 3CFEA 3IKCA 4LFHD 4U1LB 1KJ3H 1U93B 3NA9L 4YHIB 2F7IA 1PDKA 1YDPA 3D2UA 3ZZLA 3FXIC 4I88A 4MLIA 2V6HA 5C2UB 2P8MB 4QY8A 4F7PB 3G7TA 5KN5A 1KGXA 1KDIA 3ZDYF 1MRDH 1M57B 2WP3T 4JZNB 1J0KA 3CH1A 3OWEA 3RZCB 1FBIH 3FH7A 3GS0A 4CRPA 3K6DA 4LL4A 1Y6MR 4OY9A 1G6RH 2BNQD 1K9TA 4FG2A 3WLBA 5I1KH 4KTGA 4JFSA 4WUUB 3S3CB 2XN9B 3QPXH 4FGMA 2NY7L 2FTAA 4M6MH 4OAWA 1ZTXL 2PCPB 3LZPA 2C1PB 4XBPB 4QJ5B 1AANA 4ODSH 1KB5L 2FVNA 4UNTA 5FDYA 4NCDA 1AHWC 1JHKH 1UQSA 1OXYA 4M3JA 3ZL4L 5C0FB 3HS0B 2XN9E 3OJDB 2VLRA 3GF8A 1AR2A 4JY6B 5FK9A 1NBVH 1RURL 5BVJA 4ZUTB 4ZUSA 4JB9H 3HRZC 1RLWA 2Y1VA 2NY7H 4PRAB 1BFTA 1WHOA 2VERN 4JDTL 3SGDI 4Z77A 2I9TA 2W80C 1KYOK 4JFZH 2PETA 1RIHL 4JJ5B 2IBBA 4PN6A 5LGYA 1BQLL 1FHNA 5BS0A 2VMEA 4JFOB 3SHSA 3VGFA 3HBZA 4F92B 1S7XA 1TYJA 3IRCA 4EI5B 4UQCA 3W11D 2NYKA 4R90L 5C0AE 5FYKL 3VVVA 3EGXA 2HLAB 3RYMA 1UZGA 2X7LA 2CLVB 3CIAA 3KYAA 3GMMA 4JZJA 4YDKL 3DX7B 5BW7C 3Q2NA 3SGDH 4NKMB 1JFHA 4CMMA 2BFVL 5LNEA 3MYJB 1OM3H 1OD7A 4IS6A 1QRND 3VDCA 3B9EA 4HIIB 3H0TA 5C09A 5KYWB 5FFLA 5LAPA 1G7PB 1MDAA 2W9DH 1DJIA 2NY3D 3O6FA 3OF6D 2BSCA 1HX0A 2B15A 2A83B 5C0BD 4ZUWB 1W72L 2BSRB 2I9LA 5J1AB 1CG9A 3V8OA 1OGAB 3PNRB 4AKQA 4UQAA 5KVGH 2GKIA 1ZJAA 2IH8A 5C0BA 4P5KA 1J1XL 1IE5A 3ULSA 4YAQB 4EN2A 4I8DA 4NKOB 2M83A 3EG9A 1A3ZA 3TV3L 5IQ7L 3ARQA 4S2SA 5F7NC 5HYSB 4BFIB 4YVNA 3V5KA 4HC1A 1EQWA 3KYMA 5F9JB 1UXSB 4PRHD 5IMMB 3HC4H 1IGTA 1UXWA 5GSRA 3RA7L 1HILA 3NIFB 1QNZL 1AXTL 2VJ0A 3AROA 4FFZA 4JFDB 4ISVA 2D0GA 4P57B 4X9HA 2G4EA 5MEOB 4H40A 3LDBC 1C5CL 3O45B 3QQ4B 3EH2A 4PJDF 2XG4B 5T1MA 3ROOB 4CDHA 3JWNE 2V9QA 3K2UL 3QCVH 2YPVL 2OAAA 3VYOA 1I75A 1S3KL 2MSPA 2PP7A 3RVXD 3CMOL 1WRFA 4LAJH 1IBGL 3KWTA 1T6VN 4NHUA 2K4WA 2FCBA 4Z7QB 4N90D 4KI5F 3IVKB 3QFJE 5LNDA 2YN5A 3BO8A 1IFHL 4FAAB 1K2DB 1CB4A 3HIZA 4NM4L 5TH2B 2OL3H 4ZFFB 5IQNA 1MCWW 5CGMA 5JORB 4N25A 3QIBC 2E76C 2FWOB 3GSXB 5IHZB 5IJBC 3AM8C 3L5XL 5MEPB 1M05A 5CIPA 1EFXB 5T5NF 1VF5C 4Z76B 3AUVA 4KWUA 5FA3A 2AJSL 4Z5RB 3O3DA 8CGTA 5LQBH 1XGTB 4XT1C 1R5WB 3VG9B 3UAEA 5IV2B 3ARBB 4JFEE 5C0GA 3QI9D 2WINB 1PNDA 1N2RB 2JE8A 2R7EA 4L48A 2D7TL 1U3ZA 3CZEA 5ID0A 5IGXL 1C5DB 3N1GC 3EGDB 4QOKA 3SDXF 1AH1A 1MRDL 5H35B 3F7YB 4Z7WA 5FAAA 3ZYOA 5GJSH 2ZQKA 3CWGA 3CZGA 1QPKA 3LMJH 4BSWA 3VD4A 3WS3A 4KTDL 4QRPB 1AGEB 1PQZA 4QRSB 4I18B 4C4KT 3VGHA 5DUBA 2W9EL 1UJTA 3EJPA 3ULAB 1SFHA 2XZCH 3BVTA 5CEZD 3BGMA 2DLIA 3O6LL 4RETB 3DJTA 3O6KH 1QRNA 3MROA 1DBKL 4WU5A 3TBBA 5BXFA 4E68A 3CDGB 4OUOA 1EDQA 1U8HB 5KSBA 4U1HA 4XVUD 3VJ6B 3V9CA 4X2UA 5DEGB 4ELDA 5JIQA 3MLRL 2D9QB 1OEZW 1NCUA 4NYLB 4TULL 3BAYA 3MMEB 2X9WA 4N1EA 1JNLH 4QRRD 3V0VB 2OMXA 3MLUL 1DFXA 2W0LA 3QW9A 4GRMA 1FN4B 1RK1B 4OJFH 4DK5A 2P80D 3HC3H 4FLHA 3L3GB 2CE6A 2IEPA 3F7PC 4PP2A 3A6OA 1KCBA 3IFNH 4U2YA 3S8GB 2JLPA 3MRGB 1ZT7A 4PMFA 3M88A 1QP1A 1D5IH 2OI9B 1LO0H 1UWYA 4PJIE 4ZS6D 1DL7H 3ARFA 3GB7A 3RVWD 3GKZA 5CJ8A 2Z0BA 4ES9A 1ZPUA 5HPMB 2VN4A 3II2A 3O3BB 4DQOH 1AOZA 3FCBA 3QNXB 3VWJC 3VXSE 5HYJE 4RDQF 3TIDA 3CFKA 4E9VA 4JY4A 3BH8A 1REIA 3NTCH 1HL8A 4WNJA 4WY7H 5ESAA 4F7MA 4KKZA 1GA2A 1JWSA 4G8EA 5EF0A 1MN4A 2M1KA 1PU0A 1TQCB 4LARH 4A7QA 2XWJA 4G1EA 2VLKA 4L37A 4M48H 2ZYIA 1CLZH 1MFMA 2ZX7A 2VRQA 3N42F 3ZHNA 4EUPB 4FCAA 4OTXH 3X14A 4PGDA 5C0BE 2ZCHH 5C2BH 5DQDH 4C4KO 1T1WB 2ZUWA 3VXQB 4UAOB 1NCWL 2Z31D 2Z4TA 1ZVSA 5C0JB 2R9HC 4J3OC 4WUKH 5GISL 4IRZH 4QXGH 2DWSA 3DETD 5DD1H 2PR9A 5D4QA 1OB1B 3L9YA 4ZNEE 2MKLC 1RIUH 2VH5L 2J8OA 3O0RH 5EBMB 2FEDC 1CFVH 3EO1A 2FGZA 1K8DB 4YN3A 1T2JA 4Y5VB 2EDXA 3KCPB 2K9UA 1R33A 2G9HA 2OMWB 1EEZB 3IJEA 2KZ1B 4H8QA 2IBZY 4LHJB 3S6CA 2O6FA 3OAZH 1ITBB 1B0GA 3G6JE 2NQCA 2VN7A 2QV2A 4MVBC 5C0NC 2CJTA 5FO2A 2DKSA 2QTEA 1IGIL 2FUTA 1CFNB 4HUCA 3OKLA 4F33A 3UBXI 4OIBA 5INCA 3L3KB 1P2CB 2JSFA 2H6UA 1HYRC 3H42L 4I9WD 4UDTA 2W0FA 3GMLB 4BDVB 2CIIB 2HX8A 2G0LA 4J27A 2H6PA 4Y9CA 2JKLA 3GDCA 5AVWB 3VXMB 2AQ3A 4R4NC 2F1AA 1CGSL 1JNNL 2UVEA 5FV2A 1JNJA 1R5IB 2KLTA 3PGDB 4ZMLA 4JCWA 2D4DA 3VYNA 2CIKA 2DQMA 2KL6A 2WVVA 4H0GA 4K3DH 1LEKA 3HMWL 3ECQA 3SDAB 4CN6A 3DPBB 3VWJB 1UURA 2C7UA 2WTPA 1RFDH 5E4EB 3Q5YA 4RRPG 5IMLB 1IBHA 4AYSA 4JPKH 3MUZ1 3AADB 4POZD 4NC0B 2R23A 3IMVA 4MJJA 4MNQA 4CC4C 2GCYB 1NFDE 4F37F 4PVBA 2WLIB 2VDQL 5JNYA 2VO8A 4BHUI 3QXWA 3SKMB 3LRHA 4XAKD 3KVDD 4I2XE 4IDLA 2FLRT 3NCBB 1E5ZA 4LEXH 4V1DA 2J4WH 3IDJB 2EECA 3LNFA 5EZOH 3DJ9A 1KGIA 3MA7A 3BLKA 4TQIA 5J8OA 1WGVA 2CG9X 2L4OA 1LE9A 2VIRA 3DDGA 4QTHA 5AAWC 2BXYA 43C9A 1BVLB 2HG0A 3L5JA 4U0QB 3SKNB 2UY7A 2QMJA 3RWDB 1J5IA 3S37L 2VR7A 4P2RA 4H8PA 3Q6FA 1UD3A 2N1TE 2NY6B 2IH1A 4PJBE 2DWDA 1PJWA 3SGEH 3QRFM 5DS8A 2K0RA 3GJFB 4MMXC 4UCFA 3BD3A 3BQUC 2IVFC 5T3XE 2AXGB 1BFOB 1FO0L 1N64H 2PWEA 3LRSA 4GUPB 3GHBH 3FUKA 4WFGE 4NSKA 3IJSB 4L8DA 4UOW1 3ZQWA 3NCXA 3VXRA 2BNRB 2PYEE 4FXKA 3GZQA 1G4MA 2XRAH 2R2HA 3ME0B 4OLYH 5D1XD 2GTZA 1YNKL 3BPNC 5B39A 4HCIA 4MJID 4UB0L 5ADOL 1QI5A 4GP4B 4LKXA 3P3TA 1SVBA 5IV2A 3LXBA 1GKOA 2KH2B 1RZ7H 1B3IA 4Z5RA 5ANMA 1OGPA 4Q2ZB 2W38A 1NCGA 4MXQC 1ZLWH 3MRLB 4ZFOA 5LVEA 3S8WA 1N4XH 1CD8A 1RPUA 2XQBL 1QBLH 4EKJA 2E8YA 1ZV5A 1KLGB 3C6EA 5D6DA 2ODHA 2XWTB 3REVB 1Z9SB 1PZ5A 3AFLA 3GIVA 4MNQD 3DDFA 3IPBA 4GRLA 4KMLB 4XOEA 4M4PA 2VL4A 4W6WB 4HIHB 2R39A 4YIQB 3V2AR 1U4FA 4YSAA 3GEFA 3F84A 4C83A 4G80B 1GGBL 4PP1D 5E4EC 5IREA 4JRYB 2WBJB 1MCOH 1B2WL 2HJKB 3NPZB 3W3BA 1VFBA 2RALA 5D96B 2WYIA 5DD3H 3FQ4A 4LDOB 2FHCA 4NO0A 1T1YB 3U46A 4NCC2 4AEFA 3O2DA 1QFPA 2FSDA 5IUCA 3TP4A 3R0MA 2J71A 2FEDD 1JPEA 3MRBA 1WIOA 4X80H 3QHFL 3MGOB 4N8VG 3Q9QA 3BE1L 5ICUA 1BVOA 1WZKA 2QSTA 3UBGA 2UY6B 5FCUL 3E3QC 3MBEC 4P2OC 3ZRFC 2H9GA 2PXYA 3MCG1 4AIEA 1EFQA 4P5KB 5TDNB 5AZ2L 2IQAB 1XGUA 2FD6L 4G43B 3FFCD 3EF4A 3FB8B 1MPAL 1T83A 2B1HL 1FF5A 5CU5A 5T3ZH 3CLFH 3KPNB 4APQC 3EZJB 3X2QB 2PPAA 4FQHB 4WO0A 4P3DB 4APQA 3O4OB 4YC2B 1UEYA 3BLBA 3IMRA 3CN4A 3SJVB 2V2TB 3Q01A 4P9HL 5D2LF 2XWZA 2XWDA 4FQXD 2VR8A 4HEME 2WWMC 3GPSA 4UT6H 2AP2A 2UZXA 2J88H 3DPBA 3KR3H 1Q90A 5L0QC 2CLRA 1GGIH 4N2OA 5GXBB 2HLAA 5IB5B 2N7AA 1ZXQA 1HNGA 3MLXL 3CPUA 2NOYA 4AUUA 4EI5A 1YNTB 1A7RL 5GGSY 2ZWNA 1VESA 1KLUA 2E6JA 4E5XG 4IKJA 1E5YA 3OQ3B 2MRYA 4HJ0C 4KROD 2WUBL 5AW3B 4FHBD 3MRHA 3VD3A 1HU8A 2OMZA 2WMPB 1YY9C 4I18C 1ACCA 4BKSC 3ZQXA 4AJVA 3TA3B 1Z5YD 4XWOC 1RL1A 2DLTA 2ZKMX 4A2LA 3FH5A 4HGMA 2NLJA 3P77A 1D5MA 4KJYA 1S7WA 1JZFA 5AKSA 3BPLC 3DTDA 4L9LC 4JY5H 4PVNA 4A7SA 4YXHH 1WAAA 3WMSA 2OW7A 3U9PL 4XMWA 4HYTB 3V0IA 3CCHA 4LK4A 1DE4A 3MRFB 2WNGA 4AVKA 3QFJA 1CDUA 4HLEA 3T2LA 4N9GA 2CSPA 3IXTA 3NSYA 3FQYA 1KCUL 1ODUA 4HCFA 1GAFL 3B6SA 3LVEA 2Y24A 3IKCB 2WXKA 1WBYB 1TQSA 4WENB 3RHWK 3RKDC 4WSKA 1JWUB 2EE9A 4UILH 2VLKB 4XNYL 1MUJB 4J3OF 5CWSB 2B59B 3M86A 3EXJA 1HOCA 4O51A 4P4KA 4JGMA 3SZ6A 3IAQA 3A24A 3BH8B 4TVPE 5DFTA 4IK6A 2OJEA 4OGXL 2WN2A 3K7UA 5DHDA 5DI8B 4XO3A 4PU2A 2DZEA 4GRWE 1RJYB 4MMZB 2KQMA 2WXLA 2QDWA 1NUNB 1A8JH 4DVRL 4BA0A 2NCMA 3A3YB 5TJWK 5DD0L 3T8VA 5DJXA 3KPLA 1THAA 1JYVA 2EIEA 4GRMB 5DJ8A 2ZSVA 4DTGH 4EOWH 1XSOA 3PV6B 2CUIA 3GMRB 3REWB 2X6VA 3INUH 2HFFA 4I9XA 2H1XA 3KG5A 1KCSH 3L3JA 2XV2A 4M4RA 4G70B 3HVDA 2N1KA 4ZMNA 1OCWL 3TO4A 3PDOB 5GZOD 3LD8B 5J6GA 1XF2A 3MV9E 4L4TD 2E47A 1DJZA 2G4GA 3LZFL 3D06A 1QLEB 7TAAA 5EIIA 4MAUH 4WFHD 4YDMA 5SWSB 3O3EB 5GGRY 4HV8A 4WO4A 2ZCKL 3DVNA 1UM4L 3W5NA 4W6YB 2NY6D 3VXNB 2YGPA 4IHOB 3M17B 4J23A 1S7RB 4LDCA 5FHAL 5KWYC 3C5ZD 3P54A 2E7HA 3RX9A 4H0LC 4Y7OC 4YZFF 2JJUA 4FXGB 3JV6B 4RRPM 5FOBB 4HJJH 1S7UA 3RRQA 4RAUA 3O3AB 3O2VH 3WHXA 3ARXA 1PLCA 1HWGB 2HN7A 4JQXA 4LPVA 4MMYA 3D4GA 4OQTH 5FB8A 1DN0B 2ADGB 2X5PA 2EYSA 4TSBL 3BP5B 4ONGL 3TN0C 3HZYB 3VFPA 2KHAA 3INUL 3WNLA 5K1VA 1CICC 4LGSB 4XOBA 3AXLA 1TVHA 4OU3A 1I3RA 3IE4A 3QPXL 4M1GH 5ISZD 1B0IA 4P2OD 1JXGA 2OZ4H 1DBMH 2JKJA 3W9DA 5AVYB 3RWIB 3PWNB 2P43B 5FM8A 4FEIA 5KBPA 3WEXA 4X4MA 4LSPH 3PIQB 5IMOB 3PLYA 1MRCL 2DM4A 4S0SD 4PG9A 1IIKA 5HXMA 1HNFA 2Q3ZA 3HBPA 1KTJA 4BZ2H 4W9HC 3K81A 5KYUA 3KEDA 5B8CB 2I7OA 3ELQA 3D39B 5C6PB 4OGXH 1IMHC 5F88B 2B0SH 3NCFB 1QFOA 2Y07L 3OHXA 3HEIB 2Q76A 3OJVC 2RAMA 2QQLH 1ES0B 2VUKA 3PWJA 1AR1D 1KXVA 4QR7A 2GITB 5B8CC 3U0TA 4KTDH 1FE8H 1T20B 2AEQL 2IC2A 2DEWX 4A37A 3EOTL 5BZXA 3FO2B 2I5YH 2V9TA 3V0HA 2YSSB 4UBDC 4AG4L 5LN4A 5DT1L 1R3LA 3SE6A 1IGTB 4KRNA 1J88A 1SN2A 2XN9D 1AXIB 2HUEA 3UJJL 3VRIB 3SZKC 1BJ1H 5EU6A 1NLBH 1UM6H 4IMLA 4J6RH 5C0DA 3DOIA 1T22A 4JPWL 2Q8AL 4HCRL 4NBZB 3SOBL 1RHHA 3B9AA 4XO4A 1KB3A 1A4AA 2YIHA 4FQIH 4YX2H 5C0BB 1EEYA 1KEGH 1NMAH 4N90E 2BW4A 4GYBA 4J2XA 5CSGA 4ZMWA 3BH9B 3HNVH 1ND0B 5EOCH 2KZWA 3V0DA 9PCYA 1B4JH 4JFVA 1I9JL 2R1YA 5H4ZA 5DRNB 4PJBF 1CN4A 3O11B 4QF1B 4KKLC 1NM4A 3TBWA 1U3JA 2AK4E 2IG2H 2NNAA 2ZNWA 4MFHA 1CMOA 4X6CA 3II1A 4YDNA 1A7QL 3O3AA 4WQOA 4TRPL 3BESR 1JXFA 4U6YA 2Q2EB 3QH3A 3EOTH 4LGPB 1MI5A 1EXUB 2GK0A 3PL6C 3EGXB 4KVNH 4OGYL 1WO2A 3CVHA 5JYMA 1N10A 1QFHA 4YGVB 1JYXA 2OM5A 5E51A 3SKNA 1ZTMA 1P6WA 2QADD 1OLLA 4PRBB 3L4WA 2GY5A 5EIIB 3MOBL 4KXZI 4D8PB 2GJJA 3O4LA 3Q8BA 5F89B 3ES6A 5H37H 5LBGA 3F01A 4IMKC 3MCLL 1L9RA 1QWHA 1XB8A 4H8VA 2FH6A 1WFTA 2QGEA 2VUOA 4NM4H 5CP3A 1A6WH 4JHUA 4CBZA 4NC1C 5J5EA 4OAWB 1BXAA 1CBVH 1L9TA 2DIAA 3OKDA 4WUUA 4M62L 4X9GA 3SB3A 2EKJA 4WW1B 5A43C 4QHNB 1J18A 3TO2A 3WI9A 2OR9L 5I8CB 2WPGA 2HKLA 4KJWC 3FO0H 1T1XA 4OSUH 4NJ9H 2ZSWA 3MTRA 4RFOH 1AGBB 4UIKL 2J8UA 2O5ZL 1QNZH 5T1KD 3QIWC 3QDJB 3NJMA 4RWHA 1R75A 3ZIMA 4GBXA 3AAZB 3V7MA 4HGKC 2G60H 4FHJA 3VQLA 3FB6A 3Q6GL 4D3CL 4ZUUB 3HAEH 5AB9A 3P4NB 1G7JA 3FCSB 4A67A 4MCZB 2XSKA 2XIIA 2XVLA 3SD5A 4HMDA 2Q86B 5F1NB 1DEEA 1ZPLA 3MGAA 3QPQC 1HK6A 4X9IA 4XOAA 5MP6L 1HNYA 1EBPA 2Z4QB 2LOEA 4JO3L 1OO2A 4KDTA 5JOPE 2K4AA 4TUJB 2A6KB 1K8IB 2X4SB 2HX7A 4BCXA 2OZNA 1DQQA 2FAUA 1E6OH 4JFFA 4FP8H 5D96C 2EVJA 1NAKL 4HF5L 2IDQA 1JNLL 1QBBA 1QSFA 4K2UL 1ZTXH 2HB0A 3A4DA 3BP4B 4KPHL 4TXVB 4J3OD 1U4EA 4H88L 4K5OA 4X5LA 2L8AA 2Z91B 4QKXB 4ZX3A 3CFMA 4MDIA 3HI1A 4BM7A 5IW1A 5EF3A 4CNIA 3D87B 2CHDA 5FO9B 4ZYKB 3NIDB 3TH4T 4ZD3H 3FNKA 4L4TB 4GP8B 2XWJB 4L37B 4NZUL 3HPJA 4N86A 4QRQB 4Y8AA 3TJPA 2AJZA 3C2SA 4JQVA 2ATKB 4ATTA 4DW2L 2Z93B 3H9ZA 4NJAH 4X6DE 1NWOA 5TE4H 1ID5I 1O7VA 2W9EH 1A4BA 3T77B 3VI3A 1HEZA 3L9BA 4KUZL 2WLMA 1S9VA 2Y0SA 3ATAA 1RUMH 3GXIA 2AXFB 1FVDB 2V17H 1EHXA 2B3IA 4KI5C 4TVPH 2EUWA 1E6JH 3QAZC 3MRKB 5D4HA 2OR8A 2NW3A 5I2IB 5IMKA 4RDBA 4G82A 2HVJA 3L4UA 3AU0A 4XH2A 4IGBB 5ALBL 3MRPB 5AW5B 2J6WA 4HS3A 3WIHH 4FKHA 2GT9B 3MACL 3FKUS 5ECGA 1R3LB 5L2KA 1FO0B 1FN4A 2NUPB 1KTKE 5AW9B 3T9WA 4AGPA 4KVPA 4Z7WE 3BH4A 4XC1L 1FLRL 3MJ8A 2PP8A 2BP8A 4K15A 3Q43A 2H9GB 1I1YB 1ZTXE 1A6UL 3VSTA 5T1LA 3QVAA 1KXHA 1HIML 3CC5B 1RQ5A 5DVMA 5JHDE 3MBED 5HVFB 1I1AD 4L3FA 2DWYA 5C09D 4PJCB 2GSGB 4Z7VB 1DVFD 1DVUA 2ORBL 4OCYH 1IRAY 4X6CF 3WS3B 1Y0LB 3BDBA 3CN2A 1A6UH 4KX8A 3W9DB 3WU1A 3C8DA 1DVSA 4Q0XH 2UX7A 2ZUQB 4HK0A 4UI2A 1C5DA 6PAZA 4OZGA 3GSWA 2E7BA 4PGEA 4F1SA 3RX8A 1BPVA 4JRYA 2NZ1A 1JS4A 4FQLL 3HZYA 5I1IH 4L5FL 3QEUB 2KMWA 1FZOB 1QFUH 5EMYA 3T09A 4LOUC 1JF1A 4UU9A 4MMYB 4C58B 3REVA 2P52A 3D48R 4GOSA 4M56A 4WTQA 4UYPA 4IOFC 5FO7B 5T3ZL 4RH4A 3P4MA 5D7IB 4ETQB 2HKFL 25C8L 4FABL 4DT2A 4N3UA 1P5UB 3O81A 4FQLH 1TQCC 2B2XL 2A74A 3EYUH 1CXKA 1CZ8H 1G7MA 2DICA 5KVEL 4ODHL 4WO4B 5F7WC 3V6BR 4EN3B 1D5BA 2LU7A 4PREA 4NGHH 4QIRA 5SWSA 4UYQA 3OKNA 1ETZA 2N01B 3S3BB 5LXGL 2CDFB 2VE6B 5AL0A 1TTUA 5D93C 4P9HC 2HTKC 3I9IA 3OQRA 1CDGA 2DQTH 1IQWL 1MEXH 4IU2B 3P4OA 1YZZA 3F58L 4G7SB 2FLBT 2K3HA 1ZLDA 4I48A 2WLLB 4C55A 4LU5L 4CA4A 2Z8RA 3FTSA 1J8HB 4MQXC 3LY6A 1LO4H 1DBAH 3AREB 5EBGA 1GJIA 4P3WA 1FC1A 3V5KB 3RJQB 4KRMB 1O6TA 4Q9RL 3MNZA 2E7MA 4PHXA 4TVSa 3MXVL 1FYTB 3FFCE 4XBGB 1INQB 3ARBD 3RKPA 5TE6L 4XO5A 2MPAH 2XZQL 3TBVA 3DX9A 1NAMB 4ZW8A 5DJ2B 1P69B 1KCLA 5BCAA 4UV7L 4K7PY 3KBFA 5E5MB 3JV0A 1EA9C 1G4RA 3MNDA 2RACA 5DI8A 5CKAA 4GAJL 4Y4HD 3RWCA 2PLTA 2Y36L 1ZK5A 5D6DC 2DEYX 3S5LB 4DPBX 1BAFH 5DZPA 1YHPA 3IKKA 4XRCA 5BMFL 1BX2A 3KWWB 3WTXA 4C57C 2JI2A 3BVNB 4HWEH 4Y2DA 4HUXB 3GSOA 1CDHA 3IETB 3LEXA 1G9ML 4JKKA 1YEEH 2UZIH 3TZVD 1LL1A 3W9EB 4NWTL 4PRPE 1JMXA 3W1ZA 3K0YA 1S7RA 5E2UL 1L7TL 3B3IA 4WTWA 2EJ1A 4NX0A 2DPKA 4F2FA 2NNRA 1DE4B 1S7TB 4WI6A 5KVDL 2LHAA 1JF5A 4NDMA 1D5ZA 1L6XA 4KTEL 4PJ7B 4UNIA 3ARYA 3ZE1F 1O9WA 4Z7UB 4ZQKB 1HHIB 5JHMA 4V11A 3O2WL 1J0HA 4MA3B 4RX4A 1JG9A 5A2KH 3V9FA 2MFNA 3LZNA 2EQDA 1UB5A 5C0CD 3ZDYE 4PS8A 3V4VH 2B9BA 3NIGF 2YD2A 1KSRA 1FFQA 1RUAL 2QQQA 4LASL 4WEMB 2NY1C 1EWHA 1W9XA 1Y1DA 3L54A 5AG8A 3FFCB 3U4AA 5HYEA 5E1IA 4AE0A 3N43B 3B5HA 5FW6A 2N59A 3VE0B 5F1KC 1LQBC 3UPAA 1NCCH 3T08A 4JZNA 3EXLA 2C26A 1MNUL 1ZWIA 1MFDL 2APWA 4HFWB 3I6LD 4NRZA 3NH7L 1RJYA 4XBEL 3BVVA 1IFHH 3D34A 3ZU8A 3B3IB 4WHYH 1DQML 2ICEB 2WNXA 3EBAA 1GS7A 4YBQC 1CDJA 3TVMD 5DJAB 4JL2A 4E5XB 3DETC 3KXFA 4JHVA 4ZPTA 5EORL 1RUML 2JQAA 3KJ6H 4HUXA 2HFEA 1JPTL 2CPUA 1QSFD 5ANME 2AK4B 1AG0A 1KYDA 3MV8D 1Z9OA 1H3XA 1LK2B 4GI6A 5GZNA 5B4MC 4BUHA 3RA7H 4DAGL 4IRSD 3H9SE 4X8JB 3HR6A 3SE9L 5ISZA 2OSLB 4NKDB 4Z7OE 1XBRA 3ZRCC 4GKLA 4BKTC 1LQSR 3DSFL 3ZTDC 3I6KA 4WVRA 3OSVA 3HFML 2ZP9A 3QULA 4PGBB 1SVCP 2R69A 5AOMA 4DVBB 5CBAA 5JIPA 1WFJA 2DYSB 4G42A 1BZEA 1LEIA 4R83A 1T0PB 1KLFA 5IOPB 1RZKH 1VFAA 3WL9A 5INDB 2DQFA 1M9WA 4GUQA 4J8RB 2EIDA 2H0PA 4RGOH 2X2HA 4A68A 3RDTB 3LKSB 4FQJL 5FS5A 1DJGA 5HGGS 2WP3O 3O4LE 5DK0A 1R4XA 1RJCA 3MLWH 4CVZA 2CBQA 4Z0BL 3TIEA 1U8HA 4K0OA 4A6YB 1Q9LA 2DQ6A 1P84J 4I9WE 4JS7A 1K6QH 1JHLL 4UOJA 3QDMA 4A55A 5DFWH 4K55A 4PB9L 4YHPB 2YPLE 3N91A 5CEXB 1PX8A 2AQNA 5F2FA 3EUUA 1BGXL 5FWRA 1PZ5B 4DNLA 3RUGF 3KMDA 1N19A 1Z5LB 3KAAA 3FQ1A 4KQ0A 1E8YA 4XC3H 1ZSHA 2R1XB 2QQKL 4M7LH 3SD2A 1BIHA 5DHVH 5CLYA 5J06A 2XV6B 4W4OA 2XVBA 1S78C 1URLA 1XGZA 2BNQA 2WINA 3L3OB 2ADIB 1AC0A 1JPGA 4PV9A 2EIZB 4KO5A 4WTXA 4CVUA 5EFIA 4XE0A 1ZE3H 1TETL 5JUEL 3AB0C 3MOBH 3O2VL 2W0KA 1I85A 1WCBA 3KPNA 2VDMH 1BQSA 4ALAC 5E4OA 1BEYH 4PUBH 1OPGH 1S78D 1GOHA 3F7LA 5J57B 2IGLA 4EOWL 4OZIB 2XYCA 3F8UB 3G9VA 4L8CA 3OX8B 3U4BL 4M6OL 3HZMB 2E7LC 1FBIL 2WQUA 1MI5E 3BVDB 3NCWA 1D5RA 1QUNB 1GY1A 3RLSA 3FMGL 4Z7VA 1DBML 1SJVA 4PJCA 1QLEL 4HKXA 1E28A 3VD2A 1FL6B 3D30A 4WO4D 5HYJD 1B2WH 1BVLA 3M1BA 3RPBA 1DLHA 2AAAA 1A8ZA 1S9XA 2GFBB 3IMSA 1N5YH 4NO0B 3SBWA 2NQ3A 1NCAL 1XGPB 1KXQA 3EW3B 2VZVA 1JUFA 1QFWM 4R5VA 2YA0A 4XAWH 2P48B 8FABA 3QQ4A 5T1MB 3JWNH 2YAOA 2IFGA 2IV9A 3RWEA 4TYUA 1MAKA 2X0WA 4XNDA 4N0UE 4R84A 5DVLA 1YUHB 3EJCA 3DRTB 3MBXH 3UACA 4GRLC 4W70A 1RP9A 4X6EA 4OLXH 1Q94A 3NIDF 1BM7A 1U8OA 4IGBA 1M7IA 3KLLA 5DD0H 2WV3A 5T3XL 4BKLA 4UOW0 2QVMA 2EDTA 1TCMA 4GAYB 4IBTA 3MRCA 4M5ZL 4MX7A 4JZJC 4PJFF 5EN2B 5E08H 3IFLH 3L16A 2B1OA 3VX0A 3DX6B 3H55A 3UBXG 3IDIA 4MSWB 1T21A 2CIKB 4Q4EA 1MOEA 3MQIA 2K6ZA 2XZCL 3PGDA 2FJGA 4LLWB 1U92B 3GTTA 2APTA 2EUXA 1PYWA 3P2DA 2OL3L 2NY5H 2MTPA 5E2UH 3D6GA 1UJ3C 3EZ8A 1G7PA 4EE2A 2VN5A 2AMUA 4ZSOA 1W0VB 2J88L 3F2LA 2AXWA 5EU3B 3OD3A 1LO2L 1SY6H 2ATKA 4I3GA 4JMXA 2YXVA 3NZUA 4U1NB 2NY3C 5E00B 3UBHA 2Z31B 1PLGH 2CDEB 1OB0A 3I02B 2BWDA 2VLKE 3HZVB 3GSNL 1DJYA 3LX9A 1Z0NA 3KPSE 3QC5X 5AVZB 4AQAB 1MFAL 2EDNA 3BQUD 1JZ3A 2ITCA 1W0YT 3QIUC 2GAZA 3RFZC 1MWAB 4MDIB 3D8MA 2CM6A 3K4DA 3RY5A 1GOGA 1TSHA 2QQLL 5KTEL 1MLCA 3BLPX 3KPSB 4O2FA 4F58H 1M42A 2UXVA 3QIWD 3D85B 2LLGA 2HRHA 4LCWD 2EUVA 4GEIA 4IBUA 2MTZA 5FK9B 2WZ0A 3TBYA 5KS9A 4HD9A 1BF2A 3N5AA 4K8RH 1L9PA 4TSCH 4BWTA 1FCCA 4XMLL 1ZJBA 2LV4A 4Y1AE 4EEEA 5EZLB 4NAQA 3NJIA 5JNYB 1KIUA 2IANE 5TDPA 3WY2A 5HDWA 4WV1B 2YPLA 3CXDH 5EWIH 3S5YA 1A65A 3HN3A 1F8TH 5ICYB 2O72A 2VXQH 1MJ8L 4PYHA 1DJHA 5CILH 3AG2B 3PWLA 4NO0D 1NFKA 2MQ0A 1PW3A 1T7YA 3UYOD 4UQ3A 3FYEB 1F5WA 2GBVA 4U3SB 3ARDB 1W0WB 3T6XA 2G3NA 1J86A 3OX8A 2ICCA 3EHBD 4XX1G 1MF2H 1F8TL 4FFWD 5EF2A 1ZT7B 1IC4H 3V9EA 5G5DB 2QTVA 5HD8D 5F1OB 1RI8A 3BKJL 1KFAL 1UD8A 2WYTA 4QCIB 4B9FA 4HGWB 1DBJH 5EO1B 3VG9C 5JYLA 1ECYA 4UQIM 2MCG1 1S9YB 4PS3A 4ZTEA 1ZT4A 4P3CH 4PRIB 4APQD 1GC1C 1ASOA 3SBQA 2FL5A 4URTB 3BDXA 5DQJA 5B1BB 5C8JA 4XMKH 5L2KE 3HE7D 3CZNA 3CSYA 4Z8FH 2DJMA 5KANG 3K6SB 4BHUA 1INEH 3D0VB 4ZO6A 3LVTA 4FMFA 4PJBB 3TBSA 4DGWC 3NN8A 1IL1B 3MXWH 1E3ZA 1YEIL 1OQXA 4M6ML 5EZJB 3SEPA 1A1NB 4OJFL 1A3RH 2C8NA 3BGMB 4PY7B 1N7MH 4NQCE 4X7TB 4DEWA 1GGUA 2BH0A 2EDJA 1U8MA 4KRPC 1WWWX 4A6YA 1G1KA 1HHGB 1AGCB 4B5ZA 3ZE2E 1CS6A 5DMGD 3TTSA 1DUYA 1JK8B 2CMRL 4P9ML 4Y19B 3CXDL 1XR8A 3EKCA 2YA1A 4GPVA 1URZA 4UQ2A 2ZD0A 3CQFA 3DHJA 4Z7NE 4JFZL 1ZT1A 1A5FL 2FRGP 1MI5B 5HI5D 4XZUB 3QH3B 3V5DA 3OZ9L 2EXYC 1HE8A 3APCA 2I69A 4QWWC 3RGHA 1N59B 2Y9RT 4AIZA 2BVTA 4OVUA 5HDQH 5JPMA 3TNMB 4JRYE 5I6NA 1U8NB 1LE5A 4X8GA 1IAOB 4X7EC 4B9IA 4JY4B 1XGTA 2YQGA 3MGTB 1HZLA 5HYIA 1VEMA 2YD9A 3K6IA 1B0RB 4OT1L 4X8XA 5FECB 2F9BT 2NT0A 4Y5XB 4NZ8A 1R9FA 4JG1L 3UO8B 3PP4L 2G30A 3ARFB 4RAVB 4HIXH 2VSMB 3FK3A 3NT0A 4KXAA 5I6XB 4LOEA 3PXLA 1DBAL 5E6ID 3H1ZA 2H3NB 1SEQL 5DK2A 4DKAA 3BDYL 1HL9A 2P5EA 3KLHD 5AVRB 3ILQD 2BP0B 3V6FA 2P3YA 4GXFA 2DAVA 4UV4L 3MV8A 4H5SB 3VQMA 1GCYA 3A6CL 2DQUL 1CWVA 1FFTB 1EUTA 3ZG4A 3OZKA 4CSSA 1QSED 5F9WB 3O6LH 3ZHKA 4K9EL 5K1NA 3G6JB 2JWYA 4ODWA 4Y19A 2A73A 4R7XA 2Y3AA 4B41A 4WK0B 3BIBX 4F27A 1A4KA 1NPNA 3ZLQC 1TUPA 5IROD 5HHME 3TONA 1QRNB 4WU5B 4X7TA 1ZWIB 5F88A 1HILB 3VCLA 3H9SB 2P28B 3IAGC 1R5VA 3QB7C 5B3NA 2Z1KA 5IB2B 4KH2A 4OZHF 5FGSA 2WNKA 5BV7C 4N2IA 2XQ0A 3MCYA 1YUKB 1UGKA 3TBSB 5EZOL 1FZMA 3QFGA 5C07D 3N06B 1YEHL 4LEXL 5CP7A 4ZFOL 3BGAA 5KBMA 4TNVK 5KJ4A 2OMNA 3H2QA 4KUZH 1YC8A 4HC1H 1UB5B 1YEIH 1OOAA 1HKLL 2WSKA 3PQYB 3MRNA 2NR6D 3TA3D 5SX4I 2F5BH 1S8DB 3OZLA 1QFWL 3M1OA 3ZE0B 3B37A 5L88H 3H0TB 5KYWA 3BPCB 3WSQL 3HAEB 1G1OA 2J2ZB 2ZUUA 5I66A 2NY2B 2I25N 3US9A 2BHUA 5I19L 5ABDE 2MQGA 1KTLA 4PG2A 3IDGA 5LAXA 2YGNA 4NO2A 4GW4A 1N9PA 3TWCH 4PJDB 2E5EA 3AS2A 4G6JL 3GNML 3BWSA 4JQVC 5JO5A 5BW7A 4N0FA 4N2NA 3D2TA 4J8QA 4DPRA 2PWDA 2O5YL 3BFQG 3U30C 1PGRB 4LPXA 5DD6B 5CR1A 1NZRA 2XN0A 3EH1A 3RJOA 3WAJA 4UIKH 2IANB 3BKYL 4YR6B 5JDSB 6FABL 2BSSA 2KC0A 5IHHA 2WTRB 5E2JA 3BZ5A 3HE7C 3QYNA 3G6DH 2DN7A 2I60H 2GC4C 1I8UA 4N20A 2JIXA 1BYPA 4M3KB 4PJHF 1BP3B 4QT5A 3L48A 2NMSA 3DBXB 3L3JB 2C1PA 4XBPA 3NDZE 3ZT6A 1G0YR 2D9CA 5HYFA 5C9JB 4OCRL 3B3BA 3REWA 5IBUG 5TQ0L 3WN5A 4JE4B 2ISDA 4ABWA 3MLRH 5CZVH 4J3UA 5I16B 1GGBH 1HI6A 5IQLA 2E9IA 5K9QI 5T1DH 2YUZA 2I60L 2AQTA 3ZT5A 5T1JA 2B3RA 3MRDA 4KNQA 2K3TA 4JRFA 5IG7B 3BJLA 5LXGH 4JO3H 4NNXB 4HP5A 1TIUA 3NUKA 2PN5A 3D25A 1I8MA 1E27B 5TE7L 1LEGB 4HX1A 4ZUWA 3EBHA 1S9WA 3IT8D 4YHNB 5E00A 4NHCL 4H0HB 5FO8B 4LU5H 3MLTA 4TM9A 3WNJA 5H37A 2CO2A 4M1DL 5SWSD 1YPZF 1A66A 3ZXAC 2FATH 4LLUB 3B2UD 3X1NA 5I76A 2CJSA 4JVUA 1JWUA 1UKSA 2GJPA 4N0FB 3RUGA 1RUKH 1WBXA 4YSTA 12E8H 1KIRB 4HIPA 1EHLL 1CLOL 1GL4B 4KK5D 2NTFB 1A7NH 2DIEA 2W88A 4RAVA 4K71C 4RISL 4Y2DC 2GJ6B 2EAEA 3UPRB 1XGRA 4YQXH 4DGYH 4XR8C 5AAPA 1F1GA 4NB7A 1AD0A 3JZYA 1V8HA 2B5IC 4AEEA 3EGSA 3L8QA 2OMUA 2F18A 1WD8A 5DZOA 5D72L 1AKJB 5JZ7C 4RGMC 2JCCE 5C0FA 4AT6B 2DWXA 4OZIF 4XCYA 1JUFB 8FABB 2EDRA 3FTXA 5IQOA 3APMA 2VDOH 3F6IA 1ETA1 3BAEH 1HAUA 2G5UA 4Y4FD 1OE1A 2NY0B 3HMWH 2MQ3A 1YY8B 2X4OB 4YDJA 1XDTT 2HVBA 4U1SB 3FQRA 1J1OL 1L3WA 1OZUA 2XHNA 5ID1B 4N26A 2DTML 3MTXA 3DO7A 2EEDA 4NENB 3KWUA 2JJSA 1PZAA 1OT1A 2NRDA 4G6AC 3Q13A 4TMPA 4XXDA 4Y88A 1OAYL 3UMTA 3U0PA 1OT2A 1RUKL 5FYLH 4W9JC 1JVLA 1CD9B 1SXCA 3LYRA 2CDGA 4HWEL 3C9NB 4JHZA 4Y0GA 1F4AA 4ODVL 5D7EA 5AW2B 3UYRL 5IFAL 2XY2A 5D7LA 2CCLA 3SOBH 1QSEE 4OZ4A 2XACC 2O61A 2N0KA 3ZT7A 3MR9A 2YBRA 1E9QA 1YN7A 4IRJC 1YNLH 5CD3B 1BQHG 3Q05A 5E1GA 4Z3HA 5IJDC 2H5UA 4XXWA 1A6VH 3O4OC 1AHKA 4YC2C 4LCCA 1EEQA 1I7TA 4LSUL 3GMNA 3BD5A 4R6UA 3ESPA 5JHDB 2I27N 1TTBA 3CFDB 4JM4L 4PS4H 1RPQA 3CSFA 4DGYL 5EEUA 3L7EB 4GKZA 3KPRB 3OKMB 4U6HA 2VQTA 5ENWA 2NSXA 4ZPVB 1U95A 1VEPA 3IPEA 4N1CA 5JHAA 1QUPA 4KTYA 4I77L 1RULL 1RVFH 1WS7A 2AZAA 3ULUD 4ATWA 5IJVA 2ZJSL 5DWUL 4UNUA 2LVEA 1YYCA 4HG4J 2B7DT 5DT1H 2BHFA 2CJUL 2CRYA 2Q7YB 3BZFA 4EI6B 2H8PB 5AG9A 5D1QB 3VGDA 2XPZA 3BKCH 2PTTB 3ECBA 3V5DB 5DHXB 2TRYA 1FLTX 2IWFA 5FGBA 5FYJE 1BLNA 5JHBA 2B5IB 5I1EL 2VXSH 1HSBB 4GMTH 1HXKA 1H15A 3VD7A 5JW4M 1MAJA 2OCJA 4OD1L 1BXXA 4YQXL 4TSBH 3RWHB 3FN0H 3FUDA 4PQXA 1MZYA 3HI6H 1FNGA 1KC5L 1JHKL 4OLVH 4A6YH 5BQ7A 1E67A 2YK1H 3QORB 4N87A 1QSFB 4JPQA 2DL2A 4KGLA 2BPBA 1U8LA 4AGOA 4I3RH 3QR1A 1RERA 4Y2OB 3JYBA 3QISA 1CL7L 2Z3FA 1OWWA 1HEJC 5A40E 1W72H 4DP1X 3ZMNA 4LPYA 1H8SA 4ZMZA 1RVFL 2GAZB 3PV7A 5KVGL 4DP6X 1NMBL 2ITCB 3HZ3A 1D5XA 4KVCL 1I7ZA 3DXAE 5I24A 1LLAA 4PRIA 3T6VA 1L9SA 1MIEH 5IWLA 4IIQC 3FT2B 4NZRH 2VLMD 2Y22A 3AT8A 1WUZA 3GXUB 4GT0A 1MCIA 1B2YA 1CFSB 3IJHA 3KYKL 2YBRB 3PWPD 1JDDA 3PWUB 1OM3L 5EOTB 4ZBJA 3ILPA 4AQ1B 2IH3B 2JCCB 2WLYA 2ICEA 2VXSL 4HETA 4KV5F 2B2XH 4AYMC 4IJ3B 2N4IA 4TKWA 1AGBA 1DR9A 3NIDE 4PWHA 4U05A 5B38B 1F86A 1E2VA 2NZ9D 3CMOH 3VFMB 1E5UI 1MFCL 1PD1A 2UWEE 3TO4C 4TTDD 5F0LB 5I23A 3DROA 4G3YL 4YSCA 1FZKA 5HHXL 4JB9L 3B2UC 3KL3A 2WB7A 2KLSA 3FU0A 3I6GB 1KGYE 3NCCB 2AAVA 4WUUD 3U9PH 3TM6A 3U79A 3FN0L 2WLNA 4PTUA 2ZXAA 4UAOC 1ACZA 3CZKA 4DAGH 3Q3GB 4P2QB 4X6BA 4V2CB 2R4RL 3O4LB 1TTRA 3T3PB 1HQ4B 2R56H 3QDJE 5C09E 3HNTH 1G6RL 3DX8B 1QI4A 5F21B 4CN4A 5K39B 2VL5B 1FFNB 1CYXA 5GRVL 4OGQC 5FDWA 3I6GA 2PCXA 1DLHB 2IADA 3KPQA 5AVXB 4BH8B 4Y5VC 4BV1A 1E2WA 3R4RA 1QAWA 3P40A 2D3VA 2WXMA 4X99A 3SO5A 3LAFA 1CTNA 5IFAH 1ADQA 1HOEA 3CAFA 5GS1A 3VXUB 5JHLL 1XEDA 5B38A 1MY7A 1BREA 3DUUA 3NFPA 3OM3B 4LSRH 2EO7A 3QQNA 4PBWD 3LS5L 1CFTA 2DKMA 2HX9A 2BFGA 3ZKMD 4YHZL 5BO1L 4F3FA 3LZRA 1J8HD 1O7SA 3AY2A 4R5TA 1YSOA 4DUXA 3PWUA 4AQ1A 1NTDA 4Z7AA 1BZ8A 5DJYB 4GI9A 3VNZA 1OTSC 2RB8A 4OJDH 3RWCB 5EEVA 3ULUF 2CMRH 1H6EA 3GI9L 4F2ME 1UHVA 3LQAL 2ROYA 5C08B 5F44A 2Y06H 5BZWA 4HOMA 4KROB 4RSYA 3BUDA 2FYYB 4JW3A 1QTYT 3PDDA 3BSZL 1FQ9C 5ESQA 4YE4L 2DIJA 3CHRA 3PU7A 4OM0H 2ZOTA 1B0WA 1KBPA 3QFJD 4MNGA 1HI6B 2OSWA 3WKPA 5EEZA 2DWEB 3C87A 3CC1A 2CXGA 4IGBD 4WFFD 2FQDA 5L2JB 3P2TA 1HDMA 5CCHE 4J39A 3ILDA 4PLNC 2WQRA 1X5XA 3DUSB 3W81A 1TQBC 5KVFH 4AI7A 2D0HA 4DK3A 5CCKL 5JLZB 1SMAA 2H32A 3A0OA 1FNSH 2FX8L 2CUHA 4H8UA 1PTZA 4AZ8A 8PAZA 2RH0A 3G6JA 1L6PA 15C8L 4AL8H 3G08A 3NZ8A 4X0KB 3VFTB 3CVIL 3H3KA 4PJ8C 3JV4A 1N67A 4U7MA 4G1EB 4EQ2A 4PBDA 1TEYA 1R24A 4DN4L 1MVFA 1NUDA 5I15H 3OHMB 5DURD 3SQBA 5FYKE 4A7GF 1E6OL 5EIIG 5ILTL 3BQUB 2VABA 1TVHB 1OCWH 1NL0L 4XPGH 3TLRA 25C8H 4NPYA 2QPFA 4FABH 1UA3A 1QRNE 1RZGB 3EAKA 1FIGL 4YUEH 3UJTH 1KTDB 2F1EA 4ZOCA 2FT7A 1UWFA 5DJ0A 3L2MA 4IBQA 5DS1A 4JG5A 4PV9B 3NZHH 5LBSL 2ZXBA 1U3NA 4FTVA 4O2EB 1E4WH 1WAPA 4XZUA 1PFCA 3ZHDA 4UDUA 4UT9H 3CTTA 1EJ8A 4X4YB 3OXSB 1PSKH 4UMSA 3MR9B 4YK4C 2Z34A 4K3JH 1WICA 4PJCE 5GS3A 2CLZB</