5E1ZB

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,4-dichlorophenol bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
b'LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides mccartyi btf08
molecule tags Transcription
total genus 60
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1zB00
3U9GA 2PEXA 2HKOA 3ABUA 1I1GA 3CUQA 1QO0D 4OIPF 1MZBA 2R3SA 4YIFA 1U78A 3B73A 1H9GA 2XKOA 3BWGA 2NAZA 4KT5C 1ZH5A 1BC8C 1J9IA 1VTNC 2D2WA 4CYDA 2YSRA 1RIOH 4RB2C 1QZZA 1AWCA 2K4BA 2QBYA 4I7HA 1NHAA 5K1YA 3J80K 1YQAA 3ABTA 4ETSA 4KN4X 1XN7A 3JAMZ 5HLIA 1ZYRF 2XV4S 1MJ9A 3WTUC 4P9UA 3K0LA 2IW5A 2FRHA 2GAUA 2QUFA 5ILSA 2K86A 1B9MA 3WGHA 2FE3A 2G7HA 4EGZA 1TNSA 4PGHA 2M30A 3GXOA 3P7NA 4L5JA 3DPTA 2WV0A 4G8XA 4Y15A 3DV8A 2W24A 3IWZA 1RI7A 1LVAA 4A0YA 4ENNA 2H6BA 2EJRA 5FD6A 4U0VA 5D5XB 4OU0A 5LRSA 1K6OA 5L3BA 4EQQA 2GIVA 2HOEA 1LDJA 2KJBA 4A6EA 2MD5A 2ZO4A 3IKVA 1LB2A 4CICA 5ED4A 4GYGA 1D5VA 3RTRA 4HLYA 2DQRA 3WTVC 4WXHA 3HRMA 3LA7A 3MZHA 1FOKA 1DPUA 5CVUA 5J8CA 1OYWA 3GFIA 2FQ3A 4CXFA 4R79A 1YTYA 1EH8A 4HQEA 1LEAA 1HKSA 2YPRA 1V4RA 5D6EA 4L5IA 1DDNA 5IT9K 1LNWA 2NNYA 2P5VA 3K9TA 2JZYA 1HSJA 3BROA 2XAHA 4XLNF 4L0ZB 3CUQB 1IN5A 1LDDA 1ZG3A 3WTSC 3WTZA 5L3EA 1X3UA 2BEOA 1U8RA 5DEQA 4BHCA 3HRTA 3KEOA 3FM3A 5FLXK 3IL2A 4I0BA 3SZPA 1I6XA 2MBFA 1OMIA 3KP6A 4UNOA 3MAJA 2EWNA 3IRQA 3W6KB 3L2CA 5KVRA 3SXYA 1ZGAA 2JPCA 4BH9A 3RKWA 1UCRA 2QBYB 3IC7A 2QWWA 3WODF 4ENMA 2EFQA 2E7XA 3FM5A 3OOPA 4LLGF 4YFKF 1Z1DA 1V3FA 4RGSA 2LF8A 2D1HA 4WXCA 2EB7A 4ZYGA 3HSEA 3F6VA 2F2EA 2AXLA 4G94A 5TRDA 5DCFA 4MQVA 1TQIA 2E1CA 4HQMA 2KRFA 3PFIA 2ESHA 2O6GE 1SD6A 2DO7A 4HOBA 2UWMA 3E6CC 4R8HA 5LHHA 1WI9A 4EM1A 2HDCA 5DUIA 5L3GA 4DNCA 3IWFA 3ZMVA 3VFZA 2Z9OA 4LLLA 3RIRA 4EJUA 4PZJA 4KA4A 4OINF 4IRIA 3RYPA 2QVOA 4P55A 2VONA 2FXAA 3WU0A 1GVJA 1OPCA 2H6CA 1O7FA 1FP2A 1JGSA 2NRAC 4EGYA 1XCVA 2FBHA 1TLHB 1FSEA 2QM3A 3BDDA 4OMYA 1ZG1A 2DQLA 2A3SA 3HYIA 4Q47A 5LBQA 2W25A 3TQNA 1GHCA 3ZP5A 1BI3A 1YYVA 2F5DA 1PP8F 3F22A 3DFGA 3W6JB 2IJLA 1BIAA 1J75A 2L02A 2AS5F 3EDPA 4HZFA 3CO7C 1ON2A 2FMYA 2XAJA 1FBQA 4S04A 5EEHA 3TDUC 4S05A 3K1NA 1KU9A 4M6XA 1Z7UA 3GYHX 4WWCA 4EJVA 1QZYA 1TQPA 2VBXA 4M73A 2JTVA 1O3RA 2HKXA 4NB5A 1FYKA 3V7SA 1SMYF 2GQQA 2VBWA 3LQRA 5J6XA 4LMYA 4OIRF 3LA3A 3IHUA 3IRRA 2VE9A 1W5TA 1G6NA 4Q48A 5E20A 1EH6A 3I53A 4B8XA 2Y48A 1YS7A 3D0SA 2Z5UA 1JHHA 1KQ9A 2Q2EA 1OKRA 4CHUA 2V1DA 4HDUA 1KU7A 1PP7U 3HHGA 1D3YA 3DKWA 2LF7A 2E7WA 5DUKA 4AD9A 2KKOA 1T6SA 2G9WA 1XDUA 2DFIA 2KIUA 4MGRA 3ZMDA 3DF8A 3DQVC 2OBPA 3N97A 1FBSA 4M9ZA 3E5UA 3WU1B 3C3WA 4KICA 2TDXA 5LEKA 3P9CA 1FYMA 1FWZA 3S2WA 1G4DA 4ENJA 1P4XA 4HX8A 4P96A 1E17A 3T1BA 2D1VA 3NRVA 4PGGA 5TJJA 2YX4A 2D45A 4XRFA 2W85A 5BPIA 4A2UA 2DAOA 2CFXA 4A5NA 1W4MA 2A61A 3E6BA 1IF1A 4HW0A 3RPQA 6PAXA 4PCQA 1MGTA 3C7JA 1SFEA 1I1SA 2DU9A 3O6BB 2NNNA 4LK0F 1O3SA 3JTGA 4HF1A 1XSXA 2EFNA 2ZJ2A 4QWQA 2NS0A 2XKPA 2HYFA 1U5TA 3ECOA 1RNLA 3KFWX 1OYIA 5DD4A 3I64A 2VC1A 4O5VA 2DI3A 2H27A 4Q4ZF 4LD5A 5A2QZ 2MC3A 2DPDA 2OU2A 3KLNA 1KQ8A 5HLHA 3E3VA 4QLCU 3KP5A 2L4AA 2GXGA 2NYXA 4YFNF 5ICEA 3L9FA 4L9TA 2BV6A 1Z6RA 5ILUA 3Q5FA 1YS6A 1DUXC 3TGNA 2EFWA 1J59A 5IT9Z 4OMZA 1T38A 1UHMA 1SAXA 2YR2A 5HDGA 4M71A 5FFZA 2XRNA 1SMTA 3QU6A 4HV5A 2G7UA 2DK8A 1WKMA 1UFMA 5L3DA 2IA1A 3TO9A 3FMQA 3F8CA 1BI2A 5FD5A 2ZCWA 2CGPA 1FPQA 4UV9A 2FA5A 1F4KA 2LSOA 3M7GA 5HLGA 3WGGA 1TQMA 1TW3A 3GUDA 2EFOA 2ACJA 1S8NA 3ZMUA 2ZKZA 3T8TA 5E1WA 3Q9SA 4UV8A 3VODA 3K2ZA 3EETA 3KLOA 4A0XA 4AIJA 1QBJA 3ZMZA 2QQBA 1Z9CA 1R7JA 2QENA 2PBIA 1K79A 1JE8A 4Q5SF 5D5UB 1R5GA 4G6QA 4OIQF 3RPUA 5ERIA 1O57A 2P6SA 3GX4X 1IXRC 3F8MA 1C0WA 5KK1A 3H3ZA 2FOKA 2FSWA 5H6QA 3RKYA 1PUEE 2P4WA 1R1TA 2EV0A 1IN6A 1B59A 2HTJA 1F9NA 4HYEA 2L4MA 1LQ1A 4L9NA 3HUGA 3TDZC 1WWXA 3N4MA 3V8LA 1LDKB 3EQLF 5F64A 2PG4A 5LEJA 3I0TA 4M74A 5FO5A 1HKTA 2XGXA 2BBYA 1I27A 3MEXA 4RGUA 3IKTA 1YW8A 2FF4A 3LAPA 1O3QA 2XAFA 3TO6A 2V6CA 1EV7A 1W7PA 2FBIA 3BOQA 1XSDA 5LHGA 3FXUA 1L0OC 3I59B 4XLPF 3C1DA 5A2QK 3MQ0A 1R36A 2P5KA 5DV5A 1H9TA 4EM0B 3HOTA 1USSA 2P7VB 4GYIA 4GGGA 4A5MA 3SHFA 3E5QA 1R5HA 2IA2A 1QPMA 4ZZLA 1IUYA 4Y17A 2CYYA 2L01A 1OR7A 1XD7A 1SD4A 3KP2A 4P9FA 1ZN2A 4GO1A 4RGXA 4FX4A 3L09A 3R61A 1FT9A 4MEXF 2Y75A 3DPLC 2H94A 4U0YA 3P9KA 2IPQX 1I5ZA 5JVTA 2HR3A 1UB9A 4Z2YA 2XHKA 3GVAA 3CUQC 2M5WA 3REOA 3DXJF 3ZPLA 1Q1HA 4F7ZA 2PJPA 4UHTA 3GZ5A 2RC4A 4XSZF 2OA4A 3F8BA 5L3CA 3JW4A 1T39A 2O8XA 2HYGD 3CDHA 3E5XA 1IAWA 2PI0A 4I0AA 2V1UA 3HRUA 4BHBA 2FMLA 3I58A 3WE3A 2K7LA 2PN6A 2ZMEA 4BHPA 1Z6TA 2A6EF 3NQOA 2KIFA 3CTAA 2Q0OA 4HBLA 3F8FA 2RQPA 4HF0A 4HX7A 4A6DA 1ZAOA 3BJOA 2CG4A 2BGCA 3BJ6A 3R0AA 4KUMA 3ML6A 2RGVA 3CJNA 3H3UA 5HS8A 1Y0UA 2Z33A 1FBUA 3M1EA 4U7BA 2ADUA 1R1VA 5D4SA 1T98A 2A69F 1W7PB 3R0JA 5CVVA 4KIBA 4GCVA 4UVBA 4YG2F 2PLYA 4I02A 1HW5A 2QLZA 5E8GA 3ZMSA 1R22A 1ZG5A 3LAJA 1XGMA 4Y13A 1WRJA 4U7DA 2IT0A 3LQQA 5HDNA 5BOXA 3CUOA 2QQ9A 2VXZA 3FWEA 1BC7C 1W5SA 2HS5A 4N0BA 2Y0MA 2M45A 3KZZA 1ZARA 2PFBA 3U1DA 4UXNA 3J7AO 4EJWA 4CZZA 5H20A 3F72A 3E97A 2ELHA 3I71A 2P6TA 4KYWA 3V8KA 2MLGA 1MDMA 4U88A 5D8KB 1USTA 3F8NA 4MEYF 2RV8A 3FZVA 1UHWA 2XAGA 5AIPA 3QP5A 2CWEA 4UVAA 3T8RA 2VT2A 5LRRA 1TTYA 3G73A 2ISZA 5FGMA 2VE8A 3Q9VA 4EV0A 2VBYA 3JSPA 4LB6B 5E17F 2OZUA 1MJAA 4LG0A 1G3WA 4MHGA 1U6GA 3FX3A 2DK5A 2YU3A 3QPHA 3L00A 1BIBA 3GZ6A 3WE2A 3G3ZA 4MTEA 1IZ1A 1JHFA 3PQJA 2JT1A 5DCMA 1QQIA 4IPAA 1REPC 1IRFA 3V4GA 4EM2A 1HSTA 2ZBKA 4M6YA 3WTWC 1S3JA 3JSOA 1R1UA 4ENKA 4ZYHA 2FNPA 4BAYA 2FNAA 4AVPA 2W84A 1IN7A 1D8KA 2K27A 1YLFA 3M9AA 4WX9A 4M72A 3TKYA 2DPUA 2EA4A 5ICGA 3FHZA 2P7CB 4BYYA 1EH7A 1ZHFA 4I98B 3RI4A 3MZYA 3M8EA 5E1ZB 1ZRCA 4A0ZA 4IRGA 2WWYA 1MKMA 2KJCA 1GXPA 3KETA 1J0RA 1IXSB 3EUHA 1ZRDA 2ISYA 4H0EA 4KNYA 1WSUA 2J5PA 2M8EA 2JRTA 2FBKA 4L0YB 3K1MA 2DTRA 4MTDA 3H92A 1ULYA 3KP7A 4MNUA 3K1PA 1B9NA 4AIHA 3O2PE 1KU3A 5J8FA 1HKQA 3SQNA 1FYLA 2JPBA 1AOYA 1FY7A 4FHTA 3BZ6A 4HA8A 4RB0A 3QP6A 5D6FA 1ZREA 3ECHA 3R6SA 2PMUA 1IN8A 3QU3A 2EFPA 1BM9A 5LGTA 2DW4A 3ZN1A 4G7ZF 3QRFF 4RB3C 3I54A 2HQRA 2KIMA 4ON0A 4ESFA 4EJOA 3E6DA 2DLLA 2STWA 5DCMB 2OQGA 1XMKA 3GFMA 5E18F 5F6FA 4WXDA 2GWRA 4UVCA 4G7OF 2HQNA 2VT3A 4KN7X 2IP2A 1FP1D 1XDSA 2VOPA 3FF5A 2E1NA 5LGNA 3V8JA 1ONVA 2MH9A 3SZTA 4EJTA 3ISPA 2PMHA 4L9JA 2OZ6A 4TV7A 5FFXA 1Z91A 2EK5A 2QYOA 3WTXC 4LJZF 1SFUA 4OOIA 2VODA 1SD5A 1HBXG 4JQFA 4P5OA 2H09A 1ZLKA 1CGPA 4FT8A 3RDIA 1BOAA 4ASNA 5AIQA 1XB4A 4HLXA 1E2XA 5BS6A 2P5LC 1KQ0A 3HHHA 2MH2A 1U5TB 5ICCA 5CVJA 3MFKA 4IHSA 4OIOF 2FEZA 1K78A 1U5TC 4ZYEA 4ZH4F 5BPDA 4IHTA 5K5OA 4FX0A 4G7HF 1FZPB 2UZKA 1KYWA 1DP7P 4WK8F 5K5RA 2O61A 4JK1X 2C6YA 3GW2A 3M8FA 1MJBA 1B6AA 4N9HA 1G3YA 2XROA 1ZRFA 4NQWA 5CVIA 4I09A 3T0YA 1RZ4A 2A6HF 3O3KA 5IT3A 5HVQC 4IRHA 2WC2A 5JR3A 1KU2A 5L3FA 3GLXA 2ETHA 3C18A 1ON1A 2QZ8A 4HV6A 1S7OA 1YG2A 5H6RA 4M9SA 5DD8A 2UXNA 3ERED 1O3TA 3TOAA 2XVCA 3BPVA 1TNTA 2P8TA 4ZYDA 1J7KA 2B0LA 4IVNA 5JHUA 1CF7A 3WTYC 1FLIA 2EA2A 5F1RA 3HTSB 1ZGJA 3BPXA 2IA0A 3T5XA 2F5EA 4RAZA 2VOOA 2MA3A 1YFHA 1R23A 1YO5C 1XCBA 1U2WA 3R4KA 2L54A 3L7WA 2COMA 2HEOA 1XGOA 4M9XA 1HW2A 3WG9A 2O0YA 2M87A 2A07F 3FMRA 2CQKA 1D8JA 4BQAA 1XGSA 1FSHA 3FXRA 3TO7A 2OQRA 2R7DA 2GA1A 4A12A 3V7CA 4YIIA 1F1ZA 1BI0A 1IN4A 4I01A 2GA2A 3HTUA 1BI1A 1P92A 2RNJA 3KEQA 1R58A 2BE5F 2WTEA 3HOSA 1YW7A 4L9VA 1IRGA 2PQ8A 2DT5A 1QNTA 2YX7A 4D0PA 3V7RA 4L18B 4HF2A 1P4AA 3MCZA 4AIKA 3COAC 4U0WA 3VOEA 1O7LA 4K2EA 2XUBA 2A5YB 1LEBA 5AONA 1FNNA 3R60A 4B09A 1A04A 5ILVA 2LNBA 3QOPA 1R00A 2V1XA 4MQ9F 3P9IA 5DDGA 4G6DA 3J81Z 1K78B 1J2XA 2GZWA 3BP8A 2QQAA 4HAMA 5D4RA 2XAQA 4KFCA 3LA2A 3D5LA 1YIOA 4BXUA 2V9VA 4R1HA 2DBBA 2HTSA 3F23A 3K69A 4WCGA 1HXDA 4CGZA 2BYVE 3KP3A 5HOOA 3GO5A 4BNCA 1IW7F 2V79A 4RAYA 5JFRA 3JAMK 1P6RA 2HZTA 3EYIA 4DQ2A 1T0FA 2F5FA 3BY6A 4O3MA 3CLOA 3U2RA 5D8LB 1BJAA 2LKPA 3QPTA 4I2OA 2IVMA 5CJ9A 2O3FA 3QAHA 4HX4A 2VC0A 5D5VB 1S6LA 5CVRA 3SFZA 1HQCA 1DPRA 3DP7A 2FU4A 3PQKA 4LK1F 3HSRA 4N9IA 4LB5A 2GXBA 1CF7B 1LJ9A 4KDPA 4O6JA 3GFJA 2X4HA 4PDKA 2UXXA 2STTA 1J5YA 5FB2A 1XMAA 1XGNA 3MWMA 4LLNA 5JI6A 1SFXA 2F5CA 1KGSA 5LGUA 3LFKA 3JTHA 2K4JA 1T2KA 4ESBA 2MLKA 1KA8A 1QGPA 1RUOA 1H0MA 4AWXB 3F3XA 5BQTA 4KIFA 3NEUA 3B02A 1SD7A 5E8IA 5K5QA 2XIGA 2ESNA 4WF2A 2CO5A 4EVIA 5DYMA 2IRFG 5HS7A 4EMSA 3GEZA 3GF2A 3ULQB 1TBXA 1K7AA 1IXCA 2RDPA 2ZMEB 3F21A 1KYZA 2Q8KA 1OYYA 1P2FA 3LSTA 1W7PD 3DEUA 3FMSA 1S29A 4RS8A 1ZLJA 5E1XA 3ROUA 5LLQA 4LGWA 1G3TA 4XBFA 2HFHA 3GFLA 3ZMTA 1YW9A 2HWVA 2OAZA 4IXAA 1BBYA 2RKHA 2ZNYA 3EYYA 5CLSA 3TOBA 1B1BA 2K02A 4KMUX 1L3LA 3WGIA 3OV8A 3J80Z 3LWFA 5EEGA 2ZFWA 2ZXJA 5HDKA 4RB1A 3HSFA 2XASA 4CO8A 3I4PA 2L3DA 3J81K 2X0LA 2R7FA 4KIGA 3WTTC 1JXSA 3CO6C 2J5OA 2Z3YA 3GWZA 4XSXF 4GXOA 4HDVA 1TW2A 2O03A 5ICFA 2Z99A 1MD0A 2EV5A 4KMFA 1PDNC 5BMZA 2VN2A 1U3EM 4NHJA 4ZZDA 3HRSA 4IJAA 2A68F 3VEPA 3VB2A 2RVCA 4G9YA 4YFXF 1HW1A 1FX7A 2CSOA 3I5UA 1F5TA 1MDMB 5CYVA 2LDUA 4E70A 4UUVA 1G3SA 3F6OA 4IF4A 2M1BA 3AAFA 3ZN0A 3BJAA 4RGRA 3RYRA 2ZNZA 1P4WA 5HS9A 2EV6A 2JSCA 3RJPA 1ODDA 1XSVA 1STZA 3I59A 3KE2A 3ELKA 2RN7A 5LHIA 2CW0F 5D5WB 1FC3A 1B4AA 2OD5A 3E6MA 1S7AA 4ESJA 2W57A 2HGCA 4JBAA 1GXQA 1WQ2A 3ZQ7A 4LG0B 3KCCA 3KP4A 2VBZA 3HIFA 3RKXA 3FXQA 3KZYA 1RUNA 1Z05A 5FLXZ 4LFUA 1BN5A 4CDGA
chains in the Genus database with same CATH superfamily
2VUMJ 1V5GA 2M7BA 3U9GA 1P7IA 2PEXA 5IYBJ 2HKOA 3ABUA 1QU3A 1I1GA 4A69C 2PJRA 3OR1C 2GOXB 4LOCA 3H5NA 4HNUA 5J4YA 3IAM2 3SFIA 3BR0A 1QO0D 3CUQA 4OIPF 2QKMB 1MZBA 4ZDLA 3L2RA 2L2OA 2R3SA 3BG3A 3FKIJ 4YIFA 4QTRA 1WPKA 1U78A 2LH9A 3B73A 1QZEA 1H9GA 2VXDA 2XKOA 1UELB 1X58A 3BR6A 3BWGA 1G2HA 2NAZA 4KT5C 1JT0A 1Z0XA 1ZH5A 2CMPA 2WY8Q 1BC8C 4IX7A 3PSFA 1HF0A 1J9IA 5FRMA 3LSHA 1VTNC 2D2WA 4CYDA 3A4CA 2KZVA 2YSRA 3S3OA 1RIOH 2Y2ZA 5FLMJ 2NVXJ 2CUFA 1BR1A 2X48A 3GTKJ 1VQMI 3B6AA 3ZQIA 4BDYA 2L5QA 3K4CA 4RB2C 1QZZA 1AWCA 2K4BA 2QBYA 1D0YA 2M9HA 1GUUA 4I7HA 1DU0A 1A6QA 1YITI 3K70D 4Y33A 1VQ9I 1WVRA 1QHGA 3HPHA 1NHAA 5K1YA 3J80K 1YQAA 3ABTA 2JVGA 3TP0A 3CCJI 2H8WA 4RMNA 3FXOA 4ETSA 2BVMA 4KN4X 1XN7A 4CA0A 3CJQB 2ZSHB 5EGOA 3JAMZ 1OCZH 4B4CA 4XLCA 5HLIA 1ZYRF 2XV4S 1MJ9A 3WTUC 1JGGA 4P9UA 1T56A 3S2HJ 3K0LA 1BW6A 2IW5A 2K3FA 2KFDA 2FRHA 2GAUA 3PNTA 2QUFA 3DBLB 1SEUA 1LE8A 1ETQA 2K86A 1B9MA 5ILSA 3DTEA 4E7IA 3WGHA 2LLKA 2FE3A 2DMNA 2G7HA 4EGZA 1TNSA 4PGHA 2M30A 2DDAA 3GXOA 3P7NA 4FQGA 2E35A 4L5JA 3DPTA 2WV0A 3EUHC 3CMMA 4G8XA 4Y15A 3DV8A 2BY0A 5B3SH 4DYRA 2W24A 3IWZA 3H1CA 1RI7A 1LVAA 2XGEA 3O8HA 4A0YA 1PUFA 1M1EB 4ENNA 1VQ4I 1R4NB 2H6BA 3M8JA 2HPMA 1ETOA 2K9MA 2EJRA 5FD6A 4U0VA 5LD2C 3J7AY 5D5XB 2VQCA 4OU0A 2LVSA 2XPUA 4A3IJ 5LRSA 1K6OA 2LMDA 3KZIC 1ZTRA 3OYEA 1W0UA 5L3BA 3PUBA 4EQQA 3BG7A 2GIVA 2HOEA 1LDJA 1OCCH 1RRJA 2E1MC 2KJBA 4A6EA 2V26A 4A93J 2HXIA 2MD5A 3QWLA 2ZO4A 3OS1A 2F4OB 2PX9A 4XKVA 4A3DJ 3IKVA 4B47A 1LB2A 4CICA 3K4LA 3VYUB 5ED4A 4GYGA 3MMYB 1WFXA 1D5VA 1OCOH 3RTRA 4HLYA 2DQRA 3WTVC 4WXHA 3BQZA 3HRMA 3LA7A 5F0FA 3MZHA 1FOKA 4JX4A 1DPUA 5CVUA 5J8CA 4UUTA 1EJ9A 1OYWA 3GFIA 2FQ3A 3C2BA 2AHQA 4CXFA 4A3FJ 4R79A 1YTYA 1EH8A 4HQEA 1LEAA 3BR5A 1HKSA 2R7OA 2ZC2A 4HSTA 5F1JA 5J1RA 3CMYA 2HQ5A 2YPRA 1V4RA 5D6EA 1AKHB 2NS8A 4L5IA 5E3OA 1X1CA 4KISA 1DDNA 2IEKA 3HGYA 5IT9K 1LNWA 2DA5A 2NNYA 3BZCA 1U9OA 2PJRB 2P5VA 2V4JC 1Z3XA 3K9TA 3V42A 4B48A 2JZYA 1HSJA 3NWSA 3BROA 2XAHA 4XLNF 1G8XA 4IQJA 4L0ZB 3CUQB 1YJNI 1IN5A 2E34A 1LDDA 3H9QA 4A3BJ 1ZG3A 3WTSC 5F08A 3WTZA 5L3EA 1X3UA 3IH4A 4RAFA 5DS9A 1LFBA 2BEOA 1U8RA 1E3OC 5DEQA 5TISC 4BHCA 2K3PA 3HRTA 3JRFA 3KEOA 3FM3A 5F04A 4AU7A 5FLXK 3RCOA 3IL2A 4I0BA 3SZPA 2YUSA 1I6XA 4GRIA 2EILH 2MBFA 2EIMH 1OMIA 2VJIA 3KP6A 4EATA 4UNOA 3MAJA 2KISA 1VQ6I 4BY7J 2LKSA 2EWNA 4PFOA 3IRQA 2WAFA 3W6KB 1FTZA 4IHWA 3L2CA 2O9LA 5KVRA 2DDBA 3SXYA 1ZGAA 3JRAA 2JPCA 2Y9YA 1FJLA 1FOWA 4BH9A 3RKWA 1UCRA 2QBYB 2F5VA 3IC7A 3LNQA 3W3CA 3I4MJ 2QWWA 3WODF 4ENMA 2M0MA 2EFQA 5FRNA 2E7XA 3FM5A 2ELJA 3OOPA 4LLGF 4PJ0C 4YFKF 1Z1DA 4AIDA 1IO2A 1V3FA 4RGSA 3CCYA 3EUKL 4A3KJ 3VYSB 2LF8A 5EGOB 1R5ID 2D1HA 1H89C 9ANTA 4WXCA 2EB7A 4ZYGA 2WBMA 1YI2I 3HSEA 3F6VA 2F2EA 2AXLA 3S1RJ 4G94A 2M34A 5TRDA 1WJFA 3DCFA 5DCFA 1ETWA 4MQVA 2DTZA 4C3JJ 1TQIA 4BE2A 2E1CA 1YOVB 4HQMA 2KRFA 3PFIA 5GPCA 2ESHA 3AG1H 2P81A 2O6GE 1SD6A 2OV7A 2OCCH 2DO7A 4HOBA 3BTJA 3BR3A 2UWMA 1MSFC 1SFKA 3E6CC 4R8HA 5LHHA 3EUAA 3RSNA 4XOTA 1WI9A 4L5EA 3JRHA 4EM1A 3OIQA 2HDCA 5DUIA 4CCNA 4XOPA 1RR7A 5L3GA 4DNCA 4XRSG 3IWFA 3ZMVA 3VFZA 2Z9OA 1E3PA 1RC9A 4LLLA 3RIRA 2LD5A 4EJUA 3HB9A 4PZJA 4BQQA 3A0HC 5HNFA 4II3A 4KA4A 4XM3A 4OINF 4IRIA 3RQIA 3RYPA 4NC6A 3BG6A 3DTIA 2QVOA 2DJIA 4P55A 3A01A 2FXAA 3OL3A 3WU0A 2VONA 1GVJA 4XONA 1OPCA 3SZGA 2H6CA 1O7FA 2OTLI 3TBIA 5FLVA 2WAQA 3S1QJ 1FP2A 1X1BA 1JGSA 2NRAC 2VI6A 4V2GA 4EGYA 1XCVA 2R5ZB 1G59A 3C2HA 2FBHA 1TLHB 4XORA 1FSEA 1YX5A 2AO9A 2QM3A 3BDDA 4OMYA 2KRCA 2DOEA 3WU2C 2KL4A 4IOCF 4XNFA 1ZG1A 2DQLA 3BTLA 2A3SA 3HYIA 4Q47A 3SYTA 5LBQA 5FKOA 2XPWA 2W25A 3TQNA 2XGDA 1QVTA 3ZP5A 1GHCA 3OYIA 1BI3A 1JTXA 2JA2A 3OWTA 4E7LA 4DBRA 1IRXA 1YYVA 2F5DA 3LSJA 3H0DA 1PP8F 3F22A 3DFGA 4DYCA 3W6JB 3OY9A 2IJLA 2IS1A 2DXIA 1BIAA 4C9YA 1J75A 2L02A 3PL8A 2AS5F 3EDPA 4HZFA 3CO7C 1ON2A 3BZKA 3LL7A 2FMYA 4XN3A 1VQNI 2XAJA 1RESA 1BJZA 1FBQA 3DEWA 4MO7A 4S04A 1VQ7I 5EEHA 3TDUC 4S05A 2JRMA 4ZC3A 1LKXA 3K1NA 1KU9A 2VKDA 2XF5A 4M6XA 1W0TA 1YRNB 4XICA 1Z7UA 1Y1VJ 3GYHX 2XDVA 4WWCA 4EJVA 1QZYA 1HCRA 1TQPA 2VBXA 2W82A 3BR2A 2CH0A 2M0CA 2NOJB 4V19K 4M73A 1X2NA 1NG7A 2JTVA 2X6OA 2VQHA 4ANJA 1O3RA 1GVDA 2HKXA 4NB5A 3S2DJ 1FYKA 3V7SA 1SMYF 2GQQA 2VBWA 3FK6A 3LQRA 5J6XA 4LMYA 4OIRF 1CQTA 3LA3A 3IHUA 3IRRA 1ZKGA 2VE9A 1XPXA 1W5TA 1RR8C 2HZDA 2CV2A 1G6NA 4Q48A 5LFAA 5E20A 1LFUP 2ZMEC 1DGRM 1A35A 3IV5A 2MW8A 3Q0WA 3HBLA 1EH6A 4BJ5C 3I53A 1Y56A 4B8XA 2Y48A 1YS7A 3D0SA 2VKVA 5CKTA 2Z5UA 1JHHA 2W4SA 2K9NA 2DMQA 1OFCX 1KQ9A 1LVKA 1OKRA 2Q2EA 1V54H 3GLLA 4CHUA 2V1DA 4HDUA 1KU7A 3DBHB 4Z6YA 1PP7U 3HHGA 4ZDPA 5K7FA 4X6AJ 1D3YA 1MSEC 3DKWA 2LF7A 4J19A 2E7WA 4OAYA 5DUKA 4QPOA 2DOFA 4AD9A 2KKOA 2R7TA 1T6SA 4BXFA 3BTCA 4HEA2 3K10A 2G9WA 1XDUA 2DFIA 2KIUA 4MGRA 3ZMDA 1TP4A 3RQ4A 3DF8A 4A3JJ 3DQVC 2I5UA 2HXOA 2OBPA 3N97A 1FBSA 4M9ZA 1JKRC 1KONA 3E5UA 3WU1B 2AQFA 3C3WA 1P9QC 4KICA 2TDXA 5LEKA 3P9CA 1FYMA 1HC8A 1FWZA 5F0CA 3S2WA 1G4DA 4ENJA 4A3LJ 1P4XA 2HVRA 2K9LA 4HX8A 5EZHA 2X1EA 4P96A 2KDZA 1E17A 3T1BA 2D1VA 2ME0A 3S3NA 3NRVA 4PGGA 4YIRX 4JX5A 5TJJA 1MMGA 5K7HA 2YX4A 4FTHA 1BA5A 2D45A 4XRFA 2CQ7A 2W85A 1D0XA 3KYCB 5BPIA 4B44A 3Q0VA 3DKXA 1FMVA 2BHZA 4A2UA 2DAOA 2V6EA 2CFXA 2XGCA 5CQEA 4G6TB 2EINH 4A5NA 2B63J 3BCBA 5E3LA 1W4MA 3CCQI 2A61A 5EJCA 3E6BA 1TZLA 2JVHA 2KIQA 2XPVA 1Y6IA 4CCMA 4DW6A 4Y7NJ 3HKZN 1IF1A 4HW0A 3RPQA 2XC7A 6PAXA 4PCQA 1W1WE 3LSRA 1YHQI 1MGTA 5FKLA 3C7JA 1ZQ3P 1SFEA 4BUPA 1O4XA 1MMNA 1I1SA 2DU9A 2N8GA 3O6BB 2NNNA 4LK0F 4BE0A 4M3GA 3JTGA 1O3SA 4HF1A 1UHSA 1XSXA 2EFNA 5GADJ 2ZJ2A 3G4SI 2WB1A 4QWQA 1NK3P 2LY1A 2NS0A 1Q1VA 2XKPA 2HYFA 1U5TA 3ECOA 1RNLA 3KFWX 2Y9ZA 1OYIA 5DD4A 3I64A 2VC1A 4HNVA 1Y1WJ 4O5VA 2DI3A 3MN2A 4IHYA 2H27A 1FIAA 4CCKA 1DQUA 4BEHA 3CESA 1ACIA 1A6IA 4LD5A 5A2QZ 4Q4ZF 2MC3A 4B1RA 1OQYA 4N4NB 2DPDA 2OU2A 3KLNA 4XMYA 4PSWA 1KQ8A 5HLHA 3E3VA 4RM2A 4QLCU 2KT0A 3KP5A 5J1YA 2BHYA 2L4AA 5JVGF 1OISA 2GXGA 4JOMA 4RLFA 3ASNH 2DA1A 2GLOA 2NYXA 1IJWC 4YFNF 1LPQA 5ICEA 3L9FA 4FE7A 4L9TA 2I10A 4C2MJ 1TC3C 1WCMJ 2BV6A 1ORKA 1Z6RA 3TW7A 5ILUA 3Q5FA 1QA6A 1OCRH 1YS6A 1DUXC 3TGNA 2EFWA 2H1LA 5IPAA 4M6VA 3JRCA 3IP4B 2DA3A 1MBGA 1J59A 4E7JA 5IT9Z 4OMZA 3I55I 1T38A 1UHMA 2R7UA 3L1PA 1SAXA 2YR2A 3CCEI 1GV5A 1LFPA 5HDGA 3ERMA 1VF9A 4M71A 2EIKH 5FFZA 2XRNA 1EKEA 2Z2SB 1SMTA 3QU6A 4HV5A 3GTJJ 2G7UA 2DK8A 4G12A 1A31A 1WKMA 1ETXA 4BJ6C 1UFMA 3D5SC 5L3DA 1E0EA 2IA1A 3TO9A 3FMQA 3F8CA 4KT6A 1BI2A 3CDIA 5FD5A 3S15J 4QIWN 2ZCWA 2CGPA 2HNHA 1FPQA 4UV9A 3M07A 4FASD 2FA5A 3JR9A 2HVQA 1F4KA 3OYDA 4AYBN 2R5YB 2LSOA 3M7GA 5HLGA 1MNMC 3WGGA 2TRTA 1TQMA 4PK4A 4OAZA 1TW3A 1IUFA 2HQAA 3GUDA 2EFOA 4A3GJ 2MC4A 2EIJH 4X0GA 2ACJA 1K83J 1S8NA 5TGTA 3OL4A 2ZKZA 3ZCOA 3T8TA 3ZMUA 2Y0SA 3GCMA 5E1WA 4UUSA 2JA5J 3Q9SA 3NWTA 3ZGKA 1OLTA 4UV8A 5B1BH 3VODA 4RA2A 3DU5A 3VYTB 3K2ZA 3EETA 3KLOA 4E6KG 2EZHA 2E71A 2EBIA 4A0XA 4AIJA 2EPFA 1QBJA 3ZMZA 2QQBA 5JLXA 1Z9CA 1R7JA 3ZQFA 4BL0B 2L7FP 2QENA 2XF6A 2LY9A 2PBIA 3ABLH 2LREA 1K79A 5J1UA 1JE8A 4Q5SF 5D5UB 1R5GA 1WGXA 3KX2A 3H9GA 2KHMA 4G6QA 4MFDA 4OIQF 3RPUA 2XSJC 2CUZA 3BT9A 1O57A 5ERIA 2P6SA 4HSRA 3H9JA 3GX4X 2OPTA 1IXRC 4XR6A 3S1NJ 2CQNA 4DBQA 3F8MA 3KEYA 2ZXHA 2HDDA 1C0WA 1X1PA 5KK1A 3H3ZA 3TMOA 1RPWA 2KZGA 3LOCA 2FOKA 2FSWA 2CS3A 5H6QA 3RKYA 4PJNA 1PUEE 1JJ8C 3KIOA 2P4WA 3AG2H 2E5NA 3WHBA 5KHDA 1R1TA 2M4KA 2W00A 1TWCJ 3FIWA 3A0BC 3Q0UA 1JKOC 1TWHJ 2EV0A 4LIUA 3FXJA 1IN6A 1B59A 2HTJA 1F9NA 1JI8A 2WAEA 4HYEA 2L4MA 4F92B 4E7KA 1LQ1A 1ZR2A 4C3HJ 3MZ8A 1MBHA 3CP2A 2XSDC 3FHNA 4FE4A 4IEJA 4L9NA 3HUGA 3TDZC 1WWXA 4IZZA 3N4MA 3V8LA 2JA8J 3MKYB 4C2TA 2JMWA 1LDKB 3BG9A 3EQLF 4BEHB 3DWLE 5F64A 3HGGA 3QPSA 3LSPA 3G1OA 1I3QJ 3L2VA 3DEEA 2PG4A 1VQLI 2EZKA 2QKLB 1TT0A 3I0TA 5LEJA 2W1OA 4M74A 1XS9A 4XQFA 1PVEA 3B6CA 5FO5A 3X2QH 1HKTA 2XGXA 2BBYA 3A03A 1I27A 1FOXA 2ME6A 1UMQA 3MEXA 2LY2A 4M3FA 4RGUA 3IKTA 1K61A 3S1MJ 4ABZA 3M3YJ 1YW8A 2FF4A 3LAPA 1O3QA 1MMDA 2R7QA 1BR4A 3F0CA 5IYDJ 2XAFA 2E60A 3HPGA 3TO6A 5M3MJ 4NUBA 3CC4I 2DFHA 2V6CA 3CD6I 4UB6C 1EV7A 1W7PA 2FBIA 4D7MA 3I3LA 3BOQA 3FXMA 3CCLI 1XSDA 5LHGA 3FXUA 1L0OC 2NVTJ 2E36A 3I59B 2DN0A 4D7NA 3S3MA 1Z21A 2WAQN 3C1DA 4XLPF 5A2QK 3MQ0A 1R36A 2B9SA 2P5KA 5DV5A 1H9TA 5BNGA 3HG9A 4BE1A 1IRZA 4EM0B 3HOTA 2GIZA 1USSA 1JUSA 2P7VB 3S16J 4GYIA 4GGGA 3OS0A 2CJJA 4DGWB 3IAS2 5H2FC 2FJ1A 4A5MA 1VQOI 3SHFA 1UG0A 3DTKA 4XKWA 3E5QA 1B72A 1R5HA 3AG3H 3TW6A 1ZK8A 3IH2A 2IA2A 1QPMA 4ZZLA 3HXLA 3NAUA 4Y17A 1IUYA 2CYYA 2L01A 2E2IJ 1OR7A 1XD7A 4HNTA 3FISA 4DJAA 1SD4A 3KP2A 4B3AA 4P9FA 4V2FA 3DLAA 1ZN2A 2OTJI 3K4NA 1YIJI 3Q3SA 4GO1A 2KRHA 4E4HA 4RGXA 4D1QA 4FX4A 3CJRB 4CUGA 2FUG2 3L09A 3R61A 3CCMI 2ID6A 1FT9A 1QPIA 4MEXF 3AL0B 2Y75A 4RLQA 3DPLC 2H94A 4U0YA 1VNDA 5FKMA 2LC2A 3MD2A 3P9KA 2IPQX 3G2BA 4N4OB 4YELA 1I5ZA 5JVTA 3JRIA 2EZIA 2HR3A 2VJ4A 1UB9A 3AL0C 5FROA 4Z2YA 2XHKA 3GVAA 3CUQC 2M5WA 3REOA 3DXJF 3ZPLA 1Q1HA 4F7ZA 2PJPA 2L9SA 3CC2I 1YE9A 2L9NA 4LG3A 4UHTA 3W2VA 3GZ5A 2EH3A 1HDPA 2DCEA 1MNEA 2RC4A 4XSZF 5KAFC 5M3FJ 1MBKA 2OA4A 3F8BA 5L3CA 3JW4A 1PJRA 4RDUA 1D0ZA 2DMPA 3F9KA 3QYEA 1T39A 2O8XA 1LUJB 2HYGD 3CDHA 3E5XA 2JJ7A 1IAWA 5GAEJ 2PI0A 4I0AA 2V1UA 1YX3A 3QYBA 3HRUA 4BHBA 3PIPF 3K4JA 2FMLA 3I58A 3WE3A 4CSWA 3ESWB 2K7LA 4BS9A 2PN6A 2ZMEA 4BHPA 4CYCA 1Z6TA 4JX6A 1U0JA 2A6EF 3FKJA 4EEFG 2JQ7A 5C44J 3NQOA 2KIFA 3I4NJ 3CTAA 1LE8B 1AA7A 2GOMA 4IQ4A 2IGKA 2HU9A 3VYRB 4NBQA 2JA6J 2IGMA 2Q0OA 2Y31A 4HBLA 2HPIA 4XLEA 4NNJA 3F8FA 5FJ8J 3DPUA 2QGUA 3OIPA 2RQPA 1UZCA 2CFOA 3OYAA 4HF0A 4HX7A 4A6DA 2CQXA 3BJOA 1ZAOA 2Y30A 2K9SA 2CG4A 3BJ6A 2BGCA 3R0AA 1IDYA 4KUMA 3ML6A 2RGVA 1VQ5I 3CJNA 3H3UA 1ERDA 1PUFB 4C2UA 1K6YA 2UUZA 5HS8A 3GTPJ 5CQGA 2YS9A 2QCOA 2XF7A 3PUFA 2WV1A 1Y0UA 2QF7A 2Z33A 1FBUA 3C2GA 3M1EA 4U7BA 1I3AA 2ADUA 4ITVA 1R1VA 5FKNA 3CMEI 5D4SA 1T98A 2A69F 1WH5A 1W7PB 3R0JA 2Q1ZB 1V55H 1EF4A 3O8GA 1HOMA 4W97A 4XKCA 5CVVA 1BR2A 1R49A 1GT0C 4KIBA 4GCVA 4UVBA 4YG2F 2PLYA 4I02A 4KJZA 1HW5A 2QLZA 2DFEA 5E8GA 4HRIA 4FCYA 3W2WA 3ZMSA 1R22A 1S9HA 2AXTC 2HOTA 1ZG5A 2TCTA 3LAJA 1XGMA 4Y13A 1WRJA 4U7DA 3JRBA 1B72B 2D5VA 3FXKA 3ZR8X 1VQKI 4PJLA 1T8IA 2BVLA 2IT0A 2KDOA 3LQQA 5HDNA 3W6VA 4II2A 3CUOA 5BOXA 2QQ9A 3K4BA 5B66C 2VXZA 4I6ZA 2VB6A 3FWEA 1S72I 1BC7C 2LK2A 1W5SA 3FDYA 2JK3A 1ENHA 2HS5A 4W1UA 4N0BA 4A3CJ 1FEXA 2Y0MA 2M45A 3ZQGA 4P1WA 4XK4A 3KZZA 5B1AH 1ZARA 2PFBA 4MIMA 3U1DA 4XRSA 4CCJA 4UXNA 3J7AO 1F36A 1RKTA 2R4GA 4EJWA 2HOSA 3PJRA 1Y8RB 4CZZA 5H20A 3F72A 3E97A 2ELHA 3I71A 2JUGA 1A36A 1MH3A 2P6TA 1XG1A 3BCAA 2F48A 4KYWA 3V8KA 2MLGA 1MDMA 4U88A 1UG2A 2O5RA 5D8KB 1USTA 3F8NA 4MEYF 2VJ5A 5B5EC 4XIDA 3A2KA 1Z3YA 2RV8A 2MYSA 2BZTA 1MMAA 1VI0A 2BOLA 3BTIA 5M5YJ 3PNYA 3FZVA 2LOOA 4C3IJ 1UHWA 2L7MP 2XAGA 3G71I 2VLAA 5AIPA 3ZRGA 3QP5A 2CWEA 3TP3A 4UVAA 3T8RA 2VT2A 2LP0A 3BLYA 5LRRA 1TTYA 2DA7A 3G73A 2ISZA 5GTHC 5FGMA 2VE8A 4I99C 1PYVA 3Q9VA 5IY5H 4A3EJ 4AVZA 3BQYA 4EV0A 3RZDJ 3ZQQA 2R92J 2VBYA 3JSPA 4LB6B 1P7JA 1I39A 2L9VA 3I9V2 5E17F 2OZUA 3D1NI 1MJAA 4CYCB 4LG0A 1FTTA 3HJEA 4RAGA 1Y8QB 1G3WA 4MHGA 3BR1A 1U6GA 3FX3A 2DK5A 2YU3A 3QPHA 3L00A 3SDBA 1BIBA 3GZ6A 1UAAA 3WE2A 3GMEA 1BW5A 5GPAA 3ABMH 3G3ZA 4MTEA 1IZ1A 1JHFA 1ETKA 2Y0SN 1K4TA 4S0HB 2NVQJ 4FISA 3PQJA 3KYLA 2JT1A 1MBFA 2X1DA 5DCMA 1D1BA 1QQIA 2DMUA 4IPAA 1REPC 3FBIB 5DM6F 1IRFA 2L9RA 3V4GA 3QPLA 2Z16A 4EM2A 2JWTA 3PM1A 1HSTA 2ZBKA 2HOAA 2A05A 2O7OA 3QOEA 3PNVA 4HPQA 4RM3A 3J7ZI 4M6YA 3WTWC 4F93B 1S3JA 4DIQA 3JSOA 2ZJQF 1R1UA 4XRMA 5J47A 1X3ZB 4NDLA 3JREA 3OS2A 1OCTC 4ENKA 4ZYHA 1DP3A 1TL8A 2LG4A 1Z7LA 4DOZA 2FNPA 1R4MB 4BAYA 5C4JJ 3OYLA 2FNAA 1T0FC 5EG0A 4AVPA 2QQ8A 2W84A 3A01B 1IN7A 1D8KA 2K27A 1YLFA 3M9AA 4WX9A 1HDDC 4M72A 1SFOJ 2X9DA 3TKYA 2DPUA 2EA4A 3KYDB 5ICGA 3FHZA 2QA4I 2P7CB 2L7KA 4BYYA 1EH7A 1ZHFA 4I98B 5EZGA 3RI4A 3MZYA 2R93J 1S7EA 5F27A 4QPQA 1NG6A 3M8EA 5E1ZB 2QEXI 1ZRCA 4H4KC 3G1MA 2JN6A 4A0ZA 3U1KA 4IRGA 2WWYA 1MKMA 2KJCA 4BXXJ 1ZR4A 1GLNA 1GXPA 3KETA 2GBYA 1J0RA 3E1SA 1IXSB 2GXAA 3EUHA 1ZRDA 3ZQLA 2ISYA 1N78A 4H0EA 4KNYA 1KZHA 4IL6C 1WSUA 2J5PA 2M8EA 2JRTA 2MD0A 2FBKA 2VASA 3SEQA 2I8DA 4L0YB 1X2MA 3K1MA 2DTRA 4MTDA 3L2WA 3H92A 1ULYA 3JCUC 3KP7A 4MNUA 3K1PA 3PFYA 1B9NA 4AIHA 3O2PE 1KU3A 2BXYA 1B8IA 3M1CA 1MNDA 1QVUA 2LKXA 5J8FA 2ZFUA 5EEAA 4XLAA 1HKQA 5K7ZA 1V5EA 3SQNA 3GTGJ 1FYLA 2NXNB 4ZJZA 1T33A 2JPBA 2K85A 1AOYA 1FY7A 4FHTA 3VSLA 4IO9F 3BZ6A 4HA8A 4RB0A 5IYCJ 3QP6A 5D6FA 1W36C 1ZREA 3ECHA 3R6SA 5GTIC 2PMUA 1IN8A 3QU3A 3ZXSA 3K4KA 2EFPA 1BM9A 5LGTA 2DW4A 2H8RA 1MMSA 2H1KA 3ZN1A 2X6XA 2Q2EB 3CCSI 1SVLA 4G7ZF 1U9NA 3QRFF 4RB3C 3CCRI 3I54A 2HQRA 1YJWI 2KIMA 4ON0A 4ESFA 4EJOA 4UB8C 1K4SA 1Y0NA 1RETA 1WJBA 3E6DA 3P5JA 2DLLA 4BBSJ 5C3EJ 3GTMJ 2YU9J 1AKHA 2JA7J 2STWA 1DU6A 3BC8A 2OQGA 1XMKA 2DA2A 5DCMB 3GFMA 5E18F 2DOAA 5F6FA 3OYKA 4WXDA 2CQQA 3W2AA 4BGDA 1FIPA 2GWRA 3HOZJ 2P0WA 4UVCA 4G7OF 2VKEA 2HQNA 2R7RA 2VT3A 2RAEA 4CCLA 4KN7X 2IGNA 2IP2A 1IV8A 1FP1D 5DM7F 1GDTA 1YJ9I 3LSKA 2HDWA 1XX5A 1XDSA 3L2QA 1WJ5A 2VOPA 3K6GA 4NC8A 2XB0X 3FF5A 2E1NA 3H5RA 2FX0A 3PIOF 5LGNA 1H8AC 3V8JA 2M2EA 1QHHD 1ONVA 2MH9A 3VDXA 2IXSA 3SZTA 4EJTA 3ISPA 2PMHA 4L9JA 2CV1A 2OZ6A 4TV7A 5FFXA 1Z91A 4PUSA 2EK5A 2QYOA 5EG0B 3WTXC 3OSGA 4LJZF 3OYJA 2MG4A 4OOIA 4DZPA 1SFUA 2VODA 1SD5A 3G6EI 3TEDA 1HBXG 2VPLA 1TWAJ 3OYGA 1FMWA 4JQFA 4P5OA 1WJAA 1JTYA 2H09A 4BY1J 3ZOBA 1ZLKA 3ASOH 1CGPA 4FT8A 3HOXJ 1OCPA 3CCUI 3RDIA 1BOAA 4ASNA 2FOWA 5AIQA 3OOUA 2HI3A 1XB4A 4HLXA 1E2XA 5BS6A 2P5LC 3ZQHA 2F6CA 1KQ0A 2WADA 3HHHA 2MH2A 2W7NA 1U5TB 5ICCA 1W36D 5CVJA 3HKZA 3MFKA 4IHSA 4OIOF 2FEZA 2LYCA 3S93A 1K78A 1U5TC 4ZYEA 1TWFJ 4ZH4F 5BPDA 4IHTA 5K5OA 1QRYA 4FX0A 4G7HF 1FZPB 2HYJA 2UZKA 2M7AA 1KYWA 1Z77A 3S8PA 3K4MA 2KLOA 1DGWY 1DP7P 5EDNA 3LSMA 4WK8F 5K5RA 3CZ6A 3H35A 2CUEA 2O61A 1IV6A 2COBA 4JK1X 1AHDP 2R7XA 4E7ZA 2C6YA 1Y39A 4AC0A 3GW2A 3M8FA 3ABKH 4CH7A 2CV0A 3GBGA 1MJBA 1B6AA 2Y69H 4N9HA 1G3YA 2F4MB 2XROA 1ZRFA 2FQ4A 4NQWA 3AFHA 2ID3A 4I09A 1RZ4A 4NC7A 5CVIA 3T0YA 2A6HF 3O3KA 1EA3A 1D5YA 1I6HJ 5IT3A 2ELKA 2ZSIB 2VJJA 2L0KA 1B8IB 5HVQC 2NVUB 4IRHA 2WC2A 2E1MB 3S14J 4Y3OA 5JR3A 4GDFA 1KU2A 5L3FA 3GLXA 2ETHA 5HLTA 3C18A 1ON1A 3SDGA 2QZ8A 4HV6A 1S7OA 2OC6A 1YG2A 5H6RA 4M9SA 5DD8A 2UXNA 3ERED 1O3TA 3CP8A 2PMZA 3TOAA 1JKPC 4CZCA 2MGQA 2XVCA 4BU2A 2EQRA 2UV1A 4F91B 3BPVA 1TNTA 4JYKA 4X1EA 3H36A 2R5ZA 1MW7A 2P8TA 1WH7A 4ZYDA 5JHFA 1J7KA 2B0LA 2FD5A 1AU7A 4IVNA 4JP0A 1RKWA 1VZ0A 5JHUA 1CF7A 3WTYC 1FLIA 3QODA 2NVYJ 2EA2A 5F1RA 3HTSB 1ZGJA 3BPXA 2IA0A 3LSGA 3T5XA 3ONQA 2F5EA 4RAZA 5GAGJ 3OYBA 2VOOA 3LSIA 2MA3A 1YFHA 2QSGX 1R23A 1YO5C 1XCBA 2A5WA 1U2WA 3R4KA 2MABA 2ZXIA 2L54A 2ECCA 3L7WA 2COMA 4UUSB 1R71A 1VQ8I 2RREA 1NH3A 2HEOA 3DLLF 3OIOA 1XGOA 2E2JJ 4M9XA 1HW2A 3WG9A 2O0YA 4AYBA 2M87A 2ZB9A 2A07F 3FMRA 2CQKA 3OSFA 1D8JA 2W48A 4BQAA 1XGSA 1FSHA 5M5WJ 3FXRA 3TO7A 2OQRA 2R7DA 3LFUA 2R7ZJ 2GA1A 4IHVA 4A12A 2MFZA 3GTOJ 5HODA 3V7CA 4YIIA 1YRNA 1BI0A 1F1ZA 1W5CC 3E7LA 1IN4A 1Z67A 4I01A 2GA2A 3HTUA 3DU6A 1T95A 3EPZA 4YRVA 1NTCA 1IGNA 2VQLA 1S5LC 1R6RA 2RNJA 1BI1A 1P92A 3KEQA 1R58A 3SJMA 2BE5F 2WTEA 3KPHA 3HDDA 3HOSA 1JUMA 1YW7A 4L9VA 5J3LA 4RBOA 1IRGA 2PQ8A 4IKFA 2DT5A 2A6TA 2KMUA 1ETVA 1WHUA 3OR2C 1ZGWA 1QNTA 2YX7A 1SVOA 3E0JB 3HM5A 4D0PA 4DYQA 3OYCA 2R7WA 2LRDA 4Y52J 2V7FA 1POGA 3V7RA 4L18B 4HF2A 1P4AA 4A3MJ 1MH4A 3MCZA 4AIKA 3COAC 4U0WA 3VOEA 4YEJA 4D5CA 3VPRA 1O7LA 4K2EA 2XUBA 4MFEA 2A5YB 2OCEA 1LEBA 1X19A 5AONA 1FNNA 3R60A 4B09A 1A04A 5ILVA 1X1DA 2LNBA 1SAUA 2F4IA 1BL0A 3QOPA 3HUGB 4XL9A 1R00A 4M3BA 2V1XA 2M3AA 3P9IA 4MQ9F 5E79C 5EYRA 5DDGA 4ZTFA 4MLOA 4G6DA 1IG7A 3J81Z 1WZ2A 4IHXA 1K78B 1J2XA 2GZWA 3BP8A 2QQAA 2LBFA 4BJTA 2DFFA 4HAMA 5D4RA 2XAQA 2ECBA 4KFCA 3LA2A 3D5LA 1YIOA 2B7EA 4BXUA 2BW3A 3H3VK 2V9VA 5KAIC 4R1HA 2DBBA 2HTSA 1BOBA 3HEFA 3F23A 1MBJA 3K69A 2X6YA 4WCGA 1HXDA 4CGZA 4J00A 2BYVE 2X51A 4AUXA 1APLC 3KP3A 5HOOA 1E3HA 3GO5A 1JUPA 4BNCA 1IW7F 2V79A 1IDZA 4RAYA 2AQEA 4FETA 5M5XJ 3QYFA 4NQWB 2ZJRF 5JFRA 3JAMK 1P6RA 2DJNA 2V9KA 2HZTA 1JKQC 3EYIA 4XKBA 4DQ2A 3VWBA 2R7SA 4BBRJ 3K2AA 1T0FA 4D5FA 2GM4A 2F5FA 3BY6A 3OYFA 4O3MA 3CLOA 4M3EA 2WB1N 3U2RA 4F55A 3RKQA 5D8LB 1BJAA 2IS4A 2ICWG 2LKPA 3QPTA 2HVSA 4I2OA 1ETYA 2BY2A 2IVMA 5CJ9A 2O3FA 2IBDA 3QAHA 4HX4A 3U21A 4BQNA 2VC0A 3OYNA 3RPUD 5D5VB 5JLWA 1S6LA 5CVRA 3SFZA 5HNHA 1HQCA 1DPRA 3I56I 2XAUA 3DP7A 1F43A 2FU4A 3PQKA 1WI3A 4LK1F 4LITA 3HSRA 1OR7C 4N9IA 4XLFA 4LB5A 2GXBA 1SC7A 1CF7B 1LJ9A 4KDPA 4O6JA 4F3QA 3GFJA 1NK2P 5E3MA 2X4HA 2M4GA 4PDKA 1WJEA 3WHCA 2UXXA 3A02A 2STTA 1J5YA 3A1YA 4ZYAA 5FB2A 1XMAA 1XGNA 3MWMA 4LLNA 5JI6A 1SFXA 2F5CA 3CMAI 1KGSA 2IS2A 3CDLA 5LGUA 3LFKA 3JTHA 2K4JA 1T2KA 2X85A 2BXZA 4ESBA 5J4VA 4BACA 3HZJA 2NS7A 2MLKA 3FK7A 2JUCA 1KA8A 1N25A 1QGPA 2OF7A 2OJED 2CW7A 5GAHJ 2DT6A 1RUOA 1H0MA 3MVPA 4AWXB 3F3XA 5BQTA 4KIFA 3NEUA 5J40A 2VL8A 3B02A 1SD7A 5E8IA 3IUOA 2IS6A 4PSXA 2E5ZA 3UR3C 3OYHA 3FBNB 5K5QA 2XIGA 3BG5A 4B3XA 5F0HA 2ESNA 4WF2A 4J01A 3CCVI 2CO5A 3K7AJ 4EVIA 1D1CA 5IOZA 5DYMA 2IRFG 3L2UA 1MIJA 3RZOJ 4U87A 5HS7A 4EMSA 1D1AA 3GEZA 2KQRA 3GF2A 3ULQB 1TBXA 1K7AA 1IXCA 2RDPA 3D5RC 2ZMEB 3UNGC 3F21A 4IOAF 1KYZA 1IC8A 2DA6A 2Q8KA 3DKYA 3GTQJ 2DYRH 1OYYA 1P2FA 3LSTA 1W7PD 3DEUA 3AKZA 3FMSA 2O8KA 4GFBA 1UJ8A 3NARA 1VQPI 3J7YJ 1S29A 4RS8A 1ZLJA 5E1XA 4BKXA 2V1NA 2DYSH 3ROUA 3GZNB 2KP6A 5LLQA 2CU7A 4LGWA 2Z1DA 1G3TA 2MSYA 3HC7A 4XBFA 2HFHA 3GFLA 4Y4RA 2R0QC 1XTAA 4QSHA 2ZXWH 3ZMTA 1YW9A 2R5YA 4D9JA 1XC5A 2HWVA 1JJ6C 1U8BA 2OAZA 4IXAA 2CW8A 5IOYA 3HOYJ 3WG7H 1BBYA 1SVMA 2RKHA 2ZNYA 3EYYA 2LBFB 5CLSA 2RNGA 4PFPA 3ZQCA 3TOBA 1B1BA 2K02A 4KMUX 2QSHX 3MKZA 2BW3B 1X4OA 2VKHA 4HG2A 1L3LA 3PO2J 4AM3A 1X4PA 3WGIA 2L7ZA 3OV8A 3J80Z 3LWFA 5EEGA 2ZFWA 2ZXJA 3MKLA 5HDKA 2VIXA 4ZTJA 4E7HA 3HOWJ 4RB1A 2DA4A 3G1LA 2WY7Q 3HSFA 3SEZA 5C4XJ 5KNLA 2XASA 4CO8A 2K9QA 3I4PA 3CJTB 5IP6A 1J09A 2L3DA 3J81K 3OYMA 2M8GX 2K5CA 1JT6A 3FXLA 2WA0A 2X0LA 1N75A 2R7FA 4B43A 4KIGA 3WTTC 4PJMA 2IGOA 2EZLA 1VFCA 1JXSA 2G0EA 1V5FA 3CO6C 3HOUJ 2J5OA 2CRGA 2XB5A 3PSIA 2Z3YA 2DMTA 3GWZA 1MBEA 2BY1A 4XSXF 4OWRB 1X1AA 4GXOA 2VPRA 4HDVA 3CC7I 1TW2A 2O03A 1FOYA 2LTPA 2VQGA 5ICFA 3PO3J 2Z99A 1MD0A 2XRLA 2EV5A 4KMFA 1PDNC 3CLQA 2KPMA 3LMMA 5BMZA 2LFBA 2VN2A 2E2HJ 3M4OJ 1U3EM 3VSKA 4NHJA 4LIVA 4PJJA 4ZZDA 1H88C 4XN0A 3HRSA 4IJAA 2A68F 3VEPA 3VB2A 3CF2A 2RVCA 5E3NA 4G9YA 4YFXF 1HW1A 1A5JA 2E19A 1ITYA 1FX7A 2CSOA 4DZJA 3I5UA 3UKGA 3CF5F 1F5TA 1MDMB 2E1OA 2JSPA 1GV2A 2QSFX 3CQZJ 1ZELA 5CYVA 3JRDA 2LDUA 4E70A 4UUVA 1G3SA 3N05A 5KCMA 3F6OA 1WJDA 4IF4A 4KITB 2M1BA 3AAFA 3ZN0A 3BJAA 1XMXA 4RGRA 3RYRA 3GTLJ 5FKKA 2OUMA 2ZNZA 4BDZA 1P4WA 5HS9A 4BQOA 1N77A 2CUJA 2EV6A 3K70C 1T08B 2JSCA 5IP9J 4F52A 3HL2A 1HLVA 3RJPA 4ZDOA 4C30A 5DTDA 4CCOA 1ODDA 1XSVA 5IP7J 3IH3A 2PMZN 3H0GJ 1STZA 3I59A 3KE2A 3ELKA 2RN7A 2RQQA 1X3WB 2CW0F 1WJCA 5LHIA 4M3DA 5D5WB 1HA8A 2DODA 1FC3A 1B4AA 2OD5A 2K40A 3E6MA 2IAIA 1S7AA 4ESJA 2W57A 2HGCA 2R7VA 4JBAA 5EF6A 2ZJPF 1GXQA 1WQ2A 2BY3A 3HOVJ 3ZQ7A 4LG0B 3KCCA 3KP4A 2VBZA 3HIFA 3OMYA 1OJLA 2LR8A 4UY8I 2V9PA 2NOGA 3QQAA 5CPRB 3RKXA 3S32A 3DBRB 4I76A 3FXQA 3KZYA 3JRGA 4XLHA 3H5AA 3TL4X 3S17J 1R9TJ 3AG4H 1RUNA 1Z05A 5FLXZ 1SANA 1I50J 2X1CA 5GP9A 4LFUA 1BN5A 3MKWB 4E7SA 2X6WA 1TWGJ 2DT7B 4CDGA 1TT5B
chains in the Genus database with same CATH topology
3U9GA 2PEXA 2HKOA 3ABUA 1I1GA 3CUQA 1QO0D 4OIPF 1MZBA 2R3SA 4YIFA 1U78A 3B73A 1H9GA 2XKOA 3BWGA 2NAZA 4KT5C 1ZH5A 1BC8C 1J9IA 1VTNC 2D2WA 4CYDA 2YSRA 1RIOH 4RB2C 1QZZA 1AWCA 2K4BA 2QBYA 4I7HA 1NHAA 5K1YA 3J80K 1YQAA 3ABTA 4ETSA 4KN4X 1XN7A 3JAMZ 5HLIA 1ZYRF 2XV4S 1MJ9A 3WTUC 4P9UA 3K0LA 2IW5A 2FRHA 2GAUA 2QUFA 5ILSA 2K86A 1B9MA 3WGHA 2FE3A 2G7HA 4EGZA 1TNSA 4PGHA 2M30A 3GXOA 3P7NA 4L5JA 3DPTA 2WV0A 4G8XA 4Y15A 3DV8A 2W24A 3IWZA 1RI7A 1LVAA 4A0YA 4ENNA 2H6BA 2EJRA 5FD6A 4U0VA 5D5XB 4OU0A 5LRSA 1K6OA 5L3BA 4EQQA 2GIVA 2HOEA 1LDJA 2KJBA 4A6EA 2MD5A 2ZO4A 3IKVA 1LB2A 4CICA 5ED4A 4GYGA 1D5VA 3RTRA 4HLYA 2DQRA 3WTVC 4WXHA 3HRMA 3LA7A 3MZHA 1FOKA 1DPUA 5CVUA 5J8CA 1OYWA 3GFIA 2FQ3A 4CXFA 4R79A 1YTYA 1EH8A 4HQEA 1LEAA 1HKSA 2YPRA 1V4RA 5D6EA 4L5IA 1DDNA 5IT9K 1LNWA 2NNYA 2P5VA 3K9TA 2JZYA 1HSJA 3BROA 2XAHA 4XLNF 4L0ZB 3CUQB 1IN5A 1LDDA 1ZG3A 3WTSC 3WTZA 5L3EA 1X3UA 2BEOA 1U8RA 5DEQA 4BHCA 3HRTA 3KEOA 3FM3A 5FLXK 3IL2A 4I0BA 3SZPA 1I6XA 2MBFA 1OMIA 3KP6A 4UNOA 3MAJA 2EWNA 3IRQA 3W6KB 3L2CA 5KVRA 3SXYA 1ZGAA 2JPCA 4BH9A 3RKWA 1UCRA 2QBYB 3IC7A 2QWWA 3WODF 4ENMA 2EFQA 2E7XA 3FM5A 3OOPA 4LLGF 4YFKF 1Z1DA 1V3FA 4RGSA 2LF8A 2D1HA 4WXCA 2EB7A 4ZYGA 3HSEA 3F6VA 2F2EA 2AXLA 4G94A 5TRDA 5DCFA 4MQVA 1TQIA 2E1CA 4HQMA 2KRFA 3PFIA 2ESHA 2O6GE 1SD6A 2DO7A 4HOBA 2UWMA 3E6CC 4R8HA 5LHHA 1WI9A 4EM1A 2HDCA 5DUIA 5L3GA 4DNCA 3IWFA 3ZMVA 3VFZA 2Z9OA 4LLLA 3RIRA 4EJUA 4PZJA 4KA4A 4OINF 4IRIA 3RYPA 2QVOA 4P55A 2VONA 2FXAA 3WU0A 1GVJA 1OPCA 2H6CA 1O7FA 1FP2A 1JGSA 2NRAC 4EGYA 1XCVA 2FBHA 1TLHB 1FSEA 2QM3A 3BDDA 4OMYA 1ZG1A 2DQLA 2A3SA 3HYIA 4Q47A 5LBQA 2W25A 3TQNA 1GHCA 3ZP5A 1BI3A 1YYVA 2F5DA 1PP8F 3F22A 3DFGA 3W6JB 2IJLA 1BIAA 1J75A 2L02A 2AS5F 3EDPA 4HZFA 3CO7C 1ON2A 2FMYA 2XAJA 1FBQA 4S04A 5EEHA 3TDUC 4S05A 3K1NA 1KU9A 4M6XA 1Z7UA 3GYHX 4WWCA 4EJVA 1QZYA 1TQPA 2VBXA 4M73A 2JTVA 1O3RA 2HKXA 4NB5A 1FYKA 3V7SA 1SMYF 2GQQA 2VBWA 3LQRA 5J6XA 4LMYA 4OIRF 3LA3A 3IHUA 3IRRA 2VE9A 1W5TA 1G6NA 4Q48A 5E20A 1EH6A 3I53A 4B8XA 2Y48A 1YS7A 3D0SA 2Z5UA 1JHHA 1KQ9A 2Q2EA 1OKRA 4CHUA 2V1DA 4HDUA 1KU7A 1PP7U 3HHGA 1D3YA 3DKWA 2LF7A 2E7WA 5DUKA 4AD9A 2KKOA 1T6SA 2G9WA 1XDUA 2DFIA 2KIUA 4MGRA 3ZMDA 3DF8A 3DQVC 2OBPA 3N97A 1FBSA 4M9ZA 3E5UA 3WU1B 3C3WA 4KICA 2TDXA 5LEKA 3P9CA 1FYMA 1FWZA 3S2WA 1G4DA 4ENJA 1P4XA 4HX8A 4P96A 1E17A 3T1BA 2D1VA 3NRVA 4PGGA 5TJJA 2YX4A 2D45A 4XRFA 2W85A 5BPIA 4A2UA 2DAOA 2CFXA 4A5NA 1W4MA 2A61A 3E6BA 1IF1A 4HW0A 3RPQA 6PAXA 4PCQA 1MGTA 3C7JA 1SFEA 1I1SA 2DU9A 3O6BB 2NNNA 4LK0F 1O3SA 3JTGA 4HF1A 1XSXA 2EFNA 2ZJ2A 4QWQA 2NS0A 2XKPA 2HYFA 1U5TA 3ECOA 1RNLA 3KFWX 1OYIA 5DD4A 3I64A 2VC1A 4O5VA 2DI3A 2H27A 4Q4ZF 4LD5A 5A2QZ 2MC3A 2DPDA 2OU2A 3KLNA 1KQ8A 5HLHA 3E3VA 4QLCU 3KP5A 2L4AA 2GXGA 2NYXA 4YFNF 5ICEA 3L9FA 4L9TA 2BV6A 1Z6RA 5ILUA 3Q5FA 1YS6A 1DUXC 3TGNA 2EFWA 1J59A 5IT9Z 4OMZA 1T38A 1UHMA 1SAXA 2YR2A 5HDGA 4M71A 5FFZA 2XRNA 1SMTA 3QU6A 4HV5A 2G7UA 2DK8A 1WKMA 1UFMA 5L3DA 2IA1A 3TO9A 3FMQA 3F8CA 1BI2A 5FD5A 2ZCWA 2CGPA 1FPQA 4UV9A 2FA5A 1F4KA 2LSOA 3M7GA 5HLGA 3WGGA 1TQMA 1TW3A 3GUDA 2EFOA 2ACJA 1S8NA 3ZMUA 2ZKZA 3T8TA 5E1WA 3Q9SA 4UV8A 3VODA 3K2ZA 3EETA 3KLOA 4A0XA 4AIJA 1QBJA 3ZMZA 2QQBA 1Z9CA 1R7JA 2QENA 2PBIA 1K79A 1JE8A 4Q5SF 5D5UB 1R5GA 4G6QA 4OIQF 3RPUA 5ERIA 1O57A 2P6SA 3GX4X 1IXRC 3F8MA 1C0WA 5KK1A 3H3ZA 2FOKA 2FSWA 5H6QA 3RKYA 1PUEE 2P4WA 1R1TA 2EV0A 1IN6A 1B59A 2HTJA 1F9NA 4HYEA 2L4MA 1LQ1A 4L9NA 3HUGA 3TDZC 1WWXA 3N4MA 3V8LA 1LDKB 3EQLF 5F64A 2PG4A 5LEJA 3I0TA 4M74A 5FO5A 1HKTA 2XGXA 2BBYA 1I27A 3MEXA 4RGUA 3IKTA 1YW8A 2FF4A 3LAPA 1O3QA 2XAFA 3TO6A 2V6CA 1EV7A 1W7PA 2FBIA 3BOQA 1XSDA 5LHGA 3FXUA 1L0OC 3I59B 4XLPF 3C1DA 5A2QK 3MQ0A 1R36A 2P5KA 5DV5A 1H9TA 4EM0B 3HOTA 1USSA 2P7VB 4GYIA 4GGGA 4A5MA 3SHFA 3E5QA 1R5HA 2IA2A 1QPMA 4ZZLA 1IUYA 4Y17A 2CYYA 2L01A 1OR7A 1XD7A 1SD4A 3KP2A 4P9FA 1ZN2A 4GO1A 4RGXA 4FX4A 3L09A 3R61A 1FT9A 4MEXF 2Y75A 3DPLC 2H94A 4U0YA 3P9KA 2IPQX 1I5ZA 5JVTA 2HR3A 1UB9A 4Z2YA 2XHKA 3GVAA 3CUQC 2M5WA 3REOA 3DXJF 3ZPLA 1Q1HA 4F7ZA 2PJPA 4UHTA 3GZ5A 2RC4A 4XSZF 2OA4A 3F8BA 5L3CA 3JW4A 1T39A 2O8XA 2HYGD 3CDHA 3E5XA 1IAWA 2PI0A 4I0AA 2V1UA 3HRUA 4BHBA 2FMLA 3I58A 3WE3A 2K7LA 2PN6A 2ZMEA 4BHPA 1Z6TA 2A6EF 3NQOA 2KIFA 3CTAA 2Q0OA 4HBLA 3F8FA 2RQPA 4HF0A 4HX7A 4A6DA 1ZAOA 3BJOA 2CG4A 2BGCA 3BJ6A 3R0AA 4KUMA 3ML6A 2RGVA 3CJNA 3H3UA 5HS8A 1Y0UA 2Z33A 1FBUA 3M1EA 4U7BA 2ADUA 1R1VA 5D4SA 1T98A 2A69F 1W7PB 3R0JA 5CVVA 4KIBA 4GCVA 4UVBA 4YG2F 2PLYA 4I02A 1HW5A 2QLZA 5E8GA 3ZMSA 1R22A 1ZG5A 3LAJA 1XGMA 4Y13A 1WRJA 4U7DA 2IT0A 3LQQA 5HDNA 5BOXA 3CUOA 2QQ9A 2VXZA 3FWEA 1BC7C 1W5SA 2HS5A 4N0BA 2Y0MA 2M45A 3KZZA 1ZARA 2PFBA 3U1DA 4UXNA 3J7AO 4EJWA 4CZZA 5H20A 3F72A 3E97A 2ELHA 3I71A 2P6TA 4KYWA 3V8KA 2MLGA 1MDMA 4U88A 5D8KB 1USTA 3F8NA 4MEYF 2RV8A 3FZVA 1UHWA 2XAGA 5AIPA 3QP5A 2CWEA 4UVAA 3T8RA 2VT2A 5LRRA 1TTYA 3G73A 2ISZA 5FGMA 2VE8A 3Q9VA 4EV0A 2VBYA 3JSPA 4LB6B 5E17F 2OZUA 1MJAA 4LG0A 1G3WA 4MHGA 1U6GA 3FX3A 2DK5A 2YU3A 3QPHA 3L00A 1BIBA 3GZ6A 3WE2A 3G3ZA 4MTEA 1IZ1A 1JHFA 3PQJA 2JT1A 5DCMA 1QQIA 4IPAA 1REPC 1IRFA 3V4GA 4EM2A 1HSTA 2ZBKA 4M6YA 3WTWC 1S3JA 3JSOA 1R1UA 4ENKA 4ZYHA 2FNPA 4BAYA 2FNAA 4AVPA 2W84A 1IN7A 1D8KA 2K27A 1YLFA 3M9AA 4WX9A 4M72A 3TKYA 2DPUA 2EA4A 5ICGA 3FHZA 2P7CB 4BYYA 1EH7A 1ZHFA 4I98B 3RI4A 3MZYA 3M8EA 5E1ZB 1ZRCA 4A0ZA 4IRGA 2WWYA 1MKMA 2KJCA 1GXPA 3KETA 1J0RA 1IXSB 3EUHA 1ZRDA 2ISYA 4H0EA 4KNYA 1WSUA 2J5PA 2M8EA 2JRTA 2FBKA 4L0YB 3K1MA 2DTRA 4MTDA 3H92A 1ULYA 3KP7A 4MNUA 3K1PA 1B9NA 4AIHA 3O2PE 1KU3A 5J8FA 1HKQA 3SQNA 1FYLA 2JPBA 1AOYA 1FY7A 4FHTA 3BZ6A 4HA8A 4RB0A 3QP6A 5D6FA 1ZREA 3ECHA 3R6SA 2PMUA 1IN8A 3QU3A 2EFPA 1BM9A 5LGTA 2DW4A 3ZN1A 4G7ZF 3QRFF 4RB3C 3I54A 2HQRA 2KIMA 4ON0A 4ESFA 4EJOA 3E6DA 2DLLA 2STWA 5DCMB 2OQGA 1XMKA 3GFMA 5E18F 5F6FA 4WXDA 2GWRA 4UVCA 4G7OF 2HQNA 2VT3A 4KN7X 2IP2A 1FP1D 1XDSA 2VOPA 3FF5A 2E1NA 5LGNA 3V8JA 1ONVA 2MH9A 3SZTA 4EJTA 3ISPA 2PMHA 4L9JA 2OZ6A 4TV7A 5FFXA 1Z91A 2EK5A 2QYOA 3WTXC 4LJZF 1SFUA 4OOIA 2VODA 1SD5A 1HBXG 4JQFA 4P5OA 2H09A 1ZLKA 1CGPA 4FT8A 3RDIA 1BOAA 4ASNA 5AIQA 1XB4A 4HLXA 1E2XA 5BS6A 2P5LC 1KQ0A 3HHHA 2MH2A 1U5TB 5ICCA 5CVJA 3MFKA 4IHSA 4OIOF 2FEZA 1K78A 1U5TC 4ZYEA 4ZH4F 5BPDA 4IHTA 5K5OA 4FX0A 4G7HF 1FZPB 2UZKA 1KYWA 1DP7P 4WK8F 5K5RA 2O61A 4JK1X 2C6YA 3GW2A 3M8FA 1MJBA 1B6AA 4N9HA 1G3YA 2XROA 1ZRFA 4NQWA 5CVIA 4I09A 3T0YA 1RZ4A 2A6HF 3O3KA 5IT3A 5HVQC 4IRHA 2WC2A 5JR3A 1KU2A 5L3FA 3GLXA 2ETHA 3C18A 1ON1A 2QZ8A 4HV6A 1S7OA 1YG2A 5H6RA 4M9SA 5DD8A 2UXNA 3ERED 1O3TA 3TOAA 2XVCA 3BPVA 1TNTA 2P8TA 4ZYDA 1J7KA 2B0LA 4IVNA 5JHUA 1CF7A 3WTYC 1FLIA 2EA2A 5F1RA 3HTSB 1ZGJA 3BPXA 2IA0A 3T5XA 2F5EA 4RAZA 2VOOA 2MA3A 1YFHA 1R23A 1YO5C 1XCBA 1U2WA 3R4KA 2L54A 3L7WA 2COMA 2HEOA 1XGOA 4M9XA 1HW2A 3WG9A 2O0YA 2M87A 2A07F 3FMRA 2CQKA 1D8JA 4BQAA 1XGSA 1FSHA 3FXRA 3TO7A 2OQRA 2R7DA 2GA1A 4A12A 3V7CA 4YIIA 1F1ZA 1BI0A 1IN4A 4I01A 2GA2A 3HTUA 1BI1A 1P92A 2RNJA 3KEQA 1R58A 2BE5F 2WTEA 3HOSA 1YW7A 4L9VA 1IRGA 2PQ8A 2DT5A 1QNTA 2YX7A 4D0PA 3V7RA 4L18B 4HF2A 1P4AA 3MCZA 4AIKA 3COAC 4U0WA 3VOEA 1O7LA 4K2EA 2XUBA 2A5YB 1LEBA 5AONA 1FNNA 3R60A 4B09A 1A04A 5ILVA 2LNBA 3QOPA 1R00A 2V1XA 4MQ9F 3P9IA 5DDGA 4G6DA 3J81Z 1K78B 1J2XA 2GZWA 3BP8A 2QQAA 4HAMA 5D4RA 2XAQA 4KFCA 3LA2A 3D5LA 1YIOA 4BXUA 2V9VA 4R1HA 2DBBA 2HTSA 3F23A 3K69A 4WCGA 1HXDA 4CGZA 2BYVE 3KP3A 5HOOA 3GO5A 4BNCA 1IW7F 2V79A 4RAYA 5JFRA 3JAMK 1P6RA 2HZTA 3EYIA 4DQ2A 1T0FA 2F5FA 3BY6A 4O3MA 3CLOA 3U2RA 5D8LB 1BJAA 2LKPA 3QPTA 4I2OA 2IVMA 5CJ9A 2O3FA 3QAHA 4HX4A 2VC0A 5D5VB 1S6LA 5CVRA 3SFZA 1HQCA 1DPRA 3DP7A 2FU4A 3PQKA 4LK1F 3HSRA 4N9IA 4LB5A 2GXBA 1CF7B 1LJ9A 4KDPA 4O6JA 3GFJA 2X4HA 4PDKA 2UXXA 2STTA 1J5YA 5FB2A 1XMAA 1XGNA 3MWMA 4LLNA 5JI6A 1SFXA 2F5CA 1KGSA 5LGUA 3LFKA 3JTHA 2K4JA 1T2KA 4ESBA 2MLKA 1KA8A 1QGPA 1RUOA 1H0MA 4AWXB 3F3XA 5BQTA 4KIFA 3NEUA 3B02A 1SD7A 5E8IA 5K5QA 2XIGA 2ESNA 4WF2A 2CO5A 4EVIA 5DYMA 2IRFG 5HS7A 4EMSA 3GEZA 3GF2A 3ULQB 1TBXA 1K7AA 1IXCA 2RDPA 2ZMEB 3F21A 1KYZA 2Q8KA 1OYYA 1P2FA 3LSTA 1W7PD 3DEUA 3FMSA 1S29A 4RS8A 1ZLJA 5E1XA 3ROUA 5LLQA 4LGWA 1G3TA 4XBFA 2HFHA 3GFLA 3ZMTA 1YW9A 2HWVA 2OAZA 4IXAA 1BBYA 2RKHA 2ZNYA 3EYYA 5CLSA 3TOBA 1B1BA 2K02A 4KMUX 1L3LA 3WGIA 3OV8A 3J80Z 3LWFA 5EEGA 2ZFWA 2ZXJA 5HDKA 4RB1A 3HSFA 2XASA 4CO8A 3I4PA 2L3DA 3J81K 2X0LA 2R7FA 4KIGA 3WTTC 1JXSA 3CO6C 2J5OA 2Z3YA 3GWZA 4XSXF 4GXOA 4HDVA 1TW2A 2O03A 5ICFA 2Z99A 1MD0A 2EV5A 4KMFA 1PDNC 5BMZA 2VN2A 1U3EM 4NHJA 4ZZDA 3HRSA 4IJAA 2A68F 3VEPA 3VB2A 2RVCA 4G9YA 4YFXF 1HW1A 1FX7A 2CSOA 3I5UA 1F5TA 1MDMB 5CYVA 2LDUA 4E70A 4UUVA 1G3SA 3F6OA 4IF4A 2M1BA 3AAFA 3ZN0A 3BJAA 4RGRA 3RYRA 2ZNZA 1P4WA 5HS9A 2EV6A 2JSCA 3RJPA 1ODDA 1XSVA 1STZA 3I59A 3KE2A 3ELKA 2RN7A 5LHIA 2CW0F 5D5WB 1FC3A 1B4AA 2OD5A 3E6MA 1S7AA 4ESJA 2W57A 2HGCA 4JBAA 1GXQA 1WQ2A 3ZQ7A 4LG0B 3KCCA 3KP4A 2VBZA 3HIFA 3RKXA 3FXQA 3KZYA 1RUNA 1Z05A 5FLXZ 4LFUA 1BN5A 4CDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9G A;  2PEX A;  2HKO A;  3ABU A;  1I1G A;  3CUQ A;  1QO0 D;  4OIP F;  1MZB A;  2R3S A;  4YIF A;  1U78 A;  3B73 A;  1H9G A;  2XKO A;  3BWG A;  2NAZ A;  4KT5 C;  1ZH5 A;  1BC8 C;  1J9I A;  1VTN C;  2D2W A;  4CYD A;  2YSR A;  1RIO H;  4RB2 C;  1QZZ A;  1AWC A;  2K4B A;  2QBY A;  4I7H A;  1NHA A;  5K1Y A;  3J80 K;  1YQA A;  3ABT A;  4ETS A;  4KN4 X;  1XN7 A;  3JAM Z;  5HLI A;  1ZYR F;  2XV4 S;  1MJ9 A;  3WTU C;  4P9U A;  3K0L A;  2IW5 A;  2FRH A;  2GAU A;  2QUF A;  5ILS A;  2K86 A;  1B9M A;  3WGH A;  2FE3 A;  2G7H A;  4EGZ A;  1TNS A;  4PGH A;  2M30 A;  3GXO A;  3P7N A;  4L5J A;  3DPT A;  2WV0 A;  4G8X A;  4Y15 A;  3DV8 A;  2W24 A;  3IWZ A;  1RI7 A;  1LVA A;  4A0Y A;  4ENN A;  2H6B A;  2EJR A;  5FD6 A;  4U0V A;  5D5X B;  4OU0 A;  5LRS A;  1K6O A;  5L3B A;  4EQQ A;  2GIV A;  2HOE A;  1LDJ A;  2KJB A;  4A6E A;  2MD5 A;  2ZO4 A;  3IKV A;  1LB2 A;  4CIC A;  5ED4 A;  4GYG A;  1D5V A;  3RTR A;  4HLY A;  2DQR A;  3WTV C;  4WXH A;  3HRM A;  3LA7 A;  3MZH A;  1FOK A;  1DPU A;  5CVU A;  5J8C A;  1OYW A;  3GFI A;  2FQ3 A;  4CXF A;  4R79 A;  1YTY A;  1EH8 A;  4HQE A;  1LEA A;  1HKS A;  2YPR A;  1V4R A;  5D6E A;  4L5I A;  1DDN A;  5IT9 K;  1LNW A;  2NNY A;  2P5V A;  3K9T A;  2JZY A;  1HSJ A;  3BRO A;  2XAH A;  4XLN F;  4L0Z B;  3CUQ B;  1IN5 A;  1LDD A;  1ZG3 A;  3WTS C;  3WTZ A;  5L3E A;  1X3U A;  2BEO A;  1U8R A;  5DEQ A;  4BHC A;  3HRT A;  3KEO A;  3FM3 A;  5FLX K;  3IL2 A;  4I0B A;  3SZP A;  1I6X A;  2MBF A;  1OMI A;  3KP6 A;  4UNO A;  3MAJ A;  2EWN A;  3IRQ A;  3W6K B;  3L2C A;  5KVR A;  3SXY A;  1ZGA A;  2JPC A;  4BH9 A;  3RKW A;  1UCR A;  2QBY B;  3IC7 A;  2QWW A;  3WOD F;  4ENM A;  2EFQ A;  2E7X A;  3FM5 A;  3OOP A;  4LLG F;  4YFK F;  1Z1D A;  1V3F A;  4RGS A;  2LF8 A;  2D1H A;  4WXC A;  2EB7 A;  4ZYG A;  3HSE A;  3F6V A;  2F2E A;  2AXL A;  4G94 A;  5TRD A;  5DCF A;  4MQV A;  1TQI A;  2E1C A;  4HQM A;  2KRF A;  3PFI A;  2ESH A;  2O6G E;  1SD6 A;  2DO7 A;  4HOB A;  2UWM A;  3E6C C;  4R8H A;  5LHH A;  1WI9 A;  4EM1 A;  2HDC A;  5DUI A;  5L3G A;  4DNC A;  3IWF A;  3ZMV A;  3VFZ A;  2Z9O A;  4LLL A;  3RIR A;  4EJU A;  4PZJ A;  4KA4 A;  4OIN F;  4IRI A;  3RYP A;  2QVO A;  4P55 A;  2VON A;  2FXA A;  3WU0 A;  1GVJ A;  1OPC A;  2H6C A;  1O7F A;  1FP2 A;  1JGS A;  2NRA C;  4EGY A;  1XCV A;  2FBH A;  1TLH B;  1FSE A;  2QM3 A;  3BDD A;  4OMY A;  1ZG1 A;  2DQL A;  2A3S A;  3HYI A;  4Q47 A;  5LBQ A;  2W25 A;  3TQN A;  1GHC A;  3ZP5 A;  1BI3 A;  1YYV A;  2F5D A;  1PP8 F;  3F22 A;  3DFG A;  3W6J B;  2IJL A;  1BIA A;  1J75 A;  2L02 A;  2AS5 F;  3EDP A;  4HZF A;  3CO7 C;  1ON2 A;  2FMY A;  2XAJ A;  1FBQ A;  4S04 A;  5EEH A;  3TDU C;  4S05 A;  3K1N A;  1KU9 A;  4M6X A;  1Z7U A;  3GYH X;  4WWC A;  4EJV A;  1QZY A;  1TQP A;  2VBX A;  4M73 A;  2JTV A;  1O3R A;  2HKX A;  4NB5 A;  1FYK A;  3V7S A;  1SMY F;  2GQQ A;  2VBW A;  3LQR A;  5J6X A;  4LMY A;  4OIR F;  3LA3 A;  3IHU A;  3IRR A;  2VE9 A;  1W5T A;  1G6N A;  4Q48 A;  5E20 A;  1EH6 A;  3I53 A;  4B8X A;  2Y48 A;  1YS7 A;  3D0S A;  2Z5U A;  1JHH A;  1KQ9 A;  2Q2E A;  1OKR A;  4CHU A;  2V1D A;  4HDU A;  1KU7 A;  1PP7 U;  3HHG A;  1D3Y A;  3DKW A;  2LF7 A;  2E7W A;  5DUK A;  4AD9 A;  2KKO A;  1T6S A;  2G9W A;  1XDU A;  2DFI A;  2KIU A;  4MGR A;  3ZMD A;  3DF8 A;  3DQV C;  2OBP A;  3N97 A;  1FBS A;  4M9Z A;  3E5U A;  3WU1 B;  3C3W A;  4KIC A;  2TDX A;  5LEK A;  3P9C A;  1FYM A;  1FWZ A;  3S2W A;  1G4D A;  4ENJ A;  1P4X A;  4HX8 A;  4P96 A;  1E17 A;  3T1B A;  2D1V A;  3NRV A;  4PGG A;  5TJJ A;  2YX4 A;  2D45 A;  4XRF A;  2W85 A;  5BPI A;  4A2U A;  2DAO A;  2CFX A;  4A5N A;  1W4M A;  2A61 A;  3E6B A;  1IF1 A;  4HW0 A;  3RPQ A;  6PAX A;  4PCQ A;  1MGT A;  3C7J A;  1SFE A;  1I1S A;  2DU9 A;  3O6B B;  2NNN A;  4LK0 F;  1O3S A;  3JTG A;  4HF1 A;  1XSX A;  2EFN A;  2ZJ2 A;  4QWQ A;  2NS0 A;  2XKP A;  2HYF A;  1U5T A;  3ECO A;  1RNL A;  3KFW X;  1OYI A;  5DD4 A;  3I64 A;  2VC1 A;  4O5V A;  2DI3 A;  2H27 A;  4Q4Z F;  4LD5 A;  5A2Q Z;  2MC3 A;  2DPD A;  2OU2 A;  3KLN A;  1KQ8 A;  5HLH A;  3E3V A;  4QLC U;  3KP5 A;  2L4A A;  2GXG A;  2NYX A;  4YFN F;  5ICE A;  3L9F A;  4L9T A;  2BV6 A;  1Z6R A;  5ILU A;  3Q5F A;  1YS6 A;  1DUX C;  3TGN A;  2EFW A;  1J59 A;  5IT9 Z;  4OMZ A;  1T38 A;  1UHM A;  1SAX A;  2YR2 A;  5HDG A;  4M71 A;  5FFZ A;  2XRN A;  1SMT A;  3QU6 A;  4HV5 A;  2G7U A;  2DK8 A;  1WKM A;  1UFM A;  5L3D A;  2IA1 A;  3TO9 A;  3FMQ A;  3F8C A;  1BI2 A;  5FD5 A;  2ZCW A;  2CGP A;  1FPQ A;  4UV9 A;  2FA5 A;  1F4K A;  2LSO A;  3M7G A;  5HLG A;  3WGG A;  1TQM A;  1TW3 A;  3GUD A;  2EFO A;  2ACJ A;  1S8N A;  3ZMU A;  2ZKZ A;  3T8T A;  5E1W A;  3Q9S A;  4UV8 A;  3VOD A;  3K2Z A;  3EET A;  3KLO A;  4A0X A;  4AIJ A;  1QBJ A;  3ZMZ A;  2QQB A;  1Z9C A;  1R7J A;  2QEN A;  2PBI A;  1K79 A;  1JE8 A;  4Q5S F;  5D5U B;  1R5G A;  4G6Q A;  4OIQ F;  3RPU A;  5ERI A;  1O57 A;  2P6S A;  3GX4 X;  1IXR C;  3F8M A;  1C0W A;  5KK1 A;  3H3Z A;  2FOK A;  2FSW A;  5H6Q A;  3RKY A;  1PUE E;  2P4W A;  1R1T A;  2EV0 A;  1IN6 A;  1B59 A;  2HTJ A;  1F9N A;  4HYE A;  2L4M A;  1LQ1 A;  4L9N A;  3HUG A;  3TDZ C;  1WWX A;  3N4M A;  3V8L A;  1LDK B;  3EQL F;  5F64 A;  2PG4 A;  5LEJ A;  3I0T A;  4M74 A;  5FO5 A;  1HKT A;  2XGX A;  2BBY A;  1I27 A;  3MEX A;  4RGU A;  3IKT A;  1YW8 A;  2FF4 A;  3LAP A;  1O3Q A;  2XAF A;  3TO6 A;  2V6C A;  1EV7 A;  1W7P A;  2FBI A;  3BOQ A;  1XSD A;  5LHG A;  3FXU A;  1L0O C;  3I59 B;  4XLP F;  3C1D A;  5A2Q K;  3MQ0 A;  1R36 A;  2P5K A;  5DV5 A;  1H9T A;  4EM0 B;  3HOT A;  1USS A;  2P7V B;  4GYI A;  4GGG A;  4A5M A;  3SHF A;  3E5Q A;  1R5H A;  2IA2 A;  1QPM A;  4ZZL A;  1IUY A;  4Y17 A;  2CYY A;  2L01 A;  1OR7 A;  1XD7 A;  1SD4 A;  3KP2 A;  4P9F A;  1ZN2 A;  4GO1 A;  4RGX A;  4FX4 A;  3L09 A;  3R61 A;  1FT9 A;  4MEX F;  2Y75 A;  3DPL C;  2H94 A;  4U0Y A;  3P9K A;  2IPQ X;  1I5Z A;  5JVT A;  2HR3 A;  1UB9 A;  4Z2Y A;  2XHK A;  3GVA A;  3CUQ C;  2M5W A;  3REO A;  3DXJ F;  3ZPL A;  1Q1H A;  4F7Z A;  2PJP A;  4UHT A;  3GZ5 A;  2RC4 A;  4XSZ F;  2OA4 A;  3F8B A;  5L3C A;  3JW4 A;  1T39 A;  2O8X A;  2HYG D;  3CDH A;  3E5X A;  1IAW A;  2PI0 A;  4I0A A;  2V1U A;  3HRU A;  4BHB A;  2FML A;  3I58 A;  3WE3 A;  2K7L A;  2PN6 A;  2ZME A;  4BHP A;  1Z6T A;  2A6E F;  3NQO A;  2KIF A;  3CTA A;  2Q0O A;  4HBL A;  3F8F A;  2RQP A;  4HF0 A;  4HX7 A;  4A6D A;  1ZAO A;  3BJO A;  2CG4 A;  2BGC A;  3BJ6 A;  3R0A A;  4KUM A;  3ML6 A;  2RGV A;  3CJN A;  3H3U A;  5HS8 A;  1Y0U A;  2Z33 A;  1FBU A;  3M1E A;  4U7B A;  2ADU A;  1R1V A;  5D4S A;  1T98 A;  2A69 F;  1W7P B;  3R0J A;  5CVV A;  4KIB A;  4GCV A;  4UVB A;  4YG2 F;  2PLY A;  4I02 A;  1HW5 A;  2QLZ A;  5E8G A;  3ZMS A;  1R22 A;  1ZG5 A;  3LAJ A;  1XGM A;  4Y13 A;  1WRJ A;  4U7D A;  2IT0 A;  3LQQ A;  5HDN A;  5BOX A;  3CUO A;  2QQ9 A;  2VXZ A;  3FWE A;  1BC7 C;  1W5S A;  2HS5 A;  4N0B A;  2Y0M A;  2M45 A;  3KZZ A;  1ZAR A;  2PFB A;  3U1D A;  4UXN A;  3J7A O;  4EJW A;  4CZZ A;  5H20 A;  3F72 A;  3E97 A;  2ELH A;  3I71 A;  2P6T A;  4KYW A;  3V8K A;  2MLG A;  1MDM A;  4U88 A;  5D8K B;  1UST A;  3F8N A;  4MEY F;  2RV8 A;  3FZV A;  1UHW A;  2XAG A;  5AIP A;  3QP5 A;  2CWE A;  4UVA A;  3T8R A;  2VT2 A;  5LRR A;  1TTY A;  3G73 A;  2ISZ A;  5FGM A;  2VE8 A;  3Q9V A;  4EV0 A;  2VBY A;  3JSP A;  4LB6 B;  5E17 F;  2OZU A;  1MJA A;  4LG0 A;  1G3W A;  4MHG A;  1U6G A;  3FX3 A;  2DK5 A;  2YU3 A;  3QPH A;  3L00 A;  1BIB A;  3GZ6 A;  3WE2 A;  3G3Z A;  4MTE A;  1IZ1 A;  1JHF A;  3PQJ A;  2JT1 A;  5DCM A;  1QQI A;  4IPA A;  1REP C;  1IRF A;  3V4G A;  4EM2 A;  1HST A;  2ZBK A;  4M6Y A;  3WTW C;  1S3J A;  3JSO A;  1R1U A;  4ENK A;  4ZYH A;  2FNP A;  4BAY A;  2FNA A;  4AVP A;  2W84 A;  1IN7 A;  1D8K A;  2K27 A;  1YLF A;  3M9A A;  4WX9 A;  4M72 A;  3TKY A;  2DPU A;  2EA4 A;  5ICG A;  3FHZ A;  2P7C B;  4BYY A;  1EH7 A;  1ZHF A;  4I98 B;  3RI4 A;  3MZY A;  3M8E A;  5E1Z B;  1ZRC A;  4A0Z A;  4IRG A;  2WWY A;  1MKM A;  2KJC A;  1GXP A;  3KET A;  1J0R A;  1IXS B;  3EUH A;  1ZRD A;  2ISY A;  4H0E A;  4KNY A;  1WSU A;  2J5P A;  2M8E A;  2JRT A;  2FBK A;  4L0Y B;  3K1M A;  2DTR A;  4MTD A;  3H92 A;  1ULY A;  3KP7 A;  4MNU A;  3K1P A;  1B9N A;  4AIH A;  3O2P E;  1KU3 A;  5J8F A;  1HKQ A;  3SQN A;  1FYL A;  2JPB A;  1AOY A;  1FY7 A;  4FHT A;  3BZ6 A;  4HA8 A;  4RB0 A;  3QP6 A;  5D6F A;  1ZRE A;  3ECH A;  3R6S A;  2PMU A;  1IN8 A;  3QU3 A;  2EFP A;  1BM9 A;  5LGT A;  2DW4 A;  3ZN1 A;  4G7Z F;  3QRF F;  4RB3 C;  3I54 A;  2HQR A;  2KIM A;  4ON0 A;  4ESF A;  4EJO A;  3E6D A;  2DLL A;  2STW A;  5DCM B;  2OQG A;  1XMK A;  3GFM A;  5E18 F;  5F6F A;  4WXD A;  2GWR A;  4UVC A;  4G7O F;  2HQN A;  2VT3 A;  4KN7 X;  2IP2 A;  1FP1 D;  1XDS A;  2VOP A;  3FF5 A;  2E1N A;  5LGN A;  3V8J A;  1ONV A;  2MH9 A;  3SZT A;  4EJT A;  3ISP A;  2PMH A;  4L9J A;  2OZ6 A;  4TV7 A;  5FFX A;  1Z91 A;  2EK5 A;  2QYO A;  3WTX C;  4LJZ F;  1SFU A;  4OOI A;  2VOD A;  1SD5 A;  1HBX G;  4JQF A;  4P5O A;  2H09 A;  1ZLK A;  1CGP A;  4FT8 A;  3RDI A;  1BOA A;  4ASN A;  5AIQ A;  1XB4 A;  4HLX A;  1E2X A;  5BS6 A;  2P5L C;  1KQ0 A;  3HHH A;  2MH2 A;  1U5T B;  5ICC A;  5CVJ A;  3MFK A;  4IHS A;  4OIO F;  2FEZ A;  1K78 A;  1U5T C;  4ZYE A;  4ZH4 F;  5BPD A;  4IHT A;  5K5O A;  4FX0 A;  4G7H F;  1FZP B;  2UZK A;  1KYW A;  1DP7 P;  4WK8 F;  5K5R A;  2O61 A;  4JK1 X;  2C6Y A;  3GW2 A;  3M8F A;  1MJB A;  1B6A A;  4N9H A;  1G3Y A;  2XRO A;  1ZRF A;  4NQW A;  5CVI A;  4I09 A;  3T0Y A;  1RZ4 A;  2A6H F;  3O3K A;  5IT3 A;  5HVQ C;  4IRH A;  2WC2 A;  5JR3 A;  1KU2 A;  5L3F A;  3GLX A;  2ETH A;  3C18 A;  1ON1 A;  2QZ8 A;  4HV6 A;  1S7O A;  1YG2 A;  5H6R A;  4M9S A;  5DD8 A;  2UXN A;  3ERE D;  1O3T A;  3TOA A;  2XVC A;  3BPV A;  1TNT A;  2P8T A;  4ZYD A;  1J7K A;  2B0L A;  4IVN A;  5JHU A;  1CF7 A;  3WTY C;  1FLI A;  2EA2 A;  5F1R A;  3HTS B;  1ZGJ A;  3BPX A;  2IA0 A;  3T5X A;  2F5E A;  4RAZ A;  2VOO A;  2MA3 A;  1YFH A;  1R23 A;  1YO5 C;  1XCB A;  1U2W A;  3R4K A;  2L54 A;  3L7W A;  2COM A;  2HEO A;  1XGO A;  4M9X A;  1HW2 A;  3WG9 A;  2O0Y A;  2M87 A;  2A07 F;  3FMR A;  2CQK A;  1D8J A;  4BQA A;  1XGS A;  1FSH A;  3FXR A;  3TO7 A;  2OQR A;  2R7D A;  2GA1 A;  4A12 A;  3V7C A;  4YII A;  1F1Z A;  1BI0 A;  1IN4 A;  4I01 A;  2GA2 A;  3HTU A;  1BI1 A;  1P92 A;  2RNJ A;  3KEQ A;  1R58 A;  2BE5 F;  2WTE A;  3HOS A;  1YW7 A;  4L9V A;  1IRG A;  2PQ8 A;  2DT5 A;  1QNT A;  2YX7 A;  4D0P A;  3V7R A;  4L18 B;  4HF2 A;  1P4A A;  3MCZ A;  4AIK A;  3COA C;  4U0W A;  3VOE A;  1O7L A;  4K2E A;  2XUB A;  2A5Y B;  1LEB A;  5AON A;  1FNN A;  3R60 A;  4B09 A;  1A04 A;  5ILV A;  2LNB A;  3QOP A;  1R00 A;  2V1X A;  4MQ9 F;  3P9I A;  5DDG A;  4G6D A;  3J81 Z;  1K78 B;  1J2X A;  2GZW A;  3BP8 A;  2QQA A;  4HAM A;  5D4R A;  2XAQ A;  4KFC A;  3LA2 A;  3D5L A;  1YIO A;  4BXU A;  2V9V A;  4R1H A;  2DBB A;  2HTS A;  3F23 A;  3K69 A;  4WCG A;  1HXD A;  4CGZ A;  2BYV E;  3KP3 A;  5HOO A;  3GO5 A;  4BNC A;  1IW7 F;  2V79 A;  4RAY A;  5JFR A;  3JAM K;  1P6R A;  2HZT A;  3EYI A;  4DQ2 A;  1T0F A;  2F5F A;  3BY6 A;  4O3M A;  3CLO A;  3U2R A;  5D8L B;  1BJA A;  2LKP A;  3QPT A;  4I2O A;  2IVM A;  5CJ9 A;  2O3F A;  3QAH A;  4HX4 A;  2VC0 A;  5D5V B;  1S6L A;  5CVR A;  3SFZ A;  1HQC A;  1DPR A;  3DP7 A;  2FU4 A;  3PQK A;  4LK1 F;  3HSR A;  4N9I A;  4LB5 A;  2GXB A;  1CF7 B;  1LJ9 A;  4KDP A;  4O6J A;  3GFJ A;  2X4H A;  4PDK A;  2UXX A;  2STT A;  1J5Y A;  5FB2 A;  1XMA A;  1XGN A;  3MWM A;  4LLN A;  5JI6 A;  1SFX A;  2F5C A;  1KGS A;  5LGU A;  3LFK A;  3JTH A;  2K4J A;  1T2K A;  4ESB A;  2MLK A;  1KA8 A;  1QGP A;  1RUO A;  1H0M A;  4AWX B;  3F3X A;  5BQT A;  4KIF A;  3NEU A;  3B02 A;  1SD7 A;  5E8I A;  5K5Q A;  2XIG A;  2ESN A;  4WF2 A;  2CO5 A;  4EVI A;  5DYM A;  2IRF G;  5HS7 A;  4EMS A;  3GEZ A;  3GF2 A;  3ULQ B;  1TBX A;  1K7A A;  1IXC A;  2RDP A;  2ZME B;  3F21 A;  1KYZ A;  2Q8K A;  1OYY A;  1P2F A;  3LST A;  1W7P D;  3DEU A;  3FMS A;  1S29 A;  4RS8 A;  1ZLJ A;  5E1X A;  3ROU A;  5LLQ A;  4LGW A;  1G3T A;  4XBF A;  2HFH A;  3GFL A;  3ZMT A;  1YW9 A;  2HWV A;  2OAZ A;  4IXA A;  1BBY A;  2RKH A;  2ZNY A;  3EYY A;  5CLS A;  3TOB A;  1B1B A;  2K02 A;  4KMU X;  1L3L A;  3WGI A;  3OV8 A;  3J80 Z;  3LWF A;  5EEG A;  2ZFW A;  2ZXJ A;  5HDK A;  4RB1 A;  3HSF A;  2XAS A;  4CO8 A;  3I4P A;  2L3D A;  3J81 K;  2X0L A;  2R7F A;  4KIG A;  3WTT C;  1JXS A;  3CO6 C;  2J5O A;  2Z3Y A;  3GWZ A;  4XSX F;  4GXO A;  4HDV A;  1TW2 A;  2O03 A;  5ICF A;  2Z99 A;  1MD0 A;  2EV5 A;  4KMF A;  1PDN C;  5BMZ A;  2VN2 A;  1U3E M;  4NHJ A;  4ZZD A;  3HRS A;  4IJA A;  2A68 F;  3VEP A;  3VB2 A;  2RVC A;  4G9Y A;  4YFX F;  1HW1 A;  1FX7 A;  2CSO A;  3I5U A;  1F5T A;  1MDM B;  5CYV A;  2LDU A;  4E70 A;  4UUV A;  1G3S A;  3F6O A;  4IF4 A;  2M1B A;  3AAF A;  3ZN0 A;  3BJA A;  4RGR A;  3RYR A;  2ZNZ A;  1P4W A;  5HS9 A;  2EV6 A;  2JSC A;  3RJP A;  1ODD A;  1XSV A;  1STZ A;  3I59 A;  3KE2 A;  3ELK A;  2RN7 A;  5LHI A;  2CW0 F;  5D5W B;  1FC3 A;  1B4A A;  2OD5 A;  3E6M A;  1S7A A;  4ESJ A;  2W57 A;  2HGC A;  4JBA A;  1GXQ A;  1WQ2 A;  3ZQ7 A;  4LG0 B;  3KCC A;  3KP4 A;  2VBZ A;  3HIF A;  3RKX A;  3FXQ A;  3KZY A;  1RUN A;  1Z05 A;  5FLX Z;  4LFU A;  1BN5 A;  4CDG A; 
#chains in the Genus database with same CATH topology
 2VUM J;  1V5G A;  2M7B A;  3U9G A;  1P7I A;  2PEX A;  5IYB J;  2HKO A;  3ABU A;  1QU3 A;  1I1G A;  4A69 C;  2PJR A;  3OR1 C;  2GOX B;  4LOC A;  3H5N A;  4HNU A;  5J4Y A;  3IAM 2;  3SFI A;  3BR0 A;  1QO0 D;  3CUQ A;  4OIP F;  2QKM B;  1MZB A;  4ZDL A;  3L2R A;  2L2O A;  2R3S A;  3BG3 A;  3FKI J;  4YIF A;  4QTR A;  1WPK A;  1U78 A;  2LH9 A;  3B73 A;  1QZE A;  1H9G A;  2VXD A;  2XKO A;  1UEL B;  1X58 A;  3BR6 A;  3BWG A;  1G2H A;  2NAZ A;  4KT5 C;  1JT0 A;  1Z0X A;  1ZH5 A;  2CMP A;  2WY8 Q;  1BC8 C;  4IX7 A;  3PSF A;  1HF0 A;  1J9I A;  5FRM A;  3LSH A;  1VTN C;  2D2W A;  4CYD A;  3A4C A;  2KZV A;  2YSR A;  3S3O A;  1RIO H;  2Y2Z A;  5FLM J;  2NVX J;  2CUF A;  1BR1 A;  2X48 A;  3GTK J;  1VQM I;  3B6A A;  3ZQI A;  4BDY A;  2L5Q A;  3K4C A;  4RB2 C;  1QZZ A;  1AWC A;  2K4B A;  2QBY A;  1D0Y A;  2M9H A;  1GUU A;  4I7H A;  1DU0 A;  1A6Q A;  1YIT I;  3K70 D;  4Y33 A;  1VQ9 I;  1WVR A;  1QHG A;  3HPH A;  1NHA A;  5K1Y A;  3J80 K;  1YQA A;  3ABT A;  2JVG A;  3TP0 A;  3CCJ I;  2H8W A;  4RMN A;  3FXO A;  4ETS A;  2BVM A;  4KN4 X;  1XN7 A;  4CA0 A;  3CJQ B;  2ZSH B;  5EGO A;  3JAM Z;  1OCZ H;  4B4C A;  4XLC A;  5HLI A;  1ZYR F;  2XV4 S;  1MJ9 A;  3WTU C;  1JGG A;  4P9U A;  1T56 A;  3S2H J;  3K0L A;  1BW6 A;  2IW5 A;  2K3F A;  2KFD A;  2FRH A;  2GAU A;  3PNT A;  2QUF A;  3DBL B;  1SEU A;  1LE8 A;  1ETQ A;  2K86 A;  1B9M A;  5ILS A;  3DTE A;  4E7I A;  3WGH A;  2LLK A;  2FE3 A;  2DMN A;  2G7H A;  4EGZ A;  1TNS A;  4PGH A;  2M30 A;  2DDA A;  3GXO A;  3P7N A;  4FQG A;  2E35 A;  4L5J A;  3DPT A;  2WV0 A;  3EUH C;  3CMM A;  4G8X A;  4Y15 A;  3DV8 A;  2BY0 A;  5B3S H;  4DYR A;  2W24 A;  3IWZ A;  3H1C A;  1RI7 A;  1LVA A;  2XGE A;  3O8H A;  4A0Y A;  1PUF A;  1M1E B;  4ENN A;  1VQ4 I;  1R4N B;  2H6B A;  3M8J A;  2HPM A;  1ETO A;  2K9M A;  2EJR A;  5FD6 A;  4U0V A;  5LD2 C;  3J7A Y;  5D5X B;  2VQC A;  4OU0 A;  2LVS A;  2XPU A;  4A3I J;  5LRS A;  1K6O A;  2LMD A;  3KZI C;  1ZTR A;  3OYE A;  1W0U A;  5L3B A;  3PUB A;  4EQQ A;  3BG7 A;  2GIV A;  2HOE A;  1LDJ A;  1OCC H;  1RRJ A;  2E1M C;  2KJB A;  4A6E A;  2V26 A;  4A93 J;  2HXI A;  2MD5 A;  3QWL A;  2ZO4 A;  3OS1 A;  2F4O B;  2PX9 A;  4XKV A;  4A3D J;  3IKV A;  4B47 A;  1LB2 A;  4CIC A;  3K4L A;  3VYU B;  5ED4 A;  4GYG A;  3MMY B;  1WFX A;  1D5V A;  1OCO H;  3RTR A;  4HLY A;  2DQR A;  3WTV C;  4WXH A;  3BQZ A;  3HRM A;  3LA7 A;  5F0F A;  3MZH A;  1FOK A;  4JX4 A;  1DPU A;  5CVU A;  5J8C A;  4UUT A;  1EJ9 A;  1OYW A;  3GFI A;  2FQ3 A;  3C2B A;  2AHQ A;  4CXF A;  4A3F J;  4R79 A;  1YTY A;  1EH8 A;  4HQE A;  1LEA A;  3BR5 A;  1HKS A;  2R7O A;  2ZC2 A;  4HST A;  5F1J A;  5J1R A;  3CMY A;  2HQ5 A;  2YPR A;  1V4R A;  5D6E A;  1AKH B;  2NS8 A;  4L5I A;  5E3O A;  1X1C A;  4KIS A;  1DDN A;  2IEK A;  3HGY A;  5IT9 K;  1LNW A;  2DA5 A;  2NNY A;  3BZC A;  1U9O A;  2PJR B;  2P5V A;  2V4J C;  1Z3X A;  3K9T A;  3V42 A;  4B48 A;  2JZY A;  1HSJ A;  3NWS A;  3BRO A;  2XAH A;  4XLN F;  1G8X A;  4IQJ A;  4L0Z B;  3CUQ B;  1YJN I;  1IN5 A;  2E34 A;  1LDD A;  3H9Q A;  4A3B J;  1ZG3 A;  3WTS C;  5F08 A;  3WTZ A;  5L3E A;  1X3U A;  3IH4 A;  4RAF A;  5DS9 A;  1LFB A;  2BEO A;  1U8R A;  1E3O C;  5DEQ A;  5TIS C;  4BHC A;  2K3P A;  3HRT A;  3JRF A;  3KEO A;  3FM3 A;  5F04 A;  4AU7 A;  5FLX K;  3RCO A;  3IL2 A;  4I0B A;  3SZP A;  2YUS A;  1I6X A;  4GRI A;  2EIL H;  2MBF A;  2EIM H;  1OMI A;  2VJI A;  3KP6 A;  4EAT A;  4UNO A;  3MAJ A;  2KIS A;  1VQ6 I;  4BY7 J;  2LKS A;  2EWN A;  4PFO A;  3IRQ A;  2WAF A;  3W6K B;  1FTZ A;  4IHW A;  3L2C A;  2O9L A;  5KVR A;  2DDB A;  3SXY A;  1ZGA A;  3JRA A;  2JPC A;  2Y9Y A;  1FJL A;  1FOW A;  4BH9 A;  3RKW A;  1UCR A;  2QBY B;  2F5V A;  3IC7 A;  3LNQ A;  3W3C A;  3I4M J;  2QWW A;  3WOD F;  4ENM A;  2M0M A;  2EFQ A;  5FRN A;  2E7X A;  3FM5 A;  2ELJ A;  3OOP A;  4LLG F;  4PJ0 C;  4YFK F;  1Z1D A;  4AID A;  1IO2 A;  1V3F A;  4RGS A;  3CCY A;  3EUK L;  4A3K J;  3VYS B;  2LF8 A;  5EGO B;  1R5I D;  2D1H A;  1H89 C;  9ANT A;  4WXC A;  2EB7 A;  4ZYG A;  2WBM A;  1YI2 I;  3HSE A;  3F6V A;  2F2E A;  2AXL A;  3S1R J;  4G94 A;  2M34 A;  5TRD A;  1WJF A;  3DCF A;  5DCF A;  1ETW A;  4MQV A;  2DTZ A;  4C3J J;  1TQI A;  4BE2 A;  2E1C A;  1YOV B;  4HQM A;  2KRF A;  3PFI A;  5GPC A;  2ESH A;  3AG1 H;  2P81 A;  2O6G E;  1SD6 A;  2OV7 A;  2OCC H;  2DO7 A;  4HOB A;  3BTJ A;  3BR3 A;  2UWM A;  1MSF C;  1SFK A;  3E6C C;  4R8H A;  5LHH A;  3EUA A;  3RSN A;  4XOT A;  1WI9 A;  4L5E A;  3JRH A;  4EM1 A;  3OIQ A;  2HDC A;  5DUI A;  4CCN A;  4XOP A;  1RR7 A;  5L3G A;  4DNC A;  4XRS G;  3IWF A;  3ZMV A;  3VFZ A;  2Z9O A;  1E3P A;  1RC9 A;  4LLL A;  3RIR A;  2LD5 A;  4EJU A;  3HB9 A;  4PZJ A;  4BQQ A;  3A0H C;  5HNF A;  4II3 A;  4KA4 A;  4XM3 A;  4OIN F;  4IRI A;  3RQI A;  3RYP A;  4NC6 A;  3BG6 A;  3DTI A;  2QVO A;  2DJI A;  4P55 A;  3A01 A;  2FXA A;  3OL3 A;  3WU0 A;  2VON A;  1GVJ A;  4XON A;  1OPC A;  3SZG A;  2H6C A;  1O7F A;  2OTL I;  3TBI A;  5FLV A;  2WAQ A;  3S1Q J;  1FP2 A;  1X1B A;  1JGS A;  2NRA C;  2VI6 A;  4V2G A;  4EGY A;  1XCV A;  2R5Z B;  1G59 A;  3C2H A;  2FBH A;  1TLH B;  4XOR A;  1FSE A;  1YX5 A;  2AO9 A;  2QM3 A;  3BDD A;  4OMY A;  2KRC A;  2DOE A;  3WU2 C;  2KL4 A;  4IOC F;  4XNF A;  1ZG1 A;  2DQL A;  3BTL A;  2A3S A;  3HYI A;  4Q47 A;  3SYT A;  5LBQ A;  5FKO A;  2XPW A;  2W25 A;  3TQN A;  2XGD A;  1QVT A;  3ZP5 A;  1GHC A;  3OYI A;  1BI3 A;  1JTX A;  2JA2 A;  3OWT A;  4E7L A;  4DBR A;  1IRX A;  1YYV A;  2F5D A;  3LSJ A;  3H0D A;  1PP8 F;  3F22 A;  3DFG A;  4DYC A;  3W6J B;  3OY9 A;  2IJL A;  2IS1 A;  2DXI A;  1BIA A;  4C9Y A;  1J75 A;  2L02 A;  3PL8 A;  2AS5 F;  3EDP A;  4HZF A;  3CO7 C;  1ON2 A;  3BZK A;  3LL7 A;  2FMY A;  4XN3 A;  1VQN I;  2XAJ A;  1RES A;  1BJZ A;  1FBQ A;  3DEW A;  4MO7 A;  4S04 A;  1VQ7 I;  5EEH A;  3TDU C;  4S05 A;  2JRM A;  4ZC3 A;  1LKX A;  3K1N A;  1KU9 A;  2VKD A;  2XF5 A;  4M6X A;  1W0T A;  1YRN B;  4XIC A;  1Z7U A;  1Y1V J;  3GYH X;  2XDV A;  4WWC A;  4EJV A;  1QZY A;  1HCR A;  1TQP A;  2VBX A;  2W82 A;  3BR2 A;  2CH0 A;  2M0C A;  2NOJ B;  4V19 K;  4M73 A;  1X2N A;  1NG7 A;  2JTV A;  2X6O A;  2VQH A;  4ANJ A;  1O3R A;  1GVD A;  2HKX A;  4NB5 A;  3S2D J;  1FYK A;  3V7S A;  1SMY F;  2GQQ A;  2VBW A;  3FK6 A;  3LQR A;  5J6X A;  4LMY A;  4OIR F;  1CQT A;  3LA3 A;  3IHU A;  3IRR A;  1ZKG A;  2VE9 A;  1XPX A;  1W5T A;  1RR8 C;  2HZD A;  2CV2 A;  1G6N A;  4Q48 A;  5LFA A;  5E20 A;  1LFU P;  2ZME C;  1DGR M;  1A35 A;  3IV5 A;  2MW8 A;  3Q0W A;  3HBL A;  1EH6 A;  4BJ5 C;  3I53 A;  1Y56 A;  4B8X A;  2Y48 A;  1YS7 A;  3D0S A;  2VKV A;  5CKT A;  2Z5U A;  1JHH A;  2W4S A;  2K9N A;  2DMQ A;  1OFC X;  1KQ9 A;  1LVK A;  1OKR A;  2Q2E A;  1V54 H;  3GLL A;  4CHU A;  2V1D A;  4HDU A;  1KU7 A;  3DBH B;  4Z6Y A;  1PP7 U;  3HHG A;  4ZDP A;  5K7F A;  4X6A J;  1D3Y A;  1MSE C;  3DKW A;  2LF7 A;  4J19 A;  2E7W A;  4OAY A;  5DUK A;  4QPO A;  2DOF A;  4AD9 A;  2KKO A;  2R7T A;  1T6S A;  4BXF A;  3BTC A;  4HEA 2;  3K10 A;  2G9W A;  1XDU A;  2DFI A;  2KIU A;  4MGR A;  3ZMD A;  1TP4 A;  3RQ4 A;  3DF8 A;  4A3J J;  3DQV C;  2I5U A;  2HXO A;  2OBP A;  3N97 A;  1FBS A;  4M9Z A;  1JKR C;  1KON A;  3E5U A;  3WU1 B;  2AQF A;  3C3W A;  1P9Q C;  4KIC A;  2TDX A;  5LEK A;  3P9C A;  1FYM A;  1HC8 A;  1FWZ A;  5F0C A;  3S2W A;  1G4D A;  4ENJ A;  4A3L J;  1P4X A;  2HVR A;  2K9L A;  4HX8 A;  5EZH A;  2X1E A;  4P96 A;  2KDZ A;  1E17 A;  3T1B A;  2D1V A;  2ME0 A;  3S3N A;  3NRV A;  4PGG A;  4YIR X;  4JX5 A;  5TJJ A;  1MMG A;  5K7H A;  2YX4 A;  4FTH A;  1BA5 A;  2D45 A;  4XRF A;  2CQ7 A;  2W85 A;  1D0X A;  3KYC B;  5BPI A;  4B44 A;  3Q0V A;  3DKX A;  1FMV A;  2BHZ A;  4A2U A;  2DAO A;  2V6E A;  2CFX A;  2XGC A;  5CQE A;  4G6T B;  2EIN H;  4A5N A;  2B63 J;  3BCB A;  5E3L A;  1W4M A;  3CCQ I;  2A61 A;  5EJC A;  3E6B A;  1TZL A;  2JVH A;  2KIQ A;  2XPV A;  1Y6I A;  4CCM A;  4DW6 A;  4Y7N J;  3HKZ N;  1IF1 A;  4HW0 A;  3RPQ A;  2XC7 A;  6PAX A;  4PCQ A;  1W1W E;  3LSR A;  1YHQ I;  1MGT A;  5FKL A;  3C7J A;  1ZQ3 P;  1SFE A;  4BUP A;  1O4X A;  1MMN A;  1I1S A;  2DU9 A;  2N8G A;  3O6B B;  2NNN A;  4LK0 F;  4BE0 A;  4M3G A;  3JTG A;  1O3S A;  4HF1 A;  1UHS A;  1XSX A;  2EFN A;  5GAD J;  2ZJ2 A;  3G4S I;  2WB1 A;  4QWQ A;  1NK3 P;  2LY1 A;  2NS0 A;  1Q1V A;  2XKP A;  2HYF A;  1U5T A;  3ECO A;  1RNL A;  3KFW X;  2Y9Z A;  1OYI A;  5DD4 A;  3I64 A;  2VC1 A;  4HNV A;  1Y1W J;  4O5V A;  2DI3 A;  3MN2 A;  4IHY A;  2H27 A;  1FIA A;  4CCK A;  1DQU A;  4BEH A;  3CES A;  1ACI A;  1A6I A;  4LD5 A;  5A2Q Z;  4Q4Z F;  2MC3 A;  4B1R A;  1OQY A;  4N4N B;  2DPD A;  2OU2 A;  3KLN A;  4XMY A;  4PSW A;  1KQ8 A;  5HLH A;  3E3V A;  4RM2 A;  4QLC U;  2KT0 A;  3KP5 A;  5J1Y A;  2BHY A;  2L4A A;  5JVG F;  1OIS A;  2GXG A;  4JOM A;  4RLF A;  3ASN H;  2DA1 A;  2GLO A;  2NYX A;  1IJW C;  4YFN F;  1LPQ A;  5ICE A;  3L9F A;  4FE7 A;  4L9T A;  2I10 A;  4C2M J;  1TC3 C;  1WCM J;  2BV6 A;  1ORK A;  1Z6R A;  3TW7 A;  5ILU A;  3Q5F A;  1QA6 A;  1OCR H;  1YS6 A;  1DUX C;  3TGN A;  2EFW A;  2H1L A;  5IPA A;  4M6V A;  3JRC A;  3IP4 B;  2DA3 A;  1MBG A;  1J59 A;  4E7J A;  5IT9 Z;  4OMZ A;  3I55 I;  1T38 A;  1UHM A;  2R7U A;  3L1P A;  1SAX A;  2YR2 A;  3CCE I;  1GV5 A;  1LFP A;  5HDG A;  3ERM A;  1VF9 A;  4M71 A;  2EIK H;  5FFZ A;  2XRN A;  1EKE A;  2Z2S B;  1SMT A;  3QU6 A;  4HV5 A;  3GTJ J;  2G7U A;  2DK8 A;  4G12 A;  1A31 A;  1WKM A;  1ETX A;  4BJ6 C;  1UFM A;  3D5S C;  5L3D A;  1E0E A;  2IA1 A;  3TO9 A;  3FMQ A;  3F8C A;  4KT6 A;  1BI2 A;  3CDI A;  5FD5 A;  3S15 J;  4QIW N;  2ZCW A;  2CGP A;  2HNH A;  1FPQ A;  4UV9 A;  3M07 A;  4FAS D;  2FA5 A;  3JR9 A;  2HVQ A;  1F4K A;  3OYD A;  4AYB N;  2R5Y B;  2LSO A;  3M7G A;  5HLG A;  1MNM C;  3WGG A;  2TRT A;  1TQM A;  4PK4 A;  4OAZ A;  1TW3 A;  1IUF A;  2HQA A;  3GUD A;  2EFO A;  4A3G J;  2MC4 A;  2EIJ H;  4X0G A;  2ACJ A;  1K83 J;  1S8N A;  5TGT A;  3OL4 A;  2ZKZ A;  3ZCO A;  3T8T A;  3ZMU A;  2Y0S A;  3GCM A;  5E1W A;  4UUS A;  2JA5 J;  3Q9S A;  3NWT A;  3ZGK A;  1OLT A;  4UV8 A;  5B1B H;  3VOD A;  4RA2 A;  3DU5 A;  3VYT B;  3K2Z A;  3EET A;  3KLO A;  4E6K G;  2EZH A;  2E71 A;  2EBI A;  4A0X A;  4AIJ A;  2EPF A;  1QBJ A;  3ZMZ A;  2QQB A;  5JLX A;  1Z9C A;  1R7J A;  3ZQF A;  4BL0 B;  2L7F P;  2QEN A;  2XF6 A;  2LY9 A;  2PBI A;  3ABL H;  2LRE A;  1K79 A;  5J1U A;  1JE8 A;  4Q5S F;  5D5U B;  1R5G A;  1WGX A;  3KX2 A;  3H9G A;  2KHM A;  4G6Q A;  4MFD A;  4OIQ F;  3RPU A;  2XSJ C;  2CUZ A;  3BT9 A;  1O57 A;  5ERI A;  2P6S A;  4HSR A;  3H9J A;  3GX4 X;  2OPT A;  1IXR C;  4XR6 A;  3S1N J;  2CQN A;  4DBQ A;  3F8M A;  3KEY A;  2ZXH A;  2HDD A;  1C0W A;  1X1P A;  5KK1 A;  3H3Z A;  3TMO A;  1RPW A;  2KZG A;  3LOC A;  2FOK A;  2FSW A;  2CS3 A;  5H6Q A;  3RKY A;  4PJN A;  1PUE E;  1JJ8 C;  3KIO A;  2P4W A;  3AG2 H;  2E5N A;  3WHB A;  5KHD A;  1R1T A;  2M4K A;  2W00 A;  1TWC J;  3FIW A;  3A0B C;  3Q0U A;  1JKO C;  1TWH J;  2EV0 A;  4LIU A;  3FXJ A;  1IN6 A;  1B59 A;  2HTJ A;  1F9N A;  1JI8 A;  2WAE A;  4HYE A;  2L4M A;  4F92 B;  4E7K A;  1LQ1 A;  1ZR2 A;  4C3H J;  3MZ8 A;  1MBH A;  3CP2 A;  2XSD C;  3FHN A;  4FE4 A;  4IEJ A;  4L9N A;  3HUG A;  3TDZ C;  1WWX A;  4IZZ A;  3N4M A;  3V8L A;  2JA8 J;  3MKY B;  4C2T A;  2JMW A;  1LDK B;  3BG9 A;  3EQL F;  4BEH B;  3DWL E;  5F64 A;  3HGG A;  3QPS A;  3LSP A;  3G1O A;  1I3Q J;  3L2V A;  3DEE A;  2PG4 A;  1VQL I;  2EZK A;  2QKL B;  1TT0 A;  3I0T A;  5LEJ A;  2W1O A;  4M74 A;  1XS9 A;  4XQF A;  1PVE A;  3B6C A;  5FO5 A;  3X2Q H;  1HKT A;  2XGX A;  2BBY A;  3A03 A;  1I27 A;  1FOX A;  2ME6 A;  1UMQ A;  3MEX A;  2LY2 A;  4M3F A;  4RGU A;  3IKT A;  1K61 A;  3S1M J;  4ABZ A;  3M3Y J;  1YW8 A;  2FF4 A;  3LAP A;  1O3Q A;  1MMD A;  2R7Q A;  1BR4 A;  3F0C A;  5IYD J;  2XAF A;  2E60 A;  3HPG A;  3TO6 A;  5M3M J;  4NUB A;  3CC4 I;  2DFH A;  2V6C A;  3CD6 I;  4UB6 C;  1EV7 A;  1W7P A;  2FBI A;  4D7M A;  3I3L A;  3BOQ A;  3FXM A;  3CCL I;  1XSD A;  5LHG A;  3FXU A;  1L0O C;  2NVT J;  2E36 A;  3I59 B;  2DN0 A;  4D7N A;  3S3M A;  1Z21 A;  2WAQ N;  3C1D A;  4XLP F;  5A2Q K;  3MQ0 A;  1R36 A;  2B9S A;  2P5K A;  5DV5 A;  1H9T A;  5BNG A;  3HG9 A;  4BE1 A;  1IRZ A;  4EM0 B;  3HOT A;  2GIZ A;  1USS A;  1JUS A;  2P7V B;  3S16 J;  4GYI A;  4GGG A;  3OS0 A;  2CJJ A;  4DGW B;  3IAS 2;  5H2F C;  2FJ1 A;  4A5M A;  1VQO I;  3SHF A;  1UG0 A;  3DTK A;  4XKW A;  3E5Q A;  1B72 A;  1R5H A;  3AG3 H;  3TW6 A;  1ZK8 A;  3IH2 A;  2IA2 A;  1QPM A;  4ZZL A;  3HXL A;  3NAU A;  4Y17 A;  1IUY A;  2CYY A;  2L01 A;  2E2I J;  1OR7 A;  1XD7 A;  4HNT A;  3FIS A;  4DJA A;  1SD4 A;  3KP2 A;  4B3A A;  4P9F A;  4V2F A;  3DLA A;  1ZN2 A;  2OTJ I;  3K4N A;  1YIJ I;  3Q3S A;  4GO1 A;  2KRH A;  4E4H A;  4RGX A;  4D1Q A;  4FX4 A;  3CJR B;  4CUG A;  2FUG 2;  3L09 A;  3R61 A;  3CCM I;  2ID6 A;  1FT9 A;  1QPI A;  4MEX F;  3AL0 B;  2Y75 A;  4RLQ A;  3DPL C;  2H94 A;  4U0Y A;  1VND A;  5FKM A;  2LC2 A;  3MD2 A;  3P9K A;  2IPQ X;  3G2B A;  4N4O B;  4YEL A;  1I5Z A;  5JVT A;  3JRI A;  2EZI A;  2HR3 A;  2VJ4 A;  1UB9 A;  3AL0 C;  5FRO A;  4Z2Y A;  2XHK A;  3GVA A;  3CUQ C;  2M5W A;  3REO A;  3DXJ F;  3ZPL A;  1Q1H A;  4F7Z A;  2PJP A;  2L9S A;  3CC2 I;  1YE9 A;  2L9N A;  4LG3 A;  4UHT A;  3W2V A;  3GZ5 A;  2EH3 A;  1HDP A;  2DCE A;  1MNE A;  2RC4 A;  4XSZ F;  5KAF C;  5M3F J;  1MBK A;  2OA4 A;  3F8B A;  5L3C A;  3JW4 A;  1PJR A;  4RDU A;  1D0Z A;  2DMP A;  3F9K A;  3QYE A;  1T39 A;  2O8X A;  1LUJ B;  2HYG D;  3CDH A;  3E5X A;  2JJ7 A;  1IAW A;  5GAE J;  2PI0 A;  4I0A A;  2V1U A;  1YX3 A;  3QYB A;  3HRU A;  4BHB A;  3PIP F;  3K4J A;  2FML A;  3I58 A;  3WE3 A;  4CSW A;  3ESW B;  2K7L A;  4BS9 A;  2PN6 A;  2ZME A;  4BHP A;  4CYC A;  1Z6T A;  4JX6 A;  1U0J A;  2A6E F;  3FKJ A;  4EEF G;  2JQ7 A;  5C44 J;  3NQO A;  2KIF A;  3I4N J;  3CTA A;  1LE8 B;  1AA7 A;  2GOM A;  4IQ4 A;  2IGK A;  2HU9 A;  3VYR B;  4NBQ A;  2JA6 J;  2IGM A;  2Q0O A;  2Y31 A;  4HBL A;  2HPI A;  4XLE A;  4NNJ A;  3F8F A;  5FJ8 J;  3DPU A;  2QGU A;  3OIP A;  2RQP A;  1UZC A;  2CFO A;  3OYA A;  4HF0 A;  4HX7 A;  4A6D A;  2CQX A;  3BJO A;  1ZAO A;  2Y30 A;  2K9S A;  2CG4 A;  3BJ6 A;  2BGC A;  3R0A A;  1IDY A;  4KUM A;  3ML6 A;  2RGV A;  1VQ5 I;  3CJN A;  3H3U A;  1ERD A;  1PUF B;  4C2U A;  1K6Y A;  2UUZ A;  5HS8 A;  3GTP J;  5CQG A;  2YS9 A;  2QCO A;  2XF7 A;  3PUF A;  2WV1 A;  1Y0U A;  2QF7 A;  2Z33 A;  1FBU A;  3C2G A;  3M1E A;  4U7B A;  1I3A A;  2ADU A;  4ITV A;  1R1V A;  5FKN A;  3CME I;  5D4S A;  1T98 A;  2A69 F;  1WH5 A;  1W7P B;  3R0J A;  2Q1Z B;  1V55 H;  1EF4 A;  3O8G A;  1HOM A;  4W97 A;  4XKC A;  5CVV A;  1BR2 A;  1R49 A;  1GT0 C;  4KIB A;  4GCV A;  4UVB A;  4YG2 F;  2PLY A;  4I02 A;  4KJZ A;  1HW5 A;  2QLZ A;  2DFE A;  5E8G A;  4HRI A;  4FCY A;  3W2W A;  3ZMS A;  1R22 A;  1S9H A;  2AXT C;  2HOT A;  1ZG5 A;  2TCT A;  3LAJ A;  1XGM A;  4Y13 A;  1WRJ A;  4U7D A;  3JRB A;  1B72 B;  2D5V A;  3FXK A;  3ZR8 X;  1VQK I;  4PJL A;  1T8I A;  2BVL A;  2IT0 A;  2KDO A;  3LQQ A;  5HDN A;  3W6V A;  4II2 A;  3CUO A;  5BOX A;  2QQ9 A;  3K4B A;  5B66 C;  2VXZ A;  4I6Z A;  2VB6 A;  3FWE A;  1S72 I;  1BC7 C;  2LK2 A;  1W5S A;  3FDY A;  2JK3 A;  1ENH A;  2HS5 A;  4W1U A;  4N0B A;  4A3C J;  1FEX A;  2Y0M A;  2M45 A;  3ZQG A;  4P1W A;  4XK4 A;  3KZZ A;  5B1A H;  1ZAR A;  2PFB A;  4MIM A;  3U1D A;  4XRS A;  4CCJ A;  4UXN A;  3J7A O;  1F36 A;  1RKT A;  2R4G A;  4EJW A;  2HOS A;  3PJR A;  1Y8R B;  4CZZ A;  5H20 A;  3F72 A;  3E97 A;  2ELH A;  3I71 A;  2JUG A;  1A36 A;  1MH3 A;  2P6T A;  1XG1 A;  3BCA A;  2F48 A;  4KYW A;  3V8K A;  2MLG A;  1MDM A;  4U88 A;  1UG2 A;  2O5R A;  5D8K B;  1UST A;  3F8N A;  4MEY F;  2VJ5 A;  5B5E C;  4XID A;  3A2K A;  1Z3Y A;  2RV8 A;  2MYS A;  2BZT A;  1MMA A;  1VI0 A;  2BOL A;  3BTI A;  5M5Y J;  3PNY A;  3FZV A;  2LOO A;  4C3I J;  1UHW A;  2L7M P;  2XAG A;  3G71 I;  2VLA A;  5AIP A;  3ZRG A;  3QP5 A;  2CWE A;  3TP3 A;  4UVA A;  3T8R A;  2VT2 A;  2LP0 A;  3BLY A;  5LRR A;  1TTY A;  2DA7 A;  3G73 A;  2ISZ A;  5GTH C;  5FGM A;  2VE8 A;  4I99 C;  1PYV A;  3Q9V A;  5IY5 H;  4A3E J;  4AVZ A;  3BQY A;  4EV0 A;  3RZD J;  3ZQQ A;  2R92 J;  2VBY A;  3JSP A;  4LB6 B;  1P7J A;  1I39 A;  2L9V A;  3I9V 2;  5E17 F;  2OZU A;  3D1N I;  1MJA A;  4CYC B;  4LG0 A;  1FTT A;  3HJE A;  4RAG A;  1Y8Q B;  1G3W A;  4MHG A;  3BR1 A;  1U6G A;  3FX3 A;  2DK5 A;  2YU3 A;  3QPH A;  3L00 A;  3SDB A;  1BIB A;  3GZ6 A;  1UAA A;  3WE2 A;  3GME A;  1BW5 A;  5GPA A;  3ABM H;  3G3Z A;  4MTE A;  1IZ1 A;  1JHF A;  1ETK A;  2Y0S N;  1K4T A;  4S0H B;  2NVQ J;  4FIS A;  3PQJ A;  3KYL A;  2JT1 A;  1MBF A;  2X1D A;  5DCM A;  1D1B A;  1QQI A;  2DMU A;  4IPA A;  1REP C;  3FBI B;  5DM6 F;  1IRF A;  2L9R A;  3V4G A;  3QPL A;  2Z16 A;  4EM2 A;  2JWT A;  3PM1 A;  1HST A;  2ZBK A;  2HOA A;  2A05 A;  2O7O A;  3QOE A;  3PNV A;  4HPQ A;  4RM3 A;  3J7Z I;  4M6Y A;  3WTW C;  4F93 B;  1S3J A;  4DIQ A;  3JSO A;  2ZJQ F;  1R1U A;  4XRM A;  5J47 A;  1X3Z B;  4NDL A;  3JRE A;  3OS2 A;  1OCT C;  4ENK A;  4ZYH A;  1DP3 A;  1TL8 A;  2LG4 A;  1Z7L A;  4DOZ A;  2FNP A;  1R4M B;  4BAY A;  5C4J J;  3OYL A;  2FNA A;  1T0F C;  5EG0 A;  4AVP A;  2QQ8 A;  2W84 A;  3A01 B;  1IN7 A;  1D8K A;  2K27 A;  1YLF A;  3M9A A;  4WX9 A;  1HDD C;  4M72 A;  1SFO J;  2X9D A;  3TKY A;  2DPU A;  2EA4 A;  3KYD B;  5ICG A;  3FHZ A;  2QA4 I;  2P7C B;  2L7K A;  4BYY A;  1EH7 A;  1ZHF A;  4I98 B;  5EZG A;  3RI4 A;  3MZY A;  2R93 J;  1S7E A;  5F27 A;  4QPQ A;  1NG6 A;  3M8E A;  5E1Z B;  2QEX I;  1ZRC A;  4H4K C;  3G1M A;  2JN6 A;  4A0Z A;  3U1K A;  4IRG A;  2WWY A;  1MKM A;  2KJC A;  4BXX J;  1ZR4 A;  1GLN A;  1GXP A;  3KET A;  2GBY A;  1J0R A;  3E1S A;  1IXS B;  2GXA A;  3EUH A;  1ZRD A;  3ZQL A;  2ISY A;  1N78 A;  4H0E A;  4KNY A;  1KZH A;  4IL6 C;  1WSU A;  2J5P A;  2M8E A;  2JRT A;  2MD0 A;  2FBK A;  2VAS A;  3SEQ A;  2I8D A;  4L0Y B;  1X2M A;  3K1M A;  2DTR A;  4MTD A;  3L2W A;  3H92 A;  1ULY A;  3JCU C;  3KP7 A;  4MNU A;  3K1P A;  3PFY A;  1B9N A;  4AIH A;  3O2P E;  1KU3 A;  2BXY A;  1B8I A;  3M1C A;  1MND A;  1QVU A;  2LKX A;  5J8F A;  2ZFU A;  5EEA A;  4XLA A;  1HKQ A;  5K7Z A;  1V5E A;  3SQN A;  3GTG J;  1FYL A;  2NXN B;  4ZJZ A;  1T33 A;  2JPB A;  2K85 A;  1AOY A;  1FY7 A;  4FHT A;  3VSL A;  4IO9 F;  3BZ6 A;  4HA8 A;  4RB0 A;  5IYC J;  3QP6 A;  5D6F A;  1W36 C;  1ZRE A;  3ECH A;  3R6S A;  5GTI C;  2PMU A;  1IN8 A;  3QU3 A;  3ZXS A;  3K4K A;  2EFP A;  1BM9 A;  5LGT A;  2DW4 A;  2H8R A;  1MMS A;  2H1K A;  3ZN1 A;  2X6X A;  2Q2E B;  3CCS I;  1SVL A;  4G7Z F;  1U9N A;  3QRF F;  4RB3 C;  3CCR I;  3I54 A;  2HQR A;  1YJW I;  2KIM A;  4ON0 A;  4ESF A;  4EJO A;  4UB8 C;  1K4S A;  1Y0N A;  1RET A;  1WJB A;  3E6D A;  3P5J A;  2DLL A;  4BBS J;  5C3E J;  3GTM J;  2YU9 J;  1AKH A;  2JA7 J;  2STW A;  1DU6 A;  3BC8 A;  2OQG A;  1XMK A;  2DA2 A;  5DCM B;  3GFM A;  5E18 F;  2DOA A;  5F6F A;  3OYK A;  4WXD A;  2CQQ A;  3W2A A;  4BGD A;  1FIP A;  2GWR A;  3HOZ J;  2P0W A;  4UVC A;  4G7O F;  2VKE A;  2HQN A;  2R7R A;  2VT3 A;  2RAE A;  4CCL A;  4KN7 X;  2IGN A;  2IP2 A;  1IV8 A;  1FP1 D;  5DM7 F;  1GDT A;  1YJ9 I;  3LSK A;  2HDW A;  1XX5 A;  1XDS A;  3L2Q A;  1WJ5 A;  2VOP A;  3K6G A;  4NC8 A;  2XB0 X;  3FF5 A;  2E1N A;  3H5R A;  2FX0 A;  3PIO F;  5LGN A;  1H8A C;  3V8J A;  2M2E A;  1QHH D;  1ONV A;  2MH9 A;  3VDX A;  2IXS A;  3SZT A;  4EJT A;  3ISP A;  2PMH A;  4L9J A;  2CV1 A;  2OZ6 A;  4TV7 A;  5FFX A;  1Z91 A;  4PUS A;  2EK5 A;  2QYO A;  5EG0 B;  3WTX C;  3OSG A;  4LJZ F;  3OYJ A;  2MG4 A;  4OOI A;  4DZP A;  1SFU A;  2VOD A;  1SD5 A;  3G6E I;  3TED A;  1HBX G;  2VPL A;  1TWA J;  3OYG A;  1FMW A;  4JQF A;  4P5O A;  1WJA A;  1JTY A;  2H09 A;  4BY1 J;  3ZOB A;  1ZLK A;  3ASO H;  1CGP A;  4FT8 A;  3HOX J;  1OCP A;  3CCU I;  3RDI A;  1BOA A;  4ASN A;  2FOW A;  5AIQ A;  3OOU A;  2HI3 A;  1XB4 A;  4HLX A;  1E2X A;  5BS6 A;  2P5L C;  3ZQH A;  2F6C A;  1KQ0 A;  2WAD A;  3HHH A;  2MH2 A;  2W7N A;  1U5T B;  5ICC A;  1W36 D;  5CVJ A;  3HKZ A;  3MFK A;  4IHS A;  4OIO F;  2FEZ A;  2LYC A;  3S93 A;  1K78 A;  1U5T C;  4ZYE A;  1TWF J;  4ZH4 F;  5BPD A;  4IHT A;  5K5O A;  1QRY A;  4FX0 A;  4G7H F;  1FZP B;  2HYJ A;  2UZK A;  2M7A A;  1KYW A;  1Z77 A;  3S8P A;  3K4M A;  2KLO A;  1DGW Y;  1DP7 P;  5EDN A;  3LSM A;  4WK8 F;  5K5R A;  3CZ6 A;  3H35 A;  2CUE A;  2O61 A;  1IV6 A;  2COB A;  4JK1 X;  1AHD P;  2R7X A;  4E7Z A;  2C6Y A;  1Y39 A;  4AC0 A;  3GW2 A;  3M8F A;  3ABK H;  4CH7 A;  2CV0 A;  3GBG A;  1MJB A;  1B6A A;  2Y69 H;  4N9H A;  1G3Y A;  2F4M B;  2XRO A;  1ZRF A;  2FQ4 A;  4NQW A;  3AFH A;  2ID3 A;  4I09 A;  1RZ4 A;  4NC7 A;  5CVI A;  3T0Y A;  2A6H F;  3O3K A;  1EA3 A;  1D5Y A;  1I6H J;  5IT3 A;  2ELK A;  2ZSI B;  2VJJ A;  2L0K A;  1B8I B;  5HVQ C;  2NVU B;  4IRH A;  2WC2 A;  2E1M B;  3S14 J;  4Y3O A;  5JR3 A;  4GDF A;  1KU2 A;  5L3F A;  3GLX A;  2ETH A;  5HLT A;  3C18 A;  1ON1 A;  3SDG A;  2QZ8 A;  4HV6 A;  1S7O A;  2OC6 A;  1YG2 A;  5H6R A;  4M9S A;  5DD8 A;  2UXN A;  3ERE D;  1O3T A;  3CP8 A;  2PMZ A;  3TOA A;  1JKP C;  4CZC A;  2MGQ A;  2XVC A;  4BU2 A;  2EQR A;  2UV1 A;  4F91 B;  3BPV A;  1TNT A;  4JYK A;  4X1E A;  3H36 A;  2R5Z A;  1MW7 A;  2P8T A;  1WH7 A;  4ZYD A;  5JHF A;  1J7K A;  2B0L A;  2FD5 A;  1AU7 A;  4IVN A;  4JP0 A;  1RKW A;  1VZ0 A;  5JHU A;  1CF7 A;  3WTY C;  1FLI A;  3QOD A;  2NVY J;  2EA2 A;  5F1R A;  3HTS B;  1ZGJ A;  3BPX A;  2IA0 A;  3LSG A;  3T5X A;  3ONQ A;  2F5E A;  4RAZ A;  5GAG J;  3OYB A;  2VOO A;  3LSI A;  2MA3 A;  1YFH A;  2QSG X;  1R23 A;  1YO5 C;  1XCB A;  2A5W A;  1U2W A;  3R4K A;  2MAB A;  2ZXI A;  2L54 A;  2ECC A;  3L7W A;  2COM A;  4UUS B;  1R71 A;  1VQ8 I;  2RRE A;  1NH3 A;  2HEO A;  3DLL F;  3OIO A;  1XGO A;  2E2J J;  4M9X A;  1HW2 A;  3WG9 A;  2O0Y A;  4AYB A;  2M87 A;  2ZB9 A;  2A07 F;  3FMR A;  2CQK A;  3OSF A;  1D8J A;  2W48 A;  4BQA A;  1XGS A;  1FSH A;  5M5W J;  3FXR A;  3TO7 A;  2OQR A;  2R7D A;  3LFU A;  2R7Z J;  2GA1 A;  4IHV A;  4A12 A;  2MFZ A;  3GTO J;  5HOD A;  3V7C A;  4YII A;  1YRN A;  1BI0 A;  1F1Z A;  1W5C C;  3E7L A;  1IN4 A;  1Z67 A;  4I01 A;  2GA2 A;  3HTU A;  3DU6 A;  1T95 A;  3EPZ A;  4YRV A;  1NTC A;  1IGN A;  2VQL A;  1S5L C;  1R6R A;  2RNJ A;  1BI1 A;  1P92 A;  3KEQ A;  1R58 A;  3SJM A;  2BE5 F;  2WTE A;  3KPH A;  3HDD A;  3HOS A;  1JUM A;  1YW7 A;  4L9V A;  5J3L A;  4RBO A;  1IRG A;  2PQ8 A;  4IKF A;  2DT5 A;  2A6T A;  2KMU A;  1ETV A;  1WHU A;  3OR2 C;  1ZGW A;  1QNT A;  2YX7 A;  1SVO A;  3E0J B;  3HM5 A;  4D0P A;  4DYQ A;  3OYC A;  2R7W A;  2LRD A;  4Y52 J;  2V7F A;  1POG A;  3V7R A;  4L18 B;  4HF2 A;  1P4A A;  4A3M J;  1MH4 A;  3MCZ A;  4AIK A;  3COA C;  4U0W A;  3VOE A;  4YEJ A;  4D5C A;  3VPR A;  1O7L A;  4K2E A;  2XUB A;  4MFE A;  2A5Y B;  2OCE A;  1LEB A;  1X19 A;  5AON A;  1FNN A;  3R60 A;  4B09 A;  1A04 A;  5ILV A;  1X1D A;  2LNB A;  1SAU A;  2F4I A;  1BL0 A;  3QOP A;  3HUG B;  4XL9 A;  1R00 A;  4M3B A;  2V1X A;  2M3A A;  3P9I A;  4MQ9 F;  5E79 C;  5EYR A;  5DDG A;  4ZTF A;  4MLO A;  4G6D A;  1IG7 A;  3J81 Z;  1WZ2 A;  4IHX A;  1K78 B;  1J2X A;  2GZW A;  3BP8 A;  2QQA A;  2LBF A;  4BJT A;  2DFF A;  4HAM A;  5D4R A;  2XAQ A;  2ECB A;  4KFC A;  3LA2 A;  3D5L A;  1YIO A;  2B7E A;  4BXU A;  2BW3 A;  3H3V K;  2V9V A;  5KAI C;  4R1H A;  2DBB A;  2HTS A;  1BOB A;  3HEF A;  3F23 A;  1MBJ A;  3K69 A;  2X6Y A;  4WCG A;  1HXD A;  4CGZ A;  4J00 A;  2BYV E;  2X51 A;  4AUX A;  1APL C;  3KP3 A;  5HOO A;  1E3H A;  3GO5 A;  1JUP A;  4BNC A;  1IW7 F;  2V79 A;  1IDZ A;  4RAY A;  2AQE A;  4FET A;  5M5X J;  3QYF A;  4NQW B;  2ZJR F;  5JFR A;  3JAM K;  1P6R A;  2DJN A;  2V9K A;  2HZT A;  1JKQ C;  3EYI A;  4XKB A;  4DQ2 A;  3VWB A;  2R7S A;  4BBR J;  3K2A A;  1T0F A;  4D5F A;  2GM4 A;  2F5F A;  3BY6 A;  3OYF A;  4O3M A;  3CLO A;  4M3E A;  2WB1 N;  3U2R A;  4F55 A;  3RKQ A;  5D8L B;  1BJA A;  2IS4 A;  2ICW G;  2LKP A;  3QPT A;  2HVS A;  4I2O A;  1ETY A;  2BY2 A;  2IVM A;  5CJ9 A;  2O3F A;  2IBD A;  3QAH A;  4HX4 A;  3U21 A;  4BQN A;  2VC0 A;  3OYN A;  3RPU D;  5D5V B;  5JLW A;  1S6L A;  5CVR A;  3SFZ A;  5HNH A;  1HQC A;  1DPR A;  3I56 I;  2XAU A;  3DP7 A;  1F43 A;  2FU4 A;  3PQK A;  1WI3 A;  4LK1 F;  4LIT A;  3HSR A;  1OR7 C;  4N9I A;  4XLF A;  4LB5 A;  2GXB A;  1SC7 A;  1CF7 B;  1LJ9 A;  4KDP A;  4O6J A;  4F3Q A;  3GFJ A;  1NK2 P;  5E3M A;  2X4H A;  2M4G A;  4PDK A;  1WJE A;  3WHC A;  2UXX A;  3A02 A;  2STT A;  1J5Y A;  3A1Y A;  4ZYA A;  5FB2 A;  1XMA A;  1XGN A;  3MWM A;  4LLN A;  5JI6 A;  1SFX A;  2F5C A;  3CMA I;  1KGS A;  2IS2 A;  3CDL A;  5LGU A;  3LFK A;  3JTH A;  2K4J A;  1T2K A;  2X85 A;  2BXZ A;  4ESB A;  5J4V A;  4BAC A;  3HZJ A;  2NS7 A;  2MLK A;  3FK7 A;  2JUC A;  1KA8 A;  1N25 A;  1QGP A;  2OF7 A;  2OJE D;  2CW7 A;  5GAH J;  2DT6 A;  1RUO A;  1H0M A;  3MVP A;  4AWX B;  3F3X A;  5BQT A;  4KIF A;  3NEU A;  5J40 A;  2VL8 A;  3B02 A;  1SD7 A;  5E8I A;  3IUO A;  2IS6 A;  4PSX A;  2E5Z A;  3UR3 C;  3OYH A;  3FBN B;  5K5Q A;  2XIG A;  3BG5 A;  4B3X A;  5F0H A;  2ESN A;  4WF2 A;  4J01 A;  3CCV I;  2CO5 A;  3K7A J;  4EVI A;  1D1C A;  5IOZ A;  5DYM A;  2IRF G;  3L2U A;  1MIJ A;  3RZO J;  4U87 A;  5HS7 A;  4EMS A;  1D1A A;  3GEZ A;  2KQR A;  3GF2 A;  3ULQ B;  1TBX A;  1K7A A;  1IXC A;  2RDP A;  3D5R C;  2ZME B;  3UNG C;  3F21 A;  4IOA F;  1KYZ A;  1IC8 A;  2DA6 A;  2Q8K A;  3DKY A;  3GTQ J;  2DYR H;  1OYY A;  1P2F A;  3LST A;  1W7P D;  3DEU A;  3AKZ A;  3FMS A;  2O8K A;  4GFB A;  1UJ8 A;  3NAR A;  1VQP I;  3J7Y J;  1S29 A;  4RS8 A;  1ZLJ A;  5E1X A;  4BKX A;  2V1N A;  2DYS H;  3ROU A;  3GZN B;  2KP6 A;  5LLQ A;  2CU7 A;  4LGW A;  2Z1D A;  1G3T A;  2MSY A;  3HC7 A;  4XBF A;  2HFH A;  3GFL A;  4Y4R A;  2R0Q C;  1XTA A;  4QSH A;  2ZXW H;  3ZMT A;  1YW9 A;  2R5Y A;  4D9J A;  1XC5 A;  2HWV A;  1JJ6 C;  1U8B A;  2OAZ A;  4IXA A;  2CW8 A;  5IOY A;  3HOY J;  3WG7 H;  1BBY A;  1SVM A;  2RKH A;  2ZNY A;  3EYY A;  2LBF B;  5CLS A;  2RNG A;  4PFP A;  3ZQC A;  3TOB A;  1B1B A;  2K02 A;  4KMU X;  2QSH X;  3MKZ A;  2BW3 B;  1X4O A;  2VKH A;  4HG2 A;  1L3L A;  3PO2 J;  4AM3 A;  1X4P A;  3WGI A;  2L7Z A;  3OV8 A;  3J80 Z;  3LWF A;  5EEG A;  2ZFW A;  2ZXJ A;  3MKL A;  5HDK A;  2VIX A;  4ZTJ A;  4E7H A;  3HOW J;  4RB1 A;  2DA4 A;  3G1L A;  2WY7 Q;  3HSF A;  3SEZ A;  5C4X J;  5KNL A;  2XAS A;  4CO8 A;  2K9Q A;  3I4P A;  3CJT B;  5IP6 A;  1J09 A;  2L3D A;  3J81 K;  3OYM A;  2M8G X;  2K5C A;  1JT6 A;  3FXL A;  2WA0 A;  2X0L A;  1N75 A;  2R7F A;  4B43 A;  4KIG A;  3WTT C;  4PJM A;  2IGO A;  2EZL A;  1VFC A;  1JXS A;  2G0E A;  1V5F A;  3CO6 C;  3HOU J;  2J5O A;  2CRG A;  2XB5 A;  3PSI A;  2Z3Y A;  2DMT A;  3GWZ A;  1MBE A;  2BY1 A;  4XSX F;  4OWR B;  1X1A A;  4GXO A;  2VPR A;  4HDV A;  3CC7 I;  1TW2 A;  2O03 A;  1FOY A;  2LTP A;  2VQG A;  5ICF A;  3PO3 J;  2Z99 A;  1MD0 A;  2XRL A;  2EV5 A;  4KMF A;  1PDN C;  3CLQ A;  2KPM A;  3LMM A;  5BMZ A;  2LFB A;  2VN2 A;  2E2H J;  3M4O J;  1U3E M;  3VSK A;  4NHJ A;  4LIV A;  4PJJ A;  4ZZD A;  1H88 C;  4XN0 A;  3HRS A;  4IJA A;  2A68 F;  3VEP A;  3VB2 A;  3CF2 A;  2RVC A;  5E3N A;  4G9Y A;  4YFX F;  1HW1 A;  1A5J A;  2E19 A;  1ITY A;  1FX7 A;  2CSO A;  4DZJ A;  3I5U A;  3UKG A;  3CF5 F;  1F5T A;  1MDM B;  2E1O A;  2JSP A;  1GV2 A;  2QSF X;  3CQZ J;  1ZEL A;  5CYV A;  3JRD A;  2LDU A;  4E70 A;  4UUV A;  1G3S A;  3N05 A;  5KCM A;  3F6O A;  1WJD A;  4IF4 A;  4KIT B;  2M1B A;  3AAF A;  3ZN0 A;  3BJA A;  1XMX A;  4RGR A;  3RYR A;  3GTL J;  5FKK A;  2OUM A;  2ZNZ A;  4BDZ A;  1P4W A;  5HS9 A;  4BQO A;  1N77 A;  2CUJ A;  2EV6 A;  3K70 C;  1T08 B;  2JSC A;  5IP9 J;  4F52 A;  3HL2 A;  1HLV A;  3RJP A;  4ZDO A;  4C30 A;  5DTD A;  4CCO A;  1ODD A;  1XSV A;  5IP7 J;  3IH3 A;  2PMZ N;  3H0G J;  1STZ A;  3I59 A;  3KE2 A;  3ELK A;  2RN7 A;  2RQQ A;  1X3W B;  2CW0 F;  1WJC A;  5LHI A;  4M3D A;  5D5W B;  1HA8 A;  2DOD A;  1FC3 A;  1B4A A;  2OD5 A;  2K40 A;  3E6M A;  2IAI A;  1S7A A;  4ESJ A;  2W57 A;  2HGC A;  2R7V A;  4JBA A;  5EF6 A;  2ZJP F;  1GXQ A;  1WQ2 A;  2BY3 A;  3HOV J;  3ZQ7 A;  4LG0 B;  3KCC A;  3KP4 A;  2VBZ A;  3HIF A;  3OMY A;  1OJL A;  2LR8 A;  4UY8 I;  2V9P A;  2NOG A;  3QQA A;  5CPR B;  3RKX A;  3S32 A;  3DBR B;  4I76 A;  3FXQ A;  3KZY A;  3JRG A;  4XLH A;  3H5A A;  3TL4 X;  3S17 J;  1R9T J;  3AG4 H;  1RUN A;  1Z05 A;  5FLX Z;  1SAN A;  1I50 J;  2X1C A;  5GP9 A;  4LFU A;  1BN5 A;  3MKW B;  4E7S A;  2X6W A;  1TWG J;  2DT7 B;  4CDG A;  1TT5 B; 
#chains in the Genus database with same CATH homology
 3U9G A;  2PEX A;  2HKO A;  3ABU A;  1I1G A;  3CUQ A;  1QO0 D;  4OIP F;  1MZB A;  2R3S A;  4YIF A;  1U78 A;  3B73 A;  1H9G A;  2XKO A;  3BWG A;  2NAZ A;  4KT5 C;  1ZH5 A;  1BC8 C;  1J9I A;  1VTN C;  2D2W A;  4CYD A;  2YSR A;  1RIO H;  4RB2 C;  1QZZ A;  1AWC A;  2K4B A;  2QBY A;  4I7H A;  1NHA A;  5K1Y A;  3J80 K;  1YQA A;  3ABT A;  4ETS A;  4KN4 X;  1XN7 A;  3JAM Z;  5HLI A;  1ZYR F;  2XV4 S;  1MJ9 A;  3WTU C;  4P9U A;  3K0L A;  2IW5 A;  2FRH A;  2GAU A;  2QUF A;  5ILS A;  2K86 A;  1B9M A;  3WGH A;  2FE3 A;  2G7H A;  4EGZ A;  1TNS A;  4PGH A;  2M30 A;  3GXO A;  3P7N A;  4L5J A;  3DPT A;  2WV0 A;  4G8X A;  4Y15 A;  3DV8 A;  2W24 A;  3IWZ A;  1RI7 A;  1LVA A;  4A0Y A;  4ENN A;  2H6B A;  2EJR A;  5FD6 A;  4U0V A;  5D5X B;  4OU0 A;  5LRS A;  1K6O A;  5L3B A;  4EQQ A;  2GIV A;  2HOE A;  1LDJ A;  2KJB A;  4A6E A;  2MD5 A;  2ZO4 A;  3IKV A;  1LB2 A;  4CIC A;  5ED4 A;  4GYG A;  1D5V A;  3RTR A;  4HLY A;  2DQR A;  3WTV C;  4WXH A;  3HRM A;  3LA7 A;  3MZH A;  1FOK A;  1DPU A;  5CVU A;  5J8C A;  1OYW A;  3GFI A;  2FQ3 A;  4CXF A;  4R79 A;  1YTY A;  1EH8 A;  4HQE A;  1LEA A;  1HKS A;  2YPR A;  1V4R A;  5D6E A;  4L5I A;  1DDN A;  5IT9 K;  1LNW A;  2NNY A;  2P5V A;  3K9T A;  2JZY A;  1HSJ A;  3BRO A;  2XAH A;  4XLN F;  4L0Z B;  3CUQ B;  1IN5 A;  1LDD A;  1ZG3 A;  3WTS C;  3WTZ A;  5L3E A;  1X3U A;  2BEO A;  1U8R A;  5DEQ A;  4BHC A;  3HRT A;  3KEO A;  3FM3 A;  5FLX K;  3IL2 A;  4I0B A;  3SZP A;  1I6X A;  2MBF A;  1OMI A;  3KP6 A;  4UNO A;  3MAJ A;  2EWN A;  3IRQ A;  3W6K B;  3L2C A;  5KVR A;  3SXY A;  1ZGA A;  2JPC A;  4BH9 A;  3RKW A;  1UCR A;  2QBY B;  3IC7 A;  2QWW A;  3WOD F;  4ENM A;  2EFQ A;  2E7X A;  3FM5 A;  3OOP A;  4LLG F;  4YFK F;  1Z1D A;  1V3F A;  4RGS A;  2LF8 A;  2D1H A;  4WXC A;  2EB7 A;  4ZYG A;  3HSE A;  3F6V A;  2F2E A;  2AXL A;  4G94 A;  5TRD A;  5DCF A;  4MQV A;  1TQI A;  2E1C A;  4HQM A;  2KRF A;  3PFI A;  2ESH A;  2O6G E;  1SD6 A;  2DO7 A;  4HOB A;  2UWM A;  3E6C C;  4R8H A;  5LHH A;  1WI9 A;  4EM1 A;  2HDC A;  5DUI A;  5L3G A;  4DNC A;  3IWF A;  3ZMV A;  3VFZ A;  2Z9O A;  4LLL A;  3RIR A;  4EJU A;  4PZJ A;  4KA4 A;  4OIN F;  4IRI A;  3RYP A;  2QVO A;  4P55 A;  2VON A;  2FXA A;  3WU0 A;  1GVJ A;  1OPC A;  2H6C A;  1O7F A;  1FP2 A;  1JGS A;  2NRA C;  4EGY A;  1XCV A;  2FBH A;  1TLH B;  1FSE A;  2QM3 A;  3BDD A;  4OMY A;  1ZG1 A;  2DQL A;  2A3S A;  3HYI A;  4Q47 A;  5LBQ A;  2W25 A;  3TQN A;  1GHC A;  3ZP5 A;  1BI3 A;  1YYV A;  2F5D A;  1PP8 F;  3F22 A;  3DFG A;  3W6J B;  2IJL A;  1BIA A;  1J75 A;  2L02 A;  2AS5 F;  3EDP A;  4HZF A;  3CO7 C;  1ON2 A;  2FMY A;  2XAJ A;  1FBQ A;  4S04 A;  5EEH A;  3TDU C;  4S05 A;  3K1N A;  1KU9 A;  4M6X A;  1Z7U A;  3GYH X;  4WWC A;  4EJV A;  1QZY A;  1TQP A;  2VBX A;  4M73 A;  2JTV A;  1O3R A;  2HKX A;  4NB5 A;  1FYK A;  3V7S A;  1SMY F;  2GQQ A;  2VBW A;  3LQR A;  5J6X A;  4LMY A;  4OIR F;  3LA3 A;  3IHU A;  3IRR A;  2VE9 A;  1W5T A;  1G6N A;  4Q48 A;  5E20 A;  1EH6 A;  3I53 A;  4B8X A;  2Y48 A;  1YS7 A;  3D0S A;  2Z5U A;  1JHH A;  1KQ9 A;  2Q2E A;  1OKR A;  4CHU A;  2V1D A;  4HDU A;  1KU7 A;  1PP7 U;  3HHG A;  1D3Y A;  3DKW A;  2LF7 A;  2E7W A;  5DUK A;  4AD9 A;  2KKO A;  1T6S A;  2G9W A;  1XDU A;  2DFI A;  2KIU A;  4MGR A;  3ZMD A;  3DF8 A;  3DQV C;  2OBP A;  3N97 A;  1FBS A;  4M9Z A;  3E5U A;  3WU1 B;  3C3W A;  4KIC A;  2TDX A;  5LEK A;  3P9C A;  1FYM A;  1FWZ A;  3S2W A;  1G4D A;  4ENJ A;  1P4X A;  4HX8 A;  4P96 A;  1E17 A;  3T1B A;  2D1V A;  3NRV A;  4PGG A;  5TJJ A;  2YX4 A;  2D45 A;  4XRF A;  2W85 A;  5BPI A;  4A2U A;  2DAO A;  2CFX A;  4A5N A;  1W4M A;  2A61 A;  3E6B A;  1IF1 A;  4HW0 A;  3RPQ A;  6PAX A;  4PCQ A;  1MGT A;  3C7J A;  1SFE A;  1I1S A;  2DU9 A;  3O6B B;  2NNN A;  4LK0 F;  1O3S A;  3JTG A;  4HF1 A;  1XSX A;  2EFN A;  2ZJ2 A;  4QWQ A;  2NS0 A;  2XKP A;  2HYF A;  1U5T A;  3ECO A;  1RNL A;  3KFW X;  1OYI A;  5DD4 A;  3I64 A;  2VC1 A;  4O5V A;  2DI3 A;  2H27 A;  4Q4Z F;  4LD5 A;  5A2Q Z;  2MC3 A;  2DPD A;  2OU2 A;  3KLN A;  1KQ8 A;  5HLH A;  3E3V A;  4QLC U;  3KP5 A;  2L4A A;  2GXG A;  2NYX A;  4YFN F;  5ICE A;  3L9F A;  4L9T A;  2BV6 A;  1Z6R A;  5ILU A;  3Q5F A;  1YS6 A;  1DUX C;  3TGN A;  2EFW A;  1J59 A;  5IT9 Z;  4OMZ A;  1T38 A;  1UHM A;  1SAX A;  2YR2 A;  5HDG A;  4M71 A;  5FFZ A;  2XRN A;  1SMT A;  3QU6 A;  4HV5 A;  2G7U A;  2DK8 A;  1WKM A;  1UFM A;  5L3D A;  2IA1 A;  3TO9 A;  3FMQ A;  3F8C A;  1BI2 A;  5FD5 A;  2ZCW A;  2CGP A;  1FPQ A;  4UV9 A;  2FA5 A;  1F4K A;  2LSO A;  3M7G A;  5HLG A;  3WGG A;  1TQM A;  1TW3 A;  3GUD A;  2EFO A;  2ACJ A;  1S8N A;  3ZMU A;  2ZKZ A;  3T8T A;  5E1W A;  3Q9S A;  4UV8 A;  3VOD A;  3K2Z A;  3EET A;  3KLO A;  4A0X A;  4AIJ A;  1QBJ A;  3ZMZ A;  2QQB A;  1Z9C A;  1R7J A;  2QEN A;  2PBI A;  1K79 A;  1JE8 A;  4Q5S F;  5D5U B;  1R5G A;  4G6Q A;  4OIQ F;  3RPU A;  5ERI A;  1O57 A;  2P6S A;  3GX4 X;  1IXR C;  3F8M A;  1C0W A;  5KK1 A;  3H3Z A;  2FOK A;  2FSW A;  5H6Q A;  3RKY A;  1PUE E;  2P4W A;  1R1T A;  2EV0 A;  1IN6 A;  1B59 A;  2HTJ A;  1F9N A;  4HYE A;  2L4M A;  1LQ1 A;  4L9N A;  3HUG A;  3TDZ C;  1WWX A;  3N4M A;  3V8L A;  1LDK B;  3EQL F;  5F64 A;  2PG4 A;  5LEJ A;  3I0T A;  4M74 A;  5FO5 A;  1HKT A;  2XGX A;  2BBY A;  1I27 A;  3MEX A;  4RGU A;  3IKT A;  1YW8 A;  2FF4 A;  3LAP A;  1O3Q A;  2XAF A;  3TO6 A;  2V6C A;  1EV7 A;  1W7P A;  2FBI A;  3BOQ A;  1XSD A;  5LHG A;  3FXU A;  1L0O C;  3I59 B;  4XLP F;  3C1D A;  5A2Q K;  3MQ0 A;  1R36 A;  2P5K A;  5DV5 A;  1H9T A;  4EM0 B;  3HOT A;  1USS A;  2P7V B;  4GYI A;  4GGG A;  4A5M A;  3SHF A;  3E5Q A;  1R5H A;  2IA2 A;  1QPM A;  4ZZL A;  1IUY A;  4Y17 A;  2CYY A;  2L01 A;  1OR7 A;  1XD7 A;  1SD4 A;  3KP2 A;  4P9F A;  1ZN2 A;  4GO1 A;  4RGX A;  4FX4 A;  3L09 A;  3R61 A;  1FT9 A;  4MEX F;  2Y75 A;  3DPL C;  2H94 A;  4U0Y A;  3P9K A;  2IPQ X;  1I5Z A;  5JVT A;  2HR3 A;  1UB9 A;  4Z2Y A;  2XHK A;  3GVA A;  3CUQ C;  2M5W A;  3REO A;  3DXJ F;  3ZPL A;  1Q1H A;  4F7Z A;  2PJP A;  4UHT A;  3GZ5 A;  2RC4 A;  4XSZ F;  2OA4 A;  3F8B A;  5L3C A;  3JW4 A;  1T39 A;  2O8X A;  2HYG D;  3CDH A;  3E5X A;  1IAW A;  2PI0 A;  4I0A A;  2V1U A;  3HRU A;  4BHB A;  2FML A;  3I58 A;  3WE3 A;  2K7L A;  2PN6 A;  2ZME A;  4BHP A;  1Z6T A;  2A6E F;  3NQO A;  2KIF A;  3CTA A;  2Q0O A;  4HBL A;  3F8F A;  2RQP A;  4HF0 A;  4HX7 A;  4A6D A;  1ZAO A;  3BJO A;  2CG4 A;  2BGC A;  3BJ6 A;  3R0A A;  4KUM A;  3ML6 A;  2RGV A;  3CJN A;  3H3U A;  5HS8 A;  1Y0U A;  2Z33 A;  1FBU A;  3M1E A;  4U7B A;  2ADU A;  1R1V A;  5D4S A;  1T98 A;  2A69 F;  1W7P B;  3R0J A;  5CVV A;  4KIB A;  4GCV A;  4UVB A;  4YG2 F;  2PLY A;  4I02 A;  1HW5 A;  2QLZ A;  5E8G A;  3ZMS A;  1R22 A;  1ZG5 A;  3LAJ A;  1XGM A;  4Y13 A;  1WRJ A;  4U7D A;  2IT0 A;  3LQQ A;  5HDN A;  5BOX A;  3CUO A;  2QQ9 A;  2VXZ A;  3FWE A;  1BC7 C;  1W5S A;  2HS5 A;  4N0B A;  2Y0M A;  2M45 A;  3KZZ A;  1ZAR A;  2PFB A;  3U1D A;  4UXN A;  3J7A O;  4EJW A;  4CZZ A;  5H20 A;  3F72 A;  3E97 A;  2ELH A;  3I71 A;  2P6T A;  4KYW A;  3V8K A;  2MLG A;  1MDM A;  4U88 A;  5D8K B;  1UST A;  3F8N A;  4MEY F;  2RV8 A;  3FZV A;  1UHW A;  2XAG A;  5AIP A;  3QP5 A;  2CWE A;  4UVA A;  3T8R A;  2VT2 A;  5LRR A;  1TTY A;  3G73 A;  2ISZ A;  5FGM A;  2VE8 A;  3Q9V A;  4EV0 A;  2VBY A;  3JSP A;  4LB6 B;  5E17 F;  2OZU A;  1MJA A;  4LG0 A;  1G3W A;  4MHG A;  1U6G A;  3FX3 A;  2DK5 A;  2YU3 A;  3QPH A;  3L00 A;  1BIB A;  3GZ6 A;  3WE2 A;  3G3Z A;  4MTE A;  1IZ1 A;  1JHF A;  3PQJ A;  2JT1 A;  5DCM A;  1QQI A;  4IPA A;  1REP C;  1IRF A;  3V4G A;  4EM2 A;  1HST A;  2ZBK A;  4M6Y A;  3WTW C;  1S3J A;  3JSO A;  1R1U A;  4ENK A;  4ZYH A;  2FNP A;  4BAY A;  2FNA A;  4AVP A;  2W84 A;  1IN7 A;  1D8K A;  2K27 A;  1YLF A;  3M9A A;  4WX9 A;  4M72 A;  3TKY A;  2DPU A;  2EA4 A;  5ICG A;  3FHZ A;  2P7C B;  4BYY A;  1EH7 A;  1ZHF A;  4I98 B;  3RI4 A;  3MZY A;  3M8E A;  5E1Z B;  1ZRC A;  4A0Z A;  4IRG A;  2WWY A;  1MKM A;  2KJC A;  1GXP A;  3KET A;  1J0R A;  1IXS B;  3EUH A;  1ZRD A;  2ISY A;  4H0E A;  4KNY A;  1WSU A;  2J5P A;  2M8E A;  2JRT A;  2FBK A;  4L0Y B;  3K1M A;  2DTR A;  4MTD A;  3H92 A;  1ULY A;  3KP7 A;  4MNU A;  3K1P A;  1B9N A;  4AIH A;  3O2P E;  1KU3 A;  5J8F A;  1HKQ A;  3SQN A;  1FYL A;  2JPB A;  1AOY A;  1FY7 A;  4FHT A;  3BZ6 A;  4HA8 A;  4RB0 A;  3QP6 A;  5D6F A;  1ZRE A;  3ECH A;  3R6S A;  2PMU A;  1IN8 A;  3QU3 A;  2EFP A;  1BM9 A;  5LGT A;  2DW4 A;  3ZN1 A;  4G7Z F;  3QRF F;  4RB3 C;  3I54 A;  2HQR A;  2KIM A;  4ON0 A;  4ESF A;  4EJO A;  3E6D A;  2DLL A;  2STW A;  5DCM B;  2OQG A;  1XMK A;  3GFM A;  5E18 F;  5F6F A;  4WXD A;  2GWR A;  4UVC A;  4G7O F;  2HQN A;  2VT3 A;  4KN7 X;  2IP2 A;  1FP1 D;  1XDS A;  2VOP A;  3FF5 A;  2E1N A;  5LGN A;  3V8J A;  1ONV A;  2MH9 A;  3SZT A;  4EJT A;  3ISP A;  2PMH A;  4L9J A;  2OZ6 A;  4TV7 A;  5FFX A;  1Z91 A;  2EK5 A;  2QYO A;  3WTX C;  4LJZ F;  1SFU A;  4OOI A;  2VOD A;  1SD5 A;  1HBX G;  4JQF A;  4P5O A;  2H09 A;  1ZLK A;  1CGP A;  4FT8 A;  3RDI A;  1BOA A;  4ASN A;  5AIQ A;  1XB4 A;  4HLX A;  1E2X A;  5BS6 A;  2P5L C;  1KQ0 A;  3HHH A;  2MH2 A;  1U5T B;  5ICC A;  5CVJ A;  3MFK A;  4IHS A;  4OIO F;  2FEZ A;  1K78 A;  1U5T C;  4ZYE A;  4ZH4 F;  5BPD A;  4IHT A;  5K5O A;  4FX0 A;  4G7H F;  1FZP B;  2UZK A;  1KYW A;  1DP7 P;  4WK8 F;  5K5R A;  2O61 A;  4JK1 X;  2C6Y A;  3GW2 A;  3M8F A;  1MJB A;  1B6A A;  4N9H A;  1G3Y A;  2XRO A;  1ZRF A;  4NQW A;  5CVI A;  4I09 A;  3T0Y A;  1RZ4 A;  2A6H F;  3O3K A;  5IT3 A;  5HVQ C;  4IRH A;  2WC2 A;  5JR3 A;  1KU2 A;  5L3F A;  3GLX A;  2ETH A;  3C18 A;  1ON1 A;  2QZ8 A;  4HV6 A;  1S7O A;  1YG2 A;  5H6R A;  4M9S A;  5DD8 A;  2UXN A;  3ERE D;  1O3T A;  3TOA A;  2XVC A;  3BPV A;  1TNT A;  2P8T A;  4ZYD A;  1J7K A;  2B0L A;  4IVN A;  5JHU A;  1CF7 A;  3WTY C;  1FLI A;  2EA2 A;  5F1R A;  3HTS B;  1ZGJ A;  3BPX A;  2IA0 A;  3T5X A;  2F5E A;  4RAZ A;  2VOO A;  2MA3 A;  1YFH A;  1R23 A;  1YO5 C;  1XCB A;  1U2W A;  3R4K A;  2L54 A;  3L7W A;  2COM A;  2HEO A;  1XGO A;  4M9X A;  1HW2 A;  3WG9 A;  2O0Y A;  2M87 A;  2A07 F;  3FMR A;  2CQK A;  1D8J A;  4BQA A;  1XGS A;  1FSH A;  3FXR A;  3TO7 A;  2OQR A;  2R7D A;  2GA1 A;  4A12 A;  3V7C A;  4YII A;  1F1Z A;  1BI0 A;  1IN4 A;  4I01 A;  2GA2 A;  3HTU A;  1BI1 A;  1P92 A;  2RNJ A;  3KEQ A;  1R58 A;  2BE5 F;  2WTE A;  3HOS A;  1YW7 A;  4L9V A;  1IRG A;  2PQ8 A;  2DT5 A;  1QNT A;  2YX7 A;  4D0P A;  3V7R A;  4L18 B;  4HF2 A;  1P4A A;  3MCZ A;  4AIK A;  3COA C;  4U0W A;  3VOE A;  1O7L A;  4K2E A;  2XUB A;  2A5Y B;  1LEB A;  5AON A;  1FNN A;  3R60 A;  4B09 A;  1A04 A;  5ILV A;  2LNB A;  3QOP A;  1R00 A;  2V1X A;  4MQ9 F;  3P9I A;  5DDG A;  4G6D A;  3J81 Z;  1K78 B;  1J2X A;  2GZW A;  3BP8 A;  2QQA A;  4HAM A;  5D4R A;  2XAQ A;  4KFC A;  3LA2 A;  3D5L A;  1YIO A;  4BXU A;  2V9V A;  4R1H A;  2DBB A;  2HTS A;  3F23 A;  3K69 A;  4WCG A;  1HXD A;  4CGZ A;  2BYV E;  3KP3 A;  5HOO A;  3GO5 A;  4BNC A;  1IW7 F;  2V79 A;  4RAY A;  5JFR A;  3JAM K;  1P6R A;  2HZT A;  3EYI A;  4DQ2 A;  1T0F A;  2F5F A;  3BY6 A;  4O3M A;  3CLO A;  3U2R A;  5D8L B;  1BJA A;  2LKP A;  3QPT A;  4I2O A;  2IVM A;  5CJ9 A;  2O3F A;  3QAH A;  4HX4 A;  2VC0 A;  5D5V B;  1S6L A;  5CVR A;  3SFZ A;  1HQC A;  1DPR A;  3DP7 A;  2FU4 A;  3PQK A;  4LK1 F;  3HSR A;  4N9I A;  4LB5 A;  2GXB A;  1CF7 B;  1LJ9 A;  4KDP A;  4O6J A;  3GFJ A;  2X4H A;  4PDK A;  2UXX A;  2STT A;  1J5Y A;  5FB2 A;  1XMA A;  1XGN A;  3MWM A;  4LLN A;  5JI6 A;  1SFX A;  2F5C A;  1KGS A;  5LGU A;  3LFK A;  3JTH A;  2K4J A;  1T2K A;  4ESB A;  2MLK A;  1KA8 A;  1QGP A;  1RUO A;  1H0M A;  4AWX B;  3F3X A;  5BQT A;  4KIF A;  3NEU A;  3B02 A;  1SD7 A;  5E8I A;  5K5Q A;  2XIG A;  2ESN A;  4WF2 A;  2CO5 A;  4EVI A;  5DYM A;  2IRF G;  5HS7 A;  4EMS A;  3GEZ A;  3GF2 A;  3ULQ B;  1TBX A;  1K7A A;  1IXC A;  2RDP A;  2ZME B;  3F21 A;  1KYZ A;  2Q8K A;  1OYY A;  1P2F A;  3LST A;  1W7P D;  3DEU A;  3FMS A;  1S29 A;  4RS8 A;  1ZLJ A;  5E1X A;  3ROU A;  5LLQ A;  4LGW A;  1G3T A;  4XBF A;  2HFH A;  3GFL A;  3ZMT A;  1YW9 A;  2HWV A;  2OAZ A;  4IXA A;  1BBY A;  2RKH A;  2ZNY A;  3EYY A;  5CLS A;  3TOB A;  1B1B A;  2K02 A;  4KMU X;  1L3L A;  3WGI A;  3OV8 A;  3J80 Z;  3LWF A;  5EEG A;  2ZFW A;  2ZXJ A;  5HDK A;  4RB1 A;  3HSF A;  2XAS A;  4CO8 A;  3I4P A;  2L3D A;  3J81 K;  2X0L A;  2R7F A;  4KIG A;  3WTT C;  1JXS A;  3CO6 C;  2J5O A;  2Z3Y A;  3GWZ A;  4XSX F;  4GXO A;  4HDV A;  1TW2 A;  2O03 A;  5ICF A;  2Z99 A;  1MD0 A;  2EV5 A;  4KMF A;  1PDN C;  5BMZ A;  2VN2 A;  1U3E M;  4NHJ A;  4ZZD A;  3HRS A;  4IJA A;  2A68 F;  3VEP A;  3VB2 A;  2RVC A;  4G9Y A;  4YFX F;  1HW1 A;  1FX7 A;  2CSO A;  3I5U A;  1F5T A;  1MDM B;  5CYV A;  2LDU A;  4E70 A;  4UUV A;  1G3S A;  3F6O A;  4IF4 A;  2M1B A;  3AAF A;  3ZN0 A;  3BJA A;  4RGR A;  3RYR A;  2ZNZ A;  1P4W A;  5HS9 A;  2EV6 A;  2JSC A;  3RJP A;  1ODD A;  1XSV A;  1STZ A;  3I59 A;  3KE2 A;  3ELK A;  2RN7 A;  5LHI A;  2CW0 F;  5D5W B;  1FC3 A;  1B4A A;  2OD5 A;  3E6M A;  1S7A A;  4ESJ A;  2W57 A;  2HGC A;  4JBA A;  1GXQ A;  1WQ2 A;  3ZQ7 A;  4LG0 B;  3KCC A;  3KP4 A;  2VBZ A;  3HIF A;  3RKX A;  3FXQ A;  3KZY A;  1RUN A;  1Z05 A;  5FLX Z;  4LFU A;  1BN5 A;  4CDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...