5E1XA

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 3,4-dichlorophenol bound form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
169
structure length
168
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides mccartyi btf08
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
total genus 61
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1xA00
2P7CB 3ZMSA 5KK1A 3RYRA 4HX4A 5E1WA 4KIBA 1H9GA 1ZRCA 1KU7A 4LG0B 3EDPA 4HAMA 2J5OA 3BZ6A 3R0AA 5L3FA 1YIOA 2ZFWA 2PMHA 1FPQA 3F3XA 5L3DA 3CTAA 2ZXJA 2J5PA 5HLHA 2ETHA 4OIQF 2CSOA 1S7OA 5ED4A 1FZPB 5K5RA 4L0ZB 4GYGA 2LSOA 5K5QA 2MH2A 1YS6A 1UHMA 1STZA 1T2KA 3I53A 3BOQA 4LB6B 1R00A 3MZHA 1XGOA 1U5TA 3E6MA 2M87A 5J8CA 1NHAA 4L5JA 2M1BA 1YO5C 3LAJA 3L2CA 2VOPA 1Z9CA 4ZZDA 1YFHA 4FHTA 3WE2A 4ZYEA 4IRHA 3V8JA 1Z1DA 1W4MA 4LJZF 1SMTA 2CW0F 3RYPA 1CF7A 4DNCA 5LBQA 2CGPA 1ZGJA 4A5NA 3COAC 5ILVA 3F8FA 5HLGA 4YG2F 3Q5FA 2DPUA 3O3KA 4YFKF 2HKOA 5FFXA 3BPVA 1ON2A 4UXNA 4EGYA 1IN5A 4RGRA 4OINF 3GVAA 5IT9K 2VONA 3IC7A 1YW7A 4L5IA 1QQIA 2NNYA 3L9FA 4KUMA 4M73A 3JSOA 1ODDA 2Z33A 1XSVA 5BMZA 2R3SA 1ZG1A 4HX7A 2PBIA 5AONA 4EJTA 4IRGA 1FYKA 4CDGA 4I0AA 1LJ9A 4KMFA 2NAZA 1BC8C 3KP2A 1QBJA 1QNTA 1F1ZA 3CLOA 1XDSA 2RV8A 2VC0A 1HSJA 2ZJ2A 4ZZLA 3DPLC 2CG4A 1BM9A 3FMQA 3WTYC 3KLNA 4LG0A 2VBZA 3DPTA 2K02A 2V1UA 5HDNA 3VFZA 3RDIA 3CO7C 2Z3YA 5DV5A 3DKWA 4UUVA 4KFCA 2HFHA 1XN7A 2PN6A 4M9ZA 2LDUA 1YQAA 4N9IA 1BI1A 4BHBA 2EA4A 2FRHA 5FB2A 1EH7A 4AIKA 2KKOA 1PP8F 2VBWA 4M9SA 1W5SA 1R36A 1F5TA 1TQMA 2RDPA 2COMA 3TQNA 3W6KB 2QQBA 1WI9A 4GXOA 3BDDA 3L7WA 2ZMEB 3F6VA 2VT3A 2BV6A 4HLYA 3HHHA 2KIUA 3GWZA 4Y17A 2PQ8A 3NEUA 2HR3A 1BC7C 3BWGA 4A5MA 3TO6A 4QLCU 4JQFA 2OU2A 4NQWA 1IUYA 1U2WA 5HVQC 2W25A 1J7KA 3SQNA 3BROA 5LHGA 3LA3A 2P5KA 2FMLA 2E7WA 5DUKA 2IJLA 3HYIA 1RZ4A 2QUFA 1O3QA 1ZG5A 1SD5A 2M5WA 3L00A 2HQNA 4RGXA 5D6FA 4LD5A 3EQLF 1JE8A 1BOAA 1LB2A 1OYYA 1E17A 3E5UA 3I54A 4Z2YA 4K2EA 2QLZA 4HA8A 2GAUA 1Z05A 3GUDA 2W24A 3DV8A 4A6DA 1P2FA 3MZYA 4ESJA 2PI0A 2F5CA 2OA4A 2QWWA 5LGUA 4L9VA 1ZAOA 2XHKA 2XAFA 1P4WA 3LFKA 2VXZA 4WXCA 4HQEA 2KIMA 1XMAA 2IVMA 3R0JA 4PZJA 2A68F 5H6QA 3BJ6A 1Z7UA 1ZREA 1IRGA 5E1ZB 3CUQA 4PCQA 1FP2A 1KYWA 3WE3A 2MD5A 2XIGA 1AOYA 1XGMA 3HUGA 1D5VA 3ZMVA 1T39A 1MJBA 3DXJF 2XAQA 2L4MA 1IXCA 1MZBA 3MEXA 2QM3A 3Q9SA 3E5XA 1UHWA 1EH6A 4AWXB 2XASA 4YIFA 1MDMB 2H27A 1VTNC 2PJPA 5E20A 1YTYA 1ZH5A 1UB9A 1FSEA 3KFWX 1XSDA 1A04A 4HX8A 5CVUA 2FF4A 3DEUA 3KEQA 3ZPLA 1DPRA 2QENA 2YSRA 4ZYGA 4KDPA 2XUBA 1HKTA 2LF8A 2PEXA 2LKPA 3GW2A 5FFZA 3SZTA 5F64A 1U3EM 2Q2EA 2IA0A 5DD8A 4G9YA 5D5WB 3HRSA 3JTHA 4EM2A 1LDDA 1OR7A 2CO5A 3QPTA 2C6YA 3K0LA 5HDGA 4YFNF 1PDNC 3CJNA 4ESFA 2EFQA 2GXGA 4CGZA 1I1SA 3Q9VA 4H0EA 2GQQA 2DO7A 1LNWA 3DFGA 2P4WA 1LQ1A 4EJVA 2A5YB 4MEXF 4A0YA 5BS6A 2GA2A 1J9IA 5DCMB 1R5HA 1QGPA 3VEPA 4M74A 3TGNA 3EETA 3I64A 3VB2A 2QBYA 3P9IA 2QQAA 1GXPA 3F8NA 3GXOA 3CUOA 4XLPF 1DP7P 3RI4A 1SD4A 3E6CC 3EYIA 3CO6C 4GCVA 4UV8A 4S05A 2ADUA 3WTWC 5L3BA 4EV0A 5IT9Z 3TOBA 1IN8A 1IXRC 5CVVA 5FD6A 1U8RA 5LHHA 5J8FA 4B09A 3FXQA 3ERED 3ZQ7A 1D8KA 2O03A 1XDUA 4LFUA 2ZKZA 4KYWA 2FQ3A 5LGTA 3ZP5A 1JGSA 1O7LA 1FBSA 2A3SA 3K1PA 2FMYA 2H6BA 2GA1A 4KNYA 4HYEA 3REOA 4RAZA 3R4KA 1O3TA 4XBFA 4G6QA 3BP8A 2STTA 5CVRA 2QVOA 4KT5C 2IP2A 2G7UA 1Q1HA 3IKTA 1JHHA 2IA1A 2UXNA 2F5EA 2VN2A 5LRRA 4YIIA 1YS7A 2CYYA 2XKPA 3WODF 2OQRA 2DU9A 1REPC 1MJ9A 5HLIA 3WTTC 2V79A 3I5UA 4CZZA 1YLFA 1PUEE 5DDGA 4OIRF 1YYVA 1USSA 3T1BA 2P5LC 1HKQA 1QPMA 1CF7B 2V6CA 3WG9A 1K79A 1TW3A 3P9KA 2XV4S 3KP3A 1RIOH 5LEKA 2DK8A 1R22A 4CO8A 2HTSA 4MEYF 4Q48A 3GF2A 5TJJA 4E70A 1K6OA 5ICEA 2VOOA 4UNOA 4UVBA 3F8CA 3RKYA 1K78B 4L18B 2HYFA 4IRIA 1S6LA 2MA3A 1TQIA 3GX4X 2H94A 4ASNA 4LB5A 2RC4A 4HQMA 2DAOA 2O6GE 1O7FA 4EM1A 3DQVC 2Q0OA 2ZMEA 3M9AA 5F1RA 1FYMA 2P6TA 1ZLKA 2FSWA 4OOIA 4ETSA 5ERIA 4HF1A 5CYVA 3SHFA 4AD9A 2GZWA 2O3FA 4G94A 1RI7A 3KETA 4IXAA 5D4RA 3BJOA 3DP7A 1QZYA 5LGNA 5D8LB 2DW4A 5ICFA 2VC1A 1IN4A 2H6CA 4EM0B 2NS0A 4N9HA 2JZYA 1U6GA 3WGIA 4AVPA 4ZYDA 3HTSB 1BJAA 4EMSA 1B59A 4ENJA 3MAJA 2FBHA 4BAYA 2O0YA 4NHJA 2YPRA 2XGXA 3WU1B 1X3UA 2F5DA 1Z91A 3GZ6A 4BH9A 4I09A 4Q47A 1YW9A 2P5VA 4PDKA 2G9WA 2MBFA 1BI3A 1OYWA 4M71A 1T38A 4GYIA 2DTRA 3I59A 5JR3A 5D6EA 5KVRA 1FY7A 1XCBA 4B8XA 1GXQA 5DEQA 3J81Z 1U78A 2E7XA 1KQ9A 2L54A 2MLKA 3FF5A 3ZMDA 4LGWA 1G6NA 2K4BA 4ENMA 2KJBA 5A2QK 2BYVE 2RN7A 5JVTA 3GEZA 3GFIA 5A2QZ 1BIBA 6PAXA 1HW2A 1SFUA 3IWZA 4CHUA 1LVAA 4OIOF 4D0PA 1ZRFA 3LWFA 4UV9A 2A07F 5CLSA 1USTA 2KIFA 2BBYA 2ZNZA 1J5YA 3E3VA 1C0WA 5ILSA 1JHFA 4RGSA 4R79A 2G7HA 2FE3A 2Y75A 1AWCA 4WWCA 3EUHA 2EJRA 3ABUA 3JSPA 4A2UA 1SMYF 2K4JA 2PLYA 1WKMA 4R1HA 2HOEA 1B6AA 4JK1X 1XB4A 3V7CA 1PP7U 4KICA 4MHGA 5E18F 2QZ8A 3FXRA 1RNLA 2DT5A 3WTSC 1S8NA 1J59A 3PFIA 2DK5A 3HRTA 4LK0F 2JSCA 3KP6A 3MWMA 4RB2C 1H9TA 3BJAA 1HXDA 2RKHA 1XD7A 4G8XA 3L09A 1G3YA 3IHUA 1TQPA 1Y0UA 1SAXA 2XVCA 4M6YA 4BXUA 2UXXA 2DI3A 2WV0A 4BNCA 3HHGA 2FOKA 3C7JA 1P92A 1WRJA 2EFPA 3QAHA 3M7GA 2H09A 3RKXA 5JFRA 2LNBA 1TBXA 2JRTA 1YG2A 4P55A 5K1YA 1IRFA 2A61A 4UHTA 3I59B 4IF4A 1V4RA 3H92A 3LA2A 5LEJA 1I27A 1FYLA 2MLGA 4HF2A 5HOOA 3HSEA 5BPIA 2OAZA 3CUQC 1ZG3A 2GIVA 3IKVA 1G3WA 1XGSA 1I6XA 4IHTA 1BIAA 2XAJA 4FX0A 2FBKA 5ICGA 3RTRA 2ESHA 2Z9OA 4RB1A 2IPQX 3M1EA 3P9CA 4MQVA 1IN6A 5DCMA 4G7ZF 4U0YA 5BQTA 2M8EA 3ABTA 1J75A 1R5GA 1W7PB 2EFWA 4KIGA 1ONVA 3P7NA 1J0RA 4IHSA 4HW0A 2DPDA 5K5OA 5L3GA 1MKMA 4MNUA 1O3SA 4PGHA 2IRFG 1TLHB 2D1HA 4LLNA 1L0OC 5DYMA 2RVCA 3TO7A 4U7DA 4O3MA 3FMSA 1FWZA 4A6EA 4KA4A 3F8MA 3K9TA 1OKRA 2RNJA 4L9TA 3HSFA 1IXSB 5JI6A 1V3FA 1BBYA 2V9VA 3FM3A 4ZYHA 2ZCWA 4G7HF 1HKSA 1S3JA 3C18A 1R23A 1R7JA 2FXAA 5D4SA 4AIJA 2V1XA 3EYYA 3MCZA 2TDXA 1T0FA 4OIPF 2E1CA 4A0XA 1BI2A 1MDMA 1LDJA 4BHCA 1BN5A 5E1XA 1RUNA 3QU3A 4P5OA 2ZNYA 4XSZF 3KP5A 2HYGD 3ECHA 4YFXF 3QP6A 3F8BA 2PMUA 4O6JA 3V7SA 5EEGA 3K1NA 2O61A 1BI0A 4HOBA 2IW5A 2QYOA 1R1TA 3GLXA 4EQQA 2MC3A 3K1MA 2K7LA 1WQ2A 4A0ZA 5CJ9A 2VE8A 1FBUA 3M8EA 3V7RA 2Y48A 2EFOA 4WF2A 1D8JA 2K86A 3N4MA 5CVIA 2STWA 2XAHA 3N97A 3T8RA 4EJUA 1KGSA 3ZMUA 2ACJA 5LLQA 3F21A 3T0YA 3C3WA 4KN4X 3E6DA 1DDNA 2CWEA 3IL2A 3J81K 5E8GA 2EB7A 4M9XA 3FM5A 4HBLA 2GXBA 1B9NA 4RGUA 3FXUA 4I02A 5FGMA 4EJWA 5D5VB 5E17F 2W85A 1B1BA 3KE2A 3QU6A 2QBYB 4G6DA 4LLGF 4MTEA 2NNNA 4I2OA 3ZN0A 3TOAA 5HDKA 4XSXF 4P96A 1KA8A 1EV7A 1H0MA 1FOKA 3U1DA 1G3SA 3WTUC 2R7DA 1KQ8A 3GO5A 1XSXA 4HLXA 4BHPA 3R60A 2EK5A 1W7PA 2QQ9A 1KU2A 5FD5A 3HIFA 2PG4A 1FLIA 1ZRDA 3WU0A 4U7BA 3F22A 4F7ZA 2DLLA 3C1DA 3TDZC 4EGZA 2EWNA 2XKOA 1IZ1A 1GVJA 4DQ2A 1W5TA 4FT8A 1E2XA 3RIRA 1ZARA 3M8FA 5E8IA 5H20A 3T5XA 3LA7A 1GHCA 3GFMA 2OZUA 3ZN1A 2YX7A 1U5TC 3J80K 2DQLA 2AXLA 2RGVA 4U0WA 2IT0A 1B9MA 3J80Z 3QRFF 3KLOA 2X4HA 4MTDA 3TO9A 3BY6A 5TRDA 3LAPA 1FC3A 3CUQB 4U88A 1LEBA 1T6SA 4A12A 3W6JB 1P4AA 4LMYA 3U2RA 1R1UA 1O3RA 1B4AA 3OOPA 2FBIA 1KQ0A 2D1VA 4BYYA 4WX9A 1XCVA 4O5VA 5AIQA 3O6BB 2NRAC 5BPDA 4S04A 3VOEA 4M6XA 1HBXG 1UFMA 2HKXA 2L02A 1K78A 3ZMTA 4KMUX 2V1DA 2L4AA 4I0BA 2YX4A 2EV5A 2F2EA 4WK8F 3NRVA 2UWMA 4HV5A 2ISZA 2OQGA 2FA5A 1EH8A 4RS8A 5FLXZ 3PQKA 3ZMZA 3HTUA 3TKYA 3NQOA 3BPXA 4EVIA 3B02A 3LQQA 3IRQA 5ICCA 2ZO4A 5LRSA 1QZZA 2BGCA 1U5TB 4ENNA 2JPBA 2OBPA 1TNTA 2VT2A 3RJPA 1I1GA 3WGHA 1MGTA 2VODA 3V4GA 3ROUA 1I5ZA 2ISYA 1IW7F 3WTVC 2D45A 1HW1A 4KIFA 1HQCA 3FMRA 1IF1A 4P9FA 2XAGA 4P9UA 2RQPA 2DBBA 4IJAA 1TNSA 3G3ZA 3MQ0A 4OMZA 4IVNA 1KYZA 2LF7A 2P6SA 1IAWA 3ISPA 3B73A 3E97A 3RPQA 1HSTA 5HS8A 3D5LA 3O2PE 2AS5F 2ELHA 2EV0A 2F5FA 2XRNA 1HW5A 4FX4A 1YW8A 2YU3A 3HOTA 1ZGAA 3GYHX 3G73A 2CQKA 3KP7A 1LEAA 4MGRA 1FX7A 2OD5A 2HS5A 3GZ5A 4Q5SF 3QOPA 2VBYA 3ULQB 1LDKB 1ULYA 1OMIA 3WGGA 1OYIA 2MH9A 5DD4A 2L01A 1IN7A 3IWFA 4RB0A 3KCCA 3D0SA 2HWVA 1MJAA 3QP5A 3R61A 4Y15A 3I0TA 3SZPA 4L9JA 1F9NA 3WTZA 2EV6A 3FHZA 3I71A 2R7FA 2NYXA 4CXFA 2BEOA 4N0BA 3KP4A 3R6SA 2A6HF 4L0YB 2DFIA 2ZBKA 4HDVA 2D2WA 4RAYA 3FZVA 4XLNF 1OPCA 2M30A 4HZFA 3HRUA 2X0LA 2GWRA 1TW2A 5J6XA 2FU4A 2E1NA 3E5QA 2O8XA 2KRFA 4M72A 3ELKA 2YR2A 1CGPA 1RUOA 4GO1A 3HRMA 4XRFA 1DUXC 4ZH4F 1QO0D 2A6EF 3JAMZ 4TV7A 1DPUA 1XMKA 3JAMK 2KJCA 4HDUA 4EJOA 3MFKA 3I4PA 4I01A 3SXYA 4WXHA 2WTEA 2JTVA 4AIHA 3WTXC 2Z99A 1KU3A 1SFEA 3HOSA 1ZHFA 2HTJA 3GFJA 5D5XB 2HEOA 1JXSA 2FEZA 3J7AO 1UCRA 4OMYA 4LLLA 2EFNA 3KZYA 5L3CA 4IPAA 2HZTA 2HQRA 5D8KB 1ON1A 5EEHA 2IA2A 3DF8A 1WWXA 3FWEA 3QPHA 2BE5F 3U9GA 1F4KA 3H3ZA 4ESBA 2B0LA 3I58A 4RB3C 5IT3A 4NB5A 3PQJA 3H3UA 5JHUA 5HS9A 2Y0MA 2WC2A 1SD6A 5HS7A 5AIPA 4R8HA 1Z6RA 3SFZA 1MD0A 4G7OF 3IRRA 2P7VB 1R58A 4WXDA 3ECOA 2JPCA 5L3EA 2M45A 3CDHA 5CVJA 2WWYA 3K2ZA 5DCFA 4UVAA 2XROA 4Y13A 3LSTA 1K7AA 4L9NA 3AAFA 5BOXA 1T98A 2K27A 2OZ6A 1W7PD 2EA2A 4U0VA 2DQRA 2JT1A 5D5UB 2Z5UA 1SFXA 1D3YA 1O57A 2FNPA 4HV6A 1P6RA 2L3DA 4UVCA 4HF0A 4KN7X 4MQ9F 1J2XA 4WCGA 1SD7A 2Q8KA 4QWQA 2VBXA 2UZKA 3VODA 4ENKA 3GFLA 5FLXK 1Z6TA 5ILUA 1XGNA 1S29A 4JBAA 3S2WA 3RKWA 3F6OA 4OU0A 2CFXA 4CYDA 4I7HA 1FBQA 1FT9A 5H6RA 1ZN2A 4LK1F 3TDUC 5DUIA 5FO5A 1S7AA 1TTYA 2W57A 3KZZA 1G3TA 1KU9A 3T8TA 2ESNA 3V8KA 4I98B 3HSRA 2HGCA 3ML6A 3RPUA 1FSHA 2FNAA 3FX3A 3F72A 4PGGA 1ZLJA 2HDCA 4GGGA 3KEOA 5F6FA 4Q4ZF 1WSUA 4BQAA 3JTGA 1L3LA 3JW4A 2A69F 3V8LA 1FNNA 2W84A 2VE9A 4ON0A 3E6BA 1FP1D 3LQRA 4CICA 2P8TA 1ZYRF 1P4XA 3OV8A 1G4DA 2PFBA 3F23A 3K69A 1R1VA 5LHIA
chains in the Genus database with same CATH superfamily
2P7CB 3ZMSA 5KK1A 3RYRA 2XRLA 4HX4A 5E1WA 2L9NA 4KIBA 4BGDA 1H9GA 4D7MA 1ZRCA 1KU7A 4LG0B 2JA6J 3S16J 2CU7A 1WPKA 1WI3A 3EDPA 2E1MC 2X9DA 3G71I 3BTJA 3BR1A 4HAMA 2J5OA 3BZ6A 3HZJA 3R0AA 2H1KA 2IGKA 3B6AA 1P9QC 5L3FA 4CUGA 1YIOA 2ZFWA 2PMHA 2R5YB 1FPQA 3F3XA 4AVZA 5J4YA 3AG4H 5L3DA 3CTAA 1D1CA 2Q1ZB 2E2IJ 3S15J 1DQUA 2ZXJA 3FHNA 4AM3A 2J5PA 2OV7A 1WJAA 3K4JA 1IC8A 5HLHA 3CCEI 2ETHA 2XGEA 4OIQF 2ZB9A 3TW7A 2CSOA 3LSKA 1FIPA 1T0FC 3MZ8A 4F91B 1S7OA 5ED4A 4DW6A 1FZPB 3BG7A 5K5RA 2VJIA 3Q3SA 2LSOA 4GYGA 2MH2A 5K5QA 1ZR4A 4L0ZB 1YS6A 4DIQA 3OS0A 1UHMA 2GOXB 1STZA 1T2KA 2AXTC 1JTYA 2BVMA 3I53A 3I56I 3BOQA 4LB6B 3CDLA 1R00A 3MZHA 2ECBA 1XGOA 1U5TA 1XC5A 2LP0A 2M7AA 3E6MA 3PNVA 5LD2C 3S3OA 2M87A 1NK3P 1Y39A 5J8CA 1NHAA 4L5JA 2M1BA 3IUOA 4S0HB 1YO5C 3LAJA 4N4OB 2M4GA 3L2CA 3BG9A 1NH3A 2V4JC 2VOPA 1EA3A 3M1CA 1VQ7I 4BBSJ 4IOAF 2OJED 1Z9CA 5M3FJ 2QSFX 4ZZDA 2RNGA 5KHDA 4A3KJ 4ANJA 1YFHA 2LFBA 4FHTA 4ZDLA 1HA8A 4RLFA 4BACA 3WE2A 4ZYEA 4IRHA 3KYCB 3V8JA 4RBOA 1I6HJ 2JA5J 5B1AH 1Z1DA 1W4MA 4LJZF 1SMTA 2CW0F 2VKVA 3RYPA 4HRIA 1WHUA 2VJ4A 4XQFA 5F0CA 1CF7A 4DNCA 5B5EC 5JHFA 2CQ7A 5LBQA 4XM3A 2CGPA 1ZGJA 3E1SA 4A5NA 2JUGA 3COAC 2BHZA 2M2EA 3TMOA 5ILVA 2DA4A 3LFUA 3F8FA 5HLGA 3LSIA 4YG2F 3Q5FA 3O3KA 2DPUA 4YFKF 5C4XJ 2HKOA 5FFXA 3BPVA 1ON2A 3QODA 4UXNA 5DTDA 4EGYA 5J4VA 5GAHJ 1IN5A 2XB0X 2M8GX 3PNYA 4RGRA 3G6EI 2R7TA 2X48A 4OINF 2M0MA 3GVAA 5IT9K 2VONA 3IC7A 1YW7A 3QYBA 4IO9F 1I3QJ 1TZLA 4M3GA 4L5IA 1QQIA 4IKFA 2NNYA 3L9FA 4KUMA 2YS9A 4M73A 3JSOA 1ODDA 2Z33A 3BR5A 2MSYA 1XSVA 5BMZA 3HOYJ 2R3SA 1A31A 1ZG1A 4A3JJ 4HX7A 3ZQHA 2IGOA 2PBIA 2NVQJ 3OYLA 5AONA 4EJTA 4IRGA 5GADJ 3K6GA 5K7FA 1FYKA 2AQEA 4CDGA 2QA4I 4I0AA 1LJ9A 1JUPA 3HL2A 4KMFA 2EPFA 2NAZA 2Y31A 1BC8C 1K61A 3KP2A 4ITVA 1QBJA 1QNTA 1D0ZA 1F1ZA 1HDPA 2K9QA 3CLOA 2NOJB 2JSPA 1XDSA 2RV8A 2JJ7A 1HSJA 2VC0A 2ZJ2A 4ZZLA 3DPLC 5GAGJ 1R9TJ 3VWBA 2CG4A 4AYBA 3CMYA 1DGWY 1BM9A 1DP3A 5GTHC 2HOSA 3HPGA 1X1CA 2IGNA 3FMQA 1T95A 1IDZA 1OCZH 4FE7A 1ETWA 1S9HA 2EIJH 3WTYC 3TEDA 1TP4A 2QGUA 3KLNA 4LG0A 4ZTFA 2L0KA 4C3HJ 3ASNH 3P5JA 2VBZA 3DPTA 4HNVA 2K02A 2V1NA 3FXLA 2LY1A 1JGGA 2V1UA 5HDNA 4IHWA 4NNJA 4CA0A 3VFZA 2QSGX 3RDIA 3CO7C 2Z3YA 3FBNB 4IHYA 3KIOA 5DV5A 3DKWA 4M6VA 4UUVA 4KFCA 3ABKH 2VB6A 3HUGB 2NVXJ 2HFHA 1XN7A 2PN6A 4M9ZA 2HZDA 1YITI 2LDUA 1YQAA 2O7OA 4N9IA 1BI1A 4BHBA 5DM6F 2QKLB 2LOOA 3OWTA 1RPWA 2EA4A 3EPZA 2LVSA 1D1AA 2BY2A 1JKQC 2FRHA 5FB2A 1MBEA 3KYDB 3GTOJ 1FJLA 1EH7A 2VKDA 2GLOA 3OIOA 1OCTC 1WJEA 1GLNA 4AIKA 1WJDA 2X1CA 2DFEA 2PMZA 2KKOA 1PP8F 2XPWA 2VBWA 4M9SA 1W5SA 1R36A 1F5TA 3LNQA 4P1WA 1KONA 1TQMA 2B7EA 1UG2A 2RDPA 2MD0A 3IH3A 2COMA 2B9SA 3TQNA 1N78A 3W6KB 2K3PA 2QQBA 2HXIA 1WI9A 4GXOA 1ETOA 3HKZA 4XRSA 2EZKA 4XRSG 2CV1A 3BDDA 1E3PA 2ZMEB 3F6VA 2VT3A 3L7WA 2BV6A 2M7BA 4HLYA 3HHHA 3NARA 3H9QA 1Z3YA 3BC8A 4HNUA 5M3MJ 2KIUA 3GWZA 4Y17A 2DA6A 2PQ8A 3NEUA 2HR3A 1BC7C 3BWGA 4A5MA 3TO6A 4QLCU 4JQFA 1D0YA 2OU2A 4NQWA 1IUYA 1U9NA 2R7RA 1U2WA 1GUUA 1AA7A 1TWFJ 2DXIA 1MBHA 3CCYA 5HVQC 2W25A 4LG3A 3H1CA 1G59A 1J7KA 2XSDC 1Z0XA 2NVUB 1VQ6I 5TGTA 3SQNA 3BROA 2JWTA 1WZ2A 3DU6A 1QZEA 3J7ZI 3I4NJ 2X6WA 5LHGA 3LA3A 4RA2A 2P5KA 2FMLA 2EH3A 1SFKA 2E7WA 3OYEA 2BXZA 5DUKA 4B1RA 3JR9A 2IJLA 3HYIA 1X2MA 1RZ4A 2QUFA 1WJBA 1O3QA 4Y3OA 3AG3H 1ZG5A 2NVTJ 1HC8A 1SD5A 3S93A 1IJWC 3BZCA 3TL4X 3ZOBA 2M5WA 3L00A 3J7YJ 4D1QA 2X51A 1OCPA 2HQNA 4RGXA 5D6FA 4LD5A 1A6IA 3EQLF 2LREA 3U21A 1BOAA 3CP8A 1JE8A 1LB2A 1OYYA 1LFUP 1E17A 3E5UA 3I54A 4Z2YA 4DOZA 3DPUA 2VI6A 4RMNA 3IH2A 3GTPJ 4L5EA 3M3YJ 4K2EA 2QLZA 2G0EA 4HA8A 2E2HJ 4W97A 2GAUA 1Z05A 3GUDA 2W24A 3JCUC 3L2UA 1E0EA 2R4GA 1WVRA 1X2NA 2DA2A 2IS4A 3CMEI 2RAEA 3W2WA 3DV8A 4A6DA 2CS3A 1P2FA 3MZYA 4ESJA 2PI0A 2F5CA 1HCRA 2OA4A 2R92J 2QWWA 5LGUA 4L9VA 4HNTA 1ZAOA 2XHKA 2RQQA 5KAFC 3IH4A 5IP6A 2LH9A 2XAFA 3HEFA 4KJZA 1P4WA 3LFKA 2VXZA 4WXCA 4HQEA 2KIMA 1XMAA 2IVMA 3R0JA 3KYLA 3RKQA 4PZJA 2A68F 5H6QA 4G12A 3L2QA 3BJ6A 1Z7UA 1ZREA 1IRGA 5E1ZB 3ZR8X 3CUQA 4PCQA 2PMZN 1FP2A 1KYWA 1X58A 3WE3A 4FCYA 1WH7A 4PUSA 1LFBA 2MD5A 2XIGA 1DU0A 1AOYA 4F3QA 5EDNA 1XGMA 2EQRA 9ANTA 2ZC2A 3HUGA 3DBLB 2D5VA 2HYJA 1D5VA 1UHSA 3D5SC 2QQ8A 3ZMVA 1T39A 1MJBA 3DXJF 2XAQA 3H0GJ 3ONQA 2L4MA 1IXCA 3HKZN 1MZBA 4J00A 3BCBA 2KDOA 4BY7J 2GXAA 3MEXA 2QM3A 3MKYB 3Q9SA 4RM2A 4UUSB 3E5XA 1UHWA 1EH6A 4AWXB 4BE1A 2XASA 4YIFA 2CQXA 2FX0A 1MDMB 5J1RA 2H27A 1VTNC 2PJPA 3TW6A 3OL3A 5E20A 1YTYA 4DBQA 1ZH5A 1VQ4I 1WCMJ 1OISA 1UB9A 1FSEA 3KFWX 1XSDA 3GTQJ 1A04A 3DWLE 1Z3XA 4HX8A 4LIVA 1GDTA 3BR2A 5CVUA 2FF4A 3DEUA 3KEQA 3ZPLA 3M07A 3HGYA 1DPRA 2QENA 3S1RJ 1YJ9I 2YSRA 4ZYGA 2W4SA 2JA2A 4KDPA 2XUBA 2LG4A 2E35A 2LF8A 2PEXA 3S2DJ 1HKTA 2LKPA 2FOWA 4AIDA 3GW2A 3QQAA 5FFZA 2HOAA 2I8DA 3SZTA 5K7HA 5F64A 1U3EM 1OCCH 2Q2EA 3C2BA 2BXYA 3QPSA 2IA0A 5DD8A 4G9YA 3S1NJ 4Y52J 5D5WB 3HB9A 3JRIA 2XC7A 3HRSA 1QU3A 3JTHA 4EM2A 1LDDA 5E79C 3PJRA 3HJEA 3OIQA 1PUFB 1OR7A 2CO5A 3QPTA 4BDZA 2C6YA 3K0LA 5HDGA 4YFNF 1PDNC 1U8BA 3CJNA 3LL7A 4ESFA 3B6CA 3ZQGA 3TP0A 2KPMA 2EFQA 4RLQA 4AUXA 4B43A 2GXGA 4CGZA 1I1SA 3Q9VA 2MYSA 3VYTB 3F0CA 3K2AA 4H0EA 2GQQA 4CCKA 2DO7A 3DKXA 1VFCA 4XLCA 1LNWA 1UMQA 2QCOA 1RETA 3CJQB 3DFGA 4RAFA 2P4WA 4BL0B 1LQ1A 1W1WE 4EJVA 3OMYA 2A5YB 2JN6A 4MEXF 4XLEA 1LUJB 2BVLA 3RQ4A 4A0YA 1UELB 5BS6A 3OYKA 2GA2A 2DDBA 1X1PA 3CF5F 1J9IA 4F52A 5DCMB 1X3WB 4BEHA 2DOFA 5FKOA 1R5HA 1QGPA 3VEPA 2OTLI 3N05A 4M74A 2XPVA 2QF7A 3TGNA 2LR8A 3EETA 4JYKA 3I64A 1WJCA 2DMUA 3ZQFA 1V5EA 3GTJJ 3VB2A 1OR7C 3K10A 2QBYA 3P9IA 2QQAA 1GXPA 3F8NA 3GXOA 2HPIA 4OAZA 4MO7A 3CUOA 4XLPF 1DP7P 3RI4A 1YRNB 1SD4A 5FLVA 3K4KA 3FIWA 3CCMI 2LC2A 3E6CC 3EYIA 4XN3A 3CO6C 3S14J 4GCVA 4UV8A 4S05A 1FTTA 4BY1J 2ADUA 3WTWC 5L3BA 3MKZA 3ASOH 4EV0A 3LSMA 4W1UA 3TOBA 1IN8A 1IXRC 5CVVA 3ZXSA 5IT9Z 5FD6A 4A3IJ 1U8RA 5LHHA 2UUZA 1IV6A 5J8FA 1W36D 4B09A 3FXQA 4EATA 3ZQ7A 3ERED 1D8KA 2O03A 1XDUA 4LFUA 2ZKZA 4KYWA 2FQ3A 5LGTA 5GPAA 4A69C 3ZP5A 1JGSA 1O7LA 1FBSA 2A3SA 3K1PA 1KZHA 1R49A 2FMYA 2H6BA 4D9JA 1QHGA 1K4SA 3CC7I 2GA1A 3IP4B 4KNYA 3OL4A 4HYEA 3REOA 4LITA 2KLOA 4RAZA 3R4KA 1SVMA 1O3TA 4XBFA 4G6QA 1TWCJ 3BP8A 2STTA 5CVRA 3A01A 2QVOA 4X0GA 3J7AY 4KT5C 2IP2A 2XPUA 1P7IA 1A6QA 1ETKA 3VYRB 1VQOI 2G7UA 1Q1HA 3IKTA 4GRIA 2A05A 4B48A 4BXFA 1FIAA 2F48A 1XMXA 1JHHA 3UR3C 2IA1A 2UXNA 2F5EA 2VN2A 5DM7F 5LRRA 4YIIA 3OYCA 1YS7A 2CYYA 2XKPA 3K4CA 3WODF 3Q0VA 2Z16A 1K83J 1YX3A 1T56A 2OQRA 2DU9A 2Y0SN 5B66C 4HSTA 1REPC 4KT6A 1MJ9A 5HLIA 3WTTC 2OTJI 2V79A 3FDYA 2AO9A 3I5UA 4CZZA 3S17J 1YLFA 1PUEE 5DDGA 4OIRF 1YYVA 5F0HA 2MGQA 1USSA 3T1BA 4Y7NJ 1TT0A 1VQLI 2H8RA 2P5LC 5F04A 4DBRA 1HKQA 1JKPC 1QPMA 2CH0A 4B44A 1X1DA 1CF7B 2V6CA 3MKWB 3WG9A 3JRBA 1K79A 1TW3A 3P9KA 1TT5B 2XV4S 3KP3A 5FJ8J 1RIOH 5LEKA 2DK8A 1R22A 4CO8A 2E34A 2HTSA 4MEYF 3S1QJ 1RR7A 4Q48A 3UNGC 3GF2A 2IS6A 5TJJA 2HQAA 3ZQCA 4E70A 2ZMEC 1K6OA 5ICEA 4PK4A 2VOOA 2ZSHB 5HNHA 4UNOA 1ERDA 4YEJA 1H8AC 4UVBA 2DYSH 3F8CA 3RKYA 4YIRX 1K78B 2ZXHA 4L18B 2HYFA 2X85A 1GV2A 2LRDA 1S6LA 4IRIA 3O8GA 2MA3A 1TQIA 3C2GA 3PFYA 4HSRA 3GX4X 2DA3A 2Y30A 1RKWA 2E5ZA 2H94A 4Y33A 4ASNA 2RC4A 4HQMA 2L7KA 4CCLA 4LB5A 2DAOA 4LIUA 4NQWB 2VASA 2O6GE 1O7FA 2MABA 4EM1A 3DQVC 2Q0OA 1S7EA 2ZMEA 3M9AA 5F1RA 1JJ6C 2GOMA 3DTKA 1D0XA 3L2RA 4UB8C 1FYMA 2P6TA 3HC7A 1ZLKA 2FSWA 4MIMA 2H8WA 4OOIA 4ETSA 4C30A 2CJJA 5ERIA 4HF1A 2DMTA 4HG2A 5CYVA 3PL8A 3SHFA 3BG3A 3IV5A 4UUTA 4AD9A 4E7KA 2E60A 3OR2C 2GZWA 2O3FA 4G94A 1RI7A 4IXAA 4QTRA 3KETA 1PYVA 2VQLA 5D4RA 3BJOA 3OYHA 4HPQA 4CCNA 3DP7A 1QZYA 2W48A 4JX6A 5LGNA 5D8LB 1TWAJ 2DW4A 5CPRB 3OYAA 5ICFA 2VC1A 1IN4A 2Y69H 2H6CA 4EM0B 2NS0A 5FKNA 4N9HA 3KEYA 2JZYA 1G8XA 1U6GA 2LY9A 3G1MA 3WGIA 3D1NI 4AVPA 1VQNI 4ZYDA 4EEFG 2KIQA 3HTSB 5IOYA 1EKEA 2M9HA 3G4SI 2KL4A 4QPQA 4YRVA 3JRAA 1BJAA 4EMSA 1B59A 2O8KA 1X4OA 4IZZA 1D1BA 4ENJA 2QSHX 3H9JA 3MAJA 3OYNA 1X1AA 3BR6A 3BQZA 2FBHA 4BAYA 2ZJQF 2O0YA 4NHJA 2HDDA 2YPRA 2XGXA 3WU1B 4B3AA 1MBJA 1X3UA 1F36A 2F5DA 3EUHC 5IP7J 1Z91A 3GZ6A 2DT7B 1AKHB 2WAQN 2WY8Q 4BH9A 2R7ZJ 4I09A 2MFZA 1YW9A 4Q47A 4IEJA 2VQCA 1MNMC 4I99C 2P5VA 4PDKA 2G9WA 2MBFA 1ETVA 1ETXA 1BI3A 1OYWA 4M71A 1T38A 4GYIA 4JX4A 5FKMA 2DTRA 3I59A 1MH4A 4RM3A 5JR3A 5EG0A 5D6EA 5KVRA 2DOEA 1JTXA 1FY7A 1XCBA 4HEA2 4B8XA 1GXQA 4H4KC 5DEQA 4A93J 1SVOA 2HQ5A 3J81Z 1YOVB 1NG7A 1K6YA 4ABZA 3A2KA 1HF0A 4E6KG 4BQNA 2LTPA 1U78A 2E7XA 1KQ9A 1ZR2A 3CC2I 3OYFA 4E7JA 2KZGA 2L54A 1YJWI 2MLKA 3FF5A 3ZMDA 5F1JA 3GTGJ 4PJNA 4LGWA 4PSXA 1G6NA 1Z7LA 2K4BA 3CCUI 2VQGA 4BUPA 3A0BC 5EGOB 3A02A 2Z1DA 1Y1WJ 4ENMA 2KJBA 2WAEA 4E7SA 5A2QK 2BYVE 2RN7A 4II2A 5JVTA 1S5LC 3GEZA 1IG7A 1OJLA 3WG7H 3GFIA 5A2QZ 1BIBA 6PAXA 3BT9A 1AU7A 3L2WA 2HVSA 1HW2A 3A03A 3QOEA 3S2HJ 2OCCH 1SC7A 1ORKA 2LLKA 1SFUA 5EEAA 2E2JJ 5EF6A 2PX9A 1MH3A 3OYIA 2QEXI 3IWZA 5KNLA 4CHUA 1LVAA 4OIOF 1UAAA 2DYRH 1VQPI 4D0PA 3RZDJ 2DMPA 2R5ZA 4BDYA 1ZRFA 2E1MB 3LWFA 2XGDA 3DLLF 3OYJA 4UV9A 2A07F 1VQ8I 2Y9YA 5CLSA 1USTA 2KIFA 2BBYA 3BG5A 2ZNZA 3K70D 1J5YA 3E3VA 2MC4A 1MW7A 1C0WA 3CJTB 4A3EJ 5ILSA 1JHFA 2F6CA 2E5NA 4RGSA 1MSFC 3HOUJ 1OQYA 1BR1A 2O5RA 4R79A 2G7HA 2FE3A 2TRTA 2Y75A 3H5NA 4WWCA 1AWCA 3EUHA 4PJJA 2EJRA 3ABUA 3JSPA 4A2UA 3RSNA 5FKLA 1I39A 1SMYF 2JQ7A 2K4JA 2PLYA 2CQNA 1WKMA 2HOEA 4R1HA 4U87A 1B6AA 2COBA 4JK1X 1XB4A 4MFDA 4KITB 3H5RA 3V7CA 2K9LA 3IAM2 3FKIJ 1JT6A 2XGCA 1PP7U 4KICA 4XLFA 4MHGA 2DA5A 5E18F 2ELJA 2QZ8A 2FQ4A 3BTLA 2KDZA 3FXRA 1RNLA 4BE2A 1SVLA 2XF7A 2DT5A 3WTSC 1S8NA 2TCTA 3WHCA 5GTIC 2JRMA 1J59A 2K40A 5GAEJ 3PFIA 4E7LA 3LSGA 2DK5A 1QVUA 5GP9A 1Y0NA 1X19A 3VSKA 2R7OA 3GLLA 1ZGWA 2JMWA 3HRTA 4UY8I 4LK0F 4NDLA 2JSCA 3KP6A 3PO2J 3ZRGA 3H5AA 3MWMA 2LY2A 4RB2C 1N75A 2WB1N 3BJAA 1H9TA 4B3XA 1HXDA 2HU9A 4X6AJ 2ZXIA 3LSPA 2RKHA 1XD7A 4F55A 1HLVA 4G8XA 3L09A 2CQQA 4JP0A 3H35A 1IRXA 2B63J 1HDDC 1R4MB 2P81A 5EYRA 1O4XA 1G3YA 5DS9A 3I3LA 2LYCA 3IHUA 2R7QA 5KCMA 1TQPA 3WHBA 4XL9A 1I50J 1Y0UA 1JT0A 1SAXA 2XVCA 4M6YA 4BXUA 2UXXA 2P0WA 2DI3A 2WV0A 1OLTA 4BNCA 3CMAI 4J01A 3HHGA 2FOKA 3C7JA 1RRJA 4BE0A 1P92A 2NXNB 2XDVA 1Y6IA 1WRJA 4C3JJ 2EFPA 3QAHA 4IX7A 3M7GA 3SDGA 3SEZA 3VYSB 4E4HA 1YIJI 2H09A 3RKXA 2R7UA 4XONA 5JFRA 3BQYA 1QRYA 3QPLA 2PJRB 2LNBA 2KRCA 2LBFB 1TBXA 2JRTA 2L9VA 2F4OB 1YG2A 1FOWA 4P55A 5K1YA 2FJ1A 1IRFA 3GZNB 2A61A 5FRNA 4UHTA 4Z6YA 3I59B 4IF4A 1TWHJ 1V4RA 1ZKGA 3H92A 2VPRA 3LA2A 3CCJI 2K5CA 5LEJA 3CCVI 1JKOC 5K7ZA 1I27A 4XR6A 1FYLA 2MLGA 3K4BA 5E3LA 4HF2A 1ENHA 2BOLA 5HOOA 4M3DA 4NC6A 1FMWA 3HSEA 2LBFA 1S72I 3RZOJ 3FXMA 5BPIA 2GBYA 5FROA 3DU5A 3OS2A 2OAZA 3CUQC 4C9YA 1ZG3A 2GIVA 3AG2H 3IKVA 3FXJA 3FXOA 1G3WA 1XGSA 4NBQA 1I6XA 4IHTA 1BIAA 2XAJA 5IP9J 3S8PA 2BZTA 2WV1A 4FX0A 2FBKA 5ICGA 3RTRA 1MMNA 2ESHA 1ZTRA 2Z9OA 2HVRA 4C3IJ 2CUJA 1ZELA 2IPQX 4RB1A 4B47A 5C4JJ 1MBKA 3M1EA 3P9CA 1SFOJ 4MQVA 1IRZA 1VQMI 1IN6A 5DCMA 4G7ZF 2K85A 5E3OA 4U0YA 2M8EA 5BQTA 3ABTA 3S32A 1J75A 1R5GA 1W7PB 2EIMH 2MG4A 2LKSA 1I3AA 1E3HA 2EFWA 3SZGA 4KIGA 1LE8A 4PJ0C 1ONVA 4V2GA 4XLAA 3P7NA 1J0RA 4D5CA 2WAFA 1JXSA 4IHSA 3L2VA 2GIZA 2L7FP 2MW8A 4HW0A 2DPDA 3ZGKA 5K5OA 5L3GA 4F93B 5HLTA 1MKMA 4MNUA 3EUKL 1O3SA 2WY7Q 4PGHA 2IRFG 3I55I 1R6RA 1WFXA 1TLHB 2D1HA 3AFHA 3AKZA 1YI2I 4LLNA 4IOCF 1L0OC 1MMSA 1T08B 1XPXA 4BU2A 4E7HA 1Y8QB 5DYMA 3SDBA 1UJ8A 1WJFA 2IAIA 3DTIA 5GPCA 2ICWG 2ZSIB 2RVCA 3TO7A 4U7DA 4O3MA 2CUFA 3BR0A 2K9SA 3FMSA 4XKBA 1FWZA 4JOMA 4A6EA 3HOWJ 4KA4A 3F8MA 3ZCOA 3K9TA 3PIPF 2Q2EB 1OKRA 2RNJA 4L9TA 2DFHA 3HSFA 3O8HA 1IXSB 3ABMH 1V3FA 5JI6A 1BBYA 2V9VA 3G2BA 4QSHA 3FM3A 1IV8A 4ZYHA 3SJMA 4RAGA 4F92B 1FEXA 2ZCWA 4G7HF 2IGMA 3OYDA 1HKSA 1S3JA 3A01B 1B72A 1NK2P 1OFCX 3C18A 1R23A 1R7JA 1B72B 2FXAA 5D4SA 4AIJA 3W6VA 2A5WA 1NTCA 2V1XA 3EYYA 1WH5A 2L9RA 3MCZA 2TDXA 1T0FA 4OIPF 4BJTA 4M3EA 2E1CA 1VF9A 3BTIA 4A0XA 2HDWA 1BI2A 1MDMA 1LDJA 4BHCA 1YE9A 1BN5A 5E1XA 5H2FC 3K70C 3WU2C 3HBLA 1RUNA 3QU3A 1XX5A 4P5OA 2ZNYA 1A36A 1R71A 4XSZF 3KP5A 2HYGD 1VNDA 3ECHA 3U1KA 4YFXF 4KISA 3QP6A 3F8BA 3OR1C 2X6OA 2PMUA 4O6JA 3V7SA 3FXKA 1H89C 4BXXJ 5CQGA 5EEGA 3K1NA 4BQOA 2NOGA 1BL0A 2O61A 1G2HA 2ELKA 1BI0A 4HOBA 5EZHA 3CCLI 2IS1A 3RQIA 2IW5A 3BG6A 4BQQA 1V54H 2R7VA 2QYOA 3BLYA 2ID3A 1QHHD 4G6TB 1R1TA 4XORA 5EJCA 5IYBJ 1IGNA 2E1OA 3GLXA 4FETA 4EQQA 2MC3A 3K1MA 2WADA 3Q0UA 2K7LA 3RCOA 1WQ2A 4A0ZA 5CJ9A 2VE8A 3OIPA 1FBUA 3M8EA 1RR8C 3V7RA 2CW8A 2Y48A 3BR3A 2EFOA 2R0QC 1EF4A 1W36C 4WF2A 1JUMA 1D8JA 1YHQI 2PJRA 1FOXA 5CQEA 2K9NA 3NWSA 2CV0A 3S1MJ 1BA5A 2K86A 3K4LA 2KFDA 2V9PA 3N4MA 2QKMB 2WA0A 2R5YA 5CVIA 2STWA 5JLWA 2XAHA 3CCQI 4A3CJ 3N97A 1TL8A 3T8RA 2GM4A 4EJUA 1KGSA 3ESWB 3EUAA 3ZMUA 1D5YA 2ACJA 5LLQA 3F21A 3M8JA 3T0YA 3C3WA 4KN4X 1VQKI 3E6DA 1DDNA 2CWEA 3IL2A 3J81K 5E8GA 2EB7A 2YUSA 4M9XA 3FM5A 4HBLA 2GXBA 1B9NA 1U9OA 4FTHA 4RGUA 3FXUA 4I02A 5FGMA 4B4CA 1FMVA 4EJWA 5D5VB 5E17F 4I76A 2W85A 1B1BA 3KE2A 3GTLJ 4A3BJ 3QU6A 1TWGJ 2QBYB 4G6DA 3GCMA 1VZ0A 3G1LA 5J3LA 4LLGF 1SANA 4MTEA 2NNNA 3LSHA 4I2OA 3G1OA 2I5UA 5TISC 3TOAA 3ZN0A 5HDKA 2ME0A 1B8IA 4XSXF 4P96A 4A3DJ 2BHYA 3A4CA 3ERMA 1J09A 4XOTA 4FASD 2K3FA 3ZQQA 1KA8A 1EV7A 4M3BA 3RPUD 1H0MA 2HPMA 3HOVJ 1FOKA 3U1DA 4OAYA 2EZLA 2K9MA 1G3SA 1V55H 3WTUC 1APLC 2R7DA 4V2FA 1KQ8A 2IEKA 1LVKA 2FD5A 2E36A 4XIDA 3GO5A 4QPOA 1XSXA 4IQ4A 4HLXA 1BR4A 2AQFA 4BHPA 1MMAA 3R60A 2EK5A 1W7PA 2QQ9A 1AKHA 1KU2A 5FD5A 2JUCA 3HIFA 5IY5H 2PG4A 1LFPA 1FLIA 1ZRDA 3WU0A 4OWRB 2H1LA 4U7BA 3F22A 4F7ZA 2DLLA 4BJ5C 3C1DA 3TDZC 4EGZA 2EWNA 2XKOA 1IZ1A 1GVJA 4DQ2A 1W5TA 1X4PA 2FUG2 4FT8A 4E7IA 1E2XA 3RIRA 1ZARA 2F4MB 3M8FA 2CV2A 5E8IA 5H20A 2CUZA 3T5XA 3LA7A 1GHCA 3H9GA 3AL0C 3GFMA 2OZUA 3ZN1A 1JUSA 2DJIA 2W00A 1BJZA 2L9SA 2YX7A 4FQGA 5F27A 3VYUB 2L7MP 1U5TC 3J80K 1N25A 2DQLA 1BR2A 2AXLA 2RGVA 4U0WA 4CZCA 2IT0A 1B9MA 3J80Z 3QRFF 3KLOA 3Q0WA 2X4HA 4MTDA 1RESA 1GVDA 3MKLA 1POGA 3TO9A 1MBGA 3AG1H 2M4KA 3BY6A 3LAPA 1FC3A 3CUQB 4CCOA 3JRGA 5TRDA 4ZDPA 2DDAA 3DKYA 5J1UA 4U88A 1LEBA 1T6SA 4CCJA 4A12A 5EGOA 3W6JB 1P4AA 2JVGA 3DLAA 4LMYA 3IAS2 3PUBA 1FTZA 1ETQA 1MBFA 2BW3B 3NWTA 3U2RA 2BW3A 1R1UA 1O3RA 2CRGA 4PFOA 1B4AA 3HM5A 3DTEA 3OOPA 4DYCA 2FBIA 1KQ0A 1MSEC 2Z2SB 2DODA 1OCOH 5JVGF 1T8IA 2D1VA 4BYYA 4WX9A 1XCVA 3A0HC 3C2HA 2DJNA 3SFIA 3LSRA 3KPHA 4O5VA 2DFFA 2CW7A 5AIQA 3O6BB 5BPDA 4S04A 2NRAC 3VOEA 4M6XA 2F5VA 3JRDA 1XG1A 3CF2A 1UFMA 2HKXA 1HBXG 4E7ZA 2L02A 4BS9A 2DTZA 1K78A 2W82A 1X1BA 3ZMTA 4KMUX 2V1DA 3K4MA 2L4AA 2DA7A 5M5YJ 4I0BA 2YX4A 2EV5A 2F2EA 2X1DA 4WK8F 3OSGA 3NRVA 2UWMA 4A3GJ 4HV5A 2ISZA 3FISA 2OQGA 5C44J 2VKEA 2FA5A 2BY3A 3PIOF 1EH8A 4DJAA 2Y9ZA 3H3VK 2DMQA 4RS8A 5FLXZ 3PQKA 3ZMZA 2R7XA 3HTUA 1Y1VJ 3TKYA 2KP6A 2VPLA 3NQOA 3BPXA 4DYQA 4EVIA 3B02A 2R7WA 3QWLA 3LQQA 1EJ9A 2V9KA 1R5ID 1F43A 4PSWA 3IRQA 3W2VA 5ICCA 3JRCA 3NAUA 2ZO4A 2JA7J 5LRSA 1QZZA 2BGCA 2XF5A 1U5TB 5FLMJ 4ENNA 3OSFA 2JPBA 2OBPA 2R93J 2CMPA 4ZYAA 4MLOA 1TNTA 1QA6A 2VT2A 3RJPA 1I1GA 3WGHA 4V19K 5J40A 1MGTA 2VODA 3V4GA 2KZVA 3ROUA 1I5ZA 2V7FA 2ISYA 2V26A 1IW7F 2M3AA 3WTVC 2D45A 1JI8A 1H88C 1HW1A 3DCFA 4KIFA 1HQCA 3FMRA 2VXDA 1IF1A 3DBHB 4P9FA 3HPHA 3OOUA 2XAGA 4UB6C 4P9UA 2RQPA 1XS9A 2DBBA 4IJAA 4A3FJ 1TNSA 3G3ZA 3MQ0A 4OMZA 4J19A 5BNGA 1LE8B 2LMDA 4YELA 1Y56A 4XICA 3CDIA 4IVNA 3GTKJ 1KYZA 2LF7A 2P6SA 1IAWA 3ISPA 3B73A 1UZCA 3E97A 3RPQA 5E3MA 5M5XJ 2NS8A 1HSTA 5HS8A 3D5LA 3O2PE 1PJRA 1B8IB 2AS5F 2ELHA 2EV0A 2F5FA 2L5QA 2XRNA 1HW5A 3OYGA 3UKGA 4XKVA 4FX4A 1YW8A 2YU3A 3HOTA 4C2TA 1U0JA 4II3A 1ZGAA 2ZJPF 3GYHX 1V5GA 3G73A 2CQKA 3KP7A 1LEAA 2A6TA 2HXOA 4MGRA 1FX7A 2OD5A 4XRMA 2HS5A 3PM1A 2R7SA 3GZ5A 4Q5SF 2E71A 3QOPA 4AYBN 2VBYA 3ULQB 1YRNA 1LDKB 3V42A 1ULYA 1OMIA 3WGGA 3BZKA 1Z77A 1OYIA 2EIKH 2DN0A 2MH9A 5DD4A 2L01A 1BW6A 1IN7A 3IWFA 4RB0A 3PNTA 4QIWN 1P7JA 2VLAA 1BW5A 3KCCA 1IDYA 3D0SA 1GT0C 2HWVA 1R4NB 1DGRM 1MJAA 3QP5A 1OCRH 3R61A 4Y15A 3I0TA 1HOMA 3SZPA 1SEUA 4L9JA 5EG0B 4C2MJ 4RDUA 3S3MA 2X1EA 1F9NA 5CKTA 3CJRB 3QYFA 3WTZA 2EV6A 4NC7A 3CMMA 2R7FA 3I71A 3FHZA 2NYXA 3FBIB 4C2UA 4CXFA 1DU6A 4NUBA 2R5ZB 5F0FA 2BEOA 1TC3C 1VI0A 4N0BA 3KP4A 3R6SA 3VDXA 4Y4RA 2A6HF 4IQJA 4XKCA 3A1YA 4L0YB 4CH7A 2DFIA 2ZBKA 4HDVA 2D2WA 3PSFA 4IHXA 4RAYA 1JJ8C 3FZVA 3DEWA 1M1EB 2OUMA 1W5CC 4XLNF 2F4IA 1OPCA 3PSIA 3MVPA 4CSWA 2BY0A 2M30A 5J47A 1N77A 3HOZJ 4HZFA 3HRUA 2X0LA 2GWRA 1TW2A 2V6EA 5J6XA 1QPIA 2FU4A 1IUFA 3JREA 2E1NA 3GBGA 3SYTA 3E5QA 2O8XA 5IYCJ 4DZPA 3S3NA 3CLQA 2KRFA 2LKXA 3K4NA 2Y0SA 3E7LA 2HVQA 2JVHA 5IOZA 1VQ9I 4M72A 4M3FA 3ELKA 1Z21A 2YR2A 4LOCA 2DOAA 4A3MJ 1CGPA 4GO1A 1RUOA 5FKKA 3KX2A 3HRMA 4XRFA 4DZJA 1NG6A 5IPAA 1ACIA 3FK6A 1DUXC 4ZH4F 3DEEA 1QO0D 2A6EF 3JAMZ 3HDDA 1K4TA 1BOBA 4TV7A 1DPUA 3MMYB 3X2QH 1XMKA 3L1PA 3CP2A 2W7NA 3JAMK 2KJCA 4HDUA 1A35A 4EJOA 5M5WJ 4XN0A 3MFKA 3I4PA 4PJMA 4I01A 2NS7A 2HI3A 4WXHA 3SXYA 3TBIA 2VL8A 2WTEA 5B1BH 3CESA 1XTAA 1ZK8A 2VUMJ 2JTVA 2OF7A 4AIHA 3WTXC 2Z99A 4MFEA 4PFPA 1KU3A 1SFEA 3K7AJ 4PJLA 4XOPA 3JRHA 3HOSA 3CCRI 1LKXA 1ZHFA 3GFJA 2HTJA 5D5XB 5HODA 3H0DA 1LPQA 2HEOA 2FEZA 2DA1A 3J7AO 1UCRA 1Z67A 4OMYA 2UV1A 4LLLA 4XKWA 2EFNA 2EINH 3KZYA 5L3CA 4IPAA 3OS1A 3JRFA 2HZTA 2KMUA 3ZQLA 2HQRA 5D8KB 2EZHA 4NC8A 2ME6A 1ON1A 2JK3A 5EEHA 2IA2A 3DF8A 2N8GA 4XLHA 1WWXA 3FWEA 3QPHA 4GFBA 2BE5F 4X1EA 1YJNI 3U9GA 1F4KA 3H3ZA 4ESBA 2B0LA 3I58A 4RB3C 5C3EJ 3CD6I 1IO2A 5IT3A 4NB5A 3PQJA 3GTMJ 3AL0B 3H3UA 1RC9A 2XF6A 5JHUA 5HS9A 3I9V2 2ZJRF 2XSJC 2Y0MA 3LSJA 2WC2A 4AC0A 1SD6A 5HS7A 4AU7A 3FK7A 5AIPA 3M4OJ 4R8HA 4A3LJ 3W2AA 1Z6RA 3SFZA 1MD0A 4G7OF 3IRRA 1ZQ3P 2CUEA 2P7VB 1R58A 2EBIA 4WXDA 2LD5A 2VQHA 3ECOA 3PO3J 2JPCA 4ZDOA 5L3EA 5J1YA 2M45A 1YX5A 3OYBA 3CDHA 4D5FA 3BTCA 4FISA 2VJ5A 5CVJA 2WWYA 2KHMA 3K2ZA 5JLXA 3MN2A 2ZFUA 4UVAA 2OCEA 5DCFA 3D5RC 2EZIA 3OY9A 2XROA 4Y13A 3LSTA 3VSLA 5LFAA 3GMEA 1K7AA 4L9NA 3AAFA 5BOXA 1T98A 2K27A 4XNFA 1W0TA 2OZ6A 3HG9A 3KZIC 4DGWB 3LOCA 2X6YA 1JKRC 2M34A 1W7PD 2EA2A 3I4MJ 2KRHA 5E3NA 2BY1A 4U0VA 2DQRA 2L7ZA 4D7NA 4XMYA 4CYCB 4CYCA 2JT1A 1PVEA 1Q1VA 3VPRA 5D5UB 3BCAA 2XB5A 1Y8RB 2Z5UA 1SFXA 1D3YA 1O57A 4IL6C 2FNPA 4ZTJA 4HV6A 2KT0A 1ITYA 1FOYA 2AHQA 1P6RA 2L3DA 4UVCA 4HF0A 4KN7X 2RREA 4MQ9F 5F08A 3TP3A 1J2XA 4N4NB 4WCGA 2DT6A 3CQZJ 3HXLA 1X3ZB 1VQ5I 2VKHA 1SD7A 2Q8KA 1MNEA 4QWQA 2IBDA 4GDFA 1RKTA 2VBXA 2UZKA 4JX5A 3VODA 1MIJA 4ENKA 2Y2ZA 4XK4A 3GFLA 2KQRA 1T33A 4BKXA 2O9LA 2OC6A 5FLXK 1Z6TA 2HOTA 2IS2A 5ILUA 1XGNA 3CCSI 2M0CA 1S29A 5B3SH 3CZ6A 3DBRB 1MMGA 3LMMA 2CFOA 4JBAA 3S2WA 3OYMA 2I10A 2HNHA 1E3OC 3RKWA 3F6OA 4OU0A 1QVTA 4FE4A 1WGXA 2CFXA 2DMNA 4CYDA 5FRMA 3H36A 4I7HA 2KISA 1FBQA 1FT9A 5H6RA 3ABLH 1V5FA 4BJ6C 1ZN2A 2LK2A 2XAUA 3E0JB 3F9KA 4LK1F 4I6ZA 3TDUC 2IXSA 2ZXWH 5DUIA 2YU9J 2EILH 1A5JA 3FKJA 5FO5A 1S7AA 2L2OA 1TTYA 2W1OA 1AHDP 2W57A 3KZZA 1G3TA 1KU9A 3HGGA 5IYDJ 2VIXA 3T8TA 5KAIC 1CQTA 2ESNA 2JA8J 3V8KA 4I98B 3HSRA 2HGCA 3ML6A 3RPUA 1FSHA 2FNAA 1WJ5A 3HOXJ 3FX3A 3MD2A 3F72A 4PGGA 1PUFA 1ZLJA 3PUFA 2HDCA 2X6XA 4GGGA 2WB1A 3CC4I 3W3CA 3KEOA 2VJJA 5F6FA 4Q4ZF 1WSUA 5EZGA 3JTGA 4BQAA 3SEQA 1L3LA 3ZQIA 1SAUA 2NVYJ 2WBMA 3JW4A 2A69F 3V8LA 2E19A 5HNFA 1FNNA 2W84A 4BBRJ 2VE9A 4ON0A 4CCMA 4ZC3A 4BEHB 4DYRA 3E6BA 1FP1D 3LQRA 2WAQA 2P8TA 4CICA 2DCEA 1UG0A 1MNDA 1GV5A 1P4XA 1ZYRF 3OV8A 2ID6A 2OPTA 1W0UA 1G4DA 2PFBA 3F23A 3K69A 4IHVA 1ETYA 4UUSA 1R1VA 3QYEA 4ZJZA 1MMDA 2ECCA 5LHIA
chains in the Genus database with same CATH topology
2P7CB 3ZMSA 5KK1A 3RYRA 4HX4A 5E1WA 4KIBA 1H9GA 1ZRCA 1KU7A 4LG0B 3EDPA 4HAMA 2J5OA 3BZ6A 3R0AA 5L3FA 1YIOA 2ZFWA 2PMHA 1FPQA 3F3XA 5L3DA 3CTAA 2ZXJA 2J5PA 5HLHA 2ETHA 4OIQF 2CSOA 1S7OA 5ED4A 1FZPB 5K5RA 4L0ZB 4GYGA 2LSOA 5K5QA 2MH2A 1YS6A 1UHMA 1STZA 1T2KA 3I53A 3BOQA 4LB6B 1R00A 3MZHA 1XGOA 1U5TA 3E6MA 2M87A 5J8CA 1NHAA 4L5JA 2M1BA 1YO5C 3LAJA 3L2CA 2VOPA 1Z9CA 4ZZDA 1YFHA 4FHTA 3WE2A 4ZYEA 4IRHA 3V8JA 1Z1DA 1W4MA 4LJZF 1SMTA 2CW0F 3RYPA 1CF7A 4DNCA 5LBQA 2CGPA 1ZGJA 4A5NA 3COAC 5ILVA 3F8FA 5HLGA 4YG2F 3Q5FA 2DPUA 3O3KA 4YFKF 2HKOA 5FFXA 3BPVA 1ON2A 4UXNA 4EGYA 1IN5A 4RGRA 4OINF 3GVAA 5IT9K 2VONA 3IC7A 1YW7A 4L5IA 1QQIA 2NNYA 3L9FA 4KUMA 4M73A 3JSOA 1ODDA 2Z33A 1XSVA 5BMZA 2R3SA 1ZG1A 4HX7A 2PBIA 5AONA 4EJTA 4IRGA 1FYKA 4CDGA 4I0AA 1LJ9A 4KMFA 2NAZA 1BC8C 3KP2A 1QBJA 1QNTA 1F1ZA 3CLOA 1XDSA 2RV8A 2VC0A 1HSJA 2ZJ2A 4ZZLA 3DPLC 2CG4A 1BM9A 3FMQA 3WTYC 3KLNA 4LG0A 2VBZA 3DPTA 2K02A 2V1UA 5HDNA 3VFZA 3RDIA 3CO7C 2Z3YA 5DV5A 3DKWA 4UUVA 4KFCA 2HFHA 1XN7A 2PN6A 4M9ZA 2LDUA 1YQAA 4N9IA 1BI1A 4BHBA 2EA4A 2FRHA 5FB2A 1EH7A 4AIKA 2KKOA 1PP8F 2VBWA 4M9SA 1W5SA 1R36A 1F5TA 1TQMA 2RDPA 2COMA 3TQNA 3W6KB 2QQBA 1WI9A 4GXOA 3BDDA 3L7WA 2ZMEB 3F6VA 2VT3A 2BV6A 4HLYA 3HHHA 2KIUA 3GWZA 4Y17A 2PQ8A 3NEUA 2HR3A 1BC7C 3BWGA 4A5MA 3TO6A 4QLCU 4JQFA 2OU2A 4NQWA 1IUYA 1U2WA 5HVQC 2W25A 1J7KA 3SQNA 3BROA 5LHGA 3LA3A 2P5KA 2FMLA 2E7WA 5DUKA 2IJLA 3HYIA 1RZ4A 2QUFA 1O3QA 1ZG5A 1SD5A 2M5WA 3L00A 2HQNA 4RGXA 5D6FA 4LD5A 3EQLF 1JE8A 1BOAA 1LB2A 1OYYA 1E17A 3E5UA 3I54A 4Z2YA 4K2EA 2QLZA 4HA8A 2GAUA 1Z05A 3GUDA 2W24A 3DV8A 4A6DA 1P2FA 3MZYA 4ESJA 2PI0A 2F5CA 2OA4A 2QWWA 5LGUA 4L9VA 1ZAOA 2XHKA 2XAFA 1P4WA 3LFKA 2VXZA 4WXCA 4HQEA 2KIMA 1XMAA 2IVMA 3R0JA 4PZJA 2A68F 5H6QA 3BJ6A 1Z7UA 1ZREA 1IRGA 5E1ZB 3CUQA 4PCQA 1FP2A 1KYWA 3WE3A 2MD5A 2XIGA 1AOYA 1XGMA 3HUGA 1D5VA 3ZMVA 1T39A 1MJBA 3DXJF 2XAQA 2L4MA 1IXCA 1MZBA 3MEXA 2QM3A 3Q9SA 3E5XA 1UHWA 1EH6A 4AWXB 2XASA 4YIFA 1MDMB 2H27A 1VTNC 2PJPA 5E20A 1YTYA 1ZH5A 1UB9A 1FSEA 3KFWX 1XSDA 1A04A 4HX8A 5CVUA 2FF4A 3DEUA 3KEQA 3ZPLA 1DPRA 2QENA 2YSRA 4ZYGA 4KDPA 2XUBA 1HKTA 2LF8A 2PEXA 2LKPA 3GW2A 5FFZA 3SZTA 5F64A 1U3EM 2Q2EA 2IA0A 5DD8A 4G9YA 5D5WB 3HRSA 3JTHA 4EM2A 1LDDA 1OR7A 2CO5A 3QPTA 2C6YA 3K0LA 5HDGA 4YFNF 1PDNC 3CJNA 4ESFA 2EFQA 2GXGA 4CGZA 1I1SA 3Q9VA 4H0EA 2GQQA 2DO7A 1LNWA 3DFGA 2P4WA 1LQ1A 4EJVA 2A5YB 4MEXF 4A0YA 5BS6A 2GA2A 1J9IA 5DCMB 1R5HA 1QGPA 3VEPA 4M74A 3TGNA 3EETA 3I64A 3VB2A 2QBYA 3P9IA 2QQAA 1GXPA 3F8NA 3GXOA 3CUOA 4XLPF 1DP7P 3RI4A 1SD4A 3E6CC 3EYIA 3CO6C 4GCVA 4UV8A 4S05A 2ADUA 3WTWC 5L3BA 4EV0A 5IT9Z 3TOBA 1IN8A 1IXRC 5CVVA 5FD6A 1U8RA 5LHHA 5J8FA 4B09A 3FXQA 3ERED 3ZQ7A 1D8KA 2O03A 1XDUA 4LFUA 2ZKZA 4KYWA 2FQ3A 5LGTA 3ZP5A 1JGSA 1O7LA 1FBSA 2A3SA 3K1PA 2FMYA 2H6BA 2GA1A 4KNYA 4HYEA 3REOA 4RAZA 3R4KA 1O3TA 4XBFA 4G6QA 3BP8A 2STTA 5CVRA 2QVOA 4KT5C 2IP2A 2G7UA 1Q1HA 3IKTA 1JHHA 2IA1A 2UXNA 2F5EA 2VN2A 5LRRA 4YIIA 1YS7A 2CYYA 2XKPA 3WODF 2OQRA 2DU9A 1REPC 1MJ9A 5HLIA 3WTTC 2V79A 3I5UA 4CZZA 1YLFA 1PUEE 5DDGA 4OIRF 1YYVA 1USSA 3T1BA 2P5LC 1HKQA 1QPMA 1CF7B 2V6CA 3WG9A 1K79A 1TW3A 3P9KA 2XV4S 3KP3A 1RIOH 5LEKA 2DK8A 1R22A 4CO8A 2HTSA 4MEYF 4Q48A 3GF2A 5TJJA 4E70A 1K6OA 5ICEA 2VOOA 4UNOA 4UVBA 3F8CA 3RKYA 1K78B 4L18B 2HYFA 4IRIA 1S6LA 2MA3A 1TQIA 3GX4X 2H94A 4ASNA 4LB5A 2RC4A 4HQMA 2DAOA 2O6GE 1O7FA 4EM1A 3DQVC 2Q0OA 2ZMEA 3M9AA 5F1RA 1FYMA 2P6TA 1ZLKA 2FSWA 4OOIA 4ETSA 5ERIA 4HF1A 5CYVA 3SHFA 4AD9A 2GZWA 2O3FA 4G94A 1RI7A 3KETA 4IXAA 5D4RA 3BJOA 3DP7A 1QZYA 5LGNA 5D8LB 2DW4A 5ICFA 2VC1A 1IN4A 2H6CA 4EM0B 2NS0A 4N9HA 2JZYA 1U6GA 3WGIA 4AVPA 4ZYDA 3HTSB 1BJAA 4EMSA 1B59A 4ENJA 3MAJA 2FBHA 4BAYA 2O0YA 4NHJA 2YPRA 2XGXA 3WU1B 1X3UA 2F5DA 1Z91A 3GZ6A 4BH9A 4I09A 4Q47A 1YW9A 2P5VA 4PDKA 2G9WA 2MBFA 1BI3A 1OYWA 4M71A 1T38A 4GYIA 2DTRA 3I59A 5JR3A 5D6EA 5KVRA 1FY7A 1XCBA 4B8XA 1GXQA 5DEQA 3J81Z 1U78A 2E7XA 1KQ9A 2L54A 2MLKA 3FF5A 3ZMDA 4LGWA 1G6NA 2K4BA 4ENMA 2KJBA 5A2QK 2BYVE 2RN7A 5JVTA 3GEZA 3GFIA 5A2QZ 1BIBA 6PAXA 1HW2A 1SFUA 3IWZA 4CHUA 1LVAA 4OIOF 4D0PA 1ZRFA 3LWFA 4UV9A 2A07F 5CLSA 1USTA 2KIFA 2BBYA 2ZNZA 1J5YA 3E3VA 1C0WA 5ILSA 1JHFA 4RGSA 4R79A 2G7HA 2FE3A 2Y75A 1AWCA 4WWCA 3EUHA 2EJRA 3ABUA 3JSPA 4A2UA 1SMYF 2K4JA 2PLYA 1WKMA 4R1HA 2HOEA 1B6AA 4JK1X 1XB4A 3V7CA 1PP7U 4KICA 4MHGA 5E18F 2QZ8A 3FXRA 1RNLA 2DT5A 3WTSC 1S8NA 1J59A 3PFIA 2DK5A 3HRTA 4LK0F 2JSCA 3KP6A 3MWMA 4RB2C 1H9TA 3BJAA 1HXDA 2RKHA 1XD7A 4G8XA 3L09A 1G3YA 3IHUA 1TQPA 1Y0UA 1SAXA 2XVCA 4M6YA 4BXUA 2UXXA 2DI3A 2WV0A 4BNCA 3HHGA 2FOKA 3C7JA 1P92A 1WRJA 2EFPA 3QAHA 3M7GA 2H09A 3RKXA 5JFRA 2LNBA 1TBXA 2JRTA 1YG2A 4P55A 5K1YA 1IRFA 2A61A 4UHTA 3I59B 4IF4A 1V4RA 3H92A 3LA2A 5LEJA 1I27A 1FYLA 2MLGA 4HF2A 5HOOA 3HSEA 5BPIA 2OAZA 3CUQC 1ZG3A 2GIVA 3IKVA 1G3WA 1XGSA 1I6XA 4IHTA 1BIAA 2XAJA 4FX0A 2FBKA 5ICGA 3RTRA 2ESHA 2Z9OA 4RB1A 2IPQX 3M1EA 3P9CA 4MQVA 1IN6A 5DCMA 4G7ZF 4U0YA 5BQTA 2M8EA 3ABTA 1J75A 1R5GA 1W7PB 2EFWA 4KIGA 1ONVA 3P7NA 1J0RA 4IHSA 4HW0A 2DPDA 5K5OA 5L3GA 1MKMA 4MNUA 1O3SA 4PGHA 2IRFG 1TLHB 2D1HA 4LLNA 1L0OC 5DYMA 2RVCA 3TO7A 4U7DA 4O3MA 3FMSA 1FWZA 4A6EA 4KA4A 3F8MA 3K9TA 1OKRA 2RNJA 4L9TA 3HSFA 1IXSB 5JI6A 1V3FA 1BBYA 2V9VA 3FM3A 4ZYHA 2ZCWA 4G7HF 1HKSA 1S3JA 3C18A 1R23A 1R7JA 2FXAA 5D4SA 4AIJA 2V1XA 3EYYA 3MCZA 2TDXA 1T0FA 4OIPF 2E1CA 4A0XA 1BI2A 1MDMA 1LDJA 4BHCA 1BN5A 5E1XA 1RUNA 3QU3A 4P5OA 2ZNYA 4XSZF 3KP5A 2HYGD 3ECHA 4YFXF 3QP6A 3F8BA 2PMUA 4O6JA 3V7SA 5EEGA 3K1NA 2O61A 1BI0A 4HOBA 2IW5A 2QYOA 1R1TA 3GLXA 4EQQA 2MC3A 3K1MA 2K7LA 1WQ2A 4A0ZA 5CJ9A 2VE8A 1FBUA 3M8EA 3V7RA 2Y48A 2EFOA 4WF2A 1D8JA 2K86A 3N4MA 5CVIA 2STWA 2XAHA 3N97A 3T8RA 4EJUA 1KGSA 3ZMUA 2ACJA 5LLQA 3F21A 3T0YA 3C3WA 4KN4X 3E6DA 1DDNA 2CWEA 3IL2A 3J81K 5E8GA 2EB7A 4M9XA 3FM5A 4HBLA 2GXBA 1B9NA 4RGUA 3FXUA 4I02A 5FGMA 4EJWA 5D5VB 5E17F 2W85A 1B1BA 3KE2A 3QU6A 2QBYB 4G6DA 4LLGF 4MTEA 2NNNA 4I2OA 3ZN0A 3TOAA 5HDKA 4XSXF 4P96A 1KA8A 1EV7A 1H0MA 1FOKA 3U1DA 1G3SA 3WTUC 2R7DA 1KQ8A 3GO5A 1XSXA 4HLXA 4BHPA 3R60A 2EK5A 1W7PA 2QQ9A 1KU2A 5FD5A 3HIFA 2PG4A 1FLIA 1ZRDA 3WU0A 4U7BA 3F22A 4F7ZA 2DLLA 3C1DA 3TDZC 4EGZA 2EWNA 2XKOA 1IZ1A 1GVJA 4DQ2A 1W5TA 4FT8A 1E2XA 3RIRA 1ZARA 3M8FA 5E8IA 5H20A 3T5XA 3LA7A 1GHCA 3GFMA 2OZUA 3ZN1A 2YX7A 1U5TC 3J80K 2DQLA 2AXLA 2RGVA 4U0WA 2IT0A 1B9MA 3J80Z 3QRFF 3KLOA 2X4HA 4MTDA 3TO9A 3BY6A 5TRDA 3LAPA 1FC3A 3CUQB 4U88A 1LEBA 1T6SA 4A12A 3W6JB 1P4AA 4LMYA 3U2RA 1R1UA 1O3RA 1B4AA 3OOPA 2FBIA 1KQ0A 2D1VA 4BYYA 4WX9A 1XCVA 4O5VA 5AIQA 3O6BB 2NRAC 5BPDA 4S04A 3VOEA 4M6XA 1HBXG 1UFMA 2HKXA 2L02A 1K78A 3ZMTA 4KMUX 2V1DA 2L4AA 4I0BA 2YX4A 2EV5A 2F2EA 4WK8F 3NRVA 2UWMA 4HV5A 2ISZA 2OQGA 2FA5A 1EH8A 4RS8A 5FLXZ 3PQKA 3ZMZA 3HTUA 3TKYA 3NQOA 3BPXA 4EVIA 3B02A 3LQQA 3IRQA 5ICCA 2ZO4A 5LRSA 1QZZA 2BGCA 1U5TB 4ENNA 2JPBA 2OBPA 1TNTA 2VT2A 3RJPA 1I1GA 3WGHA 1MGTA 2VODA 3V4GA 3ROUA 1I5ZA 2ISYA 1IW7F 3WTVC 2D45A 1HW1A 4KIFA 1HQCA 3FMRA 1IF1A 4P9FA 2XAGA 4P9UA 2RQPA 2DBBA 4IJAA 1TNSA 3G3ZA 3MQ0A 4OMZA 4IVNA 1KYZA 2LF7A 2P6SA 1IAWA 3ISPA 3B73A 3E97A 3RPQA 1HSTA 5HS8A 3D5LA 3O2PE 2AS5F 2ELHA 2EV0A 2F5FA 2XRNA 1HW5A 4FX4A 1YW8A 2YU3A 3HOTA 1ZGAA 3GYHX 3G73A 2CQKA 3KP7A 1LEAA 4MGRA 1FX7A 2OD5A 2HS5A 3GZ5A 4Q5SF 3QOPA 2VBYA 3ULQB 1LDKB 1ULYA 1OMIA 3WGGA 1OYIA 2MH9A 5DD4A 2L01A 1IN7A 3IWFA 4RB0A 3KCCA 3D0SA 2HWVA 1MJAA 3QP5A 3R61A 4Y15A 3I0TA 3SZPA 4L9JA 1F9NA 3WTZA 2EV6A 3FHZA 3I71A 2R7FA 2NYXA 4CXFA 2BEOA 4N0BA 3KP4A 3R6SA 2A6HF 4L0YB 2DFIA 2ZBKA 4HDVA 2D2WA 4RAYA 3FZVA 4XLNF 1OPCA 2M30A 4HZFA 3HRUA 2X0LA 2GWRA 1TW2A 5J6XA 2FU4A 2E1NA 3E5QA 2O8XA 2KRFA 4M72A 3ELKA 2YR2A 1CGPA 1RUOA 4GO1A 3HRMA 4XRFA 1DUXC 4ZH4F 1QO0D 2A6EF 3JAMZ 4TV7A 1DPUA 1XMKA 3JAMK 2KJCA 4HDUA 4EJOA 3MFKA 3I4PA 4I01A 3SXYA 4WXHA 2WTEA 2JTVA 4AIHA 3WTXC 2Z99A 1KU3A 1SFEA 3HOSA 1ZHFA 2HTJA 3GFJA 5D5XB 2HEOA 1JXSA 2FEZA 3J7AO 1UCRA 4OMYA 4LLLA 2EFNA 3KZYA 5L3CA 4IPAA 2HZTA 2HQRA 5D8KB 1ON1A 5EEHA 2IA2A 3DF8A 1WWXA 3FWEA 3QPHA 2BE5F 3U9GA 1F4KA 3H3ZA 4ESBA 2B0LA 3I58A 4RB3C 5IT3A 4NB5A 3PQJA 3H3UA 5JHUA 5HS9A 2Y0MA 2WC2A 1SD6A 5HS7A 5AIPA 4R8HA 1Z6RA 3SFZA 1MD0A 4G7OF 3IRRA 2P7VB 1R58A 4WXDA 3ECOA 2JPCA 5L3EA 2M45A 3CDHA 5CVJA 2WWYA 3K2ZA 5DCFA 4UVAA 2XROA 4Y13A 3LSTA 1K7AA 4L9NA 3AAFA 5BOXA 1T98A 2K27A 2OZ6A 1W7PD 2EA2A 4U0VA 2DQRA 2JT1A 5D5UB 2Z5UA 1SFXA 1D3YA 1O57A 2FNPA 4HV6A 1P6RA 2L3DA 4UVCA 4HF0A 4KN7X 4MQ9F 1J2XA 4WCGA 1SD7A 2Q8KA 4QWQA 2VBXA 2UZKA 3VODA 4ENKA 3GFLA 5FLXK 1Z6TA 5ILUA 1XGNA 1S29A 4JBAA 3S2WA 3RKWA 3F6OA 4OU0A 2CFXA 4CYDA 4I7HA 1FBQA 1FT9A 5H6RA 1ZN2A 4LK1F 3TDUC 5DUIA 5FO5A 1S7AA 1TTYA 2W57A 3KZZA 1G3TA 1KU9A 3T8TA 2ESNA 3V8KA 4I98B 3HSRA 2HGCA 3ML6A 3RPUA 1FSHA 2FNAA 3FX3A 3F72A 4PGGA 1ZLJA 2HDCA 4GGGA 3KEOA 5F6FA 4Q4ZF 1WSUA 4BQAA 3JTGA 1L3LA 3JW4A 2A69F 3V8LA 1FNNA 2W84A 2VE9A 4ON0A 3E6BA 1FP1D 3LQRA 4CICA 2P8TA 1ZYRF 1P4XA 3OV8A 1G4DA 2PFBA 3F23A 3K69A 1R1VA 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7C B;  3ZMS A;  5KK1 A;  3RYR A;  4HX4 A;  5E1W A;  4KIB A;  1H9G A;  1ZRC A;  1KU7 A;  4LG0 B;  3EDP A;  4HAM A;  2J5O A;  3BZ6 A;  3R0A A;  5L3F A;  1YIO A;  2ZFW A;  2PMH A;  1FPQ A;  3F3X A;  5L3D A;  3CTA A;  2ZXJ A;  2J5P A;  5HLH A;  2ETH A;  4OIQ F;  2CSO A;  1S7O A;  5ED4 A;  1FZP B;  5K5R A;  4L0Z B;  4GYG A;  2LSO A;  5K5Q A;  2MH2 A;  1YS6 A;  1UHM A;  1STZ A;  1T2K A;  3I53 A;  3BOQ A;  4LB6 B;  1R00 A;  3MZH A;  1XGO A;  1U5T A;  3E6M A;  2M87 A;  5J8C A;  1NHA A;  4L5J A;  2M1B A;  1YO5 C;  3LAJ A;  3L2C A;  2VOP A;  1Z9C A;  4ZZD A;  1YFH A;  4FHT A;  3WE2 A;  4ZYE A;  4IRH A;  3V8J A;  1Z1D A;  1W4M A;  4LJZ F;  1SMT A;  2CW0 F;  3RYP A;  1CF7 A;  4DNC A;  5LBQ A;  2CGP A;  1ZGJ A;  4A5N A;  3COA C;  5ILV A;  3F8F A;  5HLG A;  4YG2 F;  3Q5F A;  2DPU A;  3O3K A;  4YFK F;  2HKO A;  5FFX A;  3BPV A;  1ON2 A;  4UXN A;  4EGY A;  1IN5 A;  4RGR A;  4OIN F;  3GVA A;  5IT9 K;  2VON A;  3IC7 A;  1YW7 A;  4L5I A;  1QQI A;  2NNY A;  3L9F A;  4KUM A;  4M73 A;  3JSO A;  1ODD A;  2Z33 A;  1XSV A;  5BMZ A;  2R3S A;  1ZG1 A;  4HX7 A;  2PBI A;  5AON A;  4EJT A;  4IRG A;  1FYK A;  4CDG A;  4I0A A;  1LJ9 A;  4KMF A;  2NAZ A;  1BC8 C;  3KP2 A;  1QBJ A;  1QNT A;  1F1Z A;  3CLO A;  1XDS A;  2RV8 A;  2VC0 A;  1HSJ A;  2ZJ2 A;  4ZZL A;  3DPL C;  2CG4 A;  1BM9 A;  3FMQ A;  3WTY C;  3KLN A;  4LG0 A;  2VBZ A;  3DPT A;  2K02 A;  2V1U A;  5HDN A;  3VFZ A;  3RDI A;  3CO7 C;  2Z3Y A;  5DV5 A;  3DKW A;  4UUV A;  4KFC A;  2HFH A;  1XN7 A;  2PN6 A;  4M9Z A;  2LDU A;  1YQA A;  4N9I A;  1BI1 A;  4BHB A;  2EA4 A;  2FRH A;  5FB2 A;  1EH7 A;  4AIK A;  2KKO A;  1PP8 F;  2VBW A;  4M9S A;  1W5S A;  1R36 A;  1F5T A;  1TQM A;  2RDP A;  2COM A;  3TQN A;  3W6K B;  2QQB A;  1WI9 A;  4GXO A;  3BDD A;  3L7W A;  2ZME B;  3F6V A;  2VT3 A;  2BV6 A;  4HLY A;  3HHH A;  2KIU A;  3GWZ A;  4Y17 A;  2PQ8 A;  3NEU A;  2HR3 A;  1BC7 C;  3BWG A;  4A5M A;  3TO6 A;  4QLC U;  4JQF A;  2OU2 A;  4NQW A;  1IUY A;  1U2W A;  5HVQ C;  2W25 A;  1J7K A;  3SQN A;  3BRO A;  5LHG A;  3LA3 A;  2P5K A;  2FML A;  2E7W A;  5DUK A;  2IJL A;  3HYI A;  1RZ4 A;  2QUF A;  1O3Q A;  1ZG5 A;  1SD5 A;  2M5W A;  3L00 A;  2HQN A;  4RGX A;  5D6F A;  4LD5 A;  3EQL F;  1JE8 A;  1BOA A;  1LB2 A;  1OYY A;  1E17 A;  3E5U A;  3I54 A;  4Z2Y A;  4K2E A;  2QLZ A;  4HA8 A;  2GAU A;  1Z05 A;  3GUD A;  2W24 A;  3DV8 A;  4A6D A;  1P2F A;  3MZY A;  4ESJ A;  2PI0 A;  2F5C A;  2OA4 A;  2QWW A;  5LGU A;  4L9V A;  1ZAO A;  2XHK A;  2XAF A;  1P4W A;  3LFK A;  2VXZ A;  4WXC A;  4HQE A;  2KIM A;  1XMA A;  2IVM A;  3R0J A;  4PZJ A;  2A68 F;  5H6Q A;  3BJ6 A;  1Z7U A;  1ZRE A;  1IRG A;  5E1Z B;  3CUQ A;  4PCQ A;  1FP2 A;  1KYW A;  3WE3 A;  2MD5 A;  2XIG A;  1AOY A;  1XGM A;  3HUG A;  1D5V A;  3ZMV A;  1T39 A;  1MJB A;  3DXJ F;  2XAQ A;  2L4M A;  1IXC A;  1MZB A;  3MEX A;  2QM3 A;  3Q9S A;  3E5X A;  1UHW A;  1EH6 A;  4AWX B;  2XAS A;  4YIF A;  1MDM B;  2H27 A;  1VTN C;  2PJP A;  5E20 A;  1YTY A;  1ZH5 A;  1UB9 A;  1FSE A;  3KFW X;  1XSD A;  1A04 A;  4HX8 A;  5CVU A;  2FF4 A;  3DEU A;  3KEQ A;  3ZPL A;  1DPR A;  2QEN A;  2YSR A;  4ZYG A;  4KDP A;  2XUB A;  1HKT A;  2LF8 A;  2PEX A;  2LKP A;  3GW2 A;  5FFZ A;  3SZT A;  5F64 A;  1U3E M;  2Q2E A;  2IA0 A;  5DD8 A;  4G9Y A;  5D5W B;  3HRS A;  3JTH A;  4EM2 A;  1LDD A;  1OR7 A;  2CO5 A;  3QPT A;  2C6Y A;  3K0L A;  5HDG A;  4YFN F;  1PDN C;  3CJN A;  4ESF A;  2EFQ A;  2GXG A;  4CGZ A;  1I1S A;  3Q9V A;  4H0E A;  2GQQ A;  2DO7 A;  1LNW A;  3DFG A;  2P4W A;  1LQ1 A;  4EJV A;  2A5Y B;  4MEX F;  4A0Y A;  5BS6 A;  2GA2 A;  1J9I A;  5DCM B;  1R5H A;  1QGP A;  3VEP A;  4M74 A;  3TGN A;  3EET A;  3I64 A;  3VB2 A;  2QBY A;  3P9I A;  2QQA A;  1GXP A;  3F8N A;  3GXO A;  3CUO A;  4XLP F;  1DP7 P;  3RI4 A;  1SD4 A;  3E6C C;  3EYI A;  3CO6 C;  4GCV A;  4UV8 A;  4S05 A;  2ADU A;  3WTW C;  5L3B A;  4EV0 A;  5IT9 Z;  3TOB A;  1IN8 A;  1IXR C;  5CVV A;  5FD6 A;  1U8R A;  5LHH A;  5J8F A;  4B09 A;  3FXQ A;  3ERE D;  3ZQ7 A;  1D8K A;  2O03 A;  1XDU A;  4LFU A;  2ZKZ A;  4KYW A;  2FQ3 A;  5LGT A;  3ZP5 A;  1JGS A;  1O7L A;  1FBS A;  2A3S A;  3K1P A;  2FMY A;  2H6B A;  2GA1 A;  4KNY A;  4HYE A;  3REO A;  4RAZ A;  3R4K A;  1O3T A;  4XBF A;  4G6Q A;  3BP8 A;  2STT A;  5CVR A;  2QVO A;  4KT5 C;  2IP2 A;  2G7U A;  1Q1H A;  3IKT A;  1JHH A;  2IA1 A;  2UXN A;  2F5E A;  2VN2 A;  5LRR A;  4YII A;  1YS7 A;  2CYY A;  2XKP A;  3WOD F;  2OQR A;  2DU9 A;  1REP C;  1MJ9 A;  5HLI A;  3WTT C;  2V79 A;  3I5U A;  4CZZ A;  1YLF A;  1PUE E;  5DDG A;  4OIR F;  1YYV A;  1USS A;  3T1B A;  2P5L C;  1HKQ A;  1QPM A;  1CF7 B;  2V6C A;  3WG9 A;  1K79 A;  1TW3 A;  3P9K A;  2XV4 S;  3KP3 A;  1RIO H;  5LEK A;  2DK8 A;  1R22 A;  4CO8 A;  2HTS A;  4MEY F;  4Q48 A;  3GF2 A;  5TJJ A;  4E70 A;  1K6O A;  5ICE A;  2VOO A;  4UNO A;  4UVB A;  3F8C A;  3RKY A;  1K78 B;  4L18 B;  2HYF A;  4IRI A;  1S6L A;  2MA3 A;  1TQI A;  3GX4 X;  2H94 A;  4ASN A;  4LB5 A;  2RC4 A;  4HQM A;  2DAO A;  2O6G E;  1O7F A;  4EM1 A;  3DQV C;  2Q0O A;  2ZME A;  3M9A A;  5F1R A;  1FYM A;  2P6T A;  1ZLK A;  2FSW A;  4OOI A;  4ETS A;  5ERI A;  4HF1 A;  5CYV A;  3SHF A;  4AD9 A;  2GZW A;  2O3F A;  4G94 A;  1RI7 A;  3KET A;  4IXA A;  5D4R A;  3BJO A;  3DP7 A;  1QZY A;  5LGN A;  5D8L B;  2DW4 A;  5ICF A;  2VC1 A;  1IN4 A;  2H6C A;  4EM0 B;  2NS0 A;  4N9H A;  2JZY A;  1U6G A;  3WGI A;  4AVP A;  4ZYD A;  3HTS B;  1BJA A;  4EMS A;  1B59 A;  4ENJ A;  3MAJ A;  2FBH A;  4BAY A;  2O0Y A;  4NHJ A;  2YPR A;  2XGX A;  3WU1 B;  1X3U A;  2F5D A;  1Z91 A;  3GZ6 A;  4BH9 A;  4I09 A;  4Q47 A;  1YW9 A;  2P5V A;  4PDK A;  2G9W A;  2MBF A;  1BI3 A;  1OYW A;  4M71 A;  1T38 A;  4GYI A;  2DTR A;  3I59 A;  5JR3 A;  5D6E A;  5KVR A;  1FY7 A;  1XCB A;  4B8X A;  1GXQ A;  5DEQ A;  3J81 Z;  1U78 A;  2E7X A;  1KQ9 A;  2L54 A;  2MLK A;  3FF5 A;  3ZMD A;  4LGW A;  1G6N A;  2K4B A;  4ENM A;  2KJB A;  5A2Q K;  2BYV E;  2RN7 A;  5JVT A;  3GEZ A;  3GFI A;  5A2Q Z;  1BIB A;  6PAX A;  1HW2 A;  1SFU A;  3IWZ A;  4CHU A;  1LVA A;  4OIO F;  4D0P A;  1ZRF A;  3LWF A;  4UV9 A;  2A07 F;  5CLS A;  1UST A;  2KIF A;  2BBY A;  2ZNZ A;  1J5Y A;  3E3V A;  1C0W A;  5ILS A;  1JHF A;  4RGS A;  4R79 A;  2G7H A;  2FE3 A;  2Y75 A;  1AWC A;  4WWC A;  3EUH A;  2EJR A;  3ABU A;  3JSP A;  4A2U A;  1SMY F;  2K4J A;  2PLY A;  1WKM A;  4R1H A;  2HOE A;  1B6A A;  4JK1 X;  1XB4 A;  3V7C A;  1PP7 U;  4KIC A;  4MHG A;  5E18 F;  2QZ8 A;  3FXR A;  1RNL A;  2DT5 A;  3WTS C;  1S8N A;  1J59 A;  3PFI A;  2DK5 A;  3HRT A;  4LK0 F;  2JSC A;  3KP6 A;  3MWM A;  4RB2 C;  1H9T A;  3BJA A;  1HXD A;  2RKH A;  1XD7 A;  4G8X A;  3L09 A;  1G3Y A;  3IHU A;  1TQP A;  1Y0U A;  1SAX A;  2XVC A;  4M6Y A;  4BXU A;  2UXX A;  2DI3 A;  2WV0 A;  4BNC A;  3HHG A;  2FOK A;  3C7J A;  1P92 A;  1WRJ A;  2EFP A;  3QAH A;  3M7G A;  2H09 A;  3RKX A;  5JFR A;  2LNB A;  1TBX A;  2JRT A;  1YG2 A;  4P55 A;  5K1Y A;  1IRF A;  2A61 A;  4UHT A;  3I59 B;  4IF4 A;  1V4R A;  3H92 A;  3LA2 A;  5LEJ A;  1I27 A;  1FYL A;  2MLG A;  4HF2 A;  5HOO A;  3HSE A;  5BPI A;  2OAZ A;  3CUQ C;  1ZG3 A;  2GIV A;  3IKV A;  1G3W A;  1XGS A;  1I6X A;  4IHT A;  1BIA A;  2XAJ A;  4FX0 A;  2FBK A;  5ICG A;  3RTR A;  2ESH A;  2Z9O A;  4RB1 A;  2IPQ X;  3M1E A;  3P9C A;  4MQV A;  1IN6 A;  5DCM A;  4G7Z F;  4U0Y A;  5BQT A;  2M8E A;  3ABT A;  1J75 A;  1R5G A;  1W7P B;  2EFW A;  4KIG A;  1ONV A;  3P7N A;  1J0R A;  4IHS A;  4HW0 A;  2DPD A;  5K5O A;  5L3G A;  1MKM A;  4MNU A;  1O3S A;  4PGH A;  2IRF G;  1TLH B;  2D1H A;  4LLN A;  1L0O C;  5DYM A;  2RVC A;  3TO7 A;  4U7D A;  4O3M A;  3FMS A;  1FWZ A;  4A6E A;  4KA4 A;  3F8M A;  3K9T A;  1OKR A;  2RNJ A;  4L9T A;  3HSF A;  1IXS B;  5JI6 A;  1V3F A;  1BBY A;  2V9V A;  3FM3 A;  4ZYH A;  2ZCW A;  4G7H F;  1HKS A;  1S3J A;  3C18 A;  1R23 A;  1R7J A;  2FXA A;  5D4S A;  4AIJ A;  2V1X A;  3EYY A;  3MCZ A;  2TDX A;  1T0F A;  4OIP F;  2E1C A;  4A0X A;  1BI2 A;  1MDM A;  1LDJ A;  4BHC A;  1BN5 A;  5E1X A;  1RUN A;  3QU3 A;  4P5O A;  2ZNY A;  4XSZ F;  3KP5 A;  2HYG D;  3ECH A;  4YFX F;  3QP6 A;  3F8B A;  2PMU A;  4O6J A;  3V7S A;  5EEG A;  3K1N A;  2O61 A;  1BI0 A;  4HOB A;  2IW5 A;  2QYO A;  1R1T A;  3GLX A;  4EQQ A;  2MC3 A;  3K1M A;  2K7L A;  1WQ2 A;  4A0Z A;  5CJ9 A;  2VE8 A;  1FBU A;  3M8E A;  3V7R A;  2Y48 A;  2EFO A;  4WF2 A;  1D8J A;  2K86 A;  3N4M A;  5CVI A;  2STW A;  2XAH A;  3N97 A;  3T8R A;  4EJU A;  1KGS A;  3ZMU A;  2ACJ A;  5LLQ A;  3F21 A;  3T0Y A;  3C3W A;  4KN4 X;  3E6D A;  1DDN A;  2CWE A;  3IL2 A;  3J81 K;  5E8G A;  2EB7 A;  4M9X A;  3FM5 A;  4HBL A;  2GXB A;  1B9N A;  4RGU A;  3FXU A;  4I02 A;  5FGM A;  4EJW A;  5D5V B;  5E17 F;  2W85 A;  1B1B A;  3KE2 A;  3QU6 A;  2QBY B;  4G6D A;  4LLG F;  4MTE A;  2NNN A;  4I2O A;  3ZN0 A;  3TOA A;  5HDK A;  4XSX F;  4P96 A;  1KA8 A;  1EV7 A;  1H0M A;  1FOK A;  3U1D A;  1G3S A;  3WTU C;  2R7D A;  1KQ8 A;  3GO5 A;  1XSX A;  4HLX A;  4BHP A;  3R60 A;  2EK5 A;  1W7P A;  2QQ9 A;  1KU2 A;  5FD5 A;  3HIF A;  2PG4 A;  1FLI A;  1ZRD A;  3WU0 A;  4U7B A;  3F22 A;  4F7Z A;  2DLL A;  3C1D A;  3TDZ C;  4EGZ A;  2EWN A;  2XKO A;  1IZ1 A;  1GVJ A;  4DQ2 A;  1W5T A;  4FT8 A;  1E2X A;  3RIR A;  1ZAR A;  3M8F A;  5E8I A;  5H20 A;  3T5X A;  3LA7 A;  1GHC A;  3GFM A;  2OZU A;  3ZN1 A;  2YX7 A;  1U5T C;  3J80 K;  2DQL A;  2AXL A;  2RGV A;  4U0W A;  2IT0 A;  1B9M A;  3J80 Z;  3QRF F;  3KLO A;  2X4H A;  4MTD A;  3TO9 A;  3BY6 A;  5TRD A;  3LAP A;  1FC3 A;  3CUQ B;  4U88 A;  1LEB A;  1T6S A;  4A12 A;  3W6J B;  1P4A A;  4LMY A;  3U2R A;  1R1U A;  1O3R A;  1B4A A;  3OOP A;  2FBI A;  1KQ0 A;  2D1V A;  4BYY A;  4WX9 A;  1XCV A;  4O5V A;  5AIQ A;  3O6B B;  2NRA C;  5BPD A;  4S04 A;  3VOE A;  4M6X A;  1HBX G;  1UFM A;  2HKX A;  2L02 A;  1K78 A;  3ZMT A;  4KMU X;  2V1D A;  2L4A A;  4I0B A;  2YX4 A;  2EV5 A;  2F2E A;  4WK8 F;  3NRV A;  2UWM A;  4HV5 A;  2ISZ A;  2OQG A;  2FA5 A;  1EH8 A;  4RS8 A;  5FLX Z;  3PQK A;  3ZMZ A;  3HTU A;  3TKY A;  3NQO A;  3BPX A;  4EVI A;  3B02 A;  3LQQ A;  3IRQ A;  5ICC A;  2ZO4 A;  5LRS A;  1QZZ A;  2BGC A;  1U5T B;  4ENN A;  2JPB A;  2OBP A;  1TNT A;  2VT2 A;  3RJP A;  1I1G A;  3WGH A;  1MGT A;  2VOD A;  3V4G A;  3ROU A;  1I5Z A;  2ISY A;  1IW7 F;  3WTV C;  2D45 A;  1HW1 A;  4KIF A;  1HQC A;  3FMR A;  1IF1 A;  4P9F A;  2XAG A;  4P9U A;  2RQP A;  2DBB A;  4IJA A;  1TNS A;  3G3Z A;  3MQ0 A;  4OMZ A;  4IVN A;  1KYZ A;  2LF7 A;  2P6S A;  1IAW A;  3ISP A;  3B73 A;  3E97 A;  3RPQ A;  1HST A;  5HS8 A;  3D5L A;  3O2P E;  2AS5 F;  2ELH A;  2EV0 A;  2F5F A;  2XRN A;  1HW5 A;  4FX4 A;  1YW8 A;  2YU3 A;  3HOT A;  1ZGA A;  3GYH X;  3G73 A;  2CQK A;  3KP7 A;  1LEA A;  4MGR A;  1FX7 A;  2OD5 A;  2HS5 A;  3GZ5 A;  4Q5S F;  3QOP A;  2VBY A;  3ULQ B;  1LDK B;  1ULY A;  1OMI A;  3WGG A;  1OYI A;  2MH9 A;  5DD4 A;  2L01 A;  1IN7 A;  3IWF A;  4RB0 A;  3KCC A;  3D0S A;  2HWV A;  1MJA A;  3QP5 A;  3R61 A;  4Y15 A;  3I0T A;  3SZP A;  4L9J A;  1F9N A;  3WTZ A;  2EV6 A;  3FHZ A;  3I71 A;  2R7F A;  2NYX A;  4CXF A;  2BEO A;  4N0B A;  3KP4 A;  3R6S A;  2A6H F;  4L0Y B;  2DFI A;  2ZBK A;  4HDV A;  2D2W A;  4RAY A;  3FZV A;  4XLN F;  1OPC A;  2M30 A;  4HZF A;  3HRU A;  2X0L A;  2GWR A;  1TW2 A;  5J6X A;  2FU4 A;  2E1N A;  3E5Q A;  2O8X A;  2KRF A;  4M72 A;  3ELK A;  2YR2 A;  1CGP A;  1RUO A;  4GO1 A;  3HRM A;  4XRF A;  1DUX C;  4ZH4 F;  1QO0 D;  2A6E F;  3JAM Z;  4TV7 A;  1DPU A;  1XMK A;  3JAM K;  2KJC A;  4HDU A;  4EJO A;  3MFK A;  3I4P A;  4I01 A;  3SXY A;  4WXH A;  2WTE A;  2JTV A;  4AIH A;  3WTX C;  2Z99 A;  1KU3 A;  1SFE A;  3HOS A;  1ZHF A;  2HTJ A;  3GFJ A;  5D5X B;  2HEO A;  1JXS A;  2FEZ A;  3J7A O;  1UCR A;  4OMY A;  4LLL A;  2EFN A;  3KZY A;  5L3C A;  4IPA A;  2HZT A;  2HQR A;  5D8K B;  1ON1 A;  5EEH A;  2IA2 A;  3DF8 A;  1WWX A;  3FWE A;  3QPH A;  2BE5 F;  3U9G A;  1F4K A;  3H3Z A;  4ESB A;  2B0L A;  3I58 A;  4RB3 C;  5IT3 A;  4NB5 A;  3PQJ A;  3H3U A;  5JHU A;  5HS9 A;  2Y0M A;  2WC2 A;  1SD6 A;  5HS7 A;  5AIP A;  4R8H A;  1Z6R A;  3SFZ A;  1MD0 A;  4G7O F;  3IRR A;  2P7V B;  1R58 A;  4WXD A;  3ECO A;  2JPC A;  5L3E A;  2M45 A;  3CDH A;  5CVJ A;  2WWY A;  3K2Z A;  5DCF A;  4UVA A;  2XRO A;  4Y13 A;  3LST A;  1K7A A;  4L9N A;  3AAF A;  5BOX A;  1T98 A;  2K27 A;  2OZ6 A;  1W7P D;  2EA2 A;  4U0V A;  2DQR A;  2JT1 A;  5D5U B;  2Z5U A;  1SFX A;  1D3Y A;  1O57 A;  2FNP A;  4HV6 A;  1P6R A;  2L3D A;  4UVC A;  4HF0 A;  4KN7 X;  4MQ9 F;  1J2X A;  4WCG A;  1SD7 A;  2Q8K A;  4QWQ A;  2VBX A;  2UZK A;  3VOD A;  4ENK A;  3GFL A;  5FLX K;  1Z6T A;  5ILU A;  1XGN A;  1S29 A;  4JBA A;  3S2W A;  3RKW A;  3F6O A;  4OU0 A;  2CFX A;  4CYD A;  4I7H A;  1FBQ A;  1FT9 A;  5H6R A;  1ZN2 A;  4LK1 F;  3TDU C;  5DUI A;  5FO5 A;  1S7A A;  1TTY A;  2W57 A;  3KZZ A;  1G3T A;  1KU9 A;  3T8T A;  2ESN A;  3V8K A;  4I98 B;  3HSR A;  2HGC A;  3ML6 A;  3RPU A;  1FSH A;  2FNA A;  3FX3 A;  3F72 A;  4PGG A;  1ZLJ A;  2HDC A;  4GGG A;  3KEO A;  5F6F A;  4Q4Z F;  1WSU A;  4BQA A;  3JTG A;  1L3L A;  3JW4 A;  2A69 F;  3V8L A;  1FNN A;  2W84 A;  2VE9 A;  4ON0 A;  3E6B A;  1FP1 D;  3LQR A;  4CIC A;  2P8T A;  1ZYR F;  1P4X A;  3OV8 A;  1G4D A;  2PFB A;  3F23 A;  3K69 A;  1R1V A;  5LHI A; 
#chains in the Genus database with same CATH topology
 2P7C B;  3ZMS A;  5KK1 A;  3RYR A;  2XRL A;  4HX4 A;  5E1W A;  2L9N A;  4KIB A;  4BGD A;  1H9G A;  4D7M A;  1ZRC A;  1KU7 A;  4LG0 B;  2JA6 J;  3S16 J;  2CU7 A;  1WPK A;  1WI3 A;  3EDP A;  2E1M C;  2X9D A;  3G71 I;  3BTJ A;  3BR1 A;  4HAM A;  2J5O A;  3BZ6 A;  3HZJ A;  3R0A A;  2H1K A;  2IGK A;  3B6A A;  1P9Q C;  5L3F A;  4CUG A;  1YIO A;  2ZFW A;  2PMH A;  2R5Y B;  1FPQ A;  3F3X A;  4AVZ A;  5J4Y A;  3AG4 H;  5L3D A;  3CTA A;  1D1C A;  2Q1Z B;  2E2I J;  3S15 J;  1DQU A;  2ZXJ A;  3FHN A;  4AM3 A;  2J5P A;  2OV7 A;  1WJA A;  3K4J A;  1IC8 A;  5HLH A;  3CCE I;  2ETH A;  2XGE A;  4OIQ F;  2ZB9 A;  3TW7 A;  2CSO A;  3LSK A;  1FIP A;  1T0F C;  3MZ8 A;  4F91 B;  1S7O A;  5ED4 A;  4DW6 A;  1FZP B;  3BG7 A;  5K5R A;  2VJI A;  3Q3S A;  2LSO A;  4GYG A;  2MH2 A;  5K5Q A;  1ZR4 A;  4L0Z B;  1YS6 A;  4DIQ A;  3OS0 A;  1UHM A;  2GOX B;  1STZ A;  1T2K A;  2AXT C;  1JTY A;  2BVM A;  3I53 A;  3I56 I;  3BOQ A;  4LB6 B;  3CDL A;  1R00 A;  3MZH A;  2ECB A;  1XGO A;  1U5T A;  1XC5 A;  2LP0 A;  2M7A A;  3E6M A;  3PNV A;  5LD2 C;  3S3O A;  2M87 A;  1NK3 P;  1Y39 A;  5J8C A;  1NHA A;  4L5J A;  2M1B A;  3IUO A;  4S0H B;  1YO5 C;  3LAJ A;  4N4O B;  2M4G A;  3L2C A;  3BG9 A;  1NH3 A;  2V4J C;  2VOP A;  1EA3 A;  3M1C A;  1VQ7 I;  4BBS J;  4IOA F;  2OJE D;  1Z9C A;  5M3F J;  2QSF X;  4ZZD A;  2RNG A;  5KHD A;  4A3K J;  4ANJ A;  1YFH A;  2LFB A;  4FHT A;  4ZDL A;  1HA8 A;  4RLF A;  4BAC A;  3WE2 A;  4ZYE A;  4IRH A;  3KYC B;  3V8J A;  4RBO A;  1I6H J;  2JA5 J;  5B1A H;  1Z1D A;  1W4M A;  4LJZ F;  1SMT A;  2CW0 F;  2VKV A;  3RYP A;  4HRI A;  1WHU A;  2VJ4 A;  4XQF A;  5F0C A;  1CF7 A;  4DNC A;  5B5E C;  5JHF A;  2CQ7 A;  5LBQ A;  4XM3 A;  2CGP A;  1ZGJ A;  3E1S A;  4A5N A;  2JUG A;  3COA C;  2BHZ A;  2M2E A;  3TMO A;  5ILV A;  2DA4 A;  3LFU A;  3F8F A;  5HLG A;  3LSI A;  4YG2 F;  3Q5F A;  3O3K A;  2DPU A;  4YFK F;  5C4X J;  2HKO A;  5FFX A;  3BPV A;  1ON2 A;  3QOD A;  4UXN A;  5DTD A;  4EGY A;  5J4V A;  5GAH J;  1IN5 A;  2XB0 X;  2M8G X;  3PNY A;  4RGR A;  3G6E I;  2R7T A;  2X48 A;  4OIN F;  2M0M A;  3GVA A;  5IT9 K;  2VON A;  3IC7 A;  1YW7 A;  3QYB A;  4IO9 F;  1I3Q J;  1TZL A;  4M3G A;  4L5I A;  1QQI A;  4IKF A;  2NNY A;  3L9F A;  4KUM A;  2YS9 A;  4M73 A;  3JSO A;  1ODD A;  2Z33 A;  3BR5 A;  2MSY A;  1XSV A;  5BMZ A;  3HOY J;  2R3S A;  1A31 A;  1ZG1 A;  4A3J J;  4HX7 A;  3ZQH A;  2IGO A;  2PBI A;  2NVQ J;  3OYL A;  5AON A;  4EJT A;  4IRG A;  5GAD J;  3K6G A;  5K7F A;  1FYK A;  2AQE A;  4CDG A;  2QA4 I;  4I0A A;  1LJ9 A;  1JUP A;  3HL2 A;  4KMF A;  2EPF A;  2NAZ A;  2Y31 A;  1BC8 C;  1K61 A;  3KP2 A;  4ITV A;  1QBJ A;  1QNT A;  1D0Z A;  1F1Z A;  1HDP A;  2K9Q A;  3CLO A;  2NOJ B;  2JSP A;  1XDS A;  2RV8 A;  2JJ7 A;  1HSJ A;  2VC0 A;  2ZJ2 A;  4ZZL A;  3DPL C;  5GAG J;  1R9T J;  3VWB A;  2CG4 A;  4AYB A;  3CMY A;  1DGW Y;  1BM9 A;  1DP3 A;  5GTH C;  2HOS A;  3HPG A;  1X1C A;  2IGN A;  3FMQ A;  1T95 A;  1IDZ A;  1OCZ H;  4FE7 A;  1ETW A;  1S9H A;  2EIJ H;  3WTY C;  3TED A;  1TP4 A;  2QGU A;  3KLN A;  4LG0 A;  4ZTF A;  2L0K A;  4C3H J;  3ASN H;  3P5J A;  2VBZ A;  3DPT A;  4HNV A;  2K02 A;  2V1N A;  3FXL A;  2LY1 A;  1JGG A;  2V1U A;  5HDN A;  4IHW A;  4NNJ A;  4CA0 A;  3VFZ A;  2QSG X;  3RDI A;  3CO7 C;  2Z3Y A;  3FBN B;  4IHY A;  3KIO A;  5DV5 A;  3DKW A;  4M6V A;  4UUV A;  4KFC A;  3ABK H;  2VB6 A;  3HUG B;  2NVX J;  2HFH A;  1XN7 A;  2PN6 A;  4M9Z A;  2HZD A;  1YIT I;  2LDU A;  1YQA A;  2O7O A;  4N9I A;  1BI1 A;  4BHB A;  5DM6 F;  2QKL B;  2LOO A;  3OWT A;  1RPW A;  2EA4 A;  3EPZ A;  2LVS A;  1D1A A;  2BY2 A;  1JKQ C;  2FRH A;  5FB2 A;  1MBE A;  3KYD B;  3GTO J;  1FJL A;  1EH7 A;  2VKD A;  2GLO A;  3OIO A;  1OCT C;  1WJE A;  1GLN A;  4AIK A;  1WJD A;  2X1C A;  2DFE A;  2PMZ A;  2KKO A;  1PP8 F;  2XPW A;  2VBW A;  4M9S A;  1W5S A;  1R36 A;  1F5T A;  3LNQ A;  4P1W A;  1KON A;  1TQM A;  2B7E A;  1UG2 A;  2RDP A;  2MD0 A;  3IH3 A;  2COM A;  2B9S A;  3TQN A;  1N78 A;  3W6K B;  2K3P A;  2QQB A;  2HXI A;  1WI9 A;  4GXO A;  1ETO A;  3HKZ A;  4XRS A;  2EZK A;  4XRS G;  2CV1 A;  3BDD A;  1E3P A;  2ZME B;  3F6V A;  2VT3 A;  3L7W A;  2BV6 A;  2M7B A;  4HLY A;  3HHH A;  3NAR A;  3H9Q A;  1Z3Y A;  3BC8 A;  4HNU A;  5M3M J;  2KIU A;  3GWZ A;  4Y17 A;  2DA6 A;  2PQ8 A;  3NEU A;  2HR3 A;  1BC7 C;  3BWG A;  4A5M A;  3TO6 A;  4QLC U;  4JQF A;  1D0Y A;  2OU2 A;  4NQW A;  1IUY A;  1U9N A;  2R7R A;  1U2W A;  1GUU A;  1AA7 A;  1TWF J;  2DXI A;  1MBH A;  3CCY A;  5HVQ C;  2W25 A;  4LG3 A;  3H1C A;  1G59 A;  1J7K A;  2XSD C;  1Z0X A;  2NVU B;  1VQ6 I;  5TGT A;  3SQN A;  3BRO A;  2JWT A;  1WZ2 A;  3DU6 A;  1QZE A;  3J7Z I;  3I4N J;  2X6W A;  5LHG A;  3LA3 A;  4RA2 A;  2P5K A;  2FML A;  2EH3 A;  1SFK A;  2E7W A;  3OYE A;  2BXZ A;  5DUK A;  4B1R A;  3JR9 A;  2IJL A;  3HYI A;  1X2M A;  1RZ4 A;  2QUF A;  1WJB A;  1O3Q A;  4Y3O A;  3AG3 H;  1ZG5 A;  2NVT J;  1HC8 A;  1SD5 A;  3S93 A;  1IJW C;  3BZC A;  3TL4 X;  3ZOB A;  2M5W A;  3L00 A;  3J7Y J;  4D1Q A;  2X51 A;  1OCP A;  2HQN A;  4RGX A;  5D6F A;  4LD5 A;  1A6I A;  3EQL F;  2LRE A;  3U21 A;  1BOA A;  3CP8 A;  1JE8 A;  1LB2 A;  1OYY A;  1LFU P;  1E17 A;  3E5U A;  3I54 A;  4Z2Y A;  4DOZ A;  3DPU A;  2VI6 A;  4RMN A;  3IH2 A;  3GTP J;  4L5E A;  3M3Y J;  4K2E A;  2QLZ A;  2G0E A;  4HA8 A;  2E2H J;  4W97 A;  2GAU A;  1Z05 A;  3GUD A;  2W24 A;  3JCU C;  3L2U A;  1E0E A;  2R4G A;  1WVR A;  1X2N A;  2DA2 A;  2IS4 A;  3CME I;  2RAE A;  3W2W A;  3DV8 A;  4A6D A;  2CS3 A;  1P2F A;  3MZY A;  4ESJ A;  2PI0 A;  2F5C A;  1HCR A;  2OA4 A;  2R92 J;  2QWW A;  5LGU A;  4L9V A;  4HNT A;  1ZAO A;  2XHK A;  2RQQ A;  5KAF C;  3IH4 A;  5IP6 A;  2LH9 A;  2XAF A;  3HEF A;  4KJZ A;  1P4W A;  3LFK A;  2VXZ A;  4WXC A;  4HQE A;  2KIM A;  1XMA A;  2IVM A;  3R0J A;  3KYL A;  3RKQ A;  4PZJ A;  2A68 F;  5H6Q A;  4G12 A;  3L2Q A;  3BJ6 A;  1Z7U A;  1ZRE A;  1IRG A;  5E1Z B;  3ZR8 X;  3CUQ A;  4PCQ A;  2PMZ N;  1FP2 A;  1KYW A;  1X58 A;  3WE3 A;  4FCY A;  1WH7 A;  4PUS A;  1LFB A;  2MD5 A;  2XIG A;  1DU0 A;  1AOY A;  4F3Q A;  5EDN A;  1XGM A;  2EQR A;  9ANT A;  2ZC2 A;  3HUG A;  3DBL B;  2D5V A;  2HYJ A;  1D5V A;  1UHS A;  3D5S C;  2QQ8 A;  3ZMV A;  1T39 A;  1MJB A;  3DXJ F;  2XAQ A;  3H0G J;  3ONQ A;  2L4M A;  1IXC A;  3HKZ N;  1MZB A;  4J00 A;  3BCB A;  2KDO A;  4BY7 J;  2GXA A;  3MEX A;  2QM3 A;  3MKY B;  3Q9S A;  4RM2 A;  4UUS B;  3E5X A;  1UHW A;  1EH6 A;  4AWX B;  4BE1 A;  2XAS A;  4YIF A;  2CQX A;  2FX0 A;  1MDM B;  5J1R A;  2H27 A;  1VTN C;  2PJP A;  3TW6 A;  3OL3 A;  5E20 A;  1YTY A;  4DBQ A;  1ZH5 A;  1VQ4 I;  1WCM J;  1OIS A;  1UB9 A;  1FSE A;  3KFW X;  1XSD A;  3GTQ J;  1A04 A;  3DWL E;  1Z3X A;  4HX8 A;  4LIV A;  1GDT A;  3BR2 A;  5CVU A;  2FF4 A;  3DEU A;  3KEQ A;  3ZPL A;  3M07 A;  3HGY A;  1DPR A;  2QEN A;  3S1R J;  1YJ9 I;  2YSR A;  4ZYG A;  2W4S A;  2JA2 A;  4KDP A;  2XUB A;  2LG4 A;  2E35 A;  2LF8 A;  2PEX A;  3S2D J;  1HKT A;  2LKP A;  2FOW A;  4AID A;  3GW2 A;  3QQA A;  5FFZ A;  2HOA A;  2I8D A;  3SZT A;  5K7H A;  5F64 A;  1U3E M;  1OCC H;  2Q2E A;  3C2B A;  2BXY A;  3QPS A;  2IA0 A;  5DD8 A;  4G9Y A;  3S1N J;  4Y52 J;  5D5W B;  3HB9 A;  3JRI A;  2XC7 A;  3HRS A;  1QU3 A;  3JTH A;  4EM2 A;  1LDD A;  5E79 C;  3PJR A;  3HJE A;  3OIQ A;  1PUF B;  1OR7 A;  2CO5 A;  3QPT A;  4BDZ A;  2C6Y A;  3K0L A;  5HDG A;  4YFN F;  1PDN C;  1U8B A;  3CJN A;  3LL7 A;  4ESF A;  3B6C A;  3ZQG A;  3TP0 A;  2KPM A;  2EFQ A;  4RLQ A;  4AUX A;  4B43 A;  2GXG A;  4CGZ A;  1I1S A;  3Q9V A;  2MYS A;  3VYT B;  3F0C A;  3K2A A;  4H0E A;  2GQQ A;  4CCK A;  2DO7 A;  3DKX A;  1VFC A;  4XLC A;  1LNW A;  1UMQ A;  2QCO A;  1RET A;  3CJQ B;  3DFG A;  4RAF A;  2P4W A;  4BL0 B;  1LQ1 A;  1W1W E;  4EJV A;  3OMY A;  2A5Y B;  2JN6 A;  4MEX F;  4XLE A;  1LUJ B;  2BVL A;  3RQ4 A;  4A0Y A;  1UEL B;  5BS6 A;  3OYK A;  2GA2 A;  2DDB A;  1X1P A;  3CF5 F;  1J9I A;  4F52 A;  5DCM B;  1X3W B;  4BEH A;  2DOF A;  5FKO A;  1R5H A;  1QGP A;  3VEP A;  2OTL I;  3N05 A;  4M74 A;  2XPV A;  2QF7 A;  3TGN A;  2LR8 A;  3EET A;  4JYK A;  3I64 A;  1WJC A;  2DMU A;  3ZQF A;  1V5E A;  3GTJ J;  3VB2 A;  1OR7 C;  3K10 A;  2QBY A;  3P9I A;  2QQA A;  1GXP A;  3F8N A;  3GXO A;  2HPI A;  4OAZ A;  4MO7 A;  3CUO A;  4XLP F;  1DP7 P;  3RI4 A;  1YRN B;  1SD4 A;  5FLV A;  3K4K A;  3FIW A;  3CCM I;  2LC2 A;  3E6C C;  3EYI A;  4XN3 A;  3CO6 C;  3S14 J;  4GCV A;  4UV8 A;  4S05 A;  1FTT A;  4BY1 J;  2ADU A;  3WTW C;  5L3B A;  3MKZ A;  3ASO H;  4EV0 A;  3LSM A;  4W1U A;  3TOB A;  1IN8 A;  1IXR C;  5CVV A;  3ZXS A;  5IT9 Z;  5FD6 A;  4A3I J;  1U8R A;  5LHH A;  2UUZ A;  1IV6 A;  5J8F A;  1W36 D;  4B09 A;  3FXQ A;  4EAT A;  3ZQ7 A;  3ERE D;  1D8K A;  2O03 A;  1XDU A;  4LFU A;  2ZKZ A;  4KYW A;  2FQ3 A;  5LGT A;  5GPA A;  4A69 C;  3ZP5 A;  1JGS A;  1O7L A;  1FBS A;  2A3S A;  3K1P A;  1KZH A;  1R49 A;  2FMY A;  2H6B A;  4D9J A;  1QHG A;  1K4S A;  3CC7 I;  2GA1 A;  3IP4 B;  4KNY A;  3OL4 A;  4HYE A;  3REO A;  4LIT A;  2KLO A;  4RAZ A;  3R4K A;  1SVM A;  1O3T A;  4XBF A;  4G6Q A;  1TWC J;  3BP8 A;  2STT A;  5CVR A;  3A01 A;  2QVO A;  4X0G A;  3J7A Y;  4KT5 C;  2IP2 A;  2XPU A;  1P7I A;  1A6Q A;  1ETK A;  3VYR B;  1VQO I;  2G7U A;  1Q1H A;  3IKT A;  4GRI A;  2A05 A;  4B48 A;  4BXF A;  1FIA A;  2F48 A;  1XMX A;  1JHH A;  3UR3 C;  2IA1 A;  2UXN A;  2F5E A;  2VN2 A;  5DM7 F;  5LRR A;  4YII A;  3OYC A;  1YS7 A;  2CYY A;  2XKP A;  3K4C A;  3WOD F;  3Q0V A;  2Z16 A;  1K83 J;  1YX3 A;  1T56 A;  2OQR A;  2DU9 A;  2Y0S N;  5B66 C;  4HST A;  1REP C;  4KT6 A;  1MJ9 A;  5HLI A;  3WTT C;  2OTJ I;  2V79 A;  3FDY A;  2AO9 A;  3I5U A;  4CZZ A;  3S17 J;  1YLF A;  1PUE E;  5DDG A;  4OIR F;  1YYV A;  5F0H A;  2MGQ A;  1USS A;  3T1B A;  4Y7N J;  1TT0 A;  1VQL I;  2H8R A;  2P5L C;  5F04 A;  4DBR A;  1HKQ A;  1JKP C;  1QPM A;  2CH0 A;  4B44 A;  1X1D A;  1CF7 B;  2V6C A;  3MKW B;  3WG9 A;  3JRB A;  1K79 A;  1TW3 A;  3P9K A;  1TT5 B;  2XV4 S;  3KP3 A;  5FJ8 J;  1RIO H;  5LEK A;  2DK8 A;  1R22 A;  4CO8 A;  2E34 A;  2HTS A;  4MEY F;  3S1Q J;  1RR7 A;  4Q48 A;  3UNG C;  3GF2 A;  2IS6 A;  5TJJ A;  2HQA A;  3ZQC A;  4E70 A;  2ZME C;  1K6O A;  5ICE A;  4PK4 A;  2VOO A;  2ZSH B;  5HNH A;  4UNO A;  1ERD A;  4YEJ A;  1H8A C;  4UVB A;  2DYS H;  3F8C A;  3RKY A;  4YIR X;  1K78 B;  2ZXH A;  4L18 B;  2HYF A;  2X85 A;  1GV2 A;  2LRD A;  1S6L A;  4IRI A;  3O8G A;  2MA3 A;  1TQI A;  3C2G A;  3PFY A;  4HSR A;  3GX4 X;  2DA3 A;  2Y30 A;  1RKW A;  2E5Z A;  2H94 A;  4Y33 A;  4ASN A;  2RC4 A;  4HQM A;  2L7K A;  4CCL A;  4LB5 A;  2DAO A;  4LIU A;  4NQW B;  2VAS A;  2O6G E;  1O7F A;  2MAB A;  4EM1 A;  3DQV C;  2Q0O A;  1S7E A;  2ZME A;  3M9A A;  5F1R A;  1JJ6 C;  2GOM A;  3DTK A;  1D0X A;  3L2R A;  4UB8 C;  1FYM A;  2P6T A;  3HC7 A;  1ZLK A;  2FSW A;  4MIM A;  2H8W A;  4OOI A;  4ETS A;  4C30 A;  2CJJ A;  5ERI A;  4HF1 A;  2DMT A;  4HG2 A;  5CYV A;  3PL8 A;  3SHF A;  3BG3 A;  3IV5 A;  4UUT A;  4AD9 A;  4E7K A;  2E60 A;  3OR2 C;  2GZW A;  2O3F A;  4G94 A;  1RI7 A;  4IXA A;  4QTR A;  3KET A;  1PYV A;  2VQL A;  5D4R A;  3BJO A;  3OYH A;  4HPQ A;  4CCN A;  3DP7 A;  1QZY A;  2W48 A;  4JX6 A;  5LGN A;  5D8L B;  1TWA J;  2DW4 A;  5CPR B;  3OYA A;  5ICF A;  2VC1 A;  1IN4 A;  2Y69 H;  2H6C A;  4EM0 B;  2NS0 A;  5FKN A;  4N9H A;  3KEY A;  2JZY A;  1G8X A;  1U6G A;  2LY9 A;  3G1M A;  3WGI A;  3D1N I;  4AVP A;  1VQN I;  4ZYD A;  4EEF G;  2KIQ A;  3HTS B;  5IOY A;  1EKE A;  2M9H A;  3G4S I;  2KL4 A;  4QPQ A;  4YRV A;  3JRA A;  1BJA A;  4EMS A;  1B59 A;  2O8K A;  1X4O A;  4IZZ A;  1D1B A;  4ENJ A;  2QSH X;  3H9J A;  3MAJ A;  3OYN A;  1X1A A;  3BR6 A;  3BQZ A;  2FBH A;  4BAY A;  2ZJQ F;  2O0Y A;  4NHJ A;  2HDD A;  2YPR A;  2XGX A;  3WU1 B;  4B3A A;  1MBJ A;  1X3U A;  1F36 A;  2F5D A;  3EUH C;  5IP7 J;  1Z91 A;  3GZ6 A;  2DT7 B;  1AKH B;  2WAQ N;  2WY8 Q;  4BH9 A;  2R7Z J;  4I09 A;  2MFZ A;  1YW9 A;  4Q47 A;  4IEJ A;  2VQC A;  1MNM C;  4I99 C;  2P5V A;  4PDK A;  2G9W A;  2MBF A;  1ETV A;  1ETX A;  1BI3 A;  1OYW A;  4M71 A;  1T38 A;  4GYI A;  4JX4 A;  5FKM A;  2DTR A;  3I59 A;  1MH4 A;  4RM3 A;  5JR3 A;  5EG0 A;  5D6E A;  5KVR A;  2DOE A;  1JTX A;  1FY7 A;  1XCB A;  4HEA 2;  4B8X A;  1GXQ A;  4H4K C;  5DEQ A;  4A93 J;  1SVO A;  2HQ5 A;  3J81 Z;  1YOV B;  1NG7 A;  1K6Y A;  4ABZ A;  3A2K A;  1HF0 A;  4E6K G;  4BQN A;  2LTP A;  1U78 A;  2E7X A;  1KQ9 A;  1ZR2 A;  3CC2 I;  3OYF A;  4E7J A;  2KZG A;  2L54 A;  1YJW I;  2MLK A;  3FF5 A;  3ZMD A;  5F1J A;  3GTG J;  4PJN A;  4LGW A;  4PSX A;  1G6N A;  1Z7L A;  2K4B A;  3CCU I;  2VQG A;  4BUP A;  3A0B C;  5EGO B;  3A02 A;  2Z1D A;  1Y1W J;  4ENM A;  2KJB A;  2WAE A;  4E7S A;  5A2Q K;  2BYV E;  2RN7 A;  4II2 A;  5JVT A;  1S5L C;  3GEZ A;  1IG7 A;  1OJL A;  3WG7 H;  3GFI A;  5A2Q Z;  1BIB A;  6PAX A;  3BT9 A;  1AU7 A;  3L2W A;  2HVS A;  1HW2 A;  3A03 A;  3QOE A;  3S2H J;  2OCC H;  1SC7 A;  1ORK A;  2LLK A;  1SFU A;  5EEA A;  2E2J J;  5EF6 A;  2PX9 A;  1MH3 A;  3OYI A;  2QEX I;  3IWZ A;  5KNL A;  4CHU A;  1LVA A;  4OIO F;  1UAA A;  2DYR H;  1VQP I;  4D0P A;  3RZD J;  2DMP A;  2R5Z A;  4BDY A;  1ZRF A;  2E1M B;  3LWF A;  2XGD A;  3DLL F;  3OYJ A;  4UV9 A;  2A07 F;  1VQ8 I;  2Y9Y A;  5CLS A;  1UST A;  2KIF A;  2BBY A;  3BG5 A;  2ZNZ A;  3K70 D;  1J5Y A;  3E3V A;  2MC4 A;  1MW7 A;  1C0W A;  3CJT B;  4A3E J;  5ILS A;  1JHF A;  2F6C A;  2E5N A;  4RGS A;  1MSF C;  3HOU J;  1OQY A;  1BR1 A;  2O5R A;  4R79 A;  2G7H A;  2FE3 A;  2TRT A;  2Y75 A;  3H5N A;  4WWC A;  1AWC A;  3EUH A;  4PJJ A;  2EJR A;  3ABU A;  3JSP A;  4A2U A;  3RSN A;  5FKL A;  1I39 A;  1SMY F;  2JQ7 A;  2K4J A;  2PLY A;  2CQN A;  1WKM A;  2HOE A;  4R1H A;  4U87 A;  1B6A A;  2COB A;  4JK1 X;  1XB4 A;  4MFD A;  4KIT B;  3H5R A;  3V7C A;  2K9L A;  3IAM 2;  3FKI J;  1JT6 A;  2XGC A;  1PP7 U;  4KIC A;  4XLF A;  4MHG A;  2DA5 A;  5E18 F;  2ELJ A;  2QZ8 A;  2FQ4 A;  3BTL A;  2KDZ A;  3FXR A;  1RNL A;  4BE2 A;  1SVL A;  2XF7 A;  2DT5 A;  3WTS C;  1S8N A;  2TCT A;  3WHC A;  5GTI C;  2JRM A;  1J59 A;  2K40 A;  5GAE J;  3PFI A;  4E7L A;  3LSG A;  2DK5 A;  1QVU A;  5GP9 A;  1Y0N A;  1X19 A;  3VSK A;  2R7O A;  3GLL A;  1ZGW A;  2JMW A;  3HRT A;  4UY8 I;  4LK0 F;  4NDL A;  2JSC A;  3KP6 A;  3PO2 J;  3ZRG A;  3H5A A;  3MWM A;  2LY2 A;  4RB2 C;  1N75 A;  2WB1 N;  3BJA A;  1H9T A;  4B3X A;  1HXD A;  2HU9 A;  4X6A J;  2ZXI A;  3LSP A;  2RKH A;  1XD7 A;  4F55 A;  1HLV A;  4G8X A;  3L09 A;  2CQQ A;  4JP0 A;  3H35 A;  1IRX A;  2B63 J;  1HDD C;  1R4M B;  2P81 A;  5EYR A;  1O4X A;  1G3Y A;  5DS9 A;  3I3L A;  2LYC A;  3IHU A;  2R7Q A;  5KCM A;  1TQP A;  3WHB A;  4XL9 A;  1I50 J;  1Y0U A;  1JT0 A;  1SAX A;  2XVC A;  4M6Y A;  4BXU A;  2UXX A;  2P0W A;  2DI3 A;  2WV0 A;  1OLT A;  4BNC A;  3CMA I;  4J01 A;  3HHG A;  2FOK A;  3C7J A;  1RRJ A;  4BE0 A;  1P92 A;  2NXN B;  2XDV A;  1Y6I A;  1WRJ A;  4C3J J;  2EFP A;  3QAH A;  4IX7 A;  3M7G A;  3SDG A;  3SEZ A;  3VYS B;  4E4H A;  1YIJ I;  2H09 A;  3RKX A;  2R7U A;  4XON A;  5JFR A;  3BQY A;  1QRY A;  3QPL A;  2PJR B;  2LNB A;  2KRC A;  2LBF B;  1TBX A;  2JRT A;  2L9V A;  2F4O B;  1YG2 A;  1FOW A;  4P55 A;  5K1Y A;  2FJ1 A;  1IRF A;  3GZN B;  2A61 A;  5FRN A;  4UHT A;  4Z6Y A;  3I59 B;  4IF4 A;  1TWH J;  1V4R A;  1ZKG A;  3H92 A;  2VPR A;  3LA2 A;  3CCJ I;  2K5C A;  5LEJ A;  3CCV I;  1JKO C;  5K7Z A;  1I27 A;  4XR6 A;  1FYL A;  2MLG A;  3K4B A;  5E3L A;  4HF2 A;  1ENH A;  2BOL A;  5HOO A;  4M3D A;  4NC6 A;  1FMW A;  3HSE A;  2LBF A;  1S72 I;  3RZO J;  3FXM A;  5BPI A;  2GBY A;  5FRO A;  3DU5 A;  3OS2 A;  2OAZ A;  3CUQ C;  4C9Y A;  1ZG3 A;  2GIV A;  3AG2 H;  3IKV A;  3FXJ A;  3FXO A;  1G3W A;  1XGS A;  4NBQ A;  1I6X A;  4IHT A;  1BIA A;  2XAJ A;  5IP9 J;  3S8P A;  2BZT A;  2WV1 A;  4FX0 A;  2FBK A;  5ICG A;  3RTR A;  1MMN A;  2ESH A;  1ZTR A;  2Z9O A;  2HVR A;  4C3I J;  2CUJ A;  1ZEL A;  2IPQ X;  4RB1 A;  4B47 A;  5C4J J;  1MBK A;  3M1E A;  3P9C A;  1SFO J;  4MQV A;  1IRZ A;  1VQM I;  1IN6 A;  5DCM A;  4G7Z F;  2K85 A;  5E3O A;  4U0Y A;  2M8E A;  5BQT A;  3ABT A;  3S32 A;  1J75 A;  1R5G A;  1W7P B;  2EIM H;  2MG4 A;  2LKS A;  1I3A A;  1E3H A;  2EFW A;  3SZG A;  4KIG A;  1LE8 A;  4PJ0 C;  1ONV A;  4V2G A;  4XLA A;  3P7N A;  1J0R A;  4D5C A;  2WAF A;  1JXS A;  4IHS A;  3L2V A;  2GIZ A;  2L7F P;  2MW8 A;  4HW0 A;  2DPD A;  3ZGK A;  5K5O A;  5L3G A;  4F93 B;  5HLT A;  1MKM A;  4MNU A;  3EUK L;  1O3S A;  2WY7 Q;  4PGH A;  2IRF G;  3I55 I;  1R6R A;  1WFX A;  1TLH B;  2D1H A;  3AFH A;  3AKZ A;  1YI2 I;  4LLN A;  4IOC F;  1L0O C;  1MMS A;  1T08 B;  1XPX A;  4BU2 A;  4E7H A;  1Y8Q B;  5DYM A;  3SDB A;  1UJ8 A;  1WJF A;  2IAI A;  3DTI A;  5GPC A;  2ICW G;  2ZSI B;  2RVC A;  3TO7 A;  4U7D A;  4O3M A;  2CUF A;  3BR0 A;  2K9S A;  3FMS A;  4XKB A;  1FWZ A;  4JOM A;  4A6E A;  3HOW J;  4KA4 A;  3F8M A;  3ZCO A;  3K9T A;  3PIP F;  2Q2E B;  1OKR A;  2RNJ A;  4L9T A;  2DFH A;  3HSF A;  3O8H A;  1IXS B;  3ABM H;  1V3F A;  5JI6 A;  1BBY A;  2V9V A;  3G2B A;  4QSH A;  3FM3 A;  1IV8 A;  4ZYH A;  3SJM A;  4RAG A;  4F92 B;  1FEX A;  2ZCW A;  4G7H F;  2IGM A;  3OYD A;  1HKS A;  1S3J A;  3A01 B;  1B72 A;  1NK2 P;  1OFC X;  3C18 A;  1R23 A;  1R7J A;  1B72 B;  2FXA A;  5D4S A;  4AIJ A;  3W6V A;  2A5W A;  1NTC A;  2V1X A;  3EYY A;  1WH5 A;  2L9R A;  3MCZ A;  2TDX A;  1T0F A;  4OIP F;  4BJT A;  4M3E A;  2E1C A;  1VF9 A;  3BTI A;  4A0X A;  2HDW A;  1BI2 A;  1MDM A;  1LDJ A;  4BHC A;  1YE9 A;  1BN5 A;  5E1X A;  5H2F C;  3K70 C;  3WU2 C;  3HBL A;  1RUN A;  3QU3 A;  1XX5 A;  4P5O A;  2ZNY A;  1A36 A;  1R71 A;  4XSZ F;  3KP5 A;  2HYG D;  1VND A;  3ECH A;  3U1K A;  4YFX F;  4KIS A;  3QP6 A;  3F8B A;  3OR1 C;  2X6O A;  2PMU A;  4O6J A;  3V7S A;  3FXK A;  1H89 C;  4BXX J;  5CQG A;  5EEG A;  3K1N A;  4BQO A;  2NOG A;  1BL0 A;  2O61 A;  1G2H A;  2ELK A;  1BI0 A;  4HOB A;  5EZH A;  3CCL I;  2IS1 A;  3RQI A;  2IW5 A;  3BG6 A;  4BQQ A;  1V54 H;  2R7V A;  2QYO A;  3BLY A;  2ID3 A;  1QHH D;  4G6T B;  1R1T A;  4XOR A;  5EJC A;  5IYB J;  1IGN A;  2E1O A;  3GLX A;  4FET A;  4EQQ A;  2MC3 A;  3K1M A;  2WAD A;  3Q0U A;  2K7L A;  3RCO A;  1WQ2 A;  4A0Z A;  5CJ9 A;  2VE8 A;  3OIP A;  1FBU A;  3M8E A;  1RR8 C;  3V7R A;  2CW8 A;  2Y48 A;  3BR3 A;  2EFO A;  2R0Q C;  1EF4 A;  1W36 C;  4WF2 A;  1JUM A;  1D8J A;  1YHQ I;  2PJR A;  1FOX A;  5CQE A;  2K9N A;  3NWS A;  2CV0 A;  3S1M J;  1BA5 A;  2K86 A;  3K4L A;  2KFD A;  2V9P A;  3N4M A;  2QKM B;  2WA0 A;  2R5Y A;  5CVI A;  2STW A;  5JLW A;  2XAH A;  3CCQ I;  4A3C J;  3N97 A;  1TL8 A;  3T8R A;  2GM4 A;  4EJU A;  1KGS A;  3ESW B;  3EUA A;  3ZMU A;  1D5Y A;  2ACJ A;  5LLQ A;  3F21 A;  3M8J A;  3T0Y A;  3C3W A;  4KN4 X;  1VQK I;  3E6D A;  1DDN A;  2CWE A;  3IL2 A;  3J81 K;  5E8G A;  2EB7 A;  2YUS A;  4M9X A;  3FM5 A;  4HBL A;  2GXB A;  1B9N A;  1U9O A;  4FTH A;  4RGU A;  3FXU A;  4I02 A;  5FGM A;  4B4C A;  1FMV A;  4EJW A;  5D5V B;  5E17 F;  4I76 A;  2W85 A;  1B1B A;  3KE2 A;  3GTL J;  4A3B J;  3QU6 A;  1TWG J;  2QBY B;  4G6D A;  3GCM A;  1VZ0 A;  3G1L A;  5J3L A;  4LLG F;  1SAN A;  4MTE A;  2NNN A;  3LSH A;  4I2O A;  3G1O A;  2I5U A;  5TIS C;  3TOA A;  3ZN0 A;  5HDK A;  2ME0 A;  1B8I A;  4XSX F;  4P96 A;  4A3D J;  2BHY A;  3A4C A;  3ERM A;  1J09 A;  4XOT A;  4FAS D;  2K3F A;  3ZQQ A;  1KA8 A;  1EV7 A;  4M3B A;  3RPU D;  1H0M A;  2HPM A;  3HOV J;  1FOK A;  3U1D A;  4OAY A;  2EZL A;  2K9M A;  1G3S A;  1V55 H;  3WTU C;  1APL C;  2R7D A;  4V2F A;  1KQ8 A;  2IEK A;  1LVK A;  2FD5 A;  2E36 A;  4XID A;  3GO5 A;  4QPO A;  1XSX A;  4IQ4 A;  4HLX A;  1BR4 A;  2AQF A;  4BHP A;  1MMA A;  3R60 A;  2EK5 A;  1W7P A;  2QQ9 A;  1AKH A;  1KU2 A;  5FD5 A;  2JUC A;  3HIF A;  5IY5 H;  2PG4 A;  1LFP A;  1FLI A;  1ZRD A;  3WU0 A;  4OWR B;  2H1L A;  4U7B A;  3F22 A;  4F7Z A;  2DLL A;  4BJ5 C;  3C1D A;  3TDZ C;  4EGZ A;  2EWN A;  2XKO A;  1IZ1 A;  1GVJ A;  4DQ2 A;  1W5T A;  1X4P A;  2FUG 2;  4FT8 A;  4E7I A;  1E2X A;  3RIR A;  1ZAR A;  2F4M B;  3M8F A;  2CV2 A;  5E8I A;  5H20 A;  2CUZ A;  3T5X A;  3LA7 A;  1GHC A;  3H9G A;  3AL0 C;  3GFM A;  2OZU A;  3ZN1 A;  1JUS A;  2DJI A;  2W00 A;  1BJZ A;  2L9S A;  2YX7 A;  4FQG A;  5F27 A;  3VYU B;  2L7M P;  1U5T C;  3J80 K;  1N25 A;  2DQL A;  1BR2 A;  2AXL A;  2RGV A;  4U0W A;  4CZC A;  2IT0 A;  1B9M A;  3J80 Z;  3QRF F;  3KLO A;  3Q0W A;  2X4H A;  4MTD A;  1RES A;  1GVD A;  3MKL A;  1POG A;  3TO9 A;  1MBG A;  3AG1 H;  2M4K A;  3BY6 A;  3LAP A;  1FC3 A;  3CUQ B;  4CCO A;  3JRG A;  5TRD A;  4ZDP A;  2DDA A;  3DKY A;  5J1U A;  4U88 A;  1LEB A;  1T6S A;  4CCJ A;  4A12 A;  5EGO A;  3W6J B;  1P4A A;  2JVG A;  3DLA A;  4LMY A;  3IAS 2;  3PUB A;  1FTZ A;  1ETQ A;  1MBF A;  2BW3 B;  3NWT A;  3U2R A;  2BW3 A;  1R1U A;  1O3R A;  2CRG A;  4PFO A;  1B4A A;  3HM5 A;  3DTE A;  3OOP A;  4DYC A;  2FBI A;  1KQ0 A;  1MSE C;  2Z2S B;  2DOD A;  1OCO H;  5JVG F;  1T8I A;  2D1V A;  4BYY A;  4WX9 A;  1XCV A;  3A0H C;  3C2H A;  2DJN A;  3SFI A;  3LSR A;  3KPH A;  4O5V A;  2DFF A;  2CW7 A;  5AIQ A;  3O6B B;  5BPD A;  4S04 A;  2NRA C;  3VOE A;  4M6X A;  2F5V A;  3JRD A;  1XG1 A;  3CF2 A;  1UFM A;  2HKX A;  1HBX G;  4E7Z A;  2L02 A;  4BS9 A;  2DTZ A;  1K78 A;  2W82 A;  1X1B A;  3ZMT A;  4KMU X;  2V1D A;  3K4M A;  2L4A A;  2DA7 A;  5M5Y J;  4I0B A;  2YX4 A;  2EV5 A;  2F2E A;  2X1D A;  4WK8 F;  3OSG A;  3NRV A;  2UWM A;  4A3G J;  4HV5 A;  2ISZ A;  3FIS A;  2OQG A;  5C44 J;  2VKE A;  2FA5 A;  2BY3 A;  3PIO F;  1EH8 A;  4DJA A;  2Y9Z A;  3H3V K;  2DMQ A;  4RS8 A;  5FLX Z;  3PQK A;  3ZMZ A;  2R7X A;  3HTU A;  1Y1V J;  3TKY A;  2KP6 A;  2VPL A;  3NQO A;  3BPX A;  4DYQ A;  4EVI A;  3B02 A;  2R7W A;  3QWL A;  3LQQ A;  1EJ9 A;  2V9K A;  1R5I D;  1F43 A;  4PSW A;  3IRQ A;  3W2V A;  5ICC A;  3JRC A;  3NAU A;  2ZO4 A;  2JA7 J;  5LRS A;  1QZZ A;  2BGC A;  2XF5 A;  1U5T B;  5FLM J;  4ENN A;  3OSF A;  2JPB A;  2OBP A;  2R93 J;  2CMP A;  4ZYA A;  4MLO A;  1TNT A;  1QA6 A;  2VT2 A;  3RJP A;  1I1G A;  3WGH A;  4V19 K;  5J40 A;  1MGT A;  2VOD A;  3V4G A;  2KZV A;  3ROU A;  1I5Z A;  2V7F A;  2ISY A;  2V26 A;  1IW7 F;  2M3A A;  3WTV C;  2D45 A;  1JI8 A;  1H88 C;  1HW1 A;  3DCF A;  4KIF A;  1HQC A;  3FMR A;  2VXD A;  1IF1 A;  3DBH B;  4P9F A;  3HPH A;  3OOU A;  2XAG A;  4UB6 C;  4P9U A;  2RQP A;  1XS9 A;  2DBB A;  4IJA A;  4A3F J;  1TNS A;  3G3Z A;  3MQ0 A;  4OMZ A;  4J19 A;  5BNG A;  1LE8 B;  2LMD A;  4YEL A;  1Y56 A;  4XIC A;  3CDI A;  4IVN A;  3GTK J;  1KYZ A;  2LF7 A;  2P6S A;  1IAW A;  3ISP A;  3B73 A;  1UZC A;  3E97 A;  3RPQ A;  5E3M A;  5M5X J;  2NS8 A;  1HST A;  5HS8 A;  3D5L A;  3O2P E;  1PJR A;  1B8I B;  2AS5 F;  2ELH A;  2EV0 A;  2F5F A;  2L5Q A;  2XRN A;  1HW5 A;  3OYG A;  3UKG A;  4XKV A;  4FX4 A;  1YW8 A;  2YU3 A;  3HOT A;  4C2T A;  1U0J A;  4II3 A;  1ZGA A;  2ZJP F;  3GYH X;  1V5G A;  3G73 A;  2CQK A;  3KP7 A;  1LEA A;  2A6T A;  2HXO A;  4MGR A;  1FX7 A;  2OD5 A;  4XRM A;  2HS5 A;  3PM1 A;  2R7S A;  3GZ5 A;  4Q5S F;  2E71 A;  3QOP A;  4AYB N;  2VBY A;  3ULQ B;  1YRN A;  1LDK B;  3V42 A;  1ULY A;  1OMI A;  3WGG A;  3BZK A;  1Z77 A;  1OYI A;  2EIK H;  2DN0 A;  2MH9 A;  5DD4 A;  2L01 A;  1BW6 A;  1IN7 A;  3IWF A;  4RB0 A;  3PNT A;  4QIW N;  1P7J A;  2VLA A;  1BW5 A;  3KCC A;  1IDY A;  3D0S A;  1GT0 C;  2HWV A;  1R4N B;  1DGR M;  1MJA A;  3QP5 A;  1OCR H;  3R61 A;  4Y15 A;  3I0T A;  1HOM A;  3SZP A;  1SEU A;  4L9J A;  5EG0 B;  4C2M J;  4RDU A;  3S3M A;  2X1E A;  1F9N A;  5CKT A;  3CJR B;  3QYF A;  3WTZ A;  2EV6 A;  4NC7 A;  3CMM A;  2R7F A;  3I71 A;  3FHZ A;  2NYX A;  3FBI B;  4C2U A;  4CXF A;  1DU6 A;  4NUB A;  2R5Z B;  5F0F A;  2BEO A;  1TC3 C;  1VI0 A;  4N0B A;  3KP4 A;  3R6S A;  3VDX A;  4Y4R A;  2A6H F;  4IQJ A;  4XKC A;  3A1Y A;  4L0Y B;  4CH7 A;  2DFI A;  2ZBK A;  4HDV A;  2D2W A;  3PSF A;  4IHX A;  4RAY A;  1JJ8 C;  3FZV A;  3DEW A;  1M1E B;  2OUM A;  1W5C C;  4XLN F;  2F4I A;  1OPC A;  3PSI A;  3MVP A;  4CSW A;  2BY0 A;  2M30 A;  5J47 A;  1N77 A;  3HOZ J;  4HZF A;  3HRU A;  2X0L A;  2GWR A;  1TW2 A;  2V6E A;  5J6X A;  1QPI A;  2FU4 A;  1IUF A;  3JRE A;  2E1N A;  3GBG A;  3SYT A;  3E5Q A;  2O8X A;  5IYC J;  4DZP A;  3S3N A;  3CLQ A;  2KRF A;  2LKX A;  3K4N A;  2Y0S A;  3E7L A;  2HVQ A;  2JVH A;  5IOZ A;  1VQ9 I;  4M72 A;  4M3F A;  3ELK A;  1Z21 A;  2YR2 A;  4LOC A;  2DOA A;  4A3M J;  1CGP A;  4GO1 A;  1RUO A;  5FKK A;  3KX2 A;  3HRM A;  4XRF A;  4DZJ A;  1NG6 A;  5IPA A;  1ACI A;  3FK6 A;  1DUX C;  4ZH4 F;  3DEE A;  1QO0 D;  2A6E F;  3JAM Z;  3HDD A;  1K4T A;  1BOB A;  4TV7 A;  1DPU A;  3MMY B;  3X2Q H;  1XMK A;  3L1P A;  3CP2 A;  2W7N A;  3JAM K;  2KJC A;  4HDU A;  1A35 A;  4EJO A;  5M5W J;  4XN0 A;  3MFK A;  3I4P A;  4PJM A;  4I01 A;  2NS7 A;  2HI3 A;  4WXH A;  3SXY A;  3TBI A;  2VL8 A;  2WTE A;  5B1B H;  3CES A;  1XTA A;  1ZK8 A;  2VUM J;  2JTV A;  2OF7 A;  4AIH A;  3WTX C;  2Z99 A;  4MFE A;  4PFP A;  1KU3 A;  1SFE A;  3K7A J;  4PJL A;  4XOP A;  3JRH A;  3HOS A;  3CCR I;  1LKX A;  1ZHF A;  3GFJ A;  2HTJ A;  5D5X B;  5HOD A;  3H0D A;  1LPQ A;  2HEO A;  2FEZ A;  2DA1 A;  3J7A O;  1UCR A;  1Z67 A;  4OMY A;  2UV1 A;  4LLL A;  4XKW A;  2EFN A;  2EIN H;  3KZY A;  5L3C A;  4IPA A;  3OS1 A;  3JRF A;  2HZT A;  2KMU A;  3ZQL A;  2HQR A;  5D8K B;  2EZH A;  4NC8 A;  2ME6 A;  1ON1 A;  2JK3 A;  5EEH A;  2IA2 A;  3DF8 A;  2N8G A;  4XLH A;  1WWX A;  3FWE A;  3QPH A;  4GFB A;  2BE5 F;  4X1E A;  1YJN I;  3U9G A;  1F4K A;  3H3Z A;  4ESB A;  2B0L A;  3I58 A;  4RB3 C;  5C3E J;  3CD6 I;  1IO2 A;  5IT3 A;  4NB5 A;  3PQJ A;  3GTM J;  3AL0 B;  3H3U A;  1RC9 A;  2XF6 A;  5JHU A;  5HS9 A;  3I9V 2;  2ZJR F;  2XSJ C;  2Y0M A;  3LSJ A;  2WC2 A;  4AC0 A;  1SD6 A;  5HS7 A;  4AU7 A;  3FK7 A;  5AIP A;  3M4O J;  4R8H A;  4A3L J;  3W2A A;  1Z6R A;  3SFZ A;  1MD0 A;  4G7O F;  3IRR A;  1ZQ3 P;  2CUE A;  2P7V B;  1R58 A;  2EBI A;  4WXD A;  2LD5 A;  2VQH A;  3ECO A;  3PO3 J;  2JPC A;  4ZDO A;  5L3E A;  5J1Y A;  2M45 A;  1YX5 A;  3OYB A;  3CDH A;  4D5F A;  3BTC A;  4FIS A;  2VJ5 A;  5CVJ A;  2WWY A;  2KHM A;  3K2Z A;  5JLX A;  3MN2 A;  2ZFU A;  4UVA A;  2OCE A;  5DCF A;  3D5R C;  2EZI A;  3OY9 A;  2XRO A;  4Y13 A;  3LST A;  3VSL A;  5LFA A;  3GME A;  1K7A A;  4L9N A;  3AAF A;  5BOX A;  1T98 A;  2K27 A;  4XNF A;  1W0T A;  2OZ6 A;  3HG9 A;  3KZI C;  4DGW B;  3LOC A;  2X6Y A;  1JKR C;  2M34 A;  1W7P D;  2EA2 A;  3I4M J;  2KRH A;  5E3N A;  2BY1 A;  4U0V A;  2DQR A;  2L7Z A;  4D7N A;  4XMY A;  4CYC B;  4CYC A;  2JT1 A;  1PVE A;  1Q1V A;  3VPR A;  5D5U B;  3BCA A;  2XB5 A;  1Y8R B;  2Z5U A;  1SFX A;  1D3Y A;  1O57 A;  4IL6 C;  2FNP A;  4ZTJ A;  4HV6 A;  2KT0 A;  1ITY A;  1FOY A;  2AHQ A;  1P6R A;  2L3D A;  4UVC A;  4HF0 A;  4KN7 X;  2RRE A;  4MQ9 F;  5F08 A;  3TP3 A;  1J2X A;  4N4N B;  4WCG A;  2DT6 A;  3CQZ J;  3HXL A;  1X3Z B;  1VQ5 I;  2VKH A;  1SD7 A;  2Q8K A;  1MNE A;  4QWQ A;  2IBD A;  4GDF A;  1RKT A;  2VBX A;  2UZK A;  4JX5 A;  3VOD A;  1MIJ A;  4ENK A;  2Y2Z A;  4XK4 A;  3GFL A;  2KQR A;  1T33 A;  4BKX A;  2O9L A;  2OC6 A;  5FLX K;  1Z6T A;  2HOT A;  2IS2 A;  5ILU A;  1XGN A;  3CCS I;  2M0C A;  1S29 A;  5B3S H;  3CZ6 A;  3DBR B;  1MMG A;  3LMM A;  2CFO A;  4JBA A;  3S2W A;  3OYM A;  2I10 A;  2HNH A;  1E3O C;  3RKW A;  3F6O A;  4OU0 A;  1QVT A;  4FE4 A;  1WGX A;  2CFX A;  2DMN A;  4CYD A;  5FRM A;  3H36 A;  4I7H A;  2KIS A;  1FBQ A;  1FT9 A;  5H6R A;  3ABL H;  1V5F A;  4BJ6 C;  1ZN2 A;  2LK2 A;  2XAU A;  3E0J B;  3F9K A;  4LK1 F;  4I6Z A;  3TDU C;  2IXS A;  2ZXW H;  5DUI A;  2YU9 J;  2EIL H;  1A5J A;  3FKJ A;  5FO5 A;  1S7A A;  2L2O A;  1TTY A;  2W1O A;  1AHD P;  2W57 A;  3KZZ A;  1G3T A;  1KU9 A;  3HGG A;  5IYD J;  2VIX A;  3T8T A;  5KAI C;  1CQT A;  2ESN A;  2JA8 J;  3V8K A;  4I98 B;  3HSR A;  2HGC A;  3ML6 A;  3RPU A;  1FSH A;  2FNA A;  1WJ5 A;  3HOX J;  3FX3 A;  3MD2 A;  3F72 A;  4PGG A;  1PUF A;  1ZLJ A;  3PUF A;  2HDC A;  2X6X A;  4GGG A;  2WB1 A;  3CC4 I;  3W3C A;  3KEO A;  2VJJ A;  5F6F A;  4Q4Z F;  1WSU A;  5EZG A;  3JTG A;  4BQA A;  3SEQ A;  1L3L A;  3ZQI A;  1SAU A;  2NVY J;  2WBM A;  3JW4 A;  2A69 F;  3V8L A;  2E19 A;  5HNF A;  1FNN A;  2W84 A;  4BBR J;  2VE9 A;  4ON0 A;  4CCM A;  4ZC3 A;  4BEH B;  4DYR A;  3E6B A;  1FP1 D;  3LQR A;  2WAQ A;  2P8T A;  4CIC A;  2DCE A;  1UG0 A;  1MND A;  1GV5 A;  1P4X A;  1ZYR F;  3OV8 A;  2ID6 A;  2OPT A;  1W0U A;  1G4D A;  2PFB A;  3F23 A;  3K69 A;  4IHV A;  1ETY A;  4UUS A;  1R1V A;  3QYE A;  4ZJZ A;  1MMD A;  2ECC A;  5LHI A; 
#chains in the Genus database with same CATH homology
 2P7C B;  3ZMS A;  5KK1 A;  3RYR A;  4HX4 A;  5E1W A;  4KIB A;  1H9G A;  1ZRC A;  1KU7 A;  4LG0 B;  3EDP A;  4HAM A;  2J5O A;  3BZ6 A;  3R0A A;  5L3F A;  1YIO A;  2ZFW A;  2PMH A;  1FPQ A;  3F3X A;  5L3D A;  3CTA A;  2ZXJ A;  2J5P A;  5HLH A;  2ETH A;  4OIQ F;  2CSO A;  1S7O A;  5ED4 A;  1FZP B;  5K5R A;  4L0Z B;  4GYG A;  2LSO A;  5K5Q A;  2MH2 A;  1YS6 A;  1UHM A;  1STZ A;  1T2K A;  3I53 A;  3BOQ A;  4LB6 B;  1R00 A;  3MZH A;  1XGO A;  1U5T A;  3E6M A;  2M87 A;  5J8C A;  1NHA A;  4L5J A;  2M1B A;  1YO5 C;  3LAJ A;  3L2C A;  2VOP A;  1Z9C A;  4ZZD A;  1YFH A;  4FHT A;  3WE2 A;  4ZYE A;  4IRH A;  3V8J A;  1Z1D A;  1W4M A;  4LJZ F;  1SMT A;  2CW0 F;  3RYP A;  1CF7 A;  4DNC A;  5LBQ A;  2CGP A;  1ZGJ A;  4A5N A;  3COA C;  5ILV A;  3F8F A;  5HLG A;  4YG2 F;  3Q5F A;  2DPU A;  3O3K A;  4YFK F;  2HKO A;  5FFX A;  3BPV A;  1ON2 A;  4UXN A;  4EGY A;  1IN5 A;  4RGR A;  4OIN F;  3GVA A;  5IT9 K;  2VON A;  3IC7 A;  1YW7 A;  4L5I A;  1QQI A;  2NNY A;  3L9F A;  4KUM A;  4M73 A;  3JSO A;  1ODD A;  2Z33 A;  1XSV A;  5BMZ A;  2R3S A;  1ZG1 A;  4HX7 A;  2PBI A;  5AON A;  4EJT A;  4IRG A;  1FYK A;  4CDG A;  4I0A A;  1LJ9 A;  4KMF A;  2NAZ A;  1BC8 C;  3KP2 A;  1QBJ A;  1QNT A;  1F1Z A;  3CLO A;  1XDS A;  2RV8 A;  2VC0 A;  1HSJ A;  2ZJ2 A;  4ZZL A;  3DPL C;  2CG4 A;  1BM9 A;  3FMQ A;  3WTY C;  3KLN A;  4LG0 A;  2VBZ A;  3DPT A;  2K02 A;  2V1U A;  5HDN A;  3VFZ A;  3RDI A;  3CO7 C;  2Z3Y A;  5DV5 A;  3DKW A;  4UUV A;  4KFC A;  2HFH A;  1XN7 A;  2PN6 A;  4M9Z A;  2LDU A;  1YQA A;  4N9I A;  1BI1 A;  4BHB A;  2EA4 A;  2FRH A;  5FB2 A;  1EH7 A;  4AIK A;  2KKO A;  1PP8 F;  2VBW A;  4M9S A;  1W5S A;  1R36 A;  1F5T A;  1TQM A;  2RDP A;  2COM A;  3TQN A;  3W6K B;  2QQB A;  1WI9 A;  4GXO A;  3BDD A;  3L7W A;  2ZME B;  3F6V A;  2VT3 A;  2BV6 A;  4HLY A;  3HHH A;  2KIU A;  3GWZ A;  4Y17 A;  2PQ8 A;  3NEU A;  2HR3 A;  1BC7 C;  3BWG A;  4A5M A;  3TO6 A;  4QLC U;  4JQF A;  2OU2 A;  4NQW A;  1IUY A;  1U2W A;  5HVQ C;  2W25 A;  1J7K A;  3SQN A;  3BRO A;  5LHG A;  3LA3 A;  2P5K A;  2FML A;  2E7W A;  5DUK A;  2IJL A;  3HYI A;  1RZ4 A;  2QUF A;  1O3Q A;  1ZG5 A;  1SD5 A;  2M5W A;  3L00 A;  2HQN A;  4RGX A;  5D6F A;  4LD5 A;  3EQL F;  1JE8 A;  1BOA A;  1LB2 A;  1OYY A;  1E17 A;  3E5U A;  3I54 A;  4Z2Y A;  4K2E A;  2QLZ A;  4HA8 A;  2GAU A;  1Z05 A;  3GUD A;  2W24 A;  3DV8 A;  4A6D A;  1P2F A;  3MZY A;  4ESJ A;  2PI0 A;  2F5C A;  2OA4 A;  2QWW A;  5LGU A;  4L9V A;  1ZAO A;  2XHK A;  2XAF A;  1P4W A;  3LFK A;  2VXZ A;  4WXC A;  4HQE A;  2KIM A;  1XMA A;  2IVM A;  3R0J A;  4PZJ A;  2A68 F;  5H6Q A;  3BJ6 A;  1Z7U A;  1ZRE A;  1IRG A;  5E1Z B;  3CUQ A;  4PCQ A;  1FP2 A;  1KYW A;  3WE3 A;  2MD5 A;  2XIG A;  1AOY A;  1XGM A;  3HUG A;  1D5V A;  3ZMV A;  1T39 A;  1MJB A;  3DXJ F;  2XAQ A;  2L4M A;  1IXC A;  1MZB A;  3MEX A;  2QM3 A;  3Q9S A;  3E5X A;  1UHW A;  1EH6 A;  4AWX B;  2XAS A;  4YIF A;  1MDM B;  2H27 A;  1VTN C;  2PJP A;  5E20 A;  1YTY A;  1ZH5 A;  1UB9 A;  1FSE A;  3KFW X;  1XSD A;  1A04 A;  4HX8 A;  5CVU A;  2FF4 A;  3DEU A;  3KEQ A;  3ZPL A;  1DPR A;  2QEN A;  2YSR A;  4ZYG A;  4KDP A;  2XUB A;  1HKT A;  2LF8 A;  2PEX A;  2LKP A;  3GW2 A;  5FFZ A;  3SZT A;  5F64 A;  1U3E M;  2Q2E A;  2IA0 A;  5DD8 A;  4G9Y A;  5D5W B;  3HRS A;  3JTH A;  4EM2 A;  1LDD A;  1OR7 A;  2CO5 A;  3QPT A;  2C6Y A;  3K0L A;  5HDG A;  4YFN F;  1PDN C;  3CJN A;  4ESF A;  2EFQ A;  2GXG A;  4CGZ A;  1I1S A;  3Q9V A;  4H0E A;  2GQQ A;  2DO7 A;  1LNW A;  3DFG A;  2P4W A;  1LQ1 A;  4EJV A;  2A5Y B;  4MEX F;  4A0Y A;  5BS6 A;  2GA2 A;  1J9I A;  5DCM B;  1R5H A;  1QGP A;  3VEP A;  4M74 A;  3TGN A;  3EET A;  3I64 A;  3VB2 A;  2QBY A;  3P9I A;  2QQA A;  1GXP A;  3F8N A;  3GXO A;  3CUO A;  4XLP F;  1DP7 P;  3RI4 A;  1SD4 A;  3E6C C;  3EYI A;  3CO6 C;  4GCV A;  4UV8 A;  4S05 A;  2ADU A;  3WTW C;  5L3B A;  4EV0 A;  5IT9 Z;  3TOB A;  1IN8 A;  1IXR C;  5CVV A;  5FD6 A;  1U8R A;  5LHH A;  5J8F A;  4B09 A;  3FXQ A;  3ERE D;  3ZQ7 A;  1D8K A;  2O03 A;  1XDU A;  4LFU A;  2ZKZ A;  4KYW A;  2FQ3 A;  5LGT A;  3ZP5 A;  1JGS A;  1O7L A;  1FBS A;  2A3S A;  3K1P A;  2FMY A;  2H6B A;  2GA1 A;  4KNY A;  4HYE A;  3REO A;  4RAZ A;  3R4K A;  1O3T A;  4XBF A;  4G6Q A;  3BP8 A;  2STT A;  5CVR A;  2QVO A;  4KT5 C;  2IP2 A;  2G7U A;  1Q1H A;  3IKT A;  1JHH A;  2IA1 A;  2UXN A;  2F5E A;  2VN2 A;  5LRR A;  4YII A;  1YS7 A;  2CYY A;  2XKP A;  3WOD F;  2OQR A;  2DU9 A;  1REP C;  1MJ9 A;  5HLI A;  3WTT C;  2V79 A;  3I5U A;  4CZZ A;  1YLF A;  1PUE E;  5DDG A;  4OIR F;  1YYV A;  1USS A;  3T1B A;  2P5L C;  1HKQ A;  1QPM A;  1CF7 B;  2V6C A;  3WG9 A;  1K79 A;  1TW3 A;  3P9K A;  2XV4 S;  3KP3 A;  1RIO H;  5LEK A;  2DK8 A;  1R22 A;  4CO8 A;  2HTS A;  4MEY F;  4Q48 A;  3GF2 A;  5TJJ A;  4E70 A;  1K6O A;  5ICE A;  2VOO A;  4UNO A;  4UVB A;  3F8C A;  3RKY A;  1K78 B;  4L18 B;  2HYF A;  4IRI A;  1S6L A;  2MA3 A;  1TQI A;  3GX4 X;  2H94 A;  4ASN A;  4LB5 A;  2RC4 A;  4HQM A;  2DAO A;  2O6G E;  1O7F A;  4EM1 A;  3DQV C;  2Q0O A;  2ZME A;  3M9A A;  5F1R A;  1FYM A;  2P6T A;  1ZLK A;  2FSW A;  4OOI A;  4ETS A;  5ERI A;  4HF1 A;  5CYV A;  3SHF A;  4AD9 A;  2GZW A;  2O3F A;  4G94 A;  1RI7 A;  3KET A;  4IXA A;  5D4R A;  3BJO A;  3DP7 A;  1QZY A;  5LGN A;  5D8L B;  2DW4 A;  5ICF A;  2VC1 A;  1IN4 A;  2H6C A;  4EM0 B;  2NS0 A;  4N9H A;  2JZY A;  1U6G A;  3WGI A;  4AVP A;  4ZYD A;  3HTS B;  1BJA A;  4EMS A;  1B59 A;  4ENJ A;  3MAJ A;  2FBH A;  4BAY A;  2O0Y A;  4NHJ A;  2YPR A;  2XGX A;  3WU1 B;  1X3U A;  2F5D A;  1Z91 A;  3GZ6 A;  4BH9 A;  4I09 A;  4Q47 A;  1YW9 A;  2P5V A;  4PDK A;  2G9W A;  2MBF A;  1BI3 A;  1OYW A;  4M71 A;  1T38 A;  4GYI A;  2DTR A;  3I59 A;  5JR3 A;  5D6E A;  5KVR A;  1FY7 A;  1XCB A;  4B8X A;  1GXQ A;  5DEQ A;  3J81 Z;  1U78 A;  2E7X A;  1KQ9 A;  2L54 A;  2MLK A;  3FF5 A;  3ZMD A;  4LGW A;  1G6N A;  2K4B A;  4ENM A;  2KJB A;  5A2Q K;  2BYV E;  2RN7 A;  5JVT A;  3GEZ A;  3GFI A;  5A2Q Z;  1BIB A;  6PAX A;  1HW2 A;  1SFU A;  3IWZ A;  4CHU A;  1LVA A;  4OIO F;  4D0P A;  1ZRF A;  3LWF A;  4UV9 A;  2A07 F;  5CLS A;  1UST A;  2KIF A;  2BBY A;  2ZNZ A;  1J5Y A;  3E3V A;  1C0W A;  5ILS A;  1JHF A;  4RGS A;  4R79 A;  2G7H A;  2FE3 A;  2Y75 A;  1AWC A;  4WWC A;  3EUH A;  2EJR A;  3ABU A;  3JSP A;  4A2U A;  1SMY F;  2K4J A;  2PLY A;  1WKM A;  4R1H A;  2HOE A;  1B6A A;  4JK1 X;  1XB4 A;  3V7C A;  1PP7 U;  4KIC A;  4MHG A;  5E18 F;  2QZ8 A;  3FXR A;  1RNL A;  2DT5 A;  3WTS C;  1S8N A;  1J59 A;  3PFI A;  2DK5 A;  3HRT A;  4LK0 F;  2JSC A;  3KP6 A;  3MWM A;  4RB2 C;  1H9T A;  3BJA A;  1HXD A;  2RKH A;  1XD7 A;  4G8X A;  3L09 A;  1G3Y A;  3IHU A;  1TQP A;  1Y0U A;  1SAX A;  2XVC A;  4M6Y A;  4BXU A;  2UXX A;  2DI3 A;  2WV0 A;  4BNC A;  3HHG A;  2FOK A;  3C7J A;  1P92 A;  1WRJ A;  2EFP A;  3QAH A;  3M7G A;  2H09 A;  3RKX A;  5JFR A;  2LNB A;  1TBX A;  2JRT A;  1YG2 A;  4P55 A;  5K1Y A;  1IRF A;  2A61 A;  4UHT A;  3I59 B;  4IF4 A;  1V4R A;  3H92 A;  3LA2 A;  5LEJ A;  1I27 A;  1FYL A;  2MLG A;  4HF2 A;  5HOO A;  3HSE A;  5BPI A;  2OAZ A;  3CUQ C;  1ZG3 A;  2GIV A;  3IKV A;  1G3W A;  1XGS A;  1I6X A;  4IHT A;  1BIA A;  2XAJ A;  4FX0 A;  2FBK A;  5ICG A;  3RTR A;  2ESH A;  2Z9O A;  4RB1 A;  2IPQ X;  3M1E A;  3P9C A;  4MQV A;  1IN6 A;  5DCM A;  4G7Z F;  4U0Y A;  5BQT A;  2M8E A;  3ABT A;  1J75 A;  1R5G A;  1W7P B;  2EFW A;  4KIG A;  1ONV A;  3P7N A;  1J0R A;  4IHS A;  4HW0 A;  2DPD A;  5K5O A;  5L3G A;  1MKM A;  4MNU A;  1O3S A;  4PGH A;  2IRF G;  1TLH B;  2D1H A;  4LLN A;  1L0O C;  5DYM A;  2RVC A;  3TO7 A;  4U7D A;  4O3M A;  3FMS A;  1FWZ A;  4A6E A;  4KA4 A;  3F8M A;  3K9T A;  1OKR A;  2RNJ A;  4L9T A;  3HSF A;  1IXS B;  5JI6 A;  1V3F A;  1BBY A;  2V9V A;  3FM3 A;  4ZYH A;  2ZCW A;  4G7H F;  1HKS A;  1S3J A;  3C18 A;  1R23 A;  1R7J A;  2FXA A;  5D4S A;  4AIJ A;  2V1X A;  3EYY A;  3MCZ A;  2TDX A;  1T0F A;  4OIP F;  2E1C A;  4A0X A;  1BI2 A;  1MDM A;  1LDJ A;  4BHC A;  1BN5 A;  5E1X A;  1RUN A;  3QU3 A;  4P5O A;  2ZNY A;  4XSZ F;  3KP5 A;  2HYG D;  3ECH A;  4YFX F;  3QP6 A;  3F8B A;  2PMU A;  4O6J A;  3V7S A;  5EEG A;  3K1N A;  2O61 A;  1BI0 A;  4HOB A;  2IW5 A;  2QYO A;  1R1T A;  3GLX A;  4EQQ A;  2MC3 A;  3K1M A;  2K7L A;  1WQ2 A;  4A0Z A;  5CJ9 A;  2VE8 A;  1FBU A;  3M8E A;  3V7R A;  2Y48 A;  2EFO A;  4WF2 A;  1D8J A;  2K86 A;  3N4M A;  5CVI A;  2STW A;  2XAH A;  3N97 A;  3T8R A;  4EJU A;  1KGS A;  3ZMU A;  2ACJ A;  5LLQ A;  3F21 A;  3T0Y A;  3C3W A;  4KN4 X;  3E6D A;  1DDN A;  2CWE A;  3IL2 A;  3J81 K;  5E8G A;  2EB7 A;  4M9X A;  3FM5 A;  4HBL A;  2GXB A;  1B9N A;  4RGU A;  3FXU A;  4I02 A;  5FGM A;  4EJW A;  5D5V B;  5E17 F;  2W85 A;  1B1B A;  3KE2 A;  3QU6 A;  2QBY B;  4G6D A;  4LLG F;  4MTE A;  2NNN A;  4I2O A;  3ZN0 A;  3TOA A;  5HDK A;  4XSX F;  4P96 A;  1KA8 A;  1EV7 A;  1H0M A;  1FOK A;  3U1D A;  1G3S A;  3WTU C;  2R7D A;  1KQ8 A;  3GO5 A;  1XSX A;  4HLX A;  4BHP A;  3R60 A;  2EK5 A;  1W7P A;  2QQ9 A;  1KU2 A;  5FD5 A;  3HIF A;  2PG4 A;  1FLI A;  1ZRD A;  3WU0 A;  4U7B A;  3F22 A;  4F7Z A;  2DLL A;  3C1D A;  3TDZ C;  4EGZ A;  2EWN A;  2XKO A;  1IZ1 A;  1GVJ A;  4DQ2 A;  1W5T A;  4FT8 A;  1E2X A;  3RIR A;  1ZAR A;  3M8F A;  5E8I A;  5H20 A;  3T5X A;  3LA7 A;  1GHC A;  3GFM A;  2OZU A;  3ZN1 A;  2YX7 A;  1U5T C;  3J80 K;  2DQL A;  2AXL A;  2RGV A;  4U0W A;  2IT0 A;  1B9M A;  3J80 Z;  3QRF F;  3KLO A;  2X4H A;  4MTD A;  3TO9 A;  3BY6 A;  5TRD A;  3LAP A;  1FC3 A;  3CUQ B;  4U88 A;  1LEB A;  1T6S A;  4A12 A;  3W6J B;  1P4A A;  4LMY A;  3U2R A;  1R1U A;  1O3R A;  1B4A A;  3OOP A;  2FBI A;  1KQ0 A;  2D1V A;  4BYY A;  4WX9 A;  1XCV A;  4O5V A;  5AIQ A;  3O6B B;  2NRA C;  5BPD A;  4S04 A;  3VOE A;  4M6X A;  1HBX G;  1UFM A;  2HKX A;  2L02 A;  1K78 A;  3ZMT A;  4KMU X;  2V1D A;  2L4A A;  4I0B A;  2YX4 A;  2EV5 A;  2F2E A;  4WK8 F;  3NRV A;  2UWM A;  4HV5 A;  2ISZ A;  2OQG A;  2FA5 A;  1EH8 A;  4RS8 A;  5FLX Z;  3PQK A;  3ZMZ A;  3HTU A;  3TKY A;  3NQO A;  3BPX A;  4EVI A;  3B02 A;  3LQQ A;  3IRQ A;  5ICC A;  2ZO4 A;  5LRS A;  1QZZ A;  2BGC A;  1U5T B;  4ENN A;  2JPB A;  2OBP A;  1TNT A;  2VT2 A;  3RJP A;  1I1G A;  3WGH A;  1MGT A;  2VOD A;  3V4G A;  3ROU A;  1I5Z A;  2ISY A;  1IW7 F;  3WTV C;  2D45 A;  1HW1 A;  4KIF A;  1HQC A;  3FMR A;  1IF1 A;  4P9F A;  2XAG A;  4P9U A;  2RQP A;  2DBB A;  4IJA A;  1TNS A;  3G3Z A;  3MQ0 A;  4OMZ A;  4IVN A;  1KYZ A;  2LF7 A;  2P6S A;  1IAW A;  3ISP A;  3B73 A;  3E97 A;  3RPQ A;  1HST A;  5HS8 A;  3D5L A;  3O2P E;  2AS5 F;  2ELH A;  2EV0 A;  2F5F A;  2XRN A;  1HW5 A;  4FX4 A;  1YW8 A;  2YU3 A;  3HOT A;  1ZGA A;  3GYH X;  3G73 A;  2CQK A;  3KP7 A;  1LEA A;  4MGR A;  1FX7 A;  2OD5 A;  2HS5 A;  3GZ5 A;  4Q5S F;  3QOP A;  2VBY A;  3ULQ B;  1LDK B;  1ULY A;  1OMI A;  3WGG A;  1OYI A;  2MH9 A;  5DD4 A;  2L01 A;  1IN7 A;  3IWF A;  4RB0 A;  3KCC A;  3D0S A;  2HWV A;  1MJA A;  3QP5 A;  3R61 A;  4Y15 A;  3I0T A;  3SZP A;  4L9J A;  1F9N A;  3WTZ A;  2EV6 A;  3FHZ A;  3I71 A;  2R7F A;  2NYX A;  4CXF A;  2BEO A;  4N0B A;  3KP4 A;  3R6S A;  2A6H F;  4L0Y B;  2DFI A;  2ZBK A;  4HDV A;  2D2W A;  4RAY A;  3FZV A;  4XLN F;  1OPC A;  2M30 A;  4HZF A;  3HRU A;  2X0L A;  2GWR A;  1TW2 A;  5J6X A;  2FU4 A;  2E1N A;  3E5Q A;  2O8X A;  2KRF A;  4M72 A;  3ELK A;  2YR2 A;  1CGP A;  1RUO A;  4GO1 A;  3HRM A;  4XRF A;  1DUX C;  4ZH4 F;  1QO0 D;  2A6E F;  3JAM Z;  4TV7 A;  1DPU A;  1XMK A;  3JAM K;  2KJC A;  4HDU A;  4EJO A;  3MFK A;  3I4P A;  4I01 A;  3SXY A;  4WXH A;  2WTE A;  2JTV A;  4AIH A;  3WTX C;  2Z99 A;  1KU3 A;  1SFE A;  3HOS A;  1ZHF A;  2HTJ A;  3GFJ A;  5D5X B;  2HEO A;  1JXS A;  2FEZ A;  3J7A O;  1UCR A;  4OMY A;  4LLL A;  2EFN A;  3KZY A;  5L3C A;  4IPA A;  2HZT A;  2HQR A;  5D8K B;  1ON1 A;  5EEH A;  2IA2 A;  3DF8 A;  1WWX A;  3FWE A;  3QPH A;  2BE5 F;  3U9G A;  1F4K A;  3H3Z A;  4ESB A;  2B0L A;  3I58 A;  4RB3 C;  5IT3 A;  4NB5 A;  3PQJ A;  3H3U A;  5JHU A;  5HS9 A;  2Y0M A;  2WC2 A;  1SD6 A;  5HS7 A;  5AIP A;  4R8H A;  1Z6R A;  3SFZ A;  1MD0 A;  4G7O F;  3IRR A;  2P7V B;  1R58 A;  4WXD A;  3ECO A;  2JPC A;  5L3E A;  2M45 A;  3CDH A;  5CVJ A;  2WWY A;  3K2Z A;  5DCF A;  4UVA A;  2XRO A;  4Y13 A;  3LST A;  1K7A A;  4L9N A;  3AAF A;  5BOX A;  1T98 A;  2K27 A;  2OZ6 A;  1W7P D;  2EA2 A;  4U0V A;  2DQR A;  2JT1 A;  5D5U B;  2Z5U A;  1SFX A;  1D3Y A;  1O57 A;  2FNP A;  4HV6 A;  1P6R A;  2L3D A;  4UVC A;  4HF0 A;  4KN7 X;  4MQ9 F;  1J2X A;  4WCG A;  1SD7 A;  2Q8K A;  4QWQ A;  2VBX A;  2UZK A;  3VOD A;  4ENK A;  3GFL A;  5FLX K;  1Z6T A;  5ILU A;  1XGN A;  1S29 A;  4JBA A;  3S2W A;  3RKW A;  3F6O A;  4OU0 A;  2CFX A;  4CYD A;  4I7H A;  1FBQ A;  1FT9 A;  5H6R A;  1ZN2 A;  4LK1 F;  3TDU C;  5DUI A;  5FO5 A;  1S7A A;  1TTY A;  2W57 A;  3KZZ A;  1G3T A;  1KU9 A;  3T8T A;  2ESN A;  3V8K A;  4I98 B;  3HSR A;  2HGC A;  3ML6 A;  3RPU A;  1FSH A;  2FNA A;  3FX3 A;  3F72 A;  4PGG A;  1ZLJ A;  2HDC A;  4GGG A;  3KEO A;  5F6F A;  4Q4Z F;  1WSU A;  4BQA A;  3JTG A;  1L3L A;  3JW4 A;  2A69 F;  3V8L A;  1FNN A;  2W84 A;  2VE9 A;  4ON0 A;  3E6B A;  1FP1 D;  3LQR A;  4CIC A;  2P8T A;  1ZYR F;  1P4X A;  3OV8 A;  1G4D A;  2PFB A;  3F23 A;  3K69 A;  1R1V A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...