5E1ZB

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,4-dichlorophenol bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides mccartyi btf08
molecule tags Transcription
total genus 60
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1zB00
1FSHA 2DAOA 2R3SA 1GVJA 3V8LA 3DPTA 2JSCA 4EVIA 3IRRA 1IN4A 2HFHA 5E8IA 2O8XA 1DPRA 1TNTA 3I64A 3B73A 2P8TA 3G3ZA 4KFCA 2D1HA 1A04A 1IN6A 4KIGA 5FB2A 1T98A 4ON0A 3E3VA 2RDPA 2EA2A 4IPAA 5HVQC 3QPHA 2QWWA 1H9TA 3G73A 3HSEA 3FMQA 2DT5A 2GXGA 4UVCA 5L3EA 4BYYA 2A6EF 1YS6A 2YPRA 4RB1A 4GO1A 4KMUX 5DUKA 3HHGA 2DK5A 2YR2A 3M1EA 3DFGA 1FOKA 3FMRA 2QVOA 3HRMA 4KIBA 4G7HF 2DBBA 3P7NA 2PMHA 1EH8A 2WWYA 3J81K 1CF7B 1R1UA 2B0LA 5FGMA 1FNNA 2XAGA 1FZPB 4A0YA 5BPDA 1R22A 4OIPF 5ICFA 4BNCA 3WTZA 5E20A 4G9YA 2LDUA 5HLHA 3TDUC 1OR7A 3HRUA 3KP7A 1HW2A 5J8FA 3BJ6A 2FOKA 2XAJA 1HSTA 5TJJA 1P92A 3QP5A 2WV0A 2DW4A 3MCZA 3CDHA 2AXLA 2FU4A 4M6XA 1XSDA 1JE8A 5IT9Z 3TO7A 5FFXA 2E1NA 2EFOA 1B9MA 1XB4A 2F5EA 2WC2A 3CUQB 3E5QA 4A5MA 1R23A 2VE8A 1O3QA 4M71A 1ZHFA 1MDMB 1W4MA 1YIOA 3ZN0A 2K4JA 3C7JA 4AD9A 4RAZA 3GXOA 4U0VA 2PEXA 4U7DA 1RIOH 4WCGA 1K78A 2COMA 2PFBA 1L3LA 2GIVA 2M8EA 3HTUA 2FNAA 2DLLA 2FNPA 1PDNC 3BP8A 2ZO4A 3ROUA 3ULQB 3CO7C 1J0RA 1R1VA 5DD8A 3F8MA 1BIAA 1ZLJA 4HQMA 5AONA 5H20A 3H3ZA 3F8CA 1HW1A 4ESJA 2P4WA 4HDUA 4D0PA 5FO5A 4CXFA 2G7UA 4GYGA 3ZPLA 3WODF 3LWFA 3R4KA 4KIFA 4BXUA 3SZPA 1XMAA 1I27A 2HZTA 3ZN1A 3GFMA 5LEJA 1U3EM 3J7AO 3JTHA 1ONVA 1T6SA 4EGYA 3L7WA 2KJBA 4XLPF 1G3SA 5HDNA 2HOEA 1KGSA 4AWXB 4NHJA 5HS9A 3DF8A 2STWA 4L18B 4HF0A 3I5UA 3SZTA 2YSRA 3M8FA 3I4PA 2W57A 3J80Z 2FBHA 1YO5C 2EFNA 1HW5A 3MZYA 1NHAA 5IT3A 1V4RA 1YS7A 2QM3A 4KA4A 2H27A 3Q5FA 2K27A 2O3FA 2P7CB 5K5OA 4EM2A 2VOOA 1S7OA 1LNWA 4A0ZA 3V7RA 4XBFA 1ZYRF 4BQAA 1ZAOA 1Z1DA 2VBZA 4CGZA 3WGIA 1GHCA 5BPIA 4WXCA 2EB7A 2M30A 4LB5A 1G4DA 4G8XA 1WKMA 4WK8F 2Q2EA 4MGRA 2DPDA 1L0OC 1CF7A 3H92A 1BJAA 4HA8A 2RGVA 4G6QA 2KJCA 1BI0A 2ZMEA 1QGPA 3ABUA 2YX7A 3U2RA 1XGMA 2LNBA 4ZH4F 1UHWA 4PCQA 2Y48A 1XSVA 5J8CA 5EEHA 3GW2A 5HLIA 5H6RA 3EUHA 1R58A 4HF1A 4M9XA 4HZFA 2GXBA 3I71A 5D6EA 1BC8C 5D5VB 2A5YB 2LKPA 2RC4A 1UB9A 2DO7A 5LLQA 1O3SA 1QNTA 3MAJA 2XGXA 3D0SA 3LAJA 3V4GA 1O7LA 4YIIA 3GO5A 4WWCA 5J6XA 2C6YA 3LQRA 3CUQA 1ZLKA 3K9TA 2BYVE 3FX3A 4ESBA 1LB2A 1MDMA 2V79A 3BWGA 3HRTA 1XSXA 4FX0A 4I0BA 3ISPA 1UFMA 2CYYA 4L5JA 5BQTA 4N9HA 2RKHA 2VODA 2IVMA 2MC3A 1R1TA 1PUEE 3KZYA 4HLYA 3H3UA 2VC0A 3SQNA 4RB0A 3MWMA 3ZMZA 4OMZA 2EFPA 2VC1A 5A2QZ 2XVCA 4S04A 3VB2A 3GFIA 2D1VA 1ZGAA 4QWQA 1FBQA 3W6KB 5BMZA 4UVAA 3WGGA 5LEKA 4L0ZB 2XAFA 3IRQA 3BDDA 4U88A 2FBKA 3ZMSA 4OINF 1ZH5A 3KP6A 2GWRA 3NQOA 1FC3A 4XLNF 5TRDA 1YG2A 2JPBA 4TV7A 2NNNA 1KYWA 2PG4A 4P9UA 3C3WA 4MNUA 3T5XA 4EQQA 3RYPA 1SFEA 3I59B 4IXAA 3E5XA 1DPUA 2K02A 4P55A 5CVUA 3GLXA 3OOPA 5DD4A 1LEBA 4Y17A 1HQCA 5JFRA 2ZXJA 4KYWA 4UHTA 4RAYA 1PP8F 4LLLA 4CHUA 1RUNA 4PGHA 3KP5A 2YU3A 1Z7UA 2A6HF 3EYIA 2YX4A 3IWZA 4S05A 4WF2A 2VBWA 4RGRA 3F6OA 4A2UA 2CFXA 5IT9K 4XRFA 2QQ9A 2E1CA 3FF5A 2OZ6A 2CO5A 1Q1HA 2UXXA 3EDPA 1SMTA 3ZQ7A 1P2FA 4U0YA 1O3RA 3R61A 1XGNA 3S2WA 4O6JA 5LRRA 2GAUA 2E7XA 3BROA 4BHBA 1W5TA 2LF8A 4UXNA 4CZZA 2DU9A 1FX7A 3Q9SA 2J5PA 4KN4X 4PGGA 4M9ZA 3GX4X 1ZRCA 3M7GA 3FZVA 2Z3YA 1ZARA 1ZGJA 5HDKA 3QRFF 4O5VA 5ICGA 4ZZLA 2H94A 1IF1A 3BZ6A 4IRGA 3K1NA 2E7WA 3ZP5A 1TTYA 1S8NA 1TQIA 4RGXA 2A3SA 3TO6A 1K79A 5D8KB 1OMIA 1O3TA 2NAZA 4OIQF 1P4WA 4ENNA 2BBYA 3V7CA 1RNLA 1XCVA 1MGTA 3U9GA 4XSZF 2GA2A 1IAWA 4L9NA 4Y15A 2ZMEB 5ILSA 4I98B 1ZRDA 3TO9A 2HTSA 3J80K 1ON2A 3LA2A 4KICA 5AIPA 2JRTA 3EQLF 2HQRA 4OIRF 5K1YA 1ZRFA 5H6QA 4ASNA 2HGCA 1TQPA 1STZA 1QPMA 4HW0A 3IHUA 1U5TB 4UV8A 2O03A 4P5OA 1HKQA 1F4KA 1DP7P 1OPCA 1R5GA 3F8NA 4R8HA 2HS5A 2VE9A 2X4HA 2ESHA 2CG4A 1XMKA 4ESFA 4YFKF 4HDVA 4EJOA 4R1HA 4A6EA 5LRSA 2O61A 3IKVA 4KDPA 3QPTA 3BJOA 3NRVA 2W24A 2K7LA 2BEOA 2H6CA 4EMSA 3GZ5A 3NEUA 4L5IA 3I59A 1FY7A 3E6DA 1JXSA 2DPUA 4ZYEA 2O0YA 1U2WA 1YYVA 3L2CA 1F1ZA 1FP2A 2QZ8A 1IN7A 4I01A 1USSA 3REOA 4L9VA 4OMYA 4ZZDA 3R6SA 3F8BA 3P9IA 1KU9A 5BOXA 1YQAA 2M5WA 1H9GA 2Z33A 1LDDA 3MEXA 1CGPA 2UZKA 4O3MA 1WI9A 3RKWA 5D5XB 4LG0B 3ML6A 1FT9A 3OV8A 4NQWA 5L3FA 1BM9A 3JW4A 4UVBA 3IC7A 1R5HA 1TNSA 3F72A 2W85A 1IRGA 1RUOA 1MJAA 4MHGA 2STTA 2WTEA 2XKOA 2ISZA 2IA0A 1G3WA 4HX7A 5DCMB 4AIHA 1REPC 2EV6A 3KE2A 1ZREA 1TW3A 4UV9A 1ULYA 3KEQA 1FYMA 4UNOA 2L01A 1XGOA 4YFNF 1Z91A 4JQFA 2HDCA 3FM3A 1IZ1A 3DKWA 4YG2F 5A2QK 2M87A 2EV0A 3RIRA 3RJPA 2MH9A 5LBQA 1I1SA 5E17F 4DNCA 1OYWA 2VOPA 3R0JA 2XUBA 4M72A 3HIFA 2Z99A 5DCFA 3RI4A 3FXQA 2OQRA 2UWMA 2ACJA 3C18A 5FFZA 1G6NA 2OAZA 1HSJA 3TQNA 2UXNA 2G7HA 4I0AA 3U1DA 4HV6A 2P6TA 5E1WA 3LFKA 5CLSA 1B59A 5JI6A 1WWXA 1IXCA 2P6SA 5L3GA 1DDNA 4I7HA 2NNYA 5FD6A 3PFIA 1SD7A 1BIBA 2ETHA 2P7VB 1ZG3A 2CWEA 3FMSA 3T8TA 1XGSA 3DQVC 2RVCA 3EETA 1P4XA 1TQMA 1O57A 2A61A 1T38A 1D8KA 5LHGA 1J5YA 3FXUA 1YW8A 2XROA 1KA8A 1SD6A 2FA5A 3IWFA 2HYGD 2FXAA 3HOSA 2IP2A 3KLOA 2P5KA 2IW5A 2F2EA 3FXRA 3GF2A 4G7ZF 5CYVA 3WTTC 2IT0A 1V3FA 1FP1D 1UCRA 1MJBA 5LHHA 4LGWA 3PQKA 3RKXA 2JPCA 3HSRA 3KZZA 1QO0D 3GWZA 1ODDA 4PDKA 4HV5A 4M73A 3DEUA 2QLZA 4CDGA 1U5TA 3PQJA 5LGNA 4G94A 4E70A 1SAXA 1HKSA 4WXHA 1BI3A 1S7AA 2P5VA 2DTRA 3O6BB 2L54A 3ERED 3KETA 3VODA 2CQKA 1J75A 2FSWA 3WU0A 3N4MA 2TDXA 3CLOA 4BH9A 2Y75A 4RGUA 5HS7A 5HS8A 2OBPA 1WSUA 5HLGA 4FHTA 4FX4A 3MZHA 2CW0F 4ZYGA 3F21A 2IA1A 4L9TA 3BOQA 1HBXG 3WTUC 2K86A 3K2ZA 5E8GA 1IRFA 1XDSA 4MQ9F 2EJRA 4R79A 4CICA 4B09A 3HYIA 4Q5SF 2XASA 3FM5A 2EV5A 1E2XA 3ZMTA 3TKYA 2QQBA 3COAC 4HAMA 4QLCU 3HOTA 1Z6RA 4IJAA 1GXQA 2NRAC 1HKTA 4EM1A 3P9KA 2D2WA 3DP7A 5L3BA 2VT2A 5BS6A 4P96A 3GZ6A 4NB5A 1W7PD 4LG0A 4EJTA 2KRFA 5ED4A 3MQ0A 2ZBKA 4G6DA 2EK5A 3B02A 4PZJA 1E17A 5E18F 3GYHX 4MQVA 3V8KA 3E6CC 2PMUA 1FBUA 3KLNA 1DUXC 3HRSA 4HX8A 1J59A 3C1DA 3VFZA 5ICCA 1I5ZA 5D4RA 4IRHA 5DCMA 2DFIA 4EV0A 2IJLA 2Z5UA 2LSOA 2W25A 3L9FA 1YLFA 4HYEA 1KQ9A 1FLIA 1SFXA 3KFWX 1XN7A 4RS8A 2DQRA 1SMYF 5EEGA 3F3XA 4Q4ZF 4RB3C 2GZWA 4HX4A 1U78A 5CJ9A 1FBSA 3T8RA 1HXDA 2OQGA 5K5QA 1IN5A 2NYXA 3RPQA 3JAMZ 2QBYB 3Q9VA 3KEOA 4U7BA 3SXYA 3GUDA 3QU3A 3LAPA 1KU2A 2HKXA 2VBYA 3N97A 2PN6A 2OZUA 4M9SA 4I09A 2PI0A 2MH2A 1B1BA 1FWZA 5DYMA 1D3YA 2F5DA 3WTWC 3CJNA 3HSFA 3HTSB 4LMYA 2V6CA 1MZBA 2HKOA 2EA4A 5CVRA 4A5NA 4I2OA 2HTJA 4LFUA 2FRHA 3QU6A 2G9WA 1ON1A 5JHUA 2XAQA 3K69A 3GFJA 1SFUA 4IF4A 1TLHB 3ECHA 1B6AA 2FBIA 4AIKA 1Z9CA 3WTXC 2Q0OA 2IPQX 1S29A 4MEYF 1SD4A 4Q47A 1IN8A 3IL2A 4BHCA 4LD5A 5LGTA 1KYZA 1XDUA 2H09A 1Z05A 3WE2A 3IKTA 4MTDA 3I54A 3P9CA 1S6LA 1W7PB 4ENKA 3JTGA 4U0WA 4LK1F 2LF7A 2EFQA 2NS0A 1Z6TA 2ZKZA 2FE3A 3WG9A 1BC7C 1JHFA 1QZZA 1BI1A 4MTEA 2XKPA 3K0LA 1BN5A 2HQNA 5E1XA 3KCCA 2XRNA 4A0XA 3E6MA 4KT5C 1GXPA 4HF2A 1IXRC 5KVRA 1PP7U 3CO6C 2HEOA 3TDZC 3M8EA 6PAXA 2GQQA 3RYRA 4KUMA 2MD5A 4GYIA 1YW9A 4GXOA 1WQ2A 3ABTA 4KMFA 1YFHA 4ENMA 1QBJA 1U5TC 4CO8A 2MLKA 3DPLC 1ZG1A 4UUVA 3D5LA 2VT3A 2D45A 4AIJA 4OOIA 2KIMA 1R7JA 5KK1A 3K1MA 5JVTA 1P6RA 1RI7A 3E6BA 1TW2A 5FLXZ 3ZMVA 3HUGA 2L02A 3CUQC 4DQ2A 5D5UB 1EV7A 4CYDA 3QP6A 3L09A 5LHIA 4GCVA 2OU2A 1F9NA 2OA4A 5DDGA 1OKRA 3WTYC 3RTRA 2KIUA 2RV8A 2IA2A 1QZYA 2Q8KA 2Z9OA 4GGGA 4P9FA 4EJWA 1RZ4A 2FF4A 3FHZA 4BAYA 3E97A 1S3JA 1SD5A 1G3YA 3WGHA 2CGPA 3R60A 3GFLA 2R7FA 3F23A 4Y13A 2A69F 4FT8A 5LGUA 3TOAA 1MD0A 3LQQA 4HBLA 5JR3A 5F1RA 4M74A 1KQ0A 2QBYA 3CTAA 5DEQA 2W84A 2H6BA 5D4SA 3DXJF 1QQIA 2ADUA 1D8JA 2HR3A 1OYIA 4HQEA 1LJ9A 3O2PE 1MJ9A 1IW7F 4F7ZA 2F5CA 4EGZA 1T0FA 2KKOA 2V1UA 1KU7A 1AOYA 2ISYA 5DV5A 4M6YA 1U8RA 1MKMA 4HOBA 1O7FA 3T0YA 3LA7A 4AVPA 3J81Z 4K2EA 4WXDA 2FMLA 2HWVA 2ZJ2A 3ZMUA 3CUOA 4EJUA 3HHHA 4Q48A 4JBAA 3FWEA 5CVIA 2ZFWA 5D8LB 3JSPA 4KN7X 4EM0B 2O6GE 2OD5A 2L3DA 2VN2A 3RDIA 4ETSA 2MA3A 5D6FA 2PLYA 2RN7A 4OU0A 2R7DA 4N0BA 4YFXF 2XAHA 4JK1X 1AWCA 2ZCWA 1T2KA 2FEZA 4IHSA 3T1BA 4ZYHA 3VOEA 5ICEA 2PBIA 2JTVA 1X3UA 2ESNA 2QENA 3KP2A 5AIQA 2VBXA 4IRIA 5L3CA 1K6OA 2FQ3A 2RQPA 1W7PA 2DI3A 2RNJA 1LEAA 2MLGA 3TOBA 1OYYA 3ELKA 2BV6A 2JT1A 4OIOF 2K4BA 3EYYA 1H0MA 1LQ1A 1JHHA 1BBYA 1KQ8A 2GA1A 3WTSC 3RKYA 1XD7A 3BY6A 1KU3A 1R00A 1P4AA 1USTA 2PQ8A 4LK0F 4RGSA 5HDGA 1VTNC 4ENJA 3KP4A 2ELHA 3R0AA 3JAMK 1B9NA 1G3TA 1IUYA 3GEZA 3V7SA 1LVAA 2V9VA 3F22A 1J9IA 3AAFA 3GVAA 2IRFG 2M1BA 1I1GA 2VXZA 1W5SA 1EH7A 1U6GA 1FYLA 2XIGA 3WE3A 1B4AA 3KP3A 2BE5F 1F5TA 5ILUA 1I6XA 4HLXA 4LJZF 4BHPA 2J5OA 2X0LA 3ECOA 1YW7A 4L9JA 2QQAA 4A6DA 1T39A 1FSEA 4YIFA 5L3DA 4A12A 5HOOA 5E1ZB 1LDJA 3I0TA 5CVVA 3F8FA 3LSTA 4ZYDA 4LB6B 3SHFA 1BOAA 1LDKB 3BPXA 4G7OF 2EFWA 2CSOA 2ZNYA 1IXSB 4N9IA 4B8XA 2F5FA 5FD5A 2DQLA 3E5UA 2XV4S 2VONA 2MBFA 1K7AA 4LLGF 5F6FA 2A68F 1FYKA 1JGSA 3I58A 1C0WA 5CVJA 3ZMDA 2QYOA 3W6JB 2PJPA 3WU1B 3LA3A 5K5RA 1J7KA 3QOPA 2BGCA 2EWNA 4MEXF 3QAHA 2JZYA 3I53A 2FMYA 3V8JA 5DUIA 3TGNA 3DV8A 3BJAA 1J2XA 1FPQA 1ZN2A 2DK8A 1D5VA 4L0YB 1YTYA 2KIFA 2XHKA 1EH6A 1Y0UA 3M9AA 3SFZA 4Z2YA 1XCBA 4WX9A 4KNYA 2V1XA 1K78B 2ZNZA 1BI2A 4IHTA 2P5LC 2L4MA 5ERIA 3K1PA 1ZG5A 2AS5F 4XSXF 1R36A 2L4AA 2Y0MA 3JSOA 5F64A 4IVNA 3VEPA 3RPUA 3L00A 1UHMA 2QUFA 2V1DA 2M45A 4RB2C 3O3KA 1WRJA 3F6VA 2HYFA 4H0EA 5FLXK 4LLNA 3WTVC 1TBXA 3BPVA 5ILVA 4I02A 3MFKA 5D5WB 4EJVA 2A07F
chains in the Genus database with same CATH superfamily
3I4NJ 1UJ8A 4BBRJ 1FSHA 2DAOA 1W36C 2R3SA 1GVJA 2GLOA 3V8LA 2R7OA 2AHQA 4AU7A 3DPTA 3OWTA 3PIPF 2JSCA 2IS2A 4EVIA 3PO2J 2E5ZA 5C44J 3ZCOA 4XRMA 3IRRA 1NG7A 1IN4A 2HFHA 5E8IA 2O8XA 4NUBA 3W2VA 3OYKA 1DPRA 1TNTA 4CZCA 1I39A 3A2KA 3I64A 1N78A 3B73A 2P8TA 2CMPA 1IRXA 1OCCH 3BTJA 3G3ZA 4KFCA 2D1HA 1A04A 2HQ5A 1IN6A 3HPHA 3PM1A 4KIGA 1U0JA 5FB2A 1T98A 3CC4I 4ON0A 3HEFA 3E3VA 2F4IA 3TL4X 2RDPA 2V7FA 1BR1A 2EA2A 4IPAA 5HVQC 2O5RA 1J09A 2QWWA 3QPHA 3ZQGA 3G73A 3HSEA 1H9TA 2LY2A 4MIMA 3FMQA 4BJ5C 1ETVA 2DT5A 2GXGA 1RKTA 3BQZA 3GZNB 4UVCA 5L3EA 4BYYA 3S93A 2A6EF 4B44A 1B8IA 1MBGA 1YS6A 2YPRA 4RB1A 4GO1A 4KMUX 4IOAF 4F91B 4A3KJ 5DUKA 3HHGA 2DK5A 5JVGF 2YR2A 3M1EA 3DFGA 4B47A 2JJ7A 4XKWA 1VQ5I 1FOKA 3FMRA 3F9KA 2QVOA 3HRMA 4KIBA 3BLYA 4G7HF 2EZIA 3OL3A 4BXXJ 4H4KC 1WGXA 2R7UA 3W2WA 2VKHA 2Q2EB 2DBBA 3P7NA 2PMHA 1EH8A 1S9HA 3BTIA 2WWYA 3J81K 3M1CA 5C3EJ 2K3PA 1R1UA 3JRHA 2GOXB 4M3EA 1CF7B 1WJDA 2B0LA 1FNNA 2DMUA 5FGMA 2XAGA 1MIJA 4CSWA 1FZPB 1X3ZB 4A0YA 1AHDP 5BPDA 5FRMA 1R22A 2MW8A 4OIPF 1QVTA 3MZ8A 5ICFA 4QIWN 4BNCA 3WTZA 2M4KA 3QPSA 5E20A 1PUFB 3AFHA 4G9YA 3CCEI 4QSHA 2LDUA 5HLHA 3TDUC 3JRDA 2QKLB 1OR7A 3H3VK 3Q0WA 3S14J 3HRUA 3KP7A 1HW2A 5J8FA 5F0FA 3BJ6A 2FOKA 2XAJA 2JQ7A 3Q3SA 3VSKA 4NC8A 1HSTA 5TJJA 2JUGA 1P92A 2E2IJ 1LFUP 3QP5A 2R92J 3P5JA 3QOEA 3QYBA 2WV0A 2JVGA 1JKPC 2DW4A 3IAS2 3MCZA 2F48A 3BTCA 3CDHA 2AXLA 2FU4A 4HSTA 4M6XA 4CCKA 2DJNA 1NH3A 1XSDA 1JE8A 4I6ZA 2XGEA 5IT9Z 5H2FC 4UB8C 3TO7A 5FFXA 2ZJRF 5GPCA 3I4MJ 2FX0A 1RR7A 2E1NA 2EFOA 1VQKI 1ETXA 1B9MA 1K4SA 3BZCA 1XB4A 2F5EA 2WC2A 3CUQB 3E5QA 1TWAJ 4A5MA 1R23A 2VE8A 1O3QA 3K10A 2PX9A 4M71A 1MBEA 2E35A 1ZHFA 1MDMB 4Y3OA 1W4MA 3W2AA 1YIOA 1IRZA 5KAIC 2K4JA 3ZN0A 5J1RA 3C7JA 4M3BA 4AD9A 3SEZA 4RAZA 2HI3A 3GXOA 3HKZN 4U0VA 4YEJA 2PEXA 5E3OA 2VPLA 4U7DA 2XF5A 3D1NI 5DTDA 4BE0A 1RIOH 4WCGA 4D9JA 4L5EA 1K78A 3GTGJ 2COMA 2PFBA 1L3LA 4BU2A 2GIVA 2M8EA 3HTUA 2FNAA 2DLLA 2PMZN 1N77A 2GXAA 2FNPA 1PDNC 3BP8A 2ZO4A 3ROUA 3VWBA 1D0XA 1GV2A 3ULQB 1VZ0A 3CO7C 1J0RA 1TWCJ 3IP4B 1R1VA 3OR2C 5DD8A 3S1RJ 3LOCA 3F8MA 4F3QA 5HNHA 1V5FA 1X1PA 1BIAA 1ZLJA 4HQMA 5AONA 5H20A 4IZZA 1FIPA 3H3ZA 3F8CA 1HW1A 4ESJA 2VL8A 2CV0A 2W4SA 5F0CA 2TCTA 3CJQB 2P4WA 3KEYA 3BR2A 1ETYA 2VKDA 1N75A 5FO5A 4D0PA 4CXFA 4HDUA 2G7UA 4GYGA 1YJWI 3ZPLA 3WODF 3LWFA 4XKCA 3A01A 5IP9J 4N4OB 3R4KA 1HCRA 4KIFA 4C2TA 3A0BC 4XL9A 4BXUA 3SZPA 1XMAA 1I27A 2HZTA 1D5YA 4XLEA 3ZN1A 3GFMA 1M1EB 2EIKH 3ZQHA 5LEJA 1ZQ3P 5JLWA 3CDLA 1U3EM 3C2HA 3J7AO 2F4MB 5J4VA 2HPMA 4E6KG 3JTHA 1ONVA 1T6SA 3AL0C 4EGYA 2CUFA 3L7WA 2KJBA 1AKHA 1D1AA 4A3LJ 1NK2P 4XLPF 2DDAA 3OIPA 1RPWA 1G3SA 5HDNA 1MMGA 4BE1A 3RZOJ 3JRBA 1G59A 2ZJQF 2HOEA 2Y0SA 3S8PA 1KGSA 4AWXB 4NHJA 5HS9A 3DF8A 2R5ZB 2STWA 4L18B 4HF0A 3I5UA 3OOUA 3SZTA 4II3A 1WJ5A 3GLLA 2YSRA 3M8FA 4BUPA 3I4PA 1R6RA 2DOAA 2W57A 5IYBJ 3J80Z 3H9GA 2FBHA 3HDDA 4PJMA 1YI2I 2K9MA 1YO5C 2CJJA 2CQXA 4A93J 2EFNA 1HW5A 3J7AY 1MBJA 3MZYA 1NHAA 5IT3A 1V4RA 1JGGA 1YS7A 2QM3A 1X1CA 2GM4A 3TW7A 4B43A 4KA4A 2DA1A 2LFBA 2H27A 4E7LA 3Q5FA 3CCVI 3FBIB 3DTIA 1RRJA 2K27A 2H1KA 2O3FA 2P7CB 2NVTJ 5K5OA 4EM2A 2VOOA 2A6TA 2E60A 4DYRA 1S7OA 1LNWA 2Y2ZA 4A0ZA 1OCPA 2XDVA 3V7RA 4XBFA 1ZYRF 1V54H 2OJED 3PL8A 4BQAA 2VASA 1ZAOA 1Z1DA 2VBZA 2NS8A 3HOWJ 4CGZA 2HYJA 3WHBA 3WGIA 1GHCA 2QCOA 1F43A 5BPIA 4WXCA 3MKYB 2EB7A 3LNQA 4ZTJA 1ETQA 3EPZA 2M30A 4RMNA 1WPKA 1LUJB 3K4LA 4LB5A 1G4DA 4G8XA 1D1BA 1ORKA 4IQJA 1WKMA 1MNMC 4WK8F 2FUG2 2Q2EA 2X6YA 3UKGA 4LIUA 4IL6C 2OV7A 4MGRA 2DPDA 1L0OC 2VQCA 1CF7A 2ZFUA 2AO9A 3H92A 1BJAA 4V2FA 3E7LA 4X6AJ 3DBLB 2R7SA 4HA8A 2RGVA 4G6QA 1ZK8A 1RESA 1H8AC 1LE8B 2KJCA 2JUCA 2VB6A 3ZQLA 4E7SA 1BI0A 2ZMEA 1QGPA 2LK2A 4PSXA 1YOVB 2RNGA 3ABUA 2YX7A 1Z21A 3U2RA 1XGMA 2RREA 1PUFA 2LNBA 4ZH4F 1UHWA 1UG0A 4PCQA 4PJ0C 2DA5A 3HB9A 1PVEA 2Y48A 1PYVA 1WFXA 1XSVA 5J8CA 5J3LA 5EEHA 4HRIA 1YX5A 3GW2A 5HLIA 1R5ID 1TWGJ 3S2DJ 2IGMA 2DYSH 3EUHA 5H6RA 5GAEJ 3TW6A 1R58A 3HBLA 4HF1A 3FXLA 4M9XA 4HZFA 4DW6A 2GXBA 3I71A 5FLMJ 5D6EA 2DFEA 1HDPA 1S72I 3L1PA 1BC8C 5D5VB 2A5YB 2DMPA 2LKPA 2RC4A 3S15J 4IHYA 4LOCA 3HM5A 2R7VA 1UB9A 2M7BA 2EZKA 3JCUC 2DO7A 2VPRA 5LLQA 1O3SA 1QNTA 2BY2A 3M8JA 4F93B 3MAJA 1YITI 2XGXA 2V26A 3D0SA 2JA5J 4RAFA 3LAJA 3V4GA 1O7LA 4YIIA 3C2GA 1XPXA 3GO5A 4WWCA 2VLAA 1W36D 4QPQA 5J6XA 4XOTA 2DOEA 5HLTA 2C6YA 2A05A 1TT5B 2K40A 1DGRM 3LQRA 3CUQA 2FQ4A 3G6EI 1ZLKA 3K9TA 2E71A 2K9LA 2VQGA 2BYVE 3S17J 4FTHA 3FX3A 3OYBA 2RAEA 4ESBA 1Y8QB 2HOAA 1MDMA 2V79A 1LB2A 3BWGA 3HRTA 1XSXA 4FX0A 2R7QA 2VKVA 4I0BA 3G1LA 3IH2A 5CQEA 1QA6A 3JR9A 2BXYA 3HOXJ 2V4JC 3ISPA 4BY1J 1UFMA 3KYDB 4C3IJ 2CYYA 4L5JA 5BQTA 1KONA 2RKHA 4N9HA 2VODA 2IVMA 3H5RA 5DS9A 4GRIA 2MC3A 4D7NA 3GMEA 1R1TA 2VJ4A 3H0GJ 3KZYA 1PUEE 2ELJA 3FK7A 4HLYA 3H3UA 5B1AH 2VC0A 3SQNA 1MMDA 4RB0A 2JA7J 3MWMA 3ZMZA 4OMZA 2EFPA 3GCMA 3VYRB 1SFOJ 2VC1A 2CH0A 5A2QZ 4ANJA 2XVCA 4S04A 1MMNA 3K4MA 3H36A 3VB2A 3GFIA 2D1VA 2DOFA 1ZGAA 4QWQA 2D5VA 1FBQA 3W6KB 5BMZA 4UVAA 2E19A 1R4MB 3WGGA 5LEKA 3BT9A 2NVXJ 2XAFA 4RBOA 4L0ZB 3IRQA 3BDDA 4U88A 2FBKA 3ZMSA 3RZDJ 4OINF 1ZH5A 1HA8A 3KP6A 4HPQA 2GWRA 3DCFA 3NQOA 4GDFA 1FC3A 1FMVA 4XLNF 1V5GA 3PNTA 5LD2C 5TRDA 1YG2A 2JPBA 2MABA 4TV7A 5B1BH 4BY7J 2NNNA 4LG3A 1Z77A 3ZQFA 2O7OA 5EG0B 1KYWA 1Z3YA 2PG4A 4FASD 4P9UA 3C3WA 4XORA 3PNVA 4J00A 4MNUA 3L2RA 2JSPA 1S7EA 1X4PA 3T5XA 2KFDA 4EQQA 2RQQA 3I55I 1T08B 1GDTA 2PJRB 2QSFX 2ZXHA 2IBDA 3RYPA 3CCLI 1FTZA 4CCMA 3RKQA 1SFEA 2JVHA 4XRSG 3I59B 4IXAA 2I10A 3M07A 3E5XA 3OR1C 4PFOA 3K4BA 1DPUA 4CCOA 1MH4A 3L2WA 5F27A 3LSPA 5FJ8J 3GTPJ 3H9JA 1MBKA 2JRMA 2K02A 4P55A 5CVUA 3GLXA 3OOPA 5DD4A 2R5ZA 1LEBA 4Y17A 1HQCA 2EQRA 5JFRA 2ZXJA 4KYWA 4UHTA 4RAYA 1PP8F 4LLLA 5GAHJ 4CHUA 2XPVA 2IS6A 1VQ6I 4ZYAA 4M6VA 4XLCA 1RUNA 1K83J 2KRHA 4PGHA 4E4HA 3KP5A 2YU3A 1Z7UA 3IUOA 2A6HF 3K6GA 1EA3A 3EYIA 2YX4A 1QHHD 2AXTC 3IWZA 3HOZJ 4S05A 1OCTC 1X58A 2KHMA 1RC9A 4WF2A 1UMQA 2VBWA 4IOCF 4NQWB 2M4GA 4RGRA 3F6OA 2JK3A 5GTHC 1T33A 4A2UA 2CFXA 2LKXA 5IT9K 3K4JA 3FXJA 3JRIA 2ZJPF 4XRFA 5M3FJ 3LSHA 3HKZA 3AG1H 2QQ9A 4CYCB 2EILH 2HVSA 5HODA 2E1CA 2K9NA 3FF5A 4BXFA 2E5NA 2EIMH 2OZ6A 2WA0A 2CO5A 2VQLA 1Y6IA 1XG1A 1Q1HA 1T0FC 2UXXA 3EDPA 4Y7NJ 1SMTA 2G0EA 2PMZA 3ZQ7A 4OAYA 1P2FA 4E7IA 4U0YA 3UNGC 4XR6A 3R61A 1XGNA 3LMMA 5CQGA 3S2WA 4B3AA 5M3MJ 1O3RA 2Z1DA 2HXIA 4O6JA 5LRRA 3CCSI 1PJRA 2GAUA 3OS0A 2E7XA 1IUFA 3BROA 4A3EJ 3NWTA 4BHBA 2EZHA 4AYBA 1W5TA 2LF8A 1JJ6C 3OL4A 3SEQA 2LRDA 1ZR2A 4UXNA 4CZZA 3OYFA 5GADJ 1RKWA 1LE8A 4NC6A 2DU9A 1FX7A 1X1AA 1OCZH 3AG4H 3D5RC 3Q9SA 2J5PA 1OFCX 4KN4X 2KZGA 4MFEA 4PGGA 3OIOA 4M9ZA 4MO7A 3O8HA 3GX4X 1ZRCA 3M7GA 1JTYA 5J1UA 2YU9J 3BQYA 1A5JA 3FZVA 2Z3YA 1ZARA 4EEFG 2HDDA 1LVKA 1ZGJA 5HDKA 2KL4A 2WY8Q 3VSLA 3QRFF 4O5VA 1P7JA 2VKEA 5ICGA 2W82A 2H94A 4ZZLA 1Y0NA 3OS1A 3OYJA 3CZ6A 3MMYB 1IF1A 3BZ6A 1UAAA 2VUMJ 2UUZA 1WCMJ 2EIJH 3CMAI 4IRGA 3K1NA 2E7WA 5KAFC 3ZP5A 1TTYA 1S8NA 1TQIA 5IOZA 2XAUA 4RGXA 2A3SA 1BR2A 1YIJI 3TO6A 1K4TA 1K79A 5D8KB 1OMIA 3K7AJ 5J40A 4A3FJ 3DU6A 1O3TA 4ZC3A 3A1YA 2NAZA 2X9DA 4OIQF 4XQFA 1GLNA 3CCJI 1F36A 1FEXA 1P4WA 4DOZA 4ENNA 1HC8A 2X48A 4F92B 3DPUA 3SDGA 4IQ4A 1BW5A 2BBYA 3V7CA 4CH7A 4XRSA 1RNLA 1XCVA 2CQQA 2O8KA 4N4NB 3ZR8X 3OS2A 1EKEA 4Y4RA 3TMOA 1MGTA 3U9GA 1X1DA 2R7WA 4XSZF 1TT0A 3Q0VA 2GA2A 4BQOA 3N05A 1IAWA 4L9NA 2LBFB 5KNLA 4Y15A 2ZMEB 1ITYA 3SDBA 5ILSA 4I98B 1OISA 1ZRDA 2P81A 2XF6A 3DEWA 3TO9A 3L2UA 1TL8A 2HTSA 3J80K 1ON2A 3LA2A 3CF5F 4X0GA 3VYUB 4LITA 4KICA 2JMWA 5AIPA 2JRTA 3EQLF 2TRTA 2H8RA 3OYCA 2HQRA 4OIRF 1OJLA 5K1YA 4A69C 1ZRFA 5H6QA 4ASNA 3FBNB 1Z7LA 2JN6A 3A0HC 2HGCA 1TQPA 1STZA 1MBHA 1QPMA 4XICA 4HW0A 3IHUA 1QPIA 1U5TB 1UHSA 4UV8A 2O03A 3OYGA 3MKWB 4P5OA 4QTRA 1HKQA 1F4KA 1DP7P 1OPCA 1R5GA 3F8NA 2WAQN 4R8HA 3S32A 2HS5A 1YRNB 1RR8C 4BEHB 2VE9A 2CS3A 2X4HA 3CP8A 2ESHA 3H9QA 2CG4A 1XMKA 3BC8A 4ESFA 1W0UA 4YFKF 3FXKA 4EJOA 1K6YA 4HDVA 1XTAA 4R1HA 1Y1WJ 2GIZA 3H5AA 5EG0A 4A6EA 5LRSA 2O61A 1WVRA 3IKVA 3PFYA 4KDPA 3QPTA 2N8GA 3VYTB 3BJOA 2LLKA 3NRVA 2W24A 2Y31A 2K7LA 4XLAA 2PJRA 3CMMA 2BEOA 2E2HJ 2H6CA 3LSRA 3S16J 3ZXSA 3CMEI 4EMSA 1IGNA 3GZ5A 3NEUA 4L5IA 3I59A 3E0JB 3OMYA 1FY7A 3E6DA 1JXSA 2DPUA 2NS7A 2M34A 4ZYEA 2O0YA 1U2WA 1YYVA 3TP0A 5J1YA 1Y1VJ 2NXNB 4HNTA 3L2CA 3S1QJ 1F1ZA 1FP2A 2QZ8A 1IN7A 4I01A 1USSA 3REOA 3CC7I 4L9VA 4OMYA 4ZZDA 5IP6A 2LOOA 3DKXA 4DYQA 3R6SA 5E3NA 3H35A 5HNFA 3F8BA 1ENHA 3P9IA 2QSHX 2QKMB 1KU9A 1YHQI 3S3OA 5BOXA 1YQAA 2M5WA 1H9GA 2V1NA 4C3HJ 4F52A 1MMAA 3AG3H 4AYBN 5IPAA 5EZHA 2Z33A 1LDDA 3MEXA 5B66C 1CGPA 2UZKA 4FE4A 4O3MA 1WI9A 2BHYA 3RKWA 5D5XB 1Q1VA 4LG0B 3ML6A 1FT9A 3OV8A 4NQWA 5FKMA 1WJBA 5L3FA 4W1UA 1BM9A 4C30A 3E1SA 3JW4A 4UVBA 3IC7A 1R5HA 1TNSA 3BR5A 3F72A 2W85A 4CYCA 1IRGA 1RUOA 4PUSA 2OUMA 1ACIA 1CQTA 1MJAA 2W00A 4MHGA 1Z0XA 2XGDA 1DP3A 2LVSA 2B9SA 4CCJA 3JRCA 2K5CA 3LSGA 1VQ9I 2STTA 2WTEA 2XKOA 2ISZA 5B3SH 3FISA 3K4CA 1E3OC 2IA0A 2HQAA 1G3WA 3ASOH 3BR0A 3OYDA 4HX7A 5DCMB 4AIHA 1REPC 1FTTA 2EV6A 4RM3A 1B72B 2HOTA 2X1DA 2M9HA 3KE2A 1ZREA 2WB1N 1TW3A 4QPOA 3GTMJ 4BS9A 4UV9A 2L5QA 1ULYA 2QA4I 2E1MC 5FKLA 1A31A 4C2MJ 3KEQA 1FYMA 1UELB 4UNOA 2L01A 1XGOA 4YFNF 2DA7A 1Z91A 4JQFA 2HDCA 3FM3A 1IZ1A 1OQYA 2HDWA 3DKWA 2DJIA 4YG2F 1N25A 4ABZA 1VI0A 5A2QK 2M87A 4MFDA 3EUKL 2OCEA 2EV0A 3RIRA 3RJPA 2MH9A 3TP3A 5LBQA 1I1SA 3CCRI 5E17F 2QGUA 4DNCA 1OYWA 2VOPA 2X1EA 3R0JA 1TWHJ 1YE9A 2XUBA 1I50J 4M72A 3HIFA 1VQLI 3G1OA 2Z99A 5DCFA 5KCMA 3RI4A 2ZXWH 3FXQA 2OQRA 2IAIA 2UWMA 1QRYA 4FETA 3CD6I 2ACJA 2NVUB 5FROA 3C18A 2MC4A 5FFZA 1OCRH 2MYSA 1G6NA 5BNGA 4KISA 1T56A 3QPLA 2OAZA 1IG7A 1HSJA 4V2GA 2KLOA 4XNFA 3TQNA 1XC5A 2UXNA 2X6WA 2G7HA 4I0AA 3U1DA 3CLQA 3BG5A 4HV6A 5CKTA 2L9VA 2P6TA 5E1WA 3LFKA 5CLSA 4MLOA 2DMQA 1B59A 5JI6A 3HL2A 1WWXA 1IXCA 3GTOJ 2P6SA 5L3GA 3ESWB 2ICWG 4DYCA 1DDNA 4I7HA 2NNYA 2NOJB 5FD6A 3PFIA 5E3MA 1SD7A 1BIBA 2ETHA 2P7VB 3I3LA 1ZG3A 2CWEA 2AQFA 3FMSA 2LBFA 3T8TA 1IV8A 1XGSA 3DQVC 3QODA 4BL0B 2RVCA 3EETA 4XN0A 4BGDA 3LSMA 1P4XA 1TQMA 4M3DA 1O57A 2A61A 2GOMA 1T38A 1D8KA 4NNJA 3FDYA 5F08A 5LHGA 1J5YA 3FXUA 1YW8A 2XROA 1KA8A 2K9QA 1SD6A 1Z3XA 2FA5A 3IWFA 2HYGD 3OYAA 2FXAA 3HOSA 5F04A 2IP2A 1JT6A 3KLOA 2P5KA 3I9V2 2IW5A 3QWLA 2F2EA 3JRFA 3FXRA 3GF2A 4G7ZF 4XK4A 5CYVA 1SVLA 3WTTC 2IT0A 1V3FA 1GV5A 3K70D 1OCOH 1FP1D 1UCRA 1E3HA 1MJBA 5LHHA 4LGWA 3PQKA 3RKXA 2JPCA 3HSRA 5TGTA 3KZZA 1QO0D 3GWZA 1ODDA 2CFOA 2X6OA 4HV5A 4M73A 3DEUA 4PDKA 2QLZA 4CDGA 1FJLA 3OYEA 1X4OA 3D5SC 1U5TA 3FK6A 3PQJA 5LGNA 4G94A 4RLFA 2DA4A 4DGWB 4E70A 1SAXA 1HKSA 4WXHA 2KIQA 1BI3A 1S7AA 2P5VA 3FKJA 2DTRA 3O6BB 1YRNA 1XS9A 2LG4A 2L54A 2B63J 3ERED 4DZPA 3KETA 4BEHA 3VODA 2CQKA 1SANA 4J19A 1J75A 2DN0A 2BY0A 1SFKA 4I76A 2KPMA 2FSWA 2JA6J 4ITVA 4W97A 2KMUA 3WU0A 3N4MA 2TDXA 3CLOA 4BH9A 1X2MA 2Y75A 4AUXA 2KRCA 4RGUA 5HS7A 5HS8A 2BXZA 2KZVA 2OBPA 5HLGA 1ZR4A 4FHTA 3HPGA 4JOMA 4FX4A 1WSUA 3MZHA 2CW0F 3G2BA 4ZYGA 3F21A 1HF0A 2IA1A 3RQ4A 4L9TA 1HOMA 3BOQA 1HBXG 3WTUC 2K86A 3K2ZA 3ABMH 5E8GA 1IRFA 1XDSA 4MQ9F 2EJRA 3WG7H 4R79A 3J7YJ 4CICA 2R0QC 4B09A 3HYIA 2IGKA 3CQZJ 4Q5SF 3CDIA 2XASA 1U9NA 3FM5A 2LR8A 2H8WA 2EV5A 1E2XA 2ZSHB 3ZMTA 2L0KA 2OF7A 1MSFC 5M5XJ 3TKYA 1W1WE 2QQBA 3COAC 4HAMA 4QLCU 2VQHA 3HOTA 1Z6RA 4DJAA 1A36A 1OR7C 4IJAA 3CCMI 1GXQA 1NTCA 3CC2I 2EBIA 2NRAC 2X6XA 4FISA 1HKTA 4EM1A 3P9KA 3SJMA 1V55H 2D2WA 2HVRA 2DMNA 3DP7A 5L3BA 2HOSA 1VQ4I 3HGGA 2CV1A 3RCOA 1MMSA 1TWFJ 3DBHB 2VT2A 2ZC2A 5BS6A 3IV5A 4A3BJ 4P96A 1E3PA 5GP9A 3GZ6A 3GTQJ 4NB5A 1W7PD 4LG0A 4EJTA 4DBQA 2KRFA 5ED4A 1JKQC 3MQ0A 2ZBKA 2EH3A 4PJLA 3MVPA 4G6DA 4ZTFA 1JKOC 2HPIA 2EK5A 1D0ZA 3B02A 1WJAA 4A3CJ 4PZJA 1W5CC 1E17A 5E18F 1SVMA 4RAGA 3GYHX 4MQVA 3V8KA 3E6CC 2PMUA 4I99C 1FBUA 4IHVA 3KLNA 1DUXC 3GTLJ 4AIDA 3HRSA 2CU7A 4HX8A 3PUBA 1J59A 3C1DA 3VFZA 5ICCA 1I5ZA 5D4RA 4IRHA 5DCMA 5EGOB 2DFIA 1B72A 3LFUA 3M3YJ 3W3CA 1V5EA 4EV0A 2IJLA 2Z5UA 1VQ8I 2LSOA 2W25A 3BG3A 3L9FA 1MSEC 1MW7A 1YLFA 4HYEA 2Y30A 3SYTA 1KQ9A 1FLIA 1SFXA 3KFWX 1XN7A 4RS8A 2DQRA 1SMYF 1Y8RB 4Y52J 1ERDA 2WAQA 5EEGA 4AM3A 1YX3A 3F3XA 1Y39A 4Q4ZF 4RB3C 2MSYA 3ZQCA 2ID3A 4HNVA 2GZWA 4PFPA 2DT6A 2XF7A 1H89C 2XB0X 4HX4A 1SEUA 4XM3A 2QSGX 1U78A 3DBRB 1QVUA 5CJ9A 1FBSA 4V19K 2KP6A 3T8RA 3OYIA 1IDZA 1HXDA 3K4KA 2OQGA 5K5QA 1WI3A 2WV1A 1IN5A 2NYXA 3RPQA 3JAMZ 2QBYB 3NWSA 5JHFA 1GVDA 3CCQI 3Q9VA 2FOWA 4XLHA 3KEOA 4U7BA 3SXYA 3GUDA 3QU3A 5M5YJ 2EINH 3KIOA 1BA5A 3LAPA 1KU2A 2HKXA 2VBYA 3N97A 2PN6A 1SVOA 4XLFA 2ZSIB 3ZQQA 2YS9A 4ZDOA 2OZUA 4M9SA 4A3MJ 4I09A 2PI0A 4IKFA 2MH2A 1B1BA 1FWZA 5DYMA 1D3YA 2F5DA 3WTWC 3H5NA 3A02A 4XONA 2NVQJ 3CJNA 3PSIA 3HSFA 3HTSB 4LMYA 2V6CA 1MZBA 2HKOA 2XGCA 2EA4A 1LPQA 3OYHA 3S1MJ 2LC2A 5CVRA 4JX4A 4A5NA 1K61A 2XSDC 4I2OA 2HTJA 1YJ9I 4LFUA 2ME6A 4XIDA 2FRHA 4BDZA 2AQEA 3QU6A 2G9WA 4BJ6C 2CQNA 4HEA2 1U8BA 1ON1A 1BJZA 2ME0A 5JHUA 2XAQA 3TBIA 4BKXA 1R4NB 3K69A 3GFJA 1KZHA 1SFUA 4IF4A 1TLHB 2OC6A 3ECHA 1B6AA 1POGA 1X19A 5FLVA 2FBIA 4AIKA 2KDZA 2R7TA 2GBYA 1G2HA 3S2HJ 2FD5A 1Z9CA 3WTXC 2Q0OA 2IPQX 1S29A 4MEYF 2X51A 1SD4A 4Q47A 1R71A 3CF2A 1NG6A 1IN8A 3IL2A 4BHCA 2I8DA 9ANTA 2NOGA 4LD5A 5LGTA 1KYZA 1XDUA 1WJEA 4PJNA 2H09A 1Z05A 2R5YB 5FKNA 1VQOI 1T8IA 3WE2A 3M4OJ 4E7KA 2WB1A 3IKTA 3EUAA 4MTDA 3I54A 1VNDA 2LH9A 3P9CA 1A35A 1S6LA 2KDOA 3BR6A 1W7PB 2MFZA 3BR3A 1JUSA 3CJRB 4ENKA 3DKYA 1DQUA 2ZXIA 3JTGA 3BTLA 2LP0A 4U0WA 4LK1F 2LF7A 2O9LA 2EFQA 2NS0A 1Z6TA 1JT0A 2CQ7A 2ZKZA 4E7ZA 2F4OB 3HXLA 4AC0A 5JLXA 4B3XA 4CCLA 3ZQIA 1EJ9A 4ZDPA 2FE3A 1MBFA 4Z6YA 2WY7Q 1ETKA 4DBRA 4Y33A 4D1QA 4IHXA 3WG9A 4PSWA 5KHDA 3OSGA 1JHFA 1BC7C 2IS1A 1QZZA 1BI1A 1AU7A 3V42A 4B48A 4MTEA 3H0DA 2XKPA 4B4CA 2VI6A 3K0LA 5DM6F 1BN5A 2HQNA 3CCUI 1VQ7I 1SC7A 5E3LA 5E1XA 3KCCA 2XRNA 3CESA 3FXMA 4A0XA 3E6MA 3RSNA 2ZMEC 4KT5C 3OYNA 3G71I 3RPUD 2F6CA 3PNYA 2QEXI 5CPRB 1GXPA 4IO9F 4HF2A 1LKXA 1IXRC 3AG2H 3IH4A 5KVRA 1PP7U 1MH3A 2YUSA 4E7JA 3DTEA 1D0YA 3K4NA 1A6IA 3CO6C 3OYMA 1WJCA 1P9QC 2HEOA 3TDZC 3EUHC 2X85A 2OTJI 5EZGA 4ZJZA 3M8EA 2DA2A 3NARA 6PAXA 5EYRA 2GQQA 2W48A 3MN2A 3RYRA 4KUMA 2MD5A 4GYIA 1YW9A 4GXOA 1WQ2A 3ABTA 4KMFA 4HG2A 4ENMA 1YFHA 1VQMI 1QBJA 2VXDA 1U5TC 1FOXA 1MNDA 4CO8A 3DTKA 5M5WJ 4JYKA 3TEDA 2MLKA 3DPLC 1TP4A 1ZG1A 4UUVA 3D5LA 2CRGA 4NBQA 2VT3A 1GUUA 4FCYA 3A03A 2D45A 3B6AA 4AIJA 2KQRA 3RQIA 3GTJJ 3C2BA 4OOIA 2KIMA 1R7JA 5KK1A 3K1MA 5IY5H 1ZELA 5B5EC 5JVTA 1P6RA 2Q1ZB 1RI7A 2HU9A 3E6BA 1TW2A 1ETWA 2CW8A 5FKOA 5FLXZ 3BCAA 2P0WA 3ASNH 3X2QH 3HUGA 2L02A 3ZMVA 4BDYA 1I3AA 3HOVJ 1OLTA 3CUQC 4DQ2A 5D5UB 4RDUA 1EV7A 4CYDA 3QP6A 3L09A 5LHIA 4GCVA 2OU2A 2LD5A 1F9NA 2OA4A 3SFIA 5DDGA 3LSKA 5F0HA 1OKRA 5IYDJ 3GBGA 4OWRB 2BW3B 5EGOA 3WTYC 2R4GA 3RTRA 3JRAA 3HJEA 2KIUA 2OCCH 2RV8A 4YIRX 2IA2A 2HZDA 1QZYA 3ABKH 2Q8KA 2Z9OA 3CP2A 4GGGA 4P9FA 4EJWA 3HC7A 4HNUA 4DZJA 4RLQA 1RZ4A 2FF4A 2DYRH 3FHZA 1GT0C 3MKLA 4BAYA 2EZLA 3E97A 1S3JA 1SD5A 1G3YA 3WGHA 2MD0A 2V6EA 3HGYA 1SAUA 2CGPA 2Y9YA 3R60A 2DDBA 3DU5A 3KYCB 3GFLA 2IGOA 2R7FA 3F23A 4Y13A 5EDNA 2A69F 4FT8A 5GAGJ 1W0TA 2L2OA 5J4YA 2HNHA 3G1MA 2COBA 4A3DJ 5LGUA 3TOAA 1MD0A 3LQQA 4HBLA 2M0CA 4C9YA 1BOBA 3ZOBA 3OY9A 5JR3A 5F1RA 1P7IA 4M74A 1KQ0A 2QBYA 3PUFA 2OTLI 2M7AA 5FRNA 1XX5A 4JP0A 1TC3C 4LIVA 1MNEA 2BVLA 3CTAA 5DEQA 2IS4A 2W84A 2H6BA 3HOUJ 2X1CA 3DXJF 5D4SA 2L7MP 1QQIA 2DFHA 2ADUA 1D8JA 1RETA 2HR3A 1OYIA 1S5LC 5EJCA 4HQEA 3CMYA 1LJ9A 3WHCA 2NVYJ 4RM2A 3O2PE 1VQPI 1MJ9A 1QZEA 3AL0B 1IO2A 1IW7F 4F7ZA 2F5CA 2B7EA 4EGZA 1T0FA 2KKOA 3KX2A 3VYSB 2V1UA 4G12A 1KU7A 3OSFA 1AOYA 2VJIA 3G4SI 2E34A 2IGNA 3LSIA 2ISYA 2VJJA 5DV5A 4M6YA 5GPAA 1XMXA 4F55A 4XMYA 3L2QA 3DLAA 1MKMA 1U8RA 2DTZA 4HOBA 1O7FA 3MD2A 4JX5A 4BJTA 2XPWA 3T0YA 1IDYA 1WHUA 3LA7A 4AVPA 3J81Z 3VPRA 4K2EA 1YJNI 2LREA 1UZCA 2E1MB 4WXDA 5EEAA 1WH5A 2FMLA 2HWVA 2IXSA 1WJFA 1Z67A 2ZJ2A 3ZMUA 3CUOA 4EJUA 3HHHA 4Q48A 4G6TB 2WBMA 4JBAA 3KPHA 3FWEA 5CVIA 2ZFWA 5D8LB 3JSPA 1JI8A 2BOLA 2DT7B 4KN7X 2QQ8A 4EM0B 2WADA 2O6GE 3BCBA 2OD5A 2L3DA 2VN2A 3ABLH 3RDIA 4ETSA 2MA3A 2L9RA 4A3GJ 5D6FA 2BY1A 2PLYA 4E7HA 4OAZA 2RN7A 4OU0A 4BQNA 3DLLF 2DFFA 2R7DA 4N0BA 4YFXF 4BQQA 2XAHA 4JK1X 1AWCA 4C2UA 2ZCWA 1JUMA 1T2KA 3AKZA 2XPUA 4S0HB 2FEZA 4IHSA 4XKBA 3T1BA 4ZYHA 1D1CA 3VOEA 4CCNA 4AVZA 5ICEA 2R5YA 2PBIA 2JTVA 1X3UA 2DODA 2E1OA 2ESNA 4PK4A 1R9TJ 2QENA 1DU6A 3KP2A 4XOPA 5AIQA 2LY9A 2VBXA 4IRIA 5L3CA 1K6OA 4U87A 4UUSB 2FQ3A 3PJRA 3PO3J 2M0MA 2RQPA 1QHGA 1W7PA 1ETOA 1WH7A 2DI3A 4IX7A 2Y9ZA 2DA6A 2DCEA 2RNJA 1LEAA 3QQAA 2MLGA 3QYFA 1IV6A 2E36A 3TOBA 3BG9A 5GTIC 1OYYA 3ELKA 5IYCJ 2BV6A 2JT1A 1BL0A 3BZKA 3S3MA 4OIOF 1ZTRA 2K4BA 2XRLA 3EYYA 2E2JJ 1H0MA 1LQ1A 1VF9A 1JHHA 5FKKA 1BBYA 2CUJA 1KQ8A 2GA1A 5K7HA 4JX6A 3RKYA 3WTSC 3UR3C 1XD7A 3IH3A 4NC7A 1HLVA 5EF6A 3BY6A 1BW6A 1KU3A 1R00A 1P4AA 1JUPA 4FQGA 4UB6C 3FIWA 1JTXA 4D7MA 3KYLA 5IP7J 4IEJA 1LFPA 1USTA 2PQ8A 4LK0F 4RGSA 5HDGA 1VTNC 3L2VA 3HZJA 4ENJA 1G8XA 1X3WB 4UUTA 4EATA 2VJ5A 1TZLA 2ELHA 3KP4A 3R0AA 2CW7A 3JAMK 1B9NA 1G3TA 1IUYA 4YELA 2L9SA 2BVMA 2MG4A 3GEZA 4D5CA 3V7SA 2UV1A 1LVAA 2V9VA 1HDDC 3F22A 2DMTA 1J9IA 3AAFA 2WAEA 3BG6A 2LTPA 3GVAA 3MKZA 1B8IB 2IRFG 3FKIJ 2M1BA 1I1GA 2VXZA 1W5SA 2OPTA 1EH7A 1U6GA 2BZTA 2KT0A 2LKSA 4XKVA 1FYLA 2XIGA 3ERMA 3WE3A 1Y56A 3PIOF 1UG2A 2CUEA 4ZDLA 1BR4A 1B4AA 2W1OA 3KP3A 2BE5F 1IC8A 3NAUA 4HSRA 5ILUA 1I6XA 1F5TA 3H1CA 1A6QA 3B6CA 4HLXA 4LJZF 1I6HJ 4BHPA 2J5OA 2X0LA 1T95A 4X1EA 4C3JJ 2MGQA 3ECOA 1YW7A 4L9JA 2QQAA 3BG7A 4D5FA 5C4XJ 5K7ZA 2CV2A 4A6DA 1T39A 2BW3A 1I3QJ 2R7ZJ 3Q0UA 4BACA 1FSEA 4NDLA 2R7XA 3DEEA 4YIFA 2L7FP 2ELKA 4FE7A 2K3FA 2Z16A 5L3DA 4A12A 5HOOA 5E1ZB 4DIQA 2WAFA 1LDJA 3KZIC 3I0TA 5CVVA 4A3IJ 2XSJC 2KISA 3F8FA 3LSTA 4ZYDA 1NK3P 4LB6B 1APLC 1JJ8C 2V9PA 3HG9A 3SHFA 5DM7F 1BOAA 4KT6A 1LDKB 3BPXA 3ZRGA 4G7OF 2M3AA 5K7FA 2EFWA 3GTKJ 2CSOA 2ZNYA 2L9NA 4KJZA 1IXSB 4N9IA 3ONQA 3U1KA 4B8XA 3LL7A 4IHWA 5E79C 4UY8I 4A3JJ 2F5FA 5FD5A 2DQLA 2M8GX 3E5UA 2DXIA 2XV4S 2VONA 2MBFA 2BY3A 1FOYA 1K7AA 4LLGF 2JA2A 2Y0SN 5F6FA 3WU2C 2XB5A 2A68F 1FYKA 1JGSA 3I58A 2FJ1A 2K85A 3VDXA 2XC7A 1C0WA 3S3NA 2EPFA 5CVJA 3ZMDA 2QYOA 3W6JB 4M3GA 2PJPA 3K2AA 4J01A 3WU1B 3HUGB 3LA3A 4GFBA 5K5RA 1J7KA 2Z2SB 3QOPA 4RA2A 4CA0A 2CUZA 2BGCA 2LYCA 1DGWY 4P1WA 2A5WA 2EWNA 4MEXF 1X1BA 2V9KA 3BR1A 3QAHA 1DU0A 4BBSJ 2JZYA 3A4CA 3I53A 2FMYA 2LMDA 3V8JA 5DUIA 2L7KA 2LY1A 3TGNA 2M2EA 1FIAA 3DV8A 5C4JJ 3BJAA 1J2XA 4KITB 3FXOA 1FPQA 1ZN2A 3U21A 4CUGA 2I5UA 2DK8A 2ID6A 2VIXA 1D5VA 3IAM2 4L0YB 2W7NA 1YTYA 2KIFA 2XHKA 1IJWC 1EH6A 3OYLA 1Y0UA 3LSJA 3M9AA 3SFZA 2QF7A 2HXOA 4Z2YA 1XCBA 3S1NJ 1ZKGA 3F0CA 4B1RA 4WX9A 4KNYA 2V1XA 1K78B 2K9SA 4PJJA 1H88C 2ZNZA 1BI2A 2L7ZA 4IHTA 2P5LC 2DA3A 1E0EA 2L4MA 3SZGA 2F5VA 3JREA 3DWLE 3ZGKA 3HOYJ 2IEKA 1FOWA 5ERIA 5TISC 1WZ2A 2BHZA 3K1PA 1AA7A 1ZG5A 5J47A 4XSXF 2AS5F 1R36A 2L4AA 2Y0MA 1R49A 3JSOA 5F64A 4IVNA 3VEPA 1ZGWA 1FMWA 4BE2A 3RPUA 2JWTA 1JKRC 2HVQA 2JA8J 3L00A 2Y69H 1UHMA 1QU3A 4II2A 3W6VA 3QYEA 5F1JA 2QUFA 2V1DA 2M45A 3JRGA 2ECBA 3CCYA 4RB2C 2ECCA 3K70C 3O3KA 3A01B 3FHNA 1VFCA 1WRJA 3I56I 4XN3A 2ZB9A 4UUSA 3F6VA 2R93J 3CJTB 1O4XA 5LFAA 1LFBA 3PSFA 2HYFA 4H0EA 5FLXK 2H1LA 1VQNI 3OIQA 4LLNA 3WTVC 1TBXA 1U9OA 3BPVA 5ILVA 4I02A 3MFKA 5D5WB 4M3FA 3J7ZI 5IOYA 1X2NA 4EJVA 2A07F 4YRVA 1AKHB 3O8GA 2R7RA 1EF4A
chains in the Genus database with same CATH topology
1FSHA 2DAOA 2R3SA 1GVJA 3V8LA 3DPTA 2JSCA 4EVIA 3IRRA 1IN4A 2HFHA 5E8IA 2O8XA 1DPRA 1TNTA 3I64A 3B73A 2P8TA 3G3ZA 4KFCA 2D1HA 1A04A 1IN6A 4KIGA 5FB2A 1T98A 4ON0A 3E3VA 2RDPA 2EA2A 4IPAA 5HVQC 3QPHA 2QWWA 1H9TA 3G73A 3HSEA 3FMQA 2DT5A 2GXGA 4UVCA 5L3EA 4BYYA 2A6EF 1YS6A 2YPRA 4RB1A 4GO1A 4KMUX 5DUKA 3HHGA 2DK5A 2YR2A 3M1EA 3DFGA 1FOKA 3FMRA 2QVOA 3HRMA 4KIBA 4G7HF 2DBBA 3P7NA 2PMHA 1EH8A 2WWYA 3J81K 1CF7B 1R1UA 2B0LA 5FGMA 1FNNA 2XAGA 1FZPB 4A0YA 5BPDA 1R22A 4OIPF 5ICFA 4BNCA 3WTZA 5E20A 4G9YA 2LDUA 5HLHA 3TDUC 1OR7A 3HRUA 3KP7A 1HW2A 5J8FA 3BJ6A 2FOKA 2XAJA 1HSTA 5TJJA 1P92A 3QP5A 2WV0A 2DW4A 3MCZA 3CDHA 2AXLA 2FU4A 4M6XA 1XSDA 1JE8A 5IT9Z 3TO7A 5FFXA 2E1NA 2EFOA 1B9MA 1XB4A 2F5EA 2WC2A 3CUQB 3E5QA 4A5MA 1R23A 2VE8A 1O3QA 4M71A 1ZHFA 1MDMB 1W4MA 1YIOA 3ZN0A 2K4JA 3C7JA 4AD9A 4RAZA 3GXOA 4U0VA 2PEXA 4U7DA 1RIOH 4WCGA 1K78A 2COMA 2PFBA 1L3LA 2GIVA 2M8EA 3HTUA 2FNAA 2DLLA 2FNPA 1PDNC 3BP8A 2ZO4A 3ROUA 3ULQB 3CO7C 1J0RA 1R1VA 5DD8A 3F8MA 1BIAA 1ZLJA 4HQMA 5AONA 5H20A 3H3ZA 3F8CA 1HW1A 4ESJA 2P4WA 4HDUA 4D0PA 5FO5A 4CXFA 2G7UA 4GYGA 3ZPLA 3WODF 3LWFA 3R4KA 4KIFA 4BXUA 3SZPA 1XMAA 1I27A 2HZTA 3ZN1A 3GFMA 5LEJA 1U3EM 3J7AO 3JTHA 1ONVA 1T6SA 4EGYA 3L7WA 2KJBA 4XLPF 1G3SA 5HDNA 2HOEA 1KGSA 4AWXB 4NHJA 5HS9A 3DF8A 2STWA 4L18B 4HF0A 3I5UA 3SZTA 2YSRA 3M8FA 3I4PA 2W57A 3J80Z 2FBHA 1YO5C 2EFNA 1HW5A 3MZYA 1NHAA 5IT3A 1V4RA 1YS7A 2QM3A 4KA4A 2H27A 3Q5FA 2K27A 2O3FA 2P7CB 5K5OA 4EM2A 2VOOA 1S7OA 1LNWA 4A0ZA 3V7RA 4XBFA 1ZYRF 4BQAA 1ZAOA 1Z1DA 2VBZA 4CGZA 3WGIA 1GHCA 5BPIA 4WXCA 2EB7A 2M30A 4LB5A 1G4DA 4G8XA 1WKMA 4WK8F 2Q2EA 4MGRA 2DPDA 1L0OC 1CF7A 3H92A 1BJAA 4HA8A 2RGVA 4G6QA 2KJCA 1BI0A 2ZMEA 1QGPA 3ABUA 2YX7A 3U2RA 1XGMA 2LNBA 4ZH4F 1UHWA 4PCQA 2Y48A 1XSVA 5J8CA 5EEHA 3GW2A 5HLIA 5H6RA 3EUHA 1R58A 4HF1A 4M9XA 4HZFA 2GXBA 3I71A 5D6EA 1BC8C 5D5VB 2A5YB 2LKPA 2RC4A 1UB9A 2DO7A 5LLQA 1O3SA 1QNTA 3MAJA 2XGXA 3D0SA 3LAJA 3V4GA 1O7LA 4YIIA 3GO5A 4WWCA 5J6XA 2C6YA 3LQRA 3CUQA 1ZLKA 3K9TA 2BYVE 3FX3A 4ESBA 1LB2A 1MDMA 2V79A 3BWGA 3HRTA 1XSXA 4FX0A 4I0BA 3ISPA 1UFMA 2CYYA 4L5JA 5BQTA 4N9HA 2RKHA 2VODA 2IVMA 2MC3A 1R1TA 1PUEE 3KZYA 4HLYA 3H3UA 2VC0A 3SQNA 4RB0A 3MWMA 3ZMZA 4OMZA 2EFPA 2VC1A 5A2QZ 2XVCA 4S04A 3VB2A 3GFIA 2D1VA 1ZGAA 4QWQA 1FBQA 3W6KB 5BMZA 4UVAA 3WGGA 5LEKA 4L0ZB 2XAFA 3IRQA 3BDDA 4U88A 2FBKA 3ZMSA 4OINF 1ZH5A 3KP6A 2GWRA 3NQOA 1FC3A 4XLNF 5TRDA 1YG2A 2JPBA 4TV7A 2NNNA 1KYWA 2PG4A 4P9UA 3C3WA 4MNUA 3T5XA 4EQQA 3RYPA 1SFEA 3I59B 4IXAA 3E5XA 1DPUA 2K02A 4P55A 5CVUA 3GLXA 3OOPA 5DD4A 1LEBA 4Y17A 1HQCA 5JFRA 2ZXJA 4KYWA 4UHTA 4RAYA 1PP8F 4LLLA 4CHUA 1RUNA 4PGHA 3KP5A 2YU3A 1Z7UA 2A6HF 3EYIA 2YX4A 3IWZA 4S05A 4WF2A 2VBWA 4RGRA 3F6OA 4A2UA 2CFXA 5IT9K 4XRFA 2QQ9A 2E1CA 3FF5A 2OZ6A 2CO5A 1Q1HA 2UXXA 3EDPA 1SMTA 3ZQ7A 1P2FA 4U0YA 1O3RA 3R61A 1XGNA 3S2WA 4O6JA 5LRRA 2GAUA 2E7XA 3BROA 4BHBA 1W5TA 2LF8A 4UXNA 4CZZA 2DU9A 1FX7A 3Q9SA 2J5PA 4KN4X 4PGGA 4M9ZA 3GX4X 1ZRCA 3M7GA 3FZVA 2Z3YA 1ZARA 1ZGJA 5HDKA 3QRFF 4O5VA 5ICGA 4ZZLA 2H94A 1IF1A 3BZ6A 4IRGA 3K1NA 2E7WA 3ZP5A 1TTYA 1S8NA 1TQIA 4RGXA 2A3SA 3TO6A 1K79A 5D8KB 1OMIA 1O3TA 2NAZA 4OIQF 1P4WA 4ENNA 2BBYA 3V7CA 1RNLA 1XCVA 1MGTA 3U9GA 4XSZF 2GA2A 1IAWA 4L9NA 4Y15A 2ZMEB 5ILSA 4I98B 1ZRDA 3TO9A 2HTSA 3J80K 1ON2A 3LA2A 4KICA 5AIPA 2JRTA 3EQLF 2HQRA 4OIRF 5K1YA 1ZRFA 5H6QA 4ASNA 2HGCA 1TQPA 1STZA 1QPMA 4HW0A 3IHUA 1U5TB 4UV8A 2O03A 4P5OA 1HKQA 1F4KA 1DP7P 1OPCA 1R5GA 3F8NA 4R8HA 2HS5A 2VE9A 2X4HA 2ESHA 2CG4A 1XMKA 4ESFA 4YFKF 4HDVA 4EJOA 4R1HA 4A6EA 5LRSA 2O61A 3IKVA 4KDPA 3QPTA 3BJOA 3NRVA 2W24A 2K7LA 2BEOA 2H6CA 4EMSA 3GZ5A 3NEUA 4L5IA 3I59A 1FY7A 3E6DA 1JXSA 2DPUA 4ZYEA 2O0YA 1U2WA 1YYVA 3L2CA 1F1ZA 1FP2A 2QZ8A 1IN7A 4I01A 1USSA 3REOA 4L9VA 4OMYA 4ZZDA 3R6SA 3F8BA 3P9IA 1KU9A 5BOXA 1YQAA 2M5WA 1H9GA 2Z33A 1LDDA 3MEXA 1CGPA 2UZKA 4O3MA 1WI9A 3RKWA 5D5XB 4LG0B 3ML6A 1FT9A 3OV8A 4NQWA 5L3FA 1BM9A 3JW4A 4UVBA 3IC7A 1R5HA 1TNSA 3F72A 2W85A 1IRGA 1RUOA 1MJAA 4MHGA 2STTA 2WTEA 2XKOA 2ISZA 2IA0A 1G3WA 4HX7A 5DCMB 4AIHA 1REPC 2EV6A 3KE2A 1ZREA 1TW3A 4UV9A 1ULYA 3KEQA 1FYMA 4UNOA 2L01A 1XGOA 4YFNF 1Z91A 4JQFA 2HDCA 3FM3A 1IZ1A 3DKWA 4YG2F 5A2QK 2M87A 2EV0A 3RIRA 3RJPA 2MH9A 5LBQA 1I1SA 5E17F 4DNCA 1OYWA 2VOPA 3R0JA 2XUBA 4M72A 3HIFA 2Z99A 5DCFA 3RI4A 3FXQA 2OQRA 2UWMA 2ACJA 3C18A 5FFZA 1G6NA 2OAZA 1HSJA 3TQNA 2UXNA 2G7HA 4I0AA 3U1DA 4HV6A 2P6TA 5E1WA 3LFKA 5CLSA 1B59A 5JI6A 1WWXA 1IXCA 2P6SA 5L3GA 1DDNA 4I7HA 2NNYA 5FD6A 3PFIA 1SD7A 1BIBA 2ETHA 2P7VB 1ZG3A 2CWEA 3FMSA 3T8TA 1XGSA 3DQVC 2RVCA 3EETA 1P4XA 1TQMA 1O57A 2A61A 1T38A 1D8KA 5LHGA 1J5YA 3FXUA 1YW8A 2XROA 1KA8A 1SD6A 2FA5A 3IWFA 2HYGD 2FXAA 3HOSA 2IP2A 3KLOA 2P5KA 2IW5A 2F2EA 3FXRA 3GF2A 4G7ZF 5CYVA 3WTTC 2IT0A 1V3FA 1FP1D 1UCRA 1MJBA 5LHHA 4LGWA 3PQKA 3RKXA 2JPCA 3HSRA 3KZZA 1QO0D 3GWZA 1ODDA 4PDKA 4HV5A 4M73A 3DEUA 2QLZA 4CDGA 1U5TA 3PQJA 5LGNA 4G94A 4E70A 1SAXA 1HKSA 4WXHA 1BI3A 1S7AA 2P5VA 2DTRA 3O6BB 2L54A 3ERED 3KETA 3VODA 2CQKA 1J75A 2FSWA 3WU0A 3N4MA 2TDXA 3CLOA 4BH9A 2Y75A 4RGUA 5HS7A 5HS8A 2OBPA 1WSUA 5HLGA 4FHTA 4FX4A 3MZHA 2CW0F 4ZYGA 3F21A 2IA1A 4L9TA 3BOQA 1HBXG 3WTUC 2K86A 3K2ZA 5E8GA 1IRFA 1XDSA 4MQ9F 2EJRA 4R79A 4CICA 4B09A 3HYIA 4Q5SF 2XASA 3FM5A 2EV5A 1E2XA 3ZMTA 3TKYA 2QQBA 3COAC 4HAMA 4QLCU 3HOTA 1Z6RA 4IJAA 1GXQA 2NRAC 1HKTA 4EM1A 3P9KA 2D2WA 3DP7A 5L3BA 2VT2A 5BS6A 4P96A 3GZ6A 4NB5A 1W7PD 4LG0A 4EJTA 2KRFA 5ED4A 3MQ0A 2ZBKA 4G6DA 2EK5A 3B02A 4PZJA 1E17A 5E18F 3GYHX 4MQVA 3V8KA 3E6CC 2PMUA 1FBUA 3KLNA 1DUXC 3HRSA 4HX8A 1J59A 3C1DA 3VFZA 5ICCA 1I5ZA 5D4RA 4IRHA 5DCMA 2DFIA 4EV0A 2IJLA 2Z5UA 2LSOA 2W25A 3L9FA 1YLFA 4HYEA 1KQ9A 1FLIA 1SFXA 3KFWX 1XN7A 4RS8A 2DQRA 1SMYF 5EEGA 3F3XA 4Q4ZF 4RB3C 2GZWA 4HX4A 1U78A 5CJ9A 1FBSA 3T8RA 1HXDA 2OQGA 5K5QA 1IN5A 2NYXA 3RPQA 3JAMZ 2QBYB 3Q9VA 3KEOA 4U7BA 3SXYA 3GUDA 3QU3A 3LAPA 1KU2A 2HKXA 2VBYA 3N97A 2PN6A 2OZUA 4M9SA 4I09A 2PI0A 2MH2A 1B1BA 1FWZA 5DYMA 1D3YA 2F5DA 3WTWC 3CJNA 3HSFA 3HTSB 4LMYA 2V6CA 1MZBA 2HKOA 2EA4A 5CVRA 4A5NA 4I2OA 2HTJA 4LFUA 2FRHA 3QU6A 2G9WA 1ON1A 5JHUA 2XAQA 3K69A 3GFJA 1SFUA 4IF4A 1TLHB 3ECHA 1B6AA 2FBIA 4AIKA 1Z9CA 3WTXC 2Q0OA 2IPQX 1S29A 4MEYF 1SD4A 4Q47A 1IN8A 3IL2A 4BHCA 4LD5A 5LGTA 1KYZA 1XDUA 2H09A 1Z05A 3WE2A 3IKTA 4MTDA 3I54A 3P9CA 1S6LA 1W7PB 4ENKA 3JTGA 4U0WA 4LK1F 2LF7A 2EFQA 2NS0A 1Z6TA 2ZKZA 2FE3A 3WG9A 1BC7C 1JHFA 1QZZA 1BI1A 4MTEA 2XKPA 3K0LA 1BN5A 2HQNA 5E1XA 3KCCA 2XRNA 4A0XA 3E6MA 4KT5C 1GXPA 4HF2A 1IXRC 5KVRA 1PP7U 3CO6C 2HEOA 3TDZC 3M8EA 6PAXA 2GQQA 3RYRA 4KUMA 2MD5A 4GYIA 1YW9A 4GXOA 1WQ2A 3ABTA 4KMFA 1YFHA 4ENMA 1QBJA 1U5TC 4CO8A 2MLKA 3DPLC 1ZG1A 4UUVA 3D5LA 2VT3A 2D45A 4AIJA 4OOIA 2KIMA 1R7JA 5KK1A 3K1MA 5JVTA 1P6RA 1RI7A 3E6BA 1TW2A 5FLXZ 3ZMVA 3HUGA 2L02A 3CUQC 4DQ2A 5D5UB 1EV7A 4CYDA 3QP6A 3L09A 5LHIA 4GCVA 2OU2A 1F9NA 2OA4A 5DDGA 1OKRA 3WTYC 3RTRA 2KIUA 2RV8A 2IA2A 1QZYA 2Q8KA 2Z9OA 4GGGA 4P9FA 4EJWA 1RZ4A 2FF4A 3FHZA 4BAYA 3E97A 1S3JA 1SD5A 1G3YA 3WGHA 2CGPA 3R60A 3GFLA 2R7FA 3F23A 4Y13A 2A69F 4FT8A 5LGUA 3TOAA 1MD0A 3LQQA 4HBLA 5JR3A 5F1RA 4M74A 1KQ0A 2QBYA 3CTAA 5DEQA 2W84A 2H6BA 5D4SA 3DXJF 1QQIA 2ADUA 1D8JA 2HR3A 1OYIA 4HQEA 1LJ9A 3O2PE 1MJ9A 1IW7F 4F7ZA 2F5CA 4EGZA 1T0FA 2KKOA 2V1UA 1KU7A 1AOYA 2ISYA 5DV5A 4M6YA 1U8RA 1MKMA 4HOBA 1O7FA 3T0YA 3LA7A 4AVPA 3J81Z 4K2EA 4WXDA 2FMLA 2HWVA 2ZJ2A 3ZMUA 3CUOA 4EJUA 3HHHA 4Q48A 4JBAA 3FWEA 5CVIA 2ZFWA 5D8LB 3JSPA 4KN7X 4EM0B 2O6GE 2OD5A 2L3DA 2VN2A 3RDIA 4ETSA 2MA3A 5D6FA 2PLYA 2RN7A 4OU0A 2R7DA 4N0BA 4YFXF 2XAHA 4JK1X 1AWCA 2ZCWA 1T2KA 2FEZA 4IHSA 3T1BA 4ZYHA 3VOEA 5ICEA 2PBIA 2JTVA 1X3UA 2ESNA 2QENA 3KP2A 5AIQA 2VBXA 4IRIA 5L3CA 1K6OA 2FQ3A 2RQPA 1W7PA 2DI3A 2RNJA 1LEAA 2MLGA 3TOBA 1OYYA 3ELKA 2BV6A 2JT1A 4OIOF 2K4BA 3EYYA 1H0MA 1LQ1A 1JHHA 1BBYA 1KQ8A 2GA1A 3WTSC 3RKYA 1XD7A 3BY6A 1KU3A 1R00A 1P4AA 1USTA 2PQ8A 4LK0F 4RGSA 5HDGA 1VTNC 4ENJA 3KP4A 2ELHA 3R0AA 3JAMK 1B9NA 1G3TA 1IUYA 3GEZA 3V7SA 1LVAA 2V9VA 3F22A 1J9IA 3AAFA 3GVAA 2IRFG 2M1BA 1I1GA 2VXZA 1W5SA 1EH7A 1U6GA 1FYLA 2XIGA 3WE3A 1B4AA 3KP3A 2BE5F 1F5TA 5ILUA 1I6XA 4HLXA 4LJZF 4BHPA 2J5OA 2X0LA 3ECOA 1YW7A 4L9JA 2QQAA 4A6DA 1T39A 1FSEA 4YIFA 5L3DA 4A12A 5HOOA 5E1ZB 1LDJA 3I0TA 5CVVA 3F8FA 3LSTA 4ZYDA 4LB6B 3SHFA 1BOAA 1LDKB 3BPXA 4G7OF 2EFWA 2CSOA 2ZNYA 1IXSB 4N9IA 4B8XA 2F5FA 5FD5A 2DQLA 3E5UA 2XV4S 2VONA 2MBFA 1K7AA 4LLGF 5F6FA 2A68F 1FYKA 1JGSA 3I58A 1C0WA 5CVJA 3ZMDA 2QYOA 3W6JB 2PJPA 3WU1B 3LA3A 5K5RA 1J7KA 3QOPA 2BGCA 2EWNA 4MEXF 3QAHA 2JZYA 3I53A 2FMYA 3V8JA 5DUIA 3TGNA 3DV8A 3BJAA 1J2XA 1FPQA 1ZN2A 2DK8A 1D5VA 4L0YB 1YTYA 2KIFA 2XHKA 1EH6A 1Y0UA 3M9AA 3SFZA 4Z2YA 1XCBA 4WX9A 4KNYA 2V1XA 1K78B 2ZNZA 1BI2A 4IHTA 2P5LC 2L4MA 5ERIA 3K1PA 1ZG5A 2AS5F 4XSXF 1R36A 2L4AA 2Y0MA 3JSOA 5F64A 4IVNA 3VEPA 3RPUA 3L00A 1UHMA 2QUFA 2V1DA 2M45A 4RB2C 3O3KA 1WRJA 3F6VA 2HYFA 4H0EA 5FLXK 4LLNA 3WTVC 1TBXA 3BPVA 5ILVA 4I02A 3MFKA 5D5WB 4EJVA 2A07F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSH A;  2DAO A;  2R3S A;  1GVJ A;  3V8L A;  3DPT A;  2JSC A;  4EVI A;  3IRR A;  1IN4 A;  2HFH A;  5E8I A;  2O8X A;  1DPR A;  1TNT A;  3I64 A;  3B73 A;  2P8T A;  3G3Z A;  4KFC A;  2D1H A;  1A04 A;  1IN6 A;  4KIG A;  5FB2 A;  1T98 A;  4ON0 A;  3E3V A;  2RDP A;  2EA2 A;  4IPA A;  5HVQ C;  3QPH A;  2QWW A;  1H9T A;  3G73 A;  3HSE A;  3FMQ A;  2DT5 A;  2GXG A;  4UVC A;  5L3E A;  4BYY A;  2A6E F;  1YS6 A;  2YPR A;  4RB1 A;  4GO1 A;  4KMU X;  5DUK A;  3HHG A;  2DK5 A;  2YR2 A;  3M1E A;  3DFG A;  1FOK A;  3FMR A;  2QVO A;  3HRM A;  4KIB A;  4G7H F;  2DBB A;  3P7N A;  2PMH A;  1EH8 A;  2WWY A;  3J81 K;  1CF7 B;  1R1U A;  2B0L A;  5FGM A;  1FNN A;  2XAG A;  1FZP B;  4A0Y A;  5BPD A;  1R22 A;  4OIP F;  5ICF A;  4BNC A;  3WTZ A;  5E20 A;  4G9Y A;  2LDU A;  5HLH A;  3TDU C;  1OR7 A;  3HRU A;  3KP7 A;  1HW2 A;  5J8F A;  3BJ6 A;  2FOK A;  2XAJ A;  1HST A;  5TJJ A;  1P92 A;  3QP5 A;  2WV0 A;  2DW4 A;  3MCZ A;  3CDH A;  2AXL A;  2FU4 A;  4M6X A;  1XSD A;  1JE8 A;  5IT9 Z;  3TO7 A;  5FFX A;  2E1N A;  2EFO A;  1B9M A;  1XB4 A;  2F5E A;  2WC2 A;  3CUQ B;  3E5Q A;  4A5M A;  1R23 A;  2VE8 A;  1O3Q A;  4M71 A;  1ZHF A;  1MDM B;  1W4M A;  1YIO A;  3ZN0 A;  2K4J A;  3C7J A;  4AD9 A;  4RAZ A;  3GXO A;  4U0V A;  2PEX A;  4U7D A;  1RIO H;  4WCG A;  1K78 A;  2COM A;  2PFB A;  1L3L A;  2GIV A;  2M8E A;  3HTU A;  2FNA A;  2DLL A;  2FNP A;  1PDN C;  3BP8 A;  2ZO4 A;  3ROU A;  3ULQ B;  3CO7 C;  1J0R A;  1R1V A;  5DD8 A;  3F8M A;  1BIA A;  1ZLJ A;  4HQM A;  5AON A;  5H20 A;  3H3Z A;  3F8C A;  1HW1 A;  4ESJ A;  2P4W A;  4HDU A;  4D0P A;  5FO5 A;  4CXF A;  2G7U A;  4GYG A;  3ZPL A;  3WOD F;  3LWF A;  3R4K A;  4KIF A;  4BXU A;  3SZP A;  1XMA A;  1I27 A;  2HZT A;  3ZN1 A;  3GFM A;  5LEJ A;  1U3E M;  3J7A O;  3JTH A;  1ONV A;  1T6S A;  4EGY A;  3L7W A;  2KJB A;  4XLP F;  1G3S A;  5HDN A;  2HOE A;  1KGS A;  4AWX B;  4NHJ A;  5HS9 A;  3DF8 A;  2STW A;  4L18 B;  4HF0 A;  3I5U A;  3SZT A;  2YSR A;  3M8F A;  3I4P A;  2W57 A;  3J80 Z;  2FBH A;  1YO5 C;  2EFN A;  1HW5 A;  3MZY A;  1NHA A;  5IT3 A;  1V4R A;  1YS7 A;  2QM3 A;  4KA4 A;  2H27 A;  3Q5F A;  2K27 A;  2O3F A;  2P7C B;  5K5O A;  4EM2 A;  2VOO A;  1S7O A;  1LNW A;  4A0Z A;  3V7R A;  4XBF A;  1ZYR F;  4BQA A;  1ZAO A;  1Z1D A;  2VBZ A;  4CGZ A;  3WGI A;  1GHC A;  5BPI A;  4WXC A;  2EB7 A;  2M30 A;  4LB5 A;  1G4D A;  4G8X A;  1WKM A;  4WK8 F;  2Q2E A;  4MGR A;  2DPD A;  1L0O C;  1CF7 A;  3H92 A;  1BJA A;  4HA8 A;  2RGV A;  4G6Q A;  2KJC A;  1BI0 A;  2ZME A;  1QGP A;  3ABU A;  2YX7 A;  3U2R A;  1XGM A;  2LNB A;  4ZH4 F;  1UHW A;  4PCQ A;  2Y48 A;  1XSV A;  5J8C A;  5EEH A;  3GW2 A;  5HLI A;  5H6R A;  3EUH A;  1R58 A;  4HF1 A;  4M9X A;  4HZF A;  2GXB A;  3I71 A;  5D6E A;  1BC8 C;  5D5V B;  2A5Y B;  2LKP A;  2RC4 A;  1UB9 A;  2DO7 A;  5LLQ A;  1O3S A;  1QNT A;  3MAJ A;  2XGX A;  3D0S A;  3LAJ A;  3V4G A;  1O7L A;  4YII A;  3GO5 A;  4WWC A;  5J6X A;  2C6Y A;  3LQR A;  3CUQ A;  1ZLK A;  3K9T A;  2BYV E;  3FX3 A;  4ESB A;  1LB2 A;  1MDM A;  2V79 A;  3BWG A;  3HRT A;  1XSX A;  4FX0 A;  4I0B A;  3ISP A;  1UFM A;  2CYY A;  4L5J A;  5BQT A;  4N9H A;  2RKH A;  2VOD A;  2IVM A;  2MC3 A;  1R1T A;  1PUE E;  3KZY A;  4HLY A;  3H3U A;  2VC0 A;  3SQN A;  4RB0 A;  3MWM A;  3ZMZ A;  4OMZ A;  2EFP A;  2VC1 A;  5A2Q Z;  2XVC A;  4S04 A;  3VB2 A;  3GFI A;  2D1V A;  1ZGA A;  4QWQ A;  1FBQ A;  3W6K B;  5BMZ A;  4UVA A;  3WGG A;  5LEK A;  4L0Z B;  2XAF A;  3IRQ A;  3BDD A;  4U88 A;  2FBK A;  3ZMS A;  4OIN F;  1ZH5 A;  3KP6 A;  2GWR A;  3NQO A;  1FC3 A;  4XLN F;  5TRD A;  1YG2 A;  2JPB A;  4TV7 A;  2NNN A;  1KYW A;  2PG4 A;  4P9U A;  3C3W A;  4MNU A;  3T5X A;  4EQQ A;  3RYP A;  1SFE A;  3I59 B;  4IXA A;  3E5X A;  1DPU A;  2K02 A;  4P55 A;  5CVU A;  3GLX A;  3OOP A;  5DD4 A;  1LEB A;  4Y17 A;  1HQC A;  5JFR A;  2ZXJ A;  4KYW A;  4UHT A;  4RAY A;  1PP8 F;  4LLL A;  4CHU A;  1RUN A;  4PGH A;  3KP5 A;  2YU3 A;  1Z7U A;  2A6H F;  3EYI A;  2YX4 A;  3IWZ A;  4S05 A;  4WF2 A;  2VBW A;  4RGR A;  3F6O A;  4A2U A;  2CFX A;  5IT9 K;  4XRF A;  2QQ9 A;  2E1C A;  3FF5 A;  2OZ6 A;  2CO5 A;  1Q1H A;  2UXX A;  3EDP A;  1SMT A;  3ZQ7 A;  1P2F A;  4U0Y A;  1O3R A;  3R61 A;  1XGN A;  3S2W A;  4O6J A;  5LRR A;  2GAU A;  2E7X A;  3BRO A;  4BHB A;  1W5T A;  2LF8 A;  4UXN A;  4CZZ A;  2DU9 A;  1FX7 A;  3Q9S A;  2J5P A;  4KN4 X;  4PGG A;  4M9Z A;  3GX4 X;  1ZRC A;  3M7G A;  3FZV A;  2Z3Y A;  1ZAR A;  1ZGJ A;  5HDK A;  3QRF F;  4O5V A;  5ICG A;  4ZZL A;  2H94 A;  1IF1 A;  3BZ6 A;  4IRG A;  3K1N A;  2E7W A;  3ZP5 A;  1TTY A;  1S8N A;  1TQI A;  4RGX A;  2A3S A;  3TO6 A;  1K79 A;  5D8K B;  1OMI A;  1O3T A;  2NAZ A;  4OIQ F;  1P4W A;  4ENN A;  2BBY A;  3V7C A;  1RNL A;  1XCV A;  1MGT A;  3U9G A;  4XSZ F;  2GA2 A;  1IAW A;  4L9N A;  4Y15 A;  2ZME B;  5ILS A;  4I98 B;  1ZRD A;  3TO9 A;  2HTS A;  3J80 K;  1ON2 A;  3LA2 A;  4KIC A;  5AIP A;  2JRT A;  3EQL F;  2HQR A;  4OIR F;  5K1Y A;  1ZRF A;  5H6Q A;  4ASN A;  2HGC A;  1TQP A;  1STZ A;  1QPM A;  4HW0 A;  3IHU A;  1U5T B;  4UV8 A;  2O03 A;  4P5O A;  1HKQ A;  1F4K A;  1DP7 P;  1OPC A;  1R5G A;  3F8N A;  4R8H A;  2HS5 A;  2VE9 A;  2X4H A;  2ESH A;  2CG4 A;  1XMK A;  4ESF A;  4YFK F;  4HDV A;  4EJO A;  4R1H A;  4A6E A;  5LRS A;  2O61 A;  3IKV A;  4KDP A;  3QPT A;  3BJO A;  3NRV A;  2W24 A;  2K7L A;  2BEO A;  2H6C A;  4EMS A;  3GZ5 A;  3NEU A;  4L5I A;  3I59 A;  1FY7 A;  3E6D A;  1JXS A;  2DPU A;  4ZYE A;  2O0Y A;  1U2W A;  1YYV A;  3L2C A;  1F1Z A;  1FP2 A;  2QZ8 A;  1IN7 A;  4I01 A;  1USS A;  3REO A;  4L9V A;  4OMY A;  4ZZD A;  3R6S A;  3F8B A;  3P9I A;  1KU9 A;  5BOX A;  1YQA A;  2M5W A;  1H9G A;  2Z33 A;  1LDD A;  3MEX A;  1CGP A;  2UZK A;  4O3M A;  1WI9 A;  3RKW A;  5D5X B;  4LG0 B;  3ML6 A;  1FT9 A;  3OV8 A;  4NQW A;  5L3F A;  1BM9 A;  3JW4 A;  4UVB A;  3IC7 A;  1R5H A;  1TNS A;  3F72 A;  2W85 A;  1IRG A;  1RUO A;  1MJA A;  4MHG A;  2STT A;  2WTE A;  2XKO A;  2ISZ A;  2IA0 A;  1G3W A;  4HX7 A;  5DCM B;  4AIH A;  1REP C;  2EV6 A;  3KE2 A;  1ZRE A;  1TW3 A;  4UV9 A;  1ULY A;  3KEQ A;  1FYM A;  4UNO A;  2L01 A;  1XGO A;  4YFN F;  1Z91 A;  4JQF A;  2HDC A;  3FM3 A;  1IZ1 A;  3DKW A;  4YG2 F;  5A2Q K;  2M87 A;  2EV0 A;  3RIR A;  3RJP A;  2MH9 A;  5LBQ A;  1I1S A;  5E17 F;  4DNC A;  1OYW A;  2VOP A;  3R0J A;  2XUB A;  4M72 A;  3HIF A;  2Z99 A;  5DCF A;  3RI4 A;  3FXQ A;  2OQR A;  2UWM A;  2ACJ A;  3C18 A;  5FFZ A;  1G6N A;  2OAZ A;  1HSJ A;  3TQN A;  2UXN A;  2G7H A;  4I0A A;  3U1D A;  4HV6 A;  2P6T A;  5E1W A;  3LFK A;  5CLS A;  1B59 A;  5JI6 A;  1WWX A;  1IXC A;  2P6S A;  5L3G A;  1DDN A;  4I7H A;  2NNY A;  5FD6 A;  3PFI A;  1SD7 A;  1BIB A;  2ETH A;  2P7V B;  1ZG3 A;  2CWE A;  3FMS A;  3T8T A;  1XGS A;  3DQV C;  2RVC A;  3EET A;  1P4X A;  1TQM A;  1O57 A;  2A61 A;  1T38 A;  1D8K A;  5LHG A;  1J5Y A;  3FXU A;  1YW8 A;  2XRO A;  1KA8 A;  1SD6 A;  2FA5 A;  3IWF A;  2HYG D;  2FXA A;  3HOS A;  2IP2 A;  3KLO A;  2P5K A;  2IW5 A;  2F2E A;  3FXR A;  3GF2 A;  4G7Z F;  5CYV A;  3WTT C;  2IT0 A;  1V3F A;  1FP1 D;  1UCR A;  1MJB A;  5LHH A;  4LGW A;  3PQK A;  3RKX A;  2JPC A;  3HSR A;  3KZZ A;  1QO0 D;  3GWZ A;  1ODD A;  4PDK A;  4HV5 A;  4M73 A;  3DEU A;  2QLZ A;  4CDG A;  1U5T A;  3PQJ A;  5LGN A;  4G94 A;  4E70 A;  1SAX A;  1HKS A;  4WXH A;  1BI3 A;  1S7A A;  2P5V A;  2DTR A;  3O6B B;  2L54 A;  3ERE D;  3KET A;  3VOD A;  2CQK A;  1J75 A;  2FSW A;  3WU0 A;  3N4M A;  2TDX A;  3CLO A;  4BH9 A;  2Y75 A;  4RGU A;  5HS7 A;  5HS8 A;  2OBP A;  1WSU A;  5HLG A;  4FHT A;  4FX4 A;  3MZH A;  2CW0 F;  4ZYG A;  3F21 A;  2IA1 A;  4L9T A;  3BOQ A;  1HBX G;  3WTU C;  2K86 A;  3K2Z A;  5E8G A;  1IRF A;  1XDS A;  4MQ9 F;  2EJR A;  4R79 A;  4CIC A;  4B09 A;  3HYI A;  4Q5S F;  2XAS A;  3FM5 A;  2EV5 A;  1E2X A;  3ZMT A;  3TKY A;  2QQB A;  3COA C;  4HAM A;  4QLC U;  3HOT A;  1Z6R A;  4IJA A;  1GXQ A;  2NRA C;  1HKT A;  4EM1 A;  3P9K A;  2D2W A;  3DP7 A;  5L3B A;  2VT2 A;  5BS6 A;  4P96 A;  3GZ6 A;  4NB5 A;  1W7P D;  4LG0 A;  4EJT A;  2KRF A;  5ED4 A;  3MQ0 A;  2ZBK A;  4G6D A;  2EK5 A;  3B02 A;  4PZJ A;  1E17 A;  5E18 F;  3GYH X;  4MQV A;  3V8K A;  3E6C C;  2PMU A;  1FBU A;  3KLN A;  1DUX C;  3HRS A;  4HX8 A;  1J59 A;  3C1D A;  3VFZ A;  5ICC A;  1I5Z A;  5D4R A;  4IRH A;  5DCM A;  2DFI A;  4EV0 A;  2IJL A;  2Z5U A;  2LSO A;  2W25 A;  3L9F A;  1YLF A;  4HYE A;  1KQ9 A;  1FLI A;  1SFX A;  3KFW X;  1XN7 A;  4RS8 A;  2DQR A;  1SMY F;  5EEG A;  3F3X A;  4Q4Z F;  4RB3 C;  2GZW A;  4HX4 A;  1U78 A;  5CJ9 A;  1FBS A;  3T8R A;  1HXD A;  2OQG A;  5K5Q A;  1IN5 A;  2NYX A;  3RPQ A;  3JAM Z;  2QBY B;  3Q9V A;  3KEO A;  4U7B A;  3SXY A;  3GUD A;  3QU3 A;  3LAP A;  1KU2 A;  2HKX A;  2VBY A;  3N97 A;  2PN6 A;  2OZU A;  4M9S A;  4I09 A;  2PI0 A;  2MH2 A;  1B1B A;  1FWZ A;  5DYM A;  1D3Y A;  2F5D A;  3WTW C;  3CJN A;  3HSF A;  3HTS B;  4LMY A;  2V6C A;  1MZB A;  2HKO A;  2EA4 A;  5CVR A;  4A5N A;  4I2O A;  2HTJ A;  4LFU A;  2FRH A;  3QU6 A;  2G9W A;  1ON1 A;  5JHU A;  2XAQ A;  3K69 A;  3GFJ A;  1SFU A;  4IF4 A;  1TLH B;  3ECH A;  1B6A A;  2FBI A;  4AIK A;  1Z9C A;  3WTX C;  2Q0O A;  2IPQ X;  1S29 A;  4MEY F;  1SD4 A;  4Q47 A;  1IN8 A;  3IL2 A;  4BHC A;  4LD5 A;  5LGT A;  1KYZ A;  1XDU A;  2H09 A;  1Z05 A;  3WE2 A;  3IKT A;  4MTD A;  3I54 A;  3P9C A;  1S6L A;  1W7P B;  4ENK A;  3JTG A;  4U0W A;  4LK1 F;  2LF7 A;  2EFQ A;  2NS0 A;  1Z6T A;  2ZKZ A;  2FE3 A;  3WG9 A;  1BC7 C;  1JHF A;  1QZZ A;  1BI1 A;  4MTE A;  2XKP A;  3K0L A;  1BN5 A;  2HQN A;  5E1X A;  3KCC A;  2XRN A;  4A0X A;  3E6M A;  4KT5 C;  1GXP A;  4HF2 A;  1IXR C;  5KVR A;  1PP7 U;  3CO6 C;  2HEO A;  3TDZ C;  3M8E A;  6PAX A;  2GQQ A;  3RYR A;  4KUM A;  2MD5 A;  4GYI A;  1YW9 A;  4GXO A;  1WQ2 A;  3ABT A;  4KMF A;  1YFH A;  4ENM A;  1QBJ A;  1U5T C;  4CO8 A;  2MLK A;  3DPL C;  1ZG1 A;  4UUV A;  3D5L A;  2VT3 A;  2D45 A;  4AIJ A;  4OOI A;  2KIM A;  1R7J A;  5KK1 A;  3K1M A;  5JVT A;  1P6R A;  1RI7 A;  3E6B A;  1TW2 A;  5FLX Z;  3ZMV A;  3HUG A;  2L02 A;  3CUQ C;  4DQ2 A;  5D5U B;  1EV7 A;  4CYD A;  3QP6 A;  3L09 A;  5LHI A;  4GCV A;  2OU2 A;  1F9N A;  2OA4 A;  5DDG A;  1OKR A;  3WTY C;  3RTR A;  2KIU A;  2RV8 A;  2IA2 A;  1QZY A;  2Q8K A;  2Z9O A;  4GGG A;  4P9F A;  4EJW A;  1RZ4 A;  2FF4 A;  3FHZ A;  4BAY A;  3E97 A;  1S3J A;  1SD5 A;  1G3Y A;  3WGH A;  2CGP A;  3R60 A;  3GFL A;  2R7F A;  3F23 A;  4Y13 A;  2A69 F;  4FT8 A;  5LGU A;  3TOA A;  1MD0 A;  3LQQ A;  4HBL A;  5JR3 A;  5F1R A;  4M74 A;  1KQ0 A;  2QBY A;  3CTA A;  5DEQ A;  2W84 A;  2H6B A;  5D4S A;  3DXJ F;  1QQI A;  2ADU A;  1D8J A;  2HR3 A;  1OYI A;  4HQE A;  1LJ9 A;  3O2P E;  1MJ9 A;  1IW7 F;  4F7Z A;  2F5C A;  4EGZ A;  1T0F A;  2KKO A;  2V1U A;  1KU7 A;  1AOY A;  2ISY A;  5DV5 A;  4M6Y A;  1U8R A;  1MKM A;  4HOB A;  1O7F A;  3T0Y A;  3LA7 A;  4AVP A;  3J81 Z;  4K2E A;  4WXD A;  2FML A;  2HWV A;  2ZJ2 A;  3ZMU A;  3CUO A;  4EJU A;  3HHH A;  4Q48 A;  4JBA A;  3FWE A;  5CVI A;  2ZFW A;  5D8L B;  3JSP A;  4KN7 X;  4EM0 B;  2O6G E;  2OD5 A;  2L3D A;  2VN2 A;  3RDI A;  4ETS A;  2MA3 A;  5D6F A;  2PLY A;  2RN7 A;  4OU0 A;  2R7D A;  4N0B A;  4YFX F;  2XAH A;  4JK1 X;  1AWC A;  2ZCW A;  1T2K A;  2FEZ A;  4IHS A;  3T1B A;  4ZYH A;  3VOE A;  5ICE A;  2PBI A;  2JTV A;  1X3U A;  2ESN A;  2QEN A;  3KP2 A;  5AIQ A;  2VBX A;  4IRI A;  5L3C A;  1K6O A;  2FQ3 A;  2RQP A;  1W7P A;  2DI3 A;  2RNJ A;  1LEA A;  2MLG A;  3TOB A;  1OYY A;  3ELK A;  2BV6 A;  2JT1 A;  4OIO F;  2K4B A;  3EYY A;  1H0M A;  1LQ1 A;  1JHH A;  1BBY A;  1KQ8 A;  2GA1 A;  3WTS C;  3RKY A;  1XD7 A;  3BY6 A;  1KU3 A;  1R00 A;  1P4A A;  1UST A;  2PQ8 A;  4LK0 F;  4RGS A;  5HDG A;  1VTN C;  4ENJ A;  3KP4 A;  2ELH A;  3R0A A;  3JAM K;  1B9N A;  1G3T A;  1IUY A;  3GEZ A;  3V7S A;  1LVA A;  2V9V A;  3F22 A;  1J9I A;  3AAF A;  3GVA A;  2IRF G;  2M1B A;  1I1G A;  2VXZ A;  1W5S A;  1EH7 A;  1U6G A;  1FYL A;  2XIG A;  3WE3 A;  1B4A A;  3KP3 A;  2BE5 F;  1F5T A;  5ILU A;  1I6X A;  4HLX A;  4LJZ F;  4BHP A;  2J5O A;  2X0L A;  3ECO A;  1YW7 A;  4L9J A;  2QQA A;  4A6D A;  1T39 A;  1FSE A;  4YIF A;  5L3D A;  4A12 A;  5HOO A;  5E1Z B;  1LDJ A;  3I0T A;  5CVV A;  3F8F A;  3LST A;  4ZYD A;  4LB6 B;  3SHF A;  1BOA A;  1LDK B;  3BPX A;  4G7O F;  2EFW A;  2CSO A;  2ZNY A;  1IXS B;  4N9I A;  4B8X A;  2F5F A;  5FD5 A;  2DQL A;  3E5U A;  2XV4 S;  2VON A;  2MBF A;  1K7A A;  4LLG F;  5F6F A;  2A68 F;  1FYK A;  1JGS A;  3I58 A;  1C0W A;  5CVJ A;  3ZMD A;  2QYO A;  3W6J B;  2PJP A;  3WU1 B;  3LA3 A;  5K5R A;  1J7K A;  3QOP A;  2BGC A;  2EWN A;  4MEX F;  3QAH A;  2JZY A;  3I53 A;  2FMY A;  3V8J A;  5DUI A;  3TGN A;  3DV8 A;  3BJA A;  1J2X A;  1FPQ A;  1ZN2 A;  2DK8 A;  1D5V A;  4L0Y B;  1YTY A;  2KIF A;  2XHK A;  1EH6 A;  1Y0U A;  3M9A A;  3SFZ A;  4Z2Y A;  1XCB A;  4WX9 A;  4KNY A;  2V1X A;  1K78 B;  2ZNZ A;  1BI2 A;  4IHT A;  2P5L C;  2L4M A;  5ERI A;  3K1P A;  1ZG5 A;  2AS5 F;  4XSX F;  1R36 A;  2L4A A;  2Y0M A;  3JSO A;  5F64 A;  4IVN A;  3VEP A;  3RPU A;  3L00 A;  1UHM A;  2QUF A;  2V1D A;  2M45 A;  4RB2 C;  3O3K A;  1WRJ A;  3F6V A;  2HYF A;  4H0E A;  5FLX K;  4LLN A;  3WTV C;  1TBX A;  3BPV A;  5ILV A;  4I02 A;  3MFK A;  5D5W B;  4EJV A;  2A07 F; 
#chains in the Genus database with same CATH topology
 3I4N J;  1UJ8 A;  4BBR J;  1FSH A;  2DAO A;  1W36 C;  2R3S A;  1GVJ A;  2GLO A;  3V8L A;  2R7O A;  2AHQ A;  4AU7 A;  3DPT A;  3OWT A;  3PIP F;  2JSC A;  2IS2 A;  4EVI A;  3PO2 J;  2E5Z A;  5C44 J;  3ZCO A;  4XRM A;  3IRR A;  1NG7 A;  1IN4 A;  2HFH A;  5E8I A;  2O8X A;  4NUB A;  3W2V A;  3OYK A;  1DPR A;  1TNT A;  4CZC A;  1I39 A;  3A2K A;  3I64 A;  1N78 A;  3B73 A;  2P8T A;  2CMP A;  1IRX A;  1OCC H;  3BTJ A;  3G3Z A;  4KFC A;  2D1H A;  1A04 A;  2HQ5 A;  1IN6 A;  3HPH A;  3PM1 A;  4KIG A;  1U0J A;  5FB2 A;  1T98 A;  3CC4 I;  4ON0 A;  3HEF A;  3E3V A;  2F4I A;  3TL4 X;  2RDP A;  2V7F A;  1BR1 A;  2EA2 A;  4IPA A;  5HVQ C;  2O5R A;  1J09 A;  2QWW A;  3QPH A;  3ZQG A;  3G73 A;  3HSE A;  1H9T A;  2LY2 A;  4MIM A;  3FMQ A;  4BJ5 C;  1ETV A;  2DT5 A;  2GXG A;  1RKT A;  3BQZ A;  3GZN B;  4UVC A;  5L3E A;  4BYY A;  3S93 A;  2A6E F;  4B44 A;  1B8I A;  1MBG A;  1YS6 A;  2YPR A;  4RB1 A;  4GO1 A;  4KMU X;  4IOA F;  4F91 B;  4A3K J;  5DUK A;  3HHG A;  2DK5 A;  5JVG F;  2YR2 A;  3M1E A;  3DFG A;  4B47 A;  2JJ7 A;  4XKW A;  1VQ5 I;  1FOK A;  3FMR A;  3F9K A;  2QVO A;  3HRM A;  4KIB A;  3BLY A;  4G7H F;  2EZI A;  3OL3 A;  4BXX J;  4H4K C;  1WGX A;  2R7U A;  3W2W A;  2VKH A;  2Q2E B;  2DBB A;  3P7N A;  2PMH A;  1EH8 A;  1S9H A;  3BTI A;  2WWY A;  3J81 K;  3M1C A;  5C3E J;  2K3P A;  1R1U A;  3JRH A;  2GOX B;  4M3E A;  1CF7 B;  1WJD A;  2B0L A;  1FNN A;  2DMU A;  5FGM A;  2XAG A;  1MIJ A;  4CSW A;  1FZP B;  1X3Z B;  4A0Y A;  1AHD P;  5BPD A;  5FRM A;  1R22 A;  2MW8 A;  4OIP F;  1QVT A;  3MZ8 A;  5ICF A;  4QIW N;  4BNC A;  3WTZ A;  2M4K A;  3QPS A;  5E20 A;  1PUF B;  3AFH A;  4G9Y A;  3CCE I;  4QSH A;  2LDU A;  5HLH A;  3TDU C;  3JRD A;  2QKL B;  1OR7 A;  3H3V K;  3Q0W A;  3S14 J;  3HRU A;  3KP7 A;  1HW2 A;  5J8F A;  5F0F A;  3BJ6 A;  2FOK A;  2XAJ A;  2JQ7 A;  3Q3S A;  3VSK A;  4NC8 A;  1HST A;  5TJJ A;  2JUG A;  1P92 A;  2E2I J;  1LFU P;  3QP5 A;  2R92 J;  3P5J A;  3QOE A;  3QYB A;  2WV0 A;  2JVG A;  1JKP C;  2DW4 A;  3IAS 2;  3MCZ A;  2F48 A;  3BTC A;  3CDH A;  2AXL A;  2FU4 A;  4HST A;  4M6X A;  4CCK A;  2DJN A;  1NH3 A;  1XSD A;  1JE8 A;  4I6Z A;  2XGE A;  5IT9 Z;  5H2F C;  4UB8 C;  3TO7 A;  5FFX A;  2ZJR F;  5GPC A;  3I4M J;  2FX0 A;  1RR7 A;  2E1N A;  2EFO A;  1VQK I;  1ETX A;  1B9M A;  1K4S A;  3BZC A;  1XB4 A;  2F5E A;  2WC2 A;  3CUQ B;  3E5Q A;  1TWA J;  4A5M A;  1R23 A;  2VE8 A;  1O3Q A;  3K10 A;  2PX9 A;  4M71 A;  1MBE A;  2E35 A;  1ZHF A;  1MDM B;  4Y3O A;  1W4M A;  3W2A A;  1YIO A;  1IRZ A;  5KAI C;  2K4J A;  3ZN0 A;  5J1R A;  3C7J A;  4M3B A;  4AD9 A;  3SEZ A;  4RAZ A;  2HI3 A;  3GXO A;  3HKZ N;  4U0V A;  4YEJ A;  2PEX A;  5E3O A;  2VPL A;  4U7D A;  2XF5 A;  3D1N I;  5DTD A;  4BE0 A;  1RIO H;  4WCG A;  4D9J A;  4L5E A;  1K78 A;  3GTG J;  2COM A;  2PFB A;  1L3L A;  4BU2 A;  2GIV A;  2M8E A;  3HTU A;  2FNA A;  2DLL A;  2PMZ N;  1N77 A;  2GXA A;  2FNP A;  1PDN C;  3BP8 A;  2ZO4 A;  3ROU A;  3VWB A;  1D0X A;  1GV2 A;  3ULQ B;  1VZ0 A;  3CO7 C;  1J0R A;  1TWC J;  3IP4 B;  1R1V A;  3OR2 C;  5DD8 A;  3S1R J;  3LOC A;  3F8M A;  4F3Q A;  5HNH A;  1V5F A;  1X1P A;  1BIA A;  1ZLJ A;  4HQM A;  5AON A;  5H20 A;  4IZZ A;  1FIP A;  3H3Z A;  3F8C A;  1HW1 A;  4ESJ A;  2VL8 A;  2CV0 A;  2W4S A;  5F0C A;  2TCT A;  3CJQ B;  2P4W A;  3KEY A;  3BR2 A;  1ETY A;  2VKD A;  1N75 A;  5FO5 A;  4D0P A;  4CXF A;  4HDU A;  2G7U A;  4GYG A;  1YJW I;  3ZPL A;  3WOD F;  3LWF A;  4XKC A;  3A01 A;  5IP9 J;  4N4O B;  3R4K A;  1HCR A;  4KIF A;  4C2T A;  3A0B C;  4XL9 A;  4BXU A;  3SZP A;  1XMA A;  1I27 A;  2HZT A;  1D5Y A;  4XLE A;  3ZN1 A;  3GFM A;  1M1E B;  2EIK H;  3ZQH A;  5LEJ A;  1ZQ3 P;  5JLW A;  3CDL A;  1U3E M;  3C2H A;  3J7A O;  2F4M B;  5J4V A;  2HPM A;  4E6K G;  3JTH A;  1ONV A;  1T6S A;  3AL0 C;  4EGY A;  2CUF A;  3L7W A;  2KJB A;  1AKH A;  1D1A A;  4A3L J;  1NK2 P;  4XLP F;  2DDA A;  3OIP A;  1RPW A;  1G3S A;  5HDN A;  1MMG A;  4BE1 A;  3RZO J;  3JRB A;  1G59 A;  2ZJQ F;  2HOE A;  2Y0S A;  3S8P A;  1KGS A;  4AWX B;  4NHJ A;  5HS9 A;  3DF8 A;  2R5Z B;  2STW A;  4L18 B;  4HF0 A;  3I5U A;  3OOU A;  3SZT A;  4II3 A;  1WJ5 A;  3GLL A;  2YSR A;  3M8F A;  4BUP A;  3I4P A;  1R6R A;  2DOA A;  2W57 A;  5IYB J;  3J80 Z;  3H9G A;  2FBH A;  3HDD A;  4PJM A;  1YI2 I;  2K9M A;  1YO5 C;  2CJJ A;  2CQX A;  4A93 J;  2EFN A;  1HW5 A;  3J7A Y;  1MBJ A;  3MZY A;  1NHA A;  5IT3 A;  1V4R A;  1JGG A;  1YS7 A;  2QM3 A;  1X1C A;  2GM4 A;  3TW7 A;  4B43 A;  4KA4 A;  2DA1 A;  2LFB A;  2H27 A;  4E7L A;  3Q5F A;  3CCV I;  3FBI B;  3DTI A;  1RRJ A;  2K27 A;  2H1K A;  2O3F A;  2P7C B;  2NVT J;  5K5O A;  4EM2 A;  2VOO A;  2A6T A;  2E60 A;  4DYR A;  1S7O A;  1LNW A;  2Y2Z A;  4A0Z A;  1OCP A;  2XDV A;  3V7R A;  4XBF A;  1ZYR F;  1V54 H;  2OJE D;  3PL8 A;  4BQA A;  2VAS A;  1ZAO A;  1Z1D A;  2VBZ A;  2NS8 A;  3HOW J;  4CGZ A;  2HYJ A;  3WHB A;  3WGI A;  1GHC A;  2QCO A;  1F43 A;  5BPI A;  4WXC A;  3MKY B;  2EB7 A;  3LNQ A;  4ZTJ A;  1ETQ A;  3EPZ A;  2M30 A;  4RMN A;  1WPK A;  1LUJ B;  3K4L A;  4LB5 A;  1G4D A;  4G8X A;  1D1B A;  1ORK A;  4IQJ A;  1WKM A;  1MNM C;  4WK8 F;  2FUG 2;  2Q2E A;  2X6Y A;  3UKG A;  4LIU A;  4IL6 C;  2OV7 A;  4MGR A;  2DPD A;  1L0O C;  2VQC A;  1CF7 A;  2ZFU A;  2AO9 A;  3H92 A;  1BJA A;  4V2F A;  3E7L A;  4X6A J;  3DBL B;  2R7S A;  4HA8 A;  2RGV A;  4G6Q A;  1ZK8 A;  1RES A;  1H8A C;  1LE8 B;  2KJC A;  2JUC A;  2VB6 A;  3ZQL A;  4E7S A;  1BI0 A;  2ZME A;  1QGP A;  2LK2 A;  4PSX A;  1YOV B;  2RNG A;  3ABU A;  2YX7 A;  1Z21 A;  3U2R A;  1XGM A;  2RRE A;  1PUF A;  2LNB A;  4ZH4 F;  1UHW A;  1UG0 A;  4PCQ A;  4PJ0 C;  2DA5 A;  3HB9 A;  1PVE A;  2Y48 A;  1PYV A;  1WFX A;  1XSV A;  5J8C A;  5J3L A;  5EEH A;  4HRI A;  1YX5 A;  3GW2 A;  5HLI A;  1R5I D;  1TWG J;  3S2D J;  2IGM A;  2DYS H;  3EUH A;  5H6R A;  5GAE J;  3TW6 A;  1R58 A;  3HBL A;  4HF1 A;  3FXL A;  4M9X A;  4HZF A;  4DW6 A;  2GXB A;  3I71 A;  5FLM J;  5D6E A;  2DFE A;  1HDP A;  1S72 I;  3L1P A;  1BC8 C;  5D5V B;  2A5Y B;  2DMP A;  2LKP A;  2RC4 A;  3S15 J;  4IHY A;  4LOC A;  3HM5 A;  2R7V A;  1UB9 A;  2M7B A;  2EZK A;  3JCU C;  2DO7 A;  2VPR A;  5LLQ A;  1O3S A;  1QNT A;  2BY2 A;  3M8J A;  4F93 B;  3MAJ A;  1YIT I;  2XGX A;  2V26 A;  3D0S A;  2JA5 J;  4RAF A;  3LAJ A;  3V4G A;  1O7L A;  4YII A;  3C2G A;  1XPX A;  3GO5 A;  4WWC A;  2VLA A;  1W36 D;  4QPQ A;  5J6X A;  4XOT A;  2DOE A;  5HLT A;  2C6Y A;  2A05 A;  1TT5 B;  2K40 A;  1DGR M;  3LQR A;  3CUQ A;  2FQ4 A;  3G6E I;  1ZLK A;  3K9T A;  2E71 A;  2K9L A;  2VQG A;  2BYV E;  3S17 J;  4FTH A;  3FX3 A;  3OYB A;  2RAE A;  4ESB A;  1Y8Q B;  2HOA A;  1MDM A;  2V79 A;  1LB2 A;  3BWG A;  3HRT A;  1XSX A;  4FX0 A;  2R7Q A;  2VKV A;  4I0B A;  3G1L A;  3IH2 A;  5CQE A;  1QA6 A;  3JR9 A;  2BXY A;  3HOX J;  2V4J C;  3ISP A;  4BY1 J;  1UFM A;  3KYD B;  4C3I J;  2CYY A;  4L5J A;  5BQT A;  1KON A;  2RKH A;  4N9H A;  2VOD A;  2IVM A;  3H5R A;  5DS9 A;  4GRI A;  2MC3 A;  4D7N A;  3GME A;  1R1T A;  2VJ4 A;  3H0G J;  3KZY A;  1PUE E;  2ELJ A;  3FK7 A;  4HLY A;  3H3U A;  5B1A H;  2VC0 A;  3SQN A;  1MMD A;  4RB0 A;  2JA7 J;  3MWM A;  3ZMZ A;  4OMZ A;  2EFP A;  3GCM A;  3VYR B;  1SFO J;  2VC1 A;  2CH0 A;  5A2Q Z;  4ANJ A;  2XVC A;  4S04 A;  1MMN A;  3K4M A;  3H36 A;  3VB2 A;  3GFI A;  2D1V A;  2DOF A;  1ZGA A;  4QWQ A;  2D5V A;  1FBQ A;  3W6K B;  5BMZ A;  4UVA A;  2E19 A;  1R4M B;  3WGG A;  5LEK A;  3BT9 A;  2NVX J;  2XAF A;  4RBO A;  4L0Z B;  3IRQ A;  3BDD A;  4U88 A;  2FBK A;  3ZMS A;  3RZD J;  4OIN F;  1ZH5 A;  1HA8 A;  3KP6 A;  4HPQ A;  2GWR A;  3DCF A;  3NQO A;  4GDF A;  1FC3 A;  1FMV A;  4XLN F;  1V5G A;  3PNT A;  5LD2 C;  5TRD A;  1YG2 A;  2JPB A;  2MAB A;  4TV7 A;  5B1B H;  4BY7 J;  2NNN A;  4LG3 A;  1Z77 A;  3ZQF A;  2O7O A;  5EG0 B;  1KYW A;  1Z3Y A;  2PG4 A;  4FAS D;  4P9U A;  3C3W A;  4XOR A;  3PNV A;  4J00 A;  4MNU A;  3L2R A;  2JSP A;  1S7E A;  1X4P A;  3T5X A;  2KFD A;  4EQQ A;  2RQQ A;  3I55 I;  1T08 B;  1GDT A;  2PJR B;  2QSF X;  2ZXH A;  2IBD A;  3RYP A;  3CCL I;  1FTZ A;  4CCM A;  3RKQ A;  1SFE A;  2JVH A;  4XRS G;  3I59 B;  4IXA A;  2I10 A;  3M07 A;  3E5X A;  3OR1 C;  4PFO A;  3K4B A;  1DPU A;  4CCO A;  1MH4 A;  3L2W A;  5F27 A;  3LSP A;  5FJ8 J;  3GTP J;  3H9J A;  1MBK A;  2JRM A;  2K02 A;  4P55 A;  5CVU A;  3GLX A;  3OOP A;  5DD4 A;  2R5Z A;  1LEB A;  4Y17 A;  1HQC A;  2EQR A;  5JFR A;  2ZXJ A;  4KYW A;  4UHT A;  4RAY A;  1PP8 F;  4LLL A;  5GAH J;  4CHU A;  2XPV A;  2IS6 A;  1VQ6 I;  4ZYA A;  4M6V A;  4XLC A;  1RUN A;  1K83 J;  2KRH A;  4PGH A;  4E4H A;  3KP5 A;  2YU3 A;  1Z7U A;  3IUO A;  2A6H F;  3K6G A;  1EA3 A;  3EYI A;  2YX4 A;  1QHH D;  2AXT C;  3IWZ A;  3HOZ J;  4S05 A;  1OCT C;  1X58 A;  2KHM A;  1RC9 A;  4WF2 A;  1UMQ A;  2VBW A;  4IOC F;  4NQW B;  2M4G A;  4RGR A;  3F6O A;  2JK3 A;  5GTH C;  1T33 A;  4A2U A;  2CFX A;  2LKX A;  5IT9 K;  3K4J A;  3FXJ A;  3JRI A;  2ZJP F;  4XRF A;  5M3F J;  3LSH A;  3HKZ A;  3AG1 H;  2QQ9 A;  4CYC B;  2EIL H;  2HVS A;  5HOD A;  2E1C A;  2K9N A;  3FF5 A;  4BXF A;  2E5N A;  2EIM H;  2OZ6 A;  2WA0 A;  2CO5 A;  2VQL A;  1Y6I A;  1XG1 A;  1Q1H A;  1T0F C;  2UXX A;  3EDP A;  4Y7N J;  1SMT A;  2G0E A;  2PMZ A;  3ZQ7 A;  4OAY A;  1P2F A;  4E7I A;  4U0Y A;  3UNG C;  4XR6 A;  3R61 A;  1XGN A;  3LMM A;  5CQG A;  3S2W A;  4B3A A;  5M3M J;  1O3R A;  2Z1D A;  2HXI A;  4O6J A;  5LRR A;  3CCS I;  1PJR A;  2GAU A;  3OS0 A;  2E7X A;  1IUF A;  3BRO A;  4A3E J;  3NWT A;  4BHB A;  2EZH A;  4AYB A;  1W5T A;  2LF8 A;  1JJ6 C;  3OL4 A;  3SEQ A;  2LRD A;  1ZR2 A;  4UXN A;  4CZZ A;  3OYF A;  5GAD J;  1RKW A;  1LE8 A;  4NC6 A;  2DU9 A;  1FX7 A;  1X1A A;  1OCZ H;  3AG4 H;  3D5R C;  3Q9S A;  2J5P A;  1OFC X;  4KN4 X;  2KZG A;  4MFE A;  4PGG A;  3OIO A;  4M9Z A;  4MO7 A;  3O8H A;  3GX4 X;  1ZRC A;  3M7G A;  1JTY A;  5J1U A;  2YU9 J;  3BQY A;  1A5J A;  3FZV A;  2Z3Y A;  1ZAR A;  4EEF G;  2HDD A;  1LVK A;  1ZGJ A;  5HDK A;  2KL4 A;  2WY8 Q;  3VSL A;  3QRF F;  4O5V A;  1P7J A;  2VKE A;  5ICG A;  2W82 A;  2H94 A;  4ZZL A;  1Y0N A;  3OS1 A;  3OYJ A;  3CZ6 A;  3MMY B;  1IF1 A;  3BZ6 A;  1UAA A;  2VUM J;  2UUZ A;  1WCM J;  2EIJ H;  3CMA I;  4IRG A;  3K1N A;  2E7W A;  5KAF C;  3ZP5 A;  1TTY A;  1S8N A;  1TQI A;  5IOZ A;  2XAU A;  4RGX A;  2A3S A;  1BR2 A;  1YIJ I;  3TO6 A;  1K4T A;  1K79 A;  5D8K B;  1OMI A;  3K7A J;  5J40 A;  4A3F J;  3DU6 A;  1O3T A;  4ZC3 A;  3A1Y A;  2NAZ A;  2X9D A;  4OIQ F;  4XQF A;  1GLN A;  3CCJ I;  1F36 A;  1FEX A;  1P4W A;  4DOZ A;  4ENN A;  1HC8 A;  2X48 A;  4F92 B;  3DPU A;  3SDG A;  4IQ4 A;  1BW5 A;  2BBY A;  3V7C A;  4CH7 A;  4XRS A;  1RNL A;  1XCV A;  2CQQ A;  2O8K A;  4N4N B;  3ZR8 X;  3OS2 A;  1EKE A;  4Y4R A;  3TMO A;  1MGT A;  3U9G A;  1X1D A;  2R7W A;  4XSZ F;  1TT0 A;  3Q0V A;  2GA2 A;  4BQO A;  3N05 A;  1IAW A;  4L9N A;  2LBF B;  5KNL A;  4Y15 A;  2ZME B;  1ITY A;  3SDB A;  5ILS A;  4I98 B;  1OIS A;  1ZRD A;  2P81 A;  2XF6 A;  3DEW A;  3TO9 A;  3L2U A;  1TL8 A;  2HTS A;  3J80 K;  1ON2 A;  3LA2 A;  3CF5 F;  4X0G A;  3VYU B;  4LIT A;  4KIC A;  2JMW A;  5AIP A;  2JRT A;  3EQL F;  2TRT A;  2H8R A;  3OYC A;  2HQR A;  4OIR F;  1OJL A;  5K1Y A;  4A69 C;  1ZRF A;  5H6Q A;  4ASN A;  3FBN B;  1Z7L A;  2JN6 A;  3A0H C;  2HGC A;  1TQP A;  1STZ A;  1MBH A;  1QPM A;  4XIC A;  4HW0 A;  3IHU A;  1QPI A;  1U5T B;  1UHS A;  4UV8 A;  2O03 A;  3OYG A;  3MKW B;  4P5O A;  4QTR A;  1HKQ A;  1F4K A;  1DP7 P;  1OPC A;  1R5G A;  3F8N A;  2WAQ N;  4R8H A;  3S32 A;  2HS5 A;  1YRN B;  1RR8 C;  4BEH B;  2VE9 A;  2CS3 A;  2X4H A;  3CP8 A;  2ESH A;  3H9Q A;  2CG4 A;  1XMK A;  3BC8 A;  4ESF A;  1W0U A;  4YFK F;  3FXK A;  4EJO A;  1K6Y A;  4HDV A;  1XTA A;  4R1H A;  1Y1W J;  2GIZ A;  3H5A A;  5EG0 A;  4A6E A;  5LRS A;  2O61 A;  1WVR A;  3IKV A;  3PFY A;  4KDP A;  3QPT A;  2N8G A;  3VYT B;  3BJO A;  2LLK A;  3NRV A;  2W24 A;  2Y31 A;  2K7L A;  4XLA A;  2PJR A;  3CMM A;  2BEO A;  2E2H J;  2H6C A;  3LSR A;  3S16 J;  3ZXS A;  3CME I;  4EMS A;  1IGN A;  3GZ5 A;  3NEU A;  4L5I A;  3I59 A;  3E0J B;  3OMY A;  1FY7 A;  3E6D A;  1JXS A;  2DPU A;  2NS7 A;  2M34 A;  4ZYE A;  2O0Y A;  1U2W A;  1YYV A;  3TP0 A;  5J1Y A;  1Y1V J;  2NXN B;  4HNT A;  3L2C A;  3S1Q J;  1F1Z A;  1FP2 A;  2QZ8 A;  1IN7 A;  4I01 A;  1USS A;  3REO A;  3CC7 I;  4L9V A;  4OMY A;  4ZZD A;  5IP6 A;  2LOO A;  3DKX A;  4DYQ A;  3R6S A;  5E3N A;  3H35 A;  5HNF A;  3F8B A;  1ENH A;  3P9I A;  2QSH X;  2QKM B;  1KU9 A;  1YHQ I;  3S3O A;  5BOX A;  1YQA A;  2M5W A;  1H9G A;  2V1N A;  4C3H J;  4F52 A;  1MMA A;  3AG3 H;  4AYB N;  5IPA A;  5EZH A;  2Z33 A;  1LDD A;  3MEX A;  5B66 C;  1CGP A;  2UZK A;  4FE4 A;  4O3M A;  1WI9 A;  2BHY A;  3RKW A;  5D5X B;  1Q1V A;  4LG0 B;  3ML6 A;  1FT9 A;  3OV8 A;  4NQW A;  5FKM A;  1WJB A;  5L3F A;  4W1U A;  1BM9 A;  4C30 A;  3E1S A;  3JW4 A;  4UVB A;  3IC7 A;  1R5H A;  1TNS A;  3BR5 A;  3F72 A;  2W85 A;  4CYC A;  1IRG A;  1RUO A;  4PUS A;  2OUM A;  1ACI A;  1CQT A;  1MJA A;  2W00 A;  4MHG A;  1Z0X A;  2XGD A;  1DP3 A;  2LVS A;  2B9S A;  4CCJ A;  3JRC A;  2K5C A;  3LSG A;  1VQ9 I;  2STT A;  2WTE A;  2XKO A;  2ISZ A;  5B3S H;  3FIS A;  3K4C A;  1E3O C;  2IA0 A;  2HQA A;  1G3W A;  3ASO H;  3BR0 A;  3OYD A;  4HX7 A;  5DCM B;  4AIH A;  1REP C;  1FTT A;  2EV6 A;  4RM3 A;  1B72 B;  2HOT A;  2X1D A;  2M9H A;  3KE2 A;  1ZRE A;  2WB1 N;  1TW3 A;  4QPO A;  3GTM J;  4BS9 A;  4UV9 A;  2L5Q A;  1ULY A;  2QA4 I;  2E1M C;  5FKL A;  1A31 A;  4C2M J;  3KEQ A;  1FYM A;  1UEL B;  4UNO A;  2L01 A;  1XGO A;  4YFN F;  2DA7 A;  1Z91 A;  4JQF A;  2HDC A;  3FM3 A;  1IZ1 A;  1OQY A;  2HDW A;  3DKW A;  2DJI A;  4YG2 F;  1N25 A;  4ABZ A;  1VI0 A;  5A2Q K;  2M87 A;  4MFD A;  3EUK L;  2OCE A;  2EV0 A;  3RIR A;  3RJP A;  2MH9 A;  3TP3 A;  5LBQ A;  1I1S A;  3CCR I;  5E17 F;  2QGU A;  4DNC A;  1OYW A;  2VOP A;  2X1E A;  3R0J A;  1TWH J;  1YE9 A;  2XUB A;  1I50 J;  4M72 A;  3HIF A;  1VQL I;  3G1O A;  2Z99 A;  5DCF A;  5KCM A;  3RI4 A;  2ZXW H;  3FXQ A;  2OQR A;  2IAI A;  2UWM A;  1QRY A;  4FET A;  3CD6 I;  2ACJ A;  2NVU B;  5FRO A;  3C18 A;  2MC4 A;  5FFZ A;  1OCR H;  2MYS A;  1G6N A;  5BNG A;  4KIS A;  1T56 A;  3QPL A;  2OAZ A;  1IG7 A;  1HSJ A;  4V2G A;  2KLO A;  4XNF A;  3TQN A;  1XC5 A;  2UXN A;  2X6W A;  2G7H A;  4I0A A;  3U1D A;  3CLQ A;  3BG5 A;  4HV6 A;  5CKT A;  2L9V A;  2P6T A;  5E1W A;  3LFK A;  5CLS A;  4MLO A;  2DMQ A;  1B59 A;  5JI6 A;  3HL2 A;  1WWX A;  1IXC A;  3GTO J;  2P6S A;  5L3G A;  3ESW B;  2ICW G;  4DYC A;  1DDN A;  4I7H A;  2NNY A;  2NOJ B;  5FD6 A;  3PFI A;  5E3M A;  1SD7 A;  1BIB A;  2ETH A;  2P7V B;  3I3L A;  1ZG3 A;  2CWE A;  2AQF A;  3FMS A;  2LBF A;  3T8T A;  1IV8 A;  1XGS A;  3DQV C;  3QOD A;  4BL0 B;  2RVC A;  3EET A;  4XN0 A;  4BGD A;  3LSM A;  1P4X A;  1TQM A;  4M3D A;  1O57 A;  2A61 A;  2GOM A;  1T38 A;  1D8K A;  4NNJ A;  3FDY A;  5F08 A;  5LHG A;  1J5Y A;  3FXU A;  1YW8 A;  2XRO A;  1KA8 A;  2K9Q A;  1SD6 A;  1Z3X A;  2FA5 A;  3IWF A;  2HYG D;  3OYA A;  2FXA A;  3HOS A;  5F04 A;  2IP2 A;  1JT6 A;  3KLO A;  2P5K A;  3I9V 2;  2IW5 A;  3QWL A;  2F2E A;  3JRF A;  3FXR A;  3GF2 A;  4G7Z F;  4XK4 A;  5CYV A;  1SVL A;  3WTT C;  2IT0 A;  1V3F A;  1GV5 A;  3K70 D;  1OCO H;  1FP1 D;  1UCR A;  1E3H A;  1MJB A;  5LHH A;  4LGW A;  3PQK A;  3RKX A;  2JPC A;  3HSR A;  5TGT A;  3KZZ A;  1QO0 D;  3GWZ A;  1ODD A;  2CFO A;  2X6O A;  4HV5 A;  4M73 A;  3DEU A;  4PDK A;  2QLZ A;  4CDG A;  1FJL A;  3OYE A;  1X4O A;  3D5S C;  1U5T A;  3FK6 A;  3PQJ A;  5LGN A;  4G94 A;  4RLF A;  2DA4 A;  4DGW B;  4E70 A;  1SAX A;  1HKS A;  4WXH A;  2KIQ A;  1BI3 A;  1S7A A;  2P5V A;  3FKJ A;  2DTR A;  3O6B B;  1YRN A;  1XS9 A;  2LG4 A;  2L54 A;  2B63 J;  3ERE D;  4DZP A;  3KET A;  4BEH A;  3VOD A;  2CQK A;  1SAN A;  4J19 A;  1J75 A;  2DN0 A;  2BY0 A;  1SFK A;  4I76 A;  2KPM A;  2FSW A;  2JA6 J;  4ITV A;  4W97 A;  2KMU A;  3WU0 A;  3N4M A;  2TDX A;  3CLO A;  4BH9 A;  1X2M A;  2Y75 A;  4AUX A;  2KRC A;  4RGU A;  5HS7 A;  5HS8 A;  2BXZ A;  2KZV A;  2OBP A;  5HLG A;  1ZR4 A;  4FHT A;  3HPG A;  4JOM A;  4FX4 A;  1WSU A;  3MZH A;  2CW0 F;  3G2B A;  4ZYG A;  3F21 A;  1HF0 A;  2IA1 A;  3RQ4 A;  4L9T A;  1HOM A;  3BOQ A;  1HBX G;  3WTU C;  2K86 A;  3K2Z A;  3ABM H;  5E8G A;  1IRF A;  1XDS A;  4MQ9 F;  2EJR A;  3WG7 H;  4R79 A;  3J7Y J;  4CIC A;  2R0Q C;  4B09 A;  3HYI A;  2IGK A;  3CQZ J;  4Q5S F;  3CDI A;  2XAS A;  1U9N A;  3FM5 A;  2LR8 A;  2H8W A;  2EV5 A;  1E2X A;  2ZSH B;  3ZMT A;  2L0K A;  2OF7 A;  1MSF C;  5M5X J;  3TKY A;  1W1W E;  2QQB A;  3COA C;  4HAM A;  4QLC U;  2VQH A;  3HOT A;  1Z6R A;  4DJA A;  1A36 A;  1OR7 C;  4IJA A;  3CCM I;  1GXQ A;  1NTC A;  3CC2 I;  2EBI A;  2NRA C;  2X6X A;  4FIS A;  1HKT A;  4EM1 A;  3P9K A;  3SJM A;  1V55 H;  2D2W A;  2HVR A;  2DMN A;  3DP7 A;  5L3B A;  2HOS A;  1VQ4 I;  3HGG A;  2CV1 A;  3RCO A;  1MMS A;  1TWF J;  3DBH B;  2VT2 A;  2ZC2 A;  5BS6 A;  3IV5 A;  4A3B J;  4P96 A;  1E3P A;  5GP9 A;  3GZ6 A;  3GTQ J;  4NB5 A;  1W7P D;  4LG0 A;  4EJT A;  4DBQ A;  2KRF A;  5ED4 A;  1JKQ C;  3MQ0 A;  2ZBK A;  2EH3 A;  4PJL A;  3MVP A;  4G6D A;  4ZTF A;  1JKO C;  2HPI A;  2EK5 A;  1D0Z A;  3B02 A;  1WJA A;  4A3C J;  4PZJ A;  1W5C C;  1E17 A;  5E18 F;  1SVM A;  4RAG A;  3GYH X;  4MQV A;  3V8K A;  3E6C C;  2PMU A;  4I99 C;  1FBU A;  4IHV A;  3KLN A;  1DUX C;  3GTL J;  4AID A;  3HRS A;  2CU7 A;  4HX8 A;  3PUB A;  1J59 A;  3C1D A;  3VFZ A;  5ICC A;  1I5Z A;  5D4R A;  4IRH A;  5DCM A;  5EGO B;  2DFI A;  1B72 A;  3LFU A;  3M3Y J;  3W3C A;  1V5E A;  4EV0 A;  2IJL A;  2Z5U A;  1VQ8 I;  2LSO A;  2W25 A;  3BG3 A;  3L9F A;  1MSE C;  1MW7 A;  1YLF A;  4HYE A;  2Y30 A;  3SYT A;  1KQ9 A;  1FLI A;  1SFX A;  3KFW X;  1XN7 A;  4RS8 A;  2DQR A;  1SMY F;  1Y8R B;  4Y52 J;  1ERD A;  2WAQ A;  5EEG A;  4AM3 A;  1YX3 A;  3F3X A;  1Y39 A;  4Q4Z F;  4RB3 C;  2MSY A;  3ZQC A;  2ID3 A;  4HNV A;  2GZW A;  4PFP A;  2DT6 A;  2XF7 A;  1H89 C;  2XB0 X;  4HX4 A;  1SEU A;  4XM3 A;  2QSG X;  1U78 A;  3DBR B;  1QVU A;  5CJ9 A;  1FBS A;  4V19 K;  2KP6 A;  3T8R A;  3OYI A;  1IDZ A;  1HXD A;  3K4K A;  2OQG A;  5K5Q A;  1WI3 A;  2WV1 A;  1IN5 A;  2NYX A;  3RPQ A;  3JAM Z;  2QBY B;  3NWS A;  5JHF A;  1GVD A;  3CCQ I;  3Q9V A;  2FOW A;  4XLH A;  3KEO A;  4U7B A;  3SXY A;  3GUD A;  3QU3 A;  5M5Y J;  2EIN H;  3KIO A;  1BA5 A;  3LAP A;  1KU2 A;  2HKX A;  2VBY A;  3N97 A;  2PN6 A;  1SVO A;  4XLF A;  2ZSI B;  3ZQQ A;  2YS9 A;  4ZDO A;  2OZU A;  4M9S A;  4A3M J;  4I09 A;  2PI0 A;  4IKF A;  2MH2 A;  1B1B A;  1FWZ A;  5DYM A;  1D3Y A;  2F5D A;  3WTW C;  3H5N A;  3A02 A;  4XON A;  2NVQ J;  3CJN A;  3PSI A;  3HSF A;  3HTS B;  4LMY A;  2V6C A;  1MZB A;  2HKO A;  2XGC A;  2EA4 A;  1LPQ A;  3OYH A;  3S1M J;  2LC2 A;  5CVR A;  4JX4 A;  4A5N A;  1K61 A;  2XSD C;  4I2O A;  2HTJ A;  1YJ9 I;  4LFU A;  2ME6 A;  4XID A;  2FRH A;  4BDZ A;  2AQE A;  3QU6 A;  2G9W A;  4BJ6 C;  2CQN A;  4HEA 2;  1U8B A;  1ON1 A;  1BJZ A;  2ME0 A;  5JHU A;  2XAQ A;  3TBI A;  4BKX A;  1R4N B;  3K69 A;  3GFJ A;  1KZH A;  1SFU A;  4IF4 A;  1TLH B;  2OC6 A;  3ECH A;  1B6A A;  1POG A;  1X19 A;  5FLV A;  2FBI A;  4AIK A;  2KDZ A;  2R7T A;  2GBY A;  1G2H A;  3S2H J;  2FD5 A;  1Z9C A;  3WTX C;  2Q0O A;  2IPQ X;  1S29 A;  4MEY F;  2X51 A;  1SD4 A;  4Q47 A;  1R71 A;  3CF2 A;  1NG6 A;  1IN8 A;  3IL2 A;  4BHC A;  2I8D A;  9ANT A;  2NOG A;  4LD5 A;  5LGT A;  1KYZ A;  1XDU A;  1WJE A;  4PJN A;  2H09 A;  1Z05 A;  2R5Y B;  5FKN A;  1VQO I;  1T8I A;  3WE2 A;  3M4O J;  4E7K A;  2WB1 A;  3IKT A;  3EUA A;  4MTD A;  3I54 A;  1VND A;  2LH9 A;  3P9C A;  1A35 A;  1S6L A;  2KDO A;  3BR6 A;  1W7P B;  2MFZ A;  3BR3 A;  1JUS A;  3CJR B;  4ENK A;  3DKY A;  1DQU A;  2ZXI A;  3JTG A;  3BTL A;  2LP0 A;  4U0W A;  4LK1 F;  2LF7 A;  2O9L A;  2EFQ A;  2NS0 A;  1Z6T A;  1JT0 A;  2CQ7 A;  2ZKZ A;  4E7Z A;  2F4O B;  3HXL A;  4AC0 A;  5JLX A;  4B3X A;  4CCL A;  3ZQI A;  1EJ9 A;  4ZDP A;  2FE3 A;  1MBF A;  4Z6Y A;  2WY7 Q;  1ETK A;  4DBR A;  4Y33 A;  4D1Q A;  4IHX A;  3WG9 A;  4PSW A;  5KHD A;  3OSG A;  1JHF A;  1BC7 C;  2IS1 A;  1QZZ A;  1BI1 A;  1AU7 A;  3V42 A;  4B48 A;  4MTE A;  3H0D A;  2XKP A;  4B4C A;  2VI6 A;  3K0L A;  5DM6 F;  1BN5 A;  2HQN A;  3CCU I;  1VQ7 I;  1SC7 A;  5E3L A;  5E1X A;  3KCC A;  2XRN A;  3CES A;  3FXM A;  4A0X A;  3E6M A;  3RSN A;  2ZME C;  4KT5 C;  3OYN A;  3G71 I;  3RPU D;  2F6C A;  3PNY A;  2QEX I;  5CPR B;  1GXP A;  4IO9 F;  4HF2 A;  1LKX A;  1IXR C;  3AG2 H;  3IH4 A;  5KVR A;  1PP7 U;  1MH3 A;  2YUS A;  4E7J A;  3DTE A;  1D0Y A;  3K4N A;  1A6I A;  3CO6 C;  3OYM A;  1WJC A;  1P9Q C;  2HEO A;  3TDZ C;  3EUH C;  2X85 A;  2OTJ I;  5EZG A;  4ZJZ A;  3M8E A;  2DA2 A;  3NAR A;  6PAX A;  5EYR A;  2GQQ A;  2W48 A;  3MN2 A;  3RYR A;  4KUM A;  2MD5 A;  4GYI A;  1YW9 A;  4GXO A;  1WQ2 A;  3ABT A;  4KMF A;  4HG2 A;  4ENM A;  1YFH A;  1VQM I;  1QBJ A;  2VXD A;  1U5T C;  1FOX A;  1MND A;  4CO8 A;  3DTK A;  5M5W J;  4JYK A;  3TED A;  2MLK A;  3DPL C;  1TP4 A;  1ZG1 A;  4UUV A;  3D5L A;  2CRG A;  4NBQ A;  2VT3 A;  1GUU A;  4FCY A;  3A03 A;  2D45 A;  3B6A A;  4AIJ A;  2KQR A;  3RQI A;  3GTJ J;  3C2B A;  4OOI A;  2KIM A;  1R7J A;  5KK1 A;  3K1M A;  5IY5 H;  1ZEL A;  5B5E C;  5JVT A;  1P6R A;  2Q1Z B;  1RI7 A;  2HU9 A;  3E6B A;  1TW2 A;  1ETW A;  2CW8 A;  5FKO A;  5FLX Z;  3BCA A;  2P0W A;  3ASN H;  3X2Q H;  3HUG A;  2L02 A;  3ZMV A;  4BDY A;  1I3A A;  3HOV J;  1OLT A;  3CUQ C;  4DQ2 A;  5D5U B;  4RDU A;  1EV7 A;  4CYD A;  3QP6 A;  3L09 A;  5LHI A;  4GCV A;  2OU2 A;  2LD5 A;  1F9N A;  2OA4 A;  3SFI A;  5DDG A;  3LSK A;  5F0H A;  1OKR A;  5IYD J;  3GBG A;  4OWR B;  2BW3 B;  5EGO A;  3WTY C;  2R4G A;  3RTR A;  3JRA A;  3HJE A;  2KIU A;  2OCC H;  2RV8 A;  4YIR X;  2IA2 A;  2HZD A;  1QZY A;  3ABK H;  2Q8K A;  2Z9O A;  3CP2 A;  4GGG A;  4P9F A;  4EJW A;  3HC7 A;  4HNU A;  4DZJ A;  4RLQ A;  1RZ4 A;  2FF4 A;  2DYR H;  3FHZ A;  1GT0 C;  3MKL A;  4BAY A;  2EZL A;  3E97 A;  1S3J A;  1SD5 A;  1G3Y A;  3WGH A;  2MD0 A;  2V6E A;  3HGY A;  1SAU A;  2CGP A;  2Y9Y A;  3R60 A;  2DDB A;  3DU5 A;  3KYC B;  3GFL A;  2IGO A;  2R7F A;  3F23 A;  4Y13 A;  5EDN A;  2A69 F;  4FT8 A;  5GAG J;  1W0T A;  2L2O A;  5J4Y A;  2HNH A;  3G1M A;  2COB A;  4A3D J;  5LGU A;  3TOA A;  1MD0 A;  3LQQ A;  4HBL A;  2M0C A;  4C9Y A;  1BOB A;  3ZOB A;  3OY9 A;  5JR3 A;  5F1R A;  1P7I A;  4M74 A;  1KQ0 A;  2QBY A;  3PUF A;  2OTL I;  2M7A A;  5FRN A;  1XX5 A;  4JP0 A;  1TC3 C;  4LIV A;  1MNE A;  2BVL A;  3CTA A;  5DEQ A;  2IS4 A;  2W84 A;  2H6B A;  3HOU J;  2X1C A;  3DXJ F;  5D4S A;  2L7M P;  1QQI A;  2DFH A;  2ADU A;  1D8J A;  1RET A;  2HR3 A;  1OYI A;  1S5L C;  5EJC A;  4HQE A;  3CMY A;  1LJ9 A;  3WHC A;  2NVY J;  4RM2 A;  3O2P E;  1VQP I;  1MJ9 A;  1QZE A;  3AL0 B;  1IO2 A;  1IW7 F;  4F7Z A;  2F5C A;  2B7E A;  4EGZ A;  1T0F A;  2KKO A;  3KX2 A;  3VYS B;  2V1U A;  4G12 A;  1KU7 A;  3OSF A;  1AOY A;  2VJI A;  3G4S I;  2E34 A;  2IGN A;  3LSI A;  2ISY A;  2VJJ A;  5DV5 A;  4M6Y A;  5GPA A;  1XMX A;  4F55 A;  4XMY A;  3L2Q A;  3DLA A;  1MKM A;  1U8R A;  2DTZ A;  4HOB A;  1O7F A;  3MD2 A;  4JX5 A;  4BJT A;  2XPW A;  3T0Y A;  1IDY A;  1WHU A;  3LA7 A;  4AVP A;  3J81 Z;  3VPR A;  4K2E A;  1YJN I;  2LRE A;  1UZC A;  2E1M B;  4WXD A;  5EEA A;  1WH5 A;  2FML A;  2HWV A;  2IXS A;  1WJF A;  1Z67 A;  2ZJ2 A;  3ZMU A;  3CUO A;  4EJU A;  3HHH A;  4Q48 A;  4G6T B;  2WBM A;  4JBA A;  3KPH A;  3FWE A;  5CVI A;  2ZFW A;  5D8L B;  3JSP A;  1JI8 A;  2BOL A;  2DT7 B;  4KN7 X;  2QQ8 A;  4EM0 B;  2WAD A;  2O6G E;  3BCB A;  2OD5 A;  2L3D A;  2VN2 A;  3ABL H;  3RDI A;  4ETS A;  2MA3 A;  2L9R A;  4A3G J;  5D6F A;  2BY1 A;  2PLY A;  4E7H A;  4OAZ A;  2RN7 A;  4OU0 A;  4BQN A;  3DLL F;  2DFF A;  2R7D A;  4N0B A;  4YFX F;  4BQQ A;  2XAH A;  4JK1 X;  1AWC A;  4C2U A;  2ZCW A;  1JUM A;  1T2K A;  3AKZ A;  2XPU A;  4S0H B;  2FEZ A;  4IHS A;  4XKB A;  3T1B A;  4ZYH A;  1D1C A;  3VOE A;  4CCN A;  4AVZ A;  5ICE A;  2R5Y A;  2PBI A;  2JTV A;  1X3U A;  2DOD A;  2E1O A;  2ESN A;  4PK4 A;  1R9T J;  2QEN A;  1DU6 A;  3KP2 A;  4XOP A;  5AIQ A;  2LY9 A;  2VBX A;  4IRI A;  5L3C A;  1K6O A;  4U87 A;  4UUS B;  2FQ3 A;  3PJR A;  3PO3 J;  2M0M A;  2RQP A;  1QHG A;  1W7P A;  1ETO A;  1WH7 A;  2DI3 A;  4IX7 A;  2Y9Z A;  2DA6 A;  2DCE A;  2RNJ A;  1LEA A;  3QQA A;  2MLG A;  3QYF A;  1IV6 A;  2E36 A;  3TOB A;  3BG9 A;  5GTI C;  1OYY A;  3ELK A;  5IYC J;  2BV6 A;  2JT1 A;  1BL0 A;  3BZK A;  3S3M A;  4OIO F;  1ZTR A;  2K4B A;  2XRL A;  3EYY A;  2E2J J;  1H0M A;  1LQ1 A;  1VF9 A;  1JHH A;  5FKK A;  1BBY A;  2CUJ A;  1KQ8 A;  2GA1 A;  5K7H A;  4JX6 A;  3RKY A;  3WTS C;  3UR3 C;  1XD7 A;  3IH3 A;  4NC7 A;  1HLV A;  5EF6 A;  3BY6 A;  1BW6 A;  1KU3 A;  1R00 A;  1P4A A;  1JUP A;  4FQG A;  4UB6 C;  3FIW A;  1JTX A;  4D7M A;  3KYL A;  5IP7 J;  4IEJ A;  1LFP A;  1UST A;  2PQ8 A;  4LK0 F;  4RGS A;  5HDG A;  1VTN C;  3L2V A;  3HZJ A;  4ENJ A;  1G8X A;  1X3W B;  4UUT A;  4EAT A;  2VJ5 A;  1TZL A;  2ELH A;  3KP4 A;  3R0A A;  2CW7 A;  3JAM K;  1B9N A;  1G3T A;  1IUY A;  4YEL A;  2L9S A;  2BVM A;  2MG4 A;  3GEZ A;  4D5C A;  3V7S A;  2UV1 A;  1LVA A;  2V9V A;  1HDD C;  3F22 A;  2DMT A;  1J9I A;  3AAF A;  2WAE A;  3BG6 A;  2LTP A;  3GVA A;  3MKZ A;  1B8I B;  2IRF G;  3FKI J;  2M1B A;  1I1G A;  2VXZ A;  1W5S A;  2OPT A;  1EH7 A;  1U6G A;  2BZT A;  2KT0 A;  2LKS A;  4XKV A;  1FYL A;  2XIG A;  3ERM A;  3WE3 A;  1Y56 A;  3PIO F;  1UG2 A;  2CUE A;  4ZDL A;  1BR4 A;  1B4A A;  2W1O A;  3KP3 A;  2BE5 F;  1IC8 A;  3NAU A;  4HSR A;  5ILU A;  1I6X A;  1F5T A;  3H1C A;  1A6Q A;  3B6C A;  4HLX A;  4LJZ F;  1I6H J;  4BHP A;  2J5O A;  2X0L A;  1T95 A;  4X1E A;  4C3J J;  2MGQ A;  3ECO A;  1YW7 A;  4L9J A;  2QQA A;  3BG7 A;  4D5F A;  5C4X J;  5K7Z A;  2CV2 A;  4A6D A;  1T39 A;  2BW3 A;  1I3Q J;  2R7Z J;  3Q0U A;  4BAC A;  1FSE A;  4NDL A;  2R7X A;  3DEE A;  4YIF A;  2L7F P;  2ELK A;  4FE7 A;  2K3F A;  2Z16 A;  5L3D A;  4A12 A;  5HOO A;  5E1Z B;  4DIQ A;  2WAF A;  1LDJ A;  3KZI C;  3I0T A;  5CVV A;  4A3I J;  2XSJ C;  2KIS A;  3F8F A;  3LST A;  4ZYD A;  1NK3 P;  4LB6 B;  1APL C;  1JJ8 C;  2V9P A;  3HG9 A;  3SHF A;  5DM7 F;  1BOA A;  4KT6 A;  1LDK B;  3BPX A;  3ZRG A;  4G7O F;  2M3A A;  5K7F A;  2EFW A;  3GTK J;  2CSO A;  2ZNY A;  2L9N A;  4KJZ A;  1IXS B;  4N9I A;  3ONQ A;  3U1K A;  4B8X A;  3LL7 A;  4IHW A;  5E79 C;  4UY8 I;  4A3J J;  2F5F A;  5FD5 A;  2DQL A;  2M8G X;  3E5U A;  2DXI A;  2XV4 S;  2VON A;  2MBF A;  2BY3 A;  1FOY A;  1K7A A;  4LLG F;  2JA2 A;  2Y0S N;  5F6F A;  3WU2 C;  2XB5 A;  2A68 F;  1FYK A;  1JGS A;  3I58 A;  2FJ1 A;  2K85 A;  3VDX A;  2XC7 A;  1C0W A;  3S3N A;  2EPF A;  5CVJ A;  3ZMD A;  2QYO A;  3W6J B;  4M3G A;  2PJP A;  3K2A A;  4J01 A;  3WU1 B;  3HUG B;  3LA3 A;  4GFB A;  5K5R A;  1J7K A;  2Z2S B;  3QOP A;  4RA2 A;  4CA0 A;  2CUZ A;  2BGC A;  2LYC A;  1DGW Y;  4P1W A;  2A5W A;  2EWN A;  4MEX F;  1X1B A;  2V9K A;  3BR1 A;  3QAH A;  1DU0 A;  4BBS J;  2JZY A;  3A4C A;  3I53 A;  2FMY A;  2LMD A;  3V8J A;  5DUI A;  2L7K A;  2LY1 A;  3TGN A;  2M2E A;  1FIA A;  3DV8 A;  5C4J J;  3BJA A;  1J2X A;  4KIT B;  3FXO A;  1FPQ A;  1ZN2 A;  3U21 A;  4CUG A;  2I5U A;  2DK8 A;  2ID6 A;  2VIX A;  1D5V A;  3IAM 2;  4L0Y B;  2W7N A;  1YTY A;  2KIF A;  2XHK A;  1IJW C;  1EH6 A;  3OYL A;  1Y0U A;  3LSJ A;  3M9A A;  3SFZ A;  2QF7 A;  2HXO A;  4Z2Y A;  1XCB A;  3S1N J;  1ZKG A;  3F0C A;  4B1R A;  4WX9 A;  4KNY A;  2V1X A;  1K78 B;  2K9S A;  4PJJ A;  1H88 C;  2ZNZ A;  1BI2 A;  2L7Z A;  4IHT A;  2P5L C;  2DA3 A;  1E0E A;  2L4M A;  3SZG A;  2F5V A;  3JRE A;  3DWL E;  3ZGK A;  3HOY J;  2IEK A;  1FOW A;  5ERI A;  5TIS C;  1WZ2 A;  2BHZ A;  3K1P A;  1AA7 A;  1ZG5 A;  5J47 A;  4XSX F;  2AS5 F;  1R36 A;  2L4A A;  2Y0M A;  1R49 A;  3JSO A;  5F64 A;  4IVN A;  3VEP A;  1ZGW A;  1FMW A;  4BE2 A;  3RPU A;  2JWT A;  1JKR C;  2HVQ A;  2JA8 J;  3L00 A;  2Y69 H;  1UHM A;  1QU3 A;  4II2 A;  3W6V A;  3QYE A;  5F1J A;  2QUF A;  2V1D A;  2M45 A;  3JRG A;  2ECB A;  3CCY A;  4RB2 C;  2ECC A;  3K70 C;  3O3K A;  3A01 B;  3FHN A;  1VFC A;  1WRJ A;  3I56 I;  4XN3 A;  2ZB9 A;  4UUS A;  3F6V A;  2R93 J;  3CJT B;  1O4X A;  5LFA A;  1LFB A;  3PSF A;  2HYF A;  4H0E A;  5FLX K;  2H1L A;  1VQN I;  3OIQ A;  4LLN A;  3WTV C;  1TBX A;  1U9O A;  3BPV A;  5ILV A;  4I02 A;  3MFK A;  5D5W B;  4M3F A;  3J7Z I;  5IOY A;  1X2N A;  4EJV A;  2A07 F;  4YRV A;  1AKH B;  3O8G A;  2R7R A;  1EF4 A; 
#chains in the Genus database with same CATH homology
 1FSH A;  2DAO A;  2R3S A;  1GVJ A;  3V8L A;  3DPT A;  2JSC A;  4EVI A;  3IRR A;  1IN4 A;  2HFH A;  5E8I A;  2O8X A;  1DPR A;  1TNT A;  3I64 A;  3B73 A;  2P8T A;  3G3Z A;  4KFC A;  2D1H A;  1A04 A;  1IN6 A;  4KIG A;  5FB2 A;  1T98 A;  4ON0 A;  3E3V A;  2RDP A;  2EA2 A;  4IPA A;  5HVQ C;  3QPH A;  2QWW A;  1H9T A;  3G73 A;  3HSE A;  3FMQ A;  2DT5 A;  2GXG A;  4UVC A;  5L3E A;  4BYY A;  2A6E F;  1YS6 A;  2YPR A;  4RB1 A;  4GO1 A;  4KMU X;  5DUK A;  3HHG A;  2DK5 A;  2YR2 A;  3M1E A;  3DFG A;  1FOK A;  3FMR A;  2QVO A;  3HRM A;  4KIB A;  4G7H F;  2DBB A;  3P7N A;  2PMH A;  1EH8 A;  2WWY A;  3J81 K;  1CF7 B;  1R1U A;  2B0L A;  5FGM A;  1FNN A;  2XAG A;  1FZP B;  4A0Y A;  5BPD A;  1R22 A;  4OIP F;  5ICF A;  4BNC A;  3WTZ A;  5E20 A;  4G9Y A;  2LDU A;  5HLH A;  3TDU C;  1OR7 A;  3HRU A;  3KP7 A;  1HW2 A;  5J8F A;  3BJ6 A;  2FOK A;  2XAJ A;  1HST A;  5TJJ A;  1P92 A;  3QP5 A;  2WV0 A;  2DW4 A;  3MCZ A;  3CDH A;  2AXL A;  2FU4 A;  4M6X A;  1XSD A;  1JE8 A;  5IT9 Z;  3TO7 A;  5FFX A;  2E1N A;  2EFO A;  1B9M A;  1XB4 A;  2F5E A;  2WC2 A;  3CUQ B;  3E5Q A;  4A5M A;  1R23 A;  2VE8 A;  1O3Q A;  4M71 A;  1ZHF A;  1MDM B;  1W4M A;  1YIO A;  3ZN0 A;  2K4J A;  3C7J A;  4AD9 A;  4RAZ A;  3GXO A;  4U0V A;  2PEX A;  4U7D A;  1RIO H;  4WCG A;  1K78 A;  2COM A;  2PFB A;  1L3L A;  2GIV A;  2M8E A;  3HTU A;  2FNA A;  2DLL A;  2FNP A;  1PDN C;  3BP8 A;  2ZO4 A;  3ROU A;  3ULQ B;  3CO7 C;  1J0R A;  1R1V A;  5DD8 A;  3F8M A;  1BIA A;  1ZLJ A;  4HQM A;  5AON A;  5H20 A;  3H3Z A;  3F8C A;  1HW1 A;  4ESJ A;  2P4W A;  4HDU A;  4D0P A;  5FO5 A;  4CXF A;  2G7U A;  4GYG A;  3ZPL A;  3WOD F;  3LWF A;  3R4K A;  4KIF A;  4BXU A;  3SZP A;  1XMA A;  1I27 A;  2HZT A;  3ZN1 A;  3GFM A;  5LEJ A;  1U3E M;  3J7A O;  3JTH A;  1ONV A;  1T6S A;  4EGY A;  3L7W A;  2KJB A;  4XLP F;  1G3S A;  5HDN A;  2HOE A;  1KGS A;  4AWX B;  4NHJ A;  5HS9 A;  3DF8 A;  2STW A;  4L18 B;  4HF0 A;  3I5U A;  3SZT A;  2YSR A;  3M8F A;  3I4P A;  2W57 A;  3J80 Z;  2FBH A;  1YO5 C;  2EFN A;  1HW5 A;  3MZY A;  1NHA A;  5IT3 A;  1V4R A;  1YS7 A;  2QM3 A;  4KA4 A;  2H27 A;  3Q5F A;  2K27 A;  2O3F A;  2P7C B;  5K5O A;  4EM2 A;  2VOO A;  1S7O A;  1LNW A;  4A0Z A;  3V7R A;  4XBF A;  1ZYR F;  4BQA A;  1ZAO A;  1Z1D A;  2VBZ A;  4CGZ A;  3WGI A;  1GHC A;  5BPI A;  4WXC A;  2EB7 A;  2M30 A;  4LB5 A;  1G4D A;  4G8X A;  1WKM A;  4WK8 F;  2Q2E A;  4MGR A;  2DPD A;  1L0O C;  1CF7 A;  3H92 A;  1BJA A;  4HA8 A;  2RGV A;  4G6Q A;  2KJC A;  1BI0 A;  2ZME A;  1QGP A;  3ABU A;  2YX7 A;  3U2R A;  1XGM A;  2LNB A;  4ZH4 F;  1UHW A;  4PCQ A;  2Y48 A;  1XSV A;  5J8C A;  5EEH A;  3GW2 A;  5HLI A;  5H6R A;  3EUH A;  1R58 A;  4HF1 A;  4M9X A;  4HZF A;  2GXB A;  3I71 A;  5D6E A;  1BC8 C;  5D5V B;  2A5Y B;  2LKP A;  2RC4 A;  1UB9 A;  2DO7 A;  5LLQ A;  1O3S A;  1QNT A;  3MAJ A;  2XGX A;  3D0S A;  3LAJ A;  3V4G A;  1O7L A;  4YII A;  3GO5 A;  4WWC A;  5J6X A;  2C6Y A;  3LQR A;  3CUQ A;  1ZLK A;  3K9T A;  2BYV E;  3FX3 A;  4ESB A;  1LB2 A;  1MDM A;  2V79 A;  3BWG A;  3HRT A;  1XSX A;  4FX0 A;  4I0B A;  3ISP A;  1UFM A;  2CYY A;  4L5J A;  5BQT A;  4N9H A;  2RKH A;  2VOD A;  2IVM A;  2MC3 A;  1R1T A;  1PUE E;  3KZY A;  4HLY A;  3H3U A;  2VC0 A;  3SQN A;  4RB0 A;  3MWM A;  3ZMZ A;  4OMZ A;  2EFP A;  2VC1 A;  5A2Q Z;  2XVC A;  4S04 A;  3VB2 A;  3GFI A;  2D1V A;  1ZGA A;  4QWQ A;  1FBQ A;  3W6K B;  5BMZ A;  4UVA A;  3WGG A;  5LEK A;  4L0Z B;  2XAF A;  3IRQ A;  3BDD A;  4U88 A;  2FBK A;  3ZMS A;  4OIN F;  1ZH5 A;  3KP6 A;  2GWR A;  3NQO A;  1FC3 A;  4XLN F;  5TRD A;  1YG2 A;  2JPB A;  4TV7 A;  2NNN A;  1KYW A;  2PG4 A;  4P9U A;  3C3W A;  4MNU A;  3T5X A;  4EQQ A;  3RYP A;  1SFE A;  3I59 B;  4IXA A;  3E5X A;  1DPU A;  2K02 A;  4P55 A;  5CVU A;  3GLX A;  3OOP A;  5DD4 A;  1LEB A;  4Y17 A;  1HQC A;  5JFR A;  2ZXJ A;  4KYW A;  4UHT A;  4RAY A;  1PP8 F;  4LLL A;  4CHU A;  1RUN A;  4PGH A;  3KP5 A;  2YU3 A;  1Z7U A;  2A6H F;  3EYI A;  2YX4 A;  3IWZ A;  4S05 A;  4WF2 A;  2VBW A;  4RGR A;  3F6O A;  4A2U A;  2CFX A;  5IT9 K;  4XRF A;  2QQ9 A;  2E1C A;  3FF5 A;  2OZ6 A;  2CO5 A;  1Q1H A;  2UXX A;  3EDP A;  1SMT A;  3ZQ7 A;  1P2F A;  4U0Y A;  1O3R A;  3R61 A;  1XGN A;  3S2W A;  4O6J A;  5LRR A;  2GAU A;  2E7X A;  3BRO A;  4BHB A;  1W5T A;  2LF8 A;  4UXN A;  4CZZ A;  2DU9 A;  1FX7 A;  3Q9S A;  2J5P A;  4KN4 X;  4PGG A;  4M9Z A;  3GX4 X;  1ZRC A;  3M7G A;  3FZV A;  2Z3Y A;  1ZAR A;  1ZGJ A;  5HDK A;  3QRF F;  4O5V A;  5ICG A;  4ZZL A;  2H94 A;  1IF1 A;  3BZ6 A;  4IRG A;  3K1N A;  2E7W A;  3ZP5 A;  1TTY A;  1S8N A;  1TQI A;  4RGX A;  2A3S A;  3TO6 A;  1K79 A;  5D8K B;  1OMI A;  1O3T A;  2NAZ A;  4OIQ F;  1P4W A;  4ENN A;  2BBY A;  3V7C A;  1RNL A;  1XCV A;  1MGT A;  3U9G A;  4XSZ F;  2GA2 A;  1IAW A;  4L9N A;  4Y15 A;  2ZME B;  5ILS A;  4I98 B;  1ZRD A;  3TO9 A;  2HTS A;  3J80 K;  1ON2 A;  3LA2 A;  4KIC A;  5AIP A;  2JRT A;  3EQL F;  2HQR A;  4OIR F;  5K1Y A;  1ZRF A;  5H6Q A;  4ASN A;  2HGC A;  1TQP A;  1STZ A;  1QPM A;  4HW0 A;  3IHU A;  1U5T B;  4UV8 A;  2O03 A;  4P5O A;  1HKQ A;  1F4K A;  1DP7 P;  1OPC A;  1R5G A;  3F8N A;  4R8H A;  2HS5 A;  2VE9 A;  2X4H A;  2ESH A;  2CG4 A;  1XMK A;  4ESF A;  4YFK F;  4HDV A;  4EJO A;  4R1H A;  4A6E A;  5LRS A;  2O61 A;  3IKV A;  4KDP A;  3QPT A;  3BJO A;  3NRV A;  2W24 A;  2K7L A;  2BEO A;  2H6C A;  4EMS A;  3GZ5 A;  3NEU A;  4L5I A;  3I59 A;  1FY7 A;  3E6D A;  1JXS A;  2DPU A;  4ZYE A;  2O0Y A;  1U2W A;  1YYV A;  3L2C A;  1F1Z A;  1FP2 A;  2QZ8 A;  1IN7 A;  4I01 A;  1USS A;  3REO A;  4L9V A;  4OMY A;  4ZZD A;  3R6S A;  3F8B A;  3P9I A;  1KU9 A;  5BOX A;  1YQA A;  2M5W A;  1H9G A;  2Z33 A;  1LDD A;  3MEX A;  1CGP A;  2UZK A;  4O3M A;  1WI9 A;  3RKW A;  5D5X B;  4LG0 B;  3ML6 A;  1FT9 A;  3OV8 A;  4NQW A;  5L3F A;  1BM9 A;  3JW4 A;  4UVB A;  3IC7 A;  1R5H A;  1TNS A;  3F72 A;  2W85 A;  1IRG A;  1RUO A;  1MJA A;  4MHG A;  2STT A;  2WTE A;  2XKO A;  2ISZ A;  2IA0 A;  1G3W A;  4HX7 A;  5DCM B;  4AIH A;  1REP C;  2EV6 A;  3KE2 A;  1ZRE A;  1TW3 A;  4UV9 A;  1ULY A;  3KEQ A;  1FYM A;  4UNO A;  2L01 A;  1XGO A;  4YFN F;  1Z91 A;  4JQF A;  2HDC A;  3FM3 A;  1IZ1 A;  3DKW A;  4YG2 F;  5A2Q K;  2M87 A;  2EV0 A;  3RIR A;  3RJP A;  2MH9 A;  5LBQ A;  1I1S A;  5E17 F;  4DNC A;  1OYW A;  2VOP A;  3R0J A;  2XUB A;  4M72 A;  3HIF A;  2Z99 A;  5DCF A;  3RI4 A;  3FXQ A;  2OQR A;  2UWM A;  2ACJ A;  3C18 A;  5FFZ A;  1G6N A;  2OAZ A;  1HSJ A;  3TQN A;  2UXN A;  2G7H A;  4I0A A;  3U1D A;  4HV6 A;  2P6T A;  5E1W A;  3LFK A;  5CLS A;  1B59 A;  5JI6 A;  1WWX A;  1IXC A;  2P6S A;  5L3G A;  1DDN A;  4I7H A;  2NNY A;  5FD6 A;  3PFI A;  1SD7 A;  1BIB A;  2ETH A;  2P7V B;  1ZG3 A;  2CWE A;  3FMS A;  3T8T A;  1XGS A;  3DQV C;  2RVC A;  3EET A;  1P4X A;  1TQM A;  1O57 A;  2A61 A;  1T38 A;  1D8K A;  5LHG A;  1J5Y A;  3FXU A;  1YW8 A;  2XRO A;  1KA8 A;  1SD6 A;  2FA5 A;  3IWF A;  2HYG D;  2FXA A;  3HOS A;  2IP2 A;  3KLO A;  2P5K A;  2IW5 A;  2F2E A;  3FXR A;  3GF2 A;  4G7Z F;  5CYV A;  3WTT C;  2IT0 A;  1V3F A;  1FP1 D;  1UCR A;  1MJB A;  5LHH A;  4LGW A;  3PQK A;  3RKX A;  2JPC A;  3HSR A;  3KZZ A;  1QO0 D;  3GWZ A;  1ODD A;  4PDK A;  4HV5 A;  4M73 A;  3DEU A;  2QLZ A;  4CDG A;  1U5T A;  3PQJ A;  5LGN A;  4G94 A;  4E70 A;  1SAX A;  1HKS A;  4WXH A;  1BI3 A;  1S7A A;  2P5V A;  2DTR A;  3O6B B;  2L54 A;  3ERE D;  3KET A;  3VOD A;  2CQK A;  1J75 A;  2FSW A;  3WU0 A;  3N4M A;  2TDX A;  3CLO A;  4BH9 A;  2Y75 A;  4RGU A;  5HS7 A;  5HS8 A;  2OBP A;  1WSU A;  5HLG A;  4FHT A;  4FX4 A;  3MZH A;  2CW0 F;  4ZYG A;  3F21 A;  2IA1 A;  4L9T A;  3BOQ A;  1HBX G;  3WTU C;  2K86 A;  3K2Z A;  5E8G A;  1IRF A;  1XDS A;  4MQ9 F;  2EJR A;  4R79 A;  4CIC A;  4B09 A;  3HYI A;  4Q5S F;  2XAS A;  3FM5 A;  2EV5 A;  1E2X A;  3ZMT A;  3TKY A;  2QQB A;  3COA C;  4HAM A;  4QLC U;  3HOT A;  1Z6R A;  4IJA A;  1GXQ A;  2NRA C;  1HKT A;  4EM1 A;  3P9K A;  2D2W A;  3DP7 A;  5L3B A;  2VT2 A;  5BS6 A;  4P96 A;  3GZ6 A;  4NB5 A;  1W7P D;  4LG0 A;  4EJT A;  2KRF A;  5ED4 A;  3MQ0 A;  2ZBK A;  4G6D A;  2EK5 A;  3B02 A;  4PZJ A;  1E17 A;  5E18 F;  3GYH X;  4MQV A;  3V8K A;  3E6C C;  2PMU A;  1FBU A;  3KLN A;  1DUX C;  3HRS A;  4HX8 A;  1J59 A;  3C1D A;  3VFZ A;  5ICC A;  1I5Z A;  5D4R A;  4IRH A;  5DCM A;  2DFI A;  4EV0 A;  2IJL A;  2Z5U A;  2LSO A;  2W25 A;  3L9F A;  1YLF A;  4HYE A;  1KQ9 A;  1FLI A;  1SFX A;  3KFW X;  1XN7 A;  4RS8 A;  2DQR A;  1SMY F;  5EEG A;  3F3X A;  4Q4Z F;  4RB3 C;  2GZW A;  4HX4 A;  1U78 A;  5CJ9 A;  1FBS A;  3T8R A;  1HXD A;  2OQG A;  5K5Q A;  1IN5 A;  2NYX A;  3RPQ A;  3JAM Z;  2QBY B;  3Q9V A;  3KEO A;  4U7B A;  3SXY A;  3GUD A;  3QU3 A;  3LAP A;  1KU2 A;  2HKX A;  2VBY A;  3N97 A;  2PN6 A;  2OZU A;  4M9S A;  4I09 A;  2PI0 A;  2MH2 A;  1B1B A;  1FWZ A;  5DYM A;  1D3Y A;  2F5D A;  3WTW C;  3CJN A;  3HSF A;  3HTS B;  4LMY A;  2V6C A;  1MZB A;  2HKO A;  2EA4 A;  5CVR A;  4A5N A;  4I2O A;  2HTJ A;  4LFU A;  2FRH A;  3QU6 A;  2G9W A;  1ON1 A;  5JHU A;  2XAQ A;  3K69 A;  3GFJ A;  1SFU A;  4IF4 A;  1TLH B;  3ECH A;  1B6A A;  2FBI A;  4AIK A;  1Z9C A;  3WTX C;  2Q0O A;  2IPQ X;  1S29 A;  4MEY F;  1SD4 A;  4Q47 A;  1IN8 A;  3IL2 A;  4BHC A;  4LD5 A;  5LGT A;  1KYZ A;  1XDU A;  2H09 A;  1Z05 A;  3WE2 A;  3IKT A;  4MTD A;  3I54 A;  3P9C A;  1S6L A;  1W7P B;  4ENK A;  3JTG A;  4U0W A;  4LK1 F;  2LF7 A;  2EFQ A;  2NS0 A;  1Z6T A;  2ZKZ A;  2FE3 A;  3WG9 A;  1BC7 C;  1JHF A;  1QZZ A;  1BI1 A;  4MTE A;  2XKP A;  3K0L A;  1BN5 A;  2HQN A;  5E1X A;  3KCC A;  2XRN A;  4A0X A;  3E6M A;  4KT5 C;  1GXP A;  4HF2 A;  1IXR C;  5KVR A;  1PP7 U;  3CO6 C;  2HEO A;  3TDZ C;  3M8E A;  6PAX A;  2GQQ A;  3RYR A;  4KUM A;  2MD5 A;  4GYI A;  1YW9 A;  4GXO A;  1WQ2 A;  3ABT A;  4KMF A;  1YFH A;  4ENM A;  1QBJ A;  1U5T C;  4CO8 A;  2MLK A;  3DPL C;  1ZG1 A;  4UUV A;  3D5L A;  2VT3 A;  2D45 A;  4AIJ A;  4OOI A;  2KIM A;  1R7J A;  5KK1 A;  3K1M A;  5JVT A;  1P6R A;  1RI7 A;  3E6B A;  1TW2 A;  5FLX Z;  3ZMV A;  3HUG A;  2L02 A;  3CUQ C;  4DQ2 A;  5D5U B;  1EV7 A;  4CYD A;  3QP6 A;  3L09 A;  5LHI A;  4GCV A;  2OU2 A;  1F9N A;  2OA4 A;  5DDG A;  1OKR A;  3WTY C;  3RTR A;  2KIU A;  2RV8 A;  2IA2 A;  1QZY A;  2Q8K A;  2Z9O A;  4GGG A;  4P9F A;  4EJW A;  1RZ4 A;  2FF4 A;  3FHZ A;  4BAY A;  3E97 A;  1S3J A;  1SD5 A;  1G3Y A;  3WGH A;  2CGP A;  3R60 A;  3GFL A;  2R7F A;  3F23 A;  4Y13 A;  2A69 F;  4FT8 A;  5LGU A;  3TOA A;  1MD0 A;  3LQQ A;  4HBL A;  5JR3 A;  5F1R A;  4M74 A;  1KQ0 A;  2QBY A;  3CTA A;  5DEQ A;  2W84 A;  2H6B A;  5D4S A;  3DXJ F;  1QQI A;  2ADU A;  1D8J A;  2HR3 A;  1OYI A;  4HQE A;  1LJ9 A;  3O2P E;  1MJ9 A;  1IW7 F;  4F7Z A;  2F5C A;  4EGZ A;  1T0F A;  2KKO A;  2V1U A;  1KU7 A;  1AOY A;  2ISY A;  5DV5 A;  4M6Y A;  1U8R A;  1MKM A;  4HOB A;  1O7F A;  3T0Y A;  3LA7 A;  4AVP A;  3J81 Z;  4K2E A;  4WXD A;  2FML A;  2HWV A;  2ZJ2 A;  3ZMU A;  3CUO A;  4EJU A;  3HHH A;  4Q48 A;  4JBA A;  3FWE A;  5CVI A;  2ZFW A;  5D8L B;  3JSP A;  4KN7 X;  4EM0 B;  2O6G E;  2OD5 A;  2L3D A;  2VN2 A;  3RDI A;  4ETS A;  2MA3 A;  5D6F A;  2PLY A;  2RN7 A;  4OU0 A;  2R7D A;  4N0B A;  4YFX F;  2XAH A;  4JK1 X;  1AWC A;  2ZCW A;  1T2K A;  2FEZ A;  4IHS A;  3T1B A;  4ZYH A;  3VOE A;  5ICE A;  2PBI A;  2JTV A;  1X3U A;  2ESN A;  2QEN A;  3KP2 A;  5AIQ A;  2VBX A;  4IRI A;  5L3C A;  1K6O A;  2FQ3 A;  2RQP A;  1W7P A;  2DI3 A;  2RNJ A;  1LEA A;  2MLG A;  3TOB A;  1OYY A;  3ELK A;  2BV6 A;  2JT1 A;  4OIO F;  2K4B A;  3EYY A;  1H0M A;  1LQ1 A;  1JHH A;  1BBY A;  1KQ8 A;  2GA1 A;  3WTS C;  3RKY A;  1XD7 A;  3BY6 A;  1KU3 A;  1R00 A;  1P4A A;  1UST A;  2PQ8 A;  4LK0 F;  4RGS A;  5HDG A;  1VTN C;  4ENJ A;  3KP4 A;  2ELH A;  3R0A A;  3JAM K;  1B9N A;  1G3T A;  1IUY A;  3GEZ A;  3V7S A;  1LVA A;  2V9V A;  3F22 A;  1J9I A;  3AAF A;  3GVA A;  2IRF G;  2M1B A;  1I1G A;  2VXZ A;  1W5S A;  1EH7 A;  1U6G A;  1FYL A;  2XIG A;  3WE3 A;  1B4A A;  3KP3 A;  2BE5 F;  1F5T A;  5ILU A;  1I6X A;  4HLX A;  4LJZ F;  4BHP A;  2J5O A;  2X0L A;  3ECO A;  1YW7 A;  4L9J A;  2QQA A;  4A6D A;  1T39 A;  1FSE A;  4YIF A;  5L3D A;  4A12 A;  5HOO A;  5E1Z B;  1LDJ A;  3I0T A;  5CVV A;  3F8F A;  3LST A;  4ZYD A;  4LB6 B;  3SHF A;  1BOA A;  1LDK B;  3BPX A;  4G7O F;  2EFW A;  2CSO A;  2ZNY A;  1IXS B;  4N9I A;  4B8X A;  2F5F A;  5FD5 A;  2DQL A;  3E5U A;  2XV4 S;  2VON A;  2MBF A;  1K7A A;  4LLG F;  5F6F A;  2A68 F;  1FYK A;  1JGS A;  3I58 A;  1C0W A;  5CVJ A;  3ZMD A;  2QYO A;  3W6J B;  2PJP A;  3WU1 B;  3LA3 A;  5K5R A;  1J7K A;  3QOP A;  2BGC A;  2EWN A;  4MEX F;  3QAH A;  2JZY A;  3I53 A;  2FMY A;  3V8J A;  5DUI A;  3TGN A;  3DV8 A;  3BJA A;  1J2X A;  1FPQ A;  1ZN2 A;  2DK8 A;  1D5V A;  4L0Y B;  1YTY A;  2KIF A;  2XHK A;  1EH6 A;  1Y0U A;  3M9A A;  3SFZ A;  4Z2Y A;  1XCB A;  4WX9 A;  4KNY A;  2V1X A;  1K78 B;  2ZNZ A;  1BI2 A;  4IHT A;  2P5L C;  2L4M A;  5ERI A;  3K1P A;  1ZG5 A;  2AS5 F;  4XSX F;  1R36 A;  2L4A A;  2Y0M A;  3JSO A;  5F64 A;  4IVN A;  3VEP A;  3RPU A;  3L00 A;  1UHM A;  2QUF A;  2V1D A;  2M45 A;  4RB2 C;  3O3K A;  1WRJ A;  3F6V A;  2HYF A;  4H0E A;  5FLX K;  4LLN A;  3WTV C;  1TBX A;  3BPV A;  5ILV A;  4I02 A;  3MFK A;  5D5W B;  4EJV A;  2A07 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...