5E1ZB

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,4-dichlorophenol bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides mccartyi btf08
molecule tags Transcription
total genus 60
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e1zB00
2AXLA 3HYIA 1ZN2A 1O7LA 1IF1A 2Q0OA 3QP6A 3RDIA 1KQ0A 4LB6B 3K1PA 3M8FA 4M9ZA 5D5XB 4Y13A 1WQ2A 5F1RA 2NYXA 2KJBA 3OOPA 2IT0A 4WF2A 1QQIA 2YX7A 3KP7A 3ZPLA 5FD5A 3RYRA 2YU3A 1RUOA 3J81K 3ULQB 4HOBA 4ZYDA 2RC4A 4EJTA 1YS6A 2IJLA 3KFWX 4GCVA 4ASNA 4S04A 1XMKA 5CYVA 1K6OA 1KQ8A 1MD0A 3ZMVA 2PMHA 3GO5A 3H3UA 2ESHA 3WGHA 3Q5FA 5FGMA 1BJAA 2W84A 1HSTA 1EH6A 3F22A 3WTTC 5HOOA 1YO5C 1J5YA 1KU7A 2F5FA 5DD4A 2LF8A 3TO7A 2M45A 1NHAA 4KN7X 3IHUA 4U0WA 4KUMA 5E17F 5LGTA 4HDUA 1B9NA 2XGXA 4GXOA 1XB4A 4HLYA 2ZFWA 1LJ9A 1SAXA 4HW0A 4I0AA 3EYYA 1RZ4A 1LNWA 4EJUA 2EK5A 2O03A 4OIPF 3T0YA 4GYIA 2IA0A 4IRGA 4EQQA 4IPAA 2MA3A 5ED4A 3G3ZA 4Z2YA 4L9JA 1GXPA 3FM5A 1ZH5A 4OMYA 4EV0A 4A5MA 1ZREA 1WKMA 1X3UA 2ZJ2A 5BOXA 1JHHA 3LQRA 1SD4A 2GA1A 1XCVA 3C18A 5DUIA 3QOPA 4M72A 3BWGA 2FBIA 3I4PA 2DAOA 2EA2A 1FC3A 1IXCA 1R5HA 3F8MA 1O3SA 2FQ3A 2P5KA 3QPTA 4BQAA 5BQTA 3IRQA 3ABUA 1MJBA 1U3EM 3GFJA 4WXCA 5HS9A 2ZCWA 1ON1A 4KN4X 3GZ5A 2VXZA 4A2UA 3HTUA 2R3SA 5JVTA 1HSJA 3GF2A 1ZLJA 3E97A 3Q9VA 4ZYEA 2OD5A 1O3TA 2VT2A 2DI3A 2AS5F 2CG4A 1LDDA 2GIVA 1F4KA 4KYWA 3ZMSA 4I0BA 3GFLA 3F8FA 4OMZA 1F5TA 2PMUA 1AWCA 4FT8A 2YR2A 1Z9CA 4TV7A 3RIRA 1TTYA 4KIFA 4ZH4F 5L3DA 3RJPA 1AOYA 1DPUA 1T0FA 4WCGA 1E17A 5AIQA 3I0TA 3KP2A 5LBQA 1UHMA 4Y15A 3H92A 2L54A 1ZARA 5EEHA 3R0JA 1IAWA 1JE8A 5A2QK 4RB2C 2H6BA 4P55A 2EV0A 3K0LA 3IKVA 3W6KB 2DPDA 1G3TA 1REPC 2CGPA 4LLGF 2P8TA 4LFUA 4G7ZF 1MGTA 4I09A 3F72A 1HW2A 5CVIA 4EM1A 4EM0B 1G4DA 1KU3A 3J81Z 2IVMA 4BHPA 1OYYA 1S6LA 3REOA 3MZHA 4RS8A 3EDPA 1W7PB 4ESJA 2IA1A 4U0VA 2KIMA 1U8RA 1XSVA 3EUHA 2ZO4A 2BEOA 2BV6A 2QBYA 3IL2A 1ZGAA 1IN4A 1O57A 3WG9A 3DQVC 3CTAA 1EH8A 3MFKA 2JZYA 2J5PA 3WE3A 2BBYA 2R7DA 4FX0A 1G3YA 1R58A 2KIUA 2GAUA 3IKTA 1S8NA 4UV9A 4RB1A 3E5XA 4XBFA 5E18F 4XLPF 1R00A 1G6NA 5D8LB 4RGUA 2C6YA 1VTNC 1J75A 1OMIA 1YS7A 5E20A 2MLGA 1IW7F 5D6FA 4L9TA 2O8XA 1KYWA 6PAXA 2H27A 3QAHA 1PP7U 2A6EF 3L09A 2VOPA 4HF0A 2BGCA 3CDHA 1R1UA 3KP5A 2CQKA 3JSOA 1IZ1A 5ICCA 1R5GA 3ECHA 4LG0A 5HDGA 4HV5A 1PDNC 2D1HA 4EGYA 3BJ6A 3RTRA 4R79A 2WTEA 2YPRA 1Z91A 2JRTA 2VBYA 4ETSA 3V8KA 2RDPA 2VN2A 3DF8A 3HHHA 2W24A 3L9FA 4MEYF 5L3BA 3E6BA 3JTHA 1B1BA 1XCBA 2NNNA 3T1BA 5BPIA 5L3GA 1FSEA 3O6BB 3NRVA 4A5NA 5HLGA 4I01A 2DU9A 1KYZA 4CDGA 3DPLC 3I59B 2XAGA 4RB3C 4EM2A 4BH9A 5FO5A 2HS5A 5EEGA 1GXQA 3RPQA 2XKPA 5K5RA 3RKXA 3EQLF 4LK0F 1QO0D 5D4RA 3ERED 4MQ9F 2V1UA 2OU2A 3JW4A 5ILUA 2OA4A 4KDPA 3CJNA 2DTRA 5FD6A 5K5OA 3TO6A 3DXJF 5HVQC 2RV8A 2ZMEB 4G7HF 2LKPA 2UWMA 1TQIA 4ON0A 2QZ8A 3BP8A 1USSA 3B02A 3DPTA 1OYWA 2HZTA 2JTVA 4XSXF 5ERIA 1S3JA 3WGGA 1YW8A 3AAFA 3HRUA 3KLOA 3M8EA 1PUEE 1A04A 3N97A 3HRSA 4Q47A 4M74A 2CYYA 1KQ9A 3LWFA 2QYOA 2ZNYA 3TO9A 5A2QZ 4HDVA 4GO1A 2G7UA 3E5QA 4F7ZA 2G9WA 1BN5A 1B9MA 2V6CA 4M71A 2L4AA 2M1BA 5CVVA 3I5UA 1ZRFA 4CZZA 1TNTA 1BI3A 3T8TA 4N9HA 1J59A 2E7WA 2RVCA 1CGPA 2ACJA 3HTSB 3E5UA 2ZBKA 2L3DA 4PZJA 1XDUA 3ZN1A 5J6XA 2XROA 1SFEA 3FZVA 1YIOA 1IRGA 1IUYA 2RNJA 1YLFA 4Y17A 2DT5A 5LHHA 4M73A 1ZYRF 3L7WA 2OQGA 4UUVA 1HXDA 1I1SA 4UVCA 4UVBA 4KT5C 4LB5A 4S05A 1FPQA 1I1GA 5LHIA 4OIOF 3VFZA 2XAQA 1P2FA 3EETA 3IC7A 1FWZA 4FHTA 4O5VA 1OYIA 2ZNZA 2GQQA 2K86A 2PI0A 4IHSA 4PDKA 1UFMA 3P9CA 3K69A 2G7HA 4JBAA 3T5XA 4IRIA 5DCFA 4HYEA 4L0YB 4UNOA 3OV8A 1FP2A 2COMA 1QBJA 5HS7A 4AIJA 2HTSA 2W57A 1LDKB 1HBXG 2FMYA 3JAMZ 3V8LA 2XIGA 2ELHA 3G73A 3CLOA 2QQBA 2HQRA 5LLQA 2FOKA 4LD5A 1R1TA 3SXYA 2E1CA 3FM3A 3NEUA 2PFBA 4HX8A 3WTZA 4LMYA 1FBSA 1BI0A 3T8RA 5LEKA 1K79A 4IF4A 3LAPA 2FBKA 4RAZA 3WODF 2NAZA 3L00A 4MGRA 4MQVA 2ZXJA 1J2XA 2FNPA 3WTVC 2J5OA 3CO6C 2CW0F 4KA4A 1JHFA 2EFWA 5JI6A 1K78B 2O0YA 2YX4A 3O3KA 1USTA 1UHWA 1BI2A 4ENJA 2VC0A 5DCMB 1ZGJA 4B09A 4IJAA 1Z6RA 2WV0A 1S29A 5DEQA 3WTXC 2D1VA 4EJVA 1YW9A 3FMQA 4MNUA 3HOTA 1EH7A 2OZUA 5E1ZB 4L18B 2QLZA 3K2ZA 5H6QA 1P4AA 2A07F 2UXXA 3C3WA 2D2WA 1FNNA 3J80K 3MZYA 3F8CA 2IA2A 2XHKA 3ZMDA 2CO5A 1YQAA 2A6HF 3V7SA 1L0OC 4EVIA 1L3LA 2OZ6A 1T38A 4A0XA 4YFXF 4U7DA 4L5IA 4R8HA 2Y48A 3C1DA 2QVOA 3FHZA 3R4KA 3GYHX 4KFCA 2K7LA 3GXOA 4QLCU 4ESBA 5IT3A 2YSRA 5CJ9A 2HOEA 1ZLKA 3I71A 1JGSA 5ICFA 2F2EA 2M87A 4HQEA 3COAC 1TQMA 4WX9A 2FBHA 3TQNA 4EMSA 4CICA 4P9FA 1LB2A 2XVCA 4N9IA 4I7HA 4EGZA 1LVAA 2WWYA 4XSZF 2FE3A 3SQNA 2Z5UA 2FA5A 2DW4A 3CUQB 3E6DA 4BYYA 3F21A 5DUKA 2OAZA 4BAYA 2VOOA 2XRNA 1B6AA 2GXGA 1Z7UA 4HF2A 5BMZA 2HEOA 1Z05A 4KIBA 2O6GE 1J0RA 2EB7A 2GWRA 3WTYC 5J8CA 4L0ZB 5HLIA 4AIKA 1DP7P 4JQFA 4O6JA 4Q4ZF 2HTJA 1D5VA 5BPDA 2FRHA 2K4BA 3HSFA 2KJCA 5ILSA 2LNBA 3J7AO 1QNTA 4IXAA 3ABTA 2BYVE 4CYDA 1IXSB 2EV6A 2D45A 2MH2A 3ECOA 4G8XA 5CLSA 2DBBA 4O3MA 5IT9K 4DQ2A 2A61A 5HDKA 3R6SA 2EA4A 3MWMA 2RGVA 5ICGA 4UVAA 4MEXF 2DK5A 5CVRA 2DK8A 3WU0A 3MAJA 4OU0A 3BROA 3FXQA 1XN7A 1Q1HA 1SD5A 2V79A 1ONVA 1J9IA 1O3QA 4M6XA 4H0EA 1IN5A 5HS8A 2Q8KA 1UCRA 4HQMA 1J7KA 3RPUA 2P7CB 5ICEA 4IVNA 3BY6A 2RN7A 4NQWA 3HRTA 2DQRA 2LF7A 2Q2EA 2XKOA 3U9GA 2GZWA 3E6MA 1BIBA 5CVUA 2K27A 4UXNA 1V4RA 2FEZA 1WRJA 3DP7A 3QU3A 2VE8A 1HW1A 3R60A 2DO7A 4BXUA 1IRFA 2KIFA 1XDSA 4GGGA 4BNCA 4M9SA 3QRFF 1KU2A 2CWEA 3S2WA 3HRMA 1CF7B 1KA8A 2QUFA 3TDZC 4I98B 5FFXA 1IN8A 2M8EA 1SMYF 4P9UA 3F23A 2PLYA 1FYMA 2EWNA 1HKSA 3V7CA 1FT9A 4LJZF 2PJPA 3HSRA 4K2EA 4OINF 4LLLA 1P6RA 5D8KB 4CXFA 4A6DA 1MJAA 1GVJA 2EV5A 2LDUA 2EFQA 2RKHA 5DD8A 1OR7A 3K1MA 1SFXA 2HKOA 3LA2A 4B8XA 5LRSA 3IWFA 4ZYHA 2QQ9A 2GA2A 1P4XA 1QPMA 1O7FA 3D5LA 4WXDA 4CHUA 3KEOA 1PP8F 3CUQC 1EV7A 5LRRA 3J80Z 2PG4A 1R22A 1T2KA 3KZZA 5HLHA 5L3CA 4XLNF 2Z9OA 2P7VB 1ON2A 3WU1B 1W7PA 1LEAA 2IRFG 1UB9A 4WK8F 2F5CA 2OBPA 1FOKA 4HX7A 5L3FA 1FP1D 3WTSC 2QQAA 5FLXK 1G3SA 3E6CC 4MTEA 4GYGA 5AONA 2H6CA 4HLXA 4HAMA 3K9TA 3SZPA 1HKTA 2HGCA 1W5TA 1XD7A 1FX7A 3ML6A 4RGRA 3BPXA 4RGSA 1U5TC 2F5DA 1U6GA 4OIRF 4HX4A 4XRFA 4M9XA 2PN6A 2H94A 2UXNA 1ZG1A 1DPRA 2XV4S 1R23A 3GWZA 1IN6A 4KNYA 2HQNA 3RI4A 1XSDA 2STTA 3KE2A 2EJRA 2Y75A 1Z6TA 3QPHA 4AVPA 3IRRA 4WXHA 2HDCA 1SD6A 4BHBA 1BBYA 2DLLA 2M5WA 1R1VA 1CF7A 3PQKA 4ESFA 2XUBA 3SFZA 2HFHA 1R7JA 1T98A 1LQ1A 1U2WA 5IT9Z 4HBLA 2CSOA 3I58A 3MQ0A 3FF5A 4BHCA 4G94A 3GEZA 1YTYA 2ISZA 1TQPA 2MH9A 1MJ9A 1RIOH 4YFKF 1XGMA 1RI7A 2VONA 2A68F 5LGUA 4U7BA 1BIAA 2XAFA 2IP2A 3ROUA 2XAHA 4WWCA 4CO8A 1ZRCA 4OIQF 2FMLA 1P4WA 4IHTA 3FMRA 3GZ6A 2W85A 5H20A 5E1XA 2PBIA 1LDJA 2X0LA 3C7JA 1YW7A 1IN7A 1OKRA 3LAJA 1TBXA 3I59A 1YFHA 1OPCA 3RKYA 2FF4A 5LEJA 4E70A 4G7OF 3DKWA 4HA8A 3SZTA 1Z1DA 2JPBA 2GXBA 1RUNA 2VT3A 4YFNF 4LLNA 2A69F 3ZMTA 1XGSA 4DNCA 1T39A 5E8IA 1KGSA 3NQOA 4L9NA 3KEQA 3TOAA 3WGIA 3Q9SA 2TDXA 2P6SA 1HW5A 5K5QA 1H9TA 3BZ6A 1T6SA 1I27A 3KLNA 5D6EA 2ZMEA 4U88A 2XASA 5LGNA 4LK1F 5F64A 3JSPA 4AD9A 3F8BA 1I6XA 4LGWA 1FBQA 2IW5A 1R36A 2F5EA 2HWVA 1MDMB 5FB2A 2A3SA 4L5JA 1WI9A 1D8KA 4OOIA 4KMFA 3N4MA 1FY7A 1HQCA 1FYLA 4G6DA 2DPUA 1TW2A 2KKOA 4YG2F 1H0MA 4L9VA 2QBYB 5JHUA 2MD5A 2ZKZA 3WTUC 3F3XA 3HUGA 1STZA 2VC1A 2K02A 3GFIA 3I53A 1QGPA 3L2CA 1ZG3A 5LHGA 5KK1A 2P5LC 2FNAA 3KP3A 3EYIA 5JR3A 1B59A 1C0WA 3ELKA 3VB2A 5D4SA 1FZPB 3FXUA 3LQQA 3P7NA 4HF1A 5K1YA 1DUXC 2M30A 5E1WA 3KP6A 5FLXZ 2DQLA 2EFPA 1SMTA 3R0AA 1BI1A 1Y0UA 4EJOA 3I54A 2STWA 3PFIA 1W4MA 3U2RA 1XGNA 2Z3YA 5DV5A 5DDGA 3LA3A 4KICA 5AIPA 2Y0MA 4KMUX 3VOEA 1XGOA 4ZYGA 3BDDA 4UV8A 2MBFA 2PEXA 2L4MA 1K7AA 4NB5A 3LA7A 4LG0B 3P9KA 4PGGA 2O61A 3HSEA 4RB0A 1D8JA 3BOQA 2JPCA 4JK1X 3M1EA 3BJAA 4CGZA 1V3FA 4YIFA 1ZRDA 1W7PD 4G9YA 4MHGA 5J8FA 4M6YA 2R7FA 2ADUA 2RQPA 4A0ZA 4AWXB 1S7OA 2JT1A 4N0BA 1FSHA 2XAJA 4EJWA 3WE2A 2L02A 2MC3A 4KIGA 4RAYA 5D5VB 2WC2A 2L01A 1U78A 3GFMA 3DV8A 2V1XA 4NHJA 3I64A 2FSWA 4Q48A 2UZKA 2VBZA 1U5TB 4UHTA 4A12A 3FWEA 1ZG5A 4HV6A 5DYMA 1HKQA 2V1DA 2HYFA 1MDMA 1TLHB 3KCCA 4PGHA 3V8JA 2P6TA 3CO7C 1ODDA 1RNLA 3ZMZA 2BE5F 2EFOA 1K78A 4IRHA 2EFNA 5DCMA 3LFKA 4A6EA 1XSXA 3H3ZA 3FX3A 1IXRC 2LSOA 3RYPA 4RGXA 3GLXA 5TJJA 2CFXA 3TGNA 3GVAA 2ETHA 5KVRA 2Z33A 2HKXA 3LSTA 1YYVA 3QU6A 2P5VA 1ZAOA 1YG2A 1GHCA 4I02A 1BM9A 5H6RA 1FBUA 1BOAA 1ZHFA 4ZZLA 1JXSA 2ISYA 1FLIA 4ZZDA 1P92A 3O2PE 2NRAC 3GUDA 1MZBA 2PQ8A 3FMSA 3HOSA 4D0PA 3MEXA 3V7RA 3FXRA 4ENMA 3BJOA 2QENA 2X4HA 1SD7A 3JAMK 4Q5SF 2HR3A 1O3RA 2B0LA 2K4JA 1W5SA 3SHFA 5CVJA 5F6FA 1QZYA 1G3WA 3ZP5A 4PCQA 3JTGA 2E7XA 3PQJA 2JSCA 1B4AA 4A0YA 1ULYA 3R61A 2FU4A 4MTDA 3KZYA 1WWXA 3K1NA 5D5WB 3ZN0A 2O3FA 2E1NA 3M9AA 1BC7C 3CUQA 3GW2A 5L3EA 4R1HA 4AIHA 3ZMUA 3VODA 3ZQ7A 4U0YA 2FXAA 2VBXA 3GX4X 1LEBA 2KRFA 3VEPA 1BC8C 2H09A 3DEUA 2VODA 1MKMA 3E3VA 1I5ZA 4QWQA 3HHGA 2Z99A 4P5OA 2MLKA 5HDNA 2OQRA 3HIFA 3TOBA 5E8GA 3B73A 3F8NA 1DDNA 4G6QA 3DFGA 3D0SA 3W6JB 1QZZA 2A5YB 5FFZA 3TKYA 1U5TA 1WSUA 2DFIA 2W25A 1KU9A 2NS0A 5JFRA 3F6OA 2IPQX 3TDUC 2ESNA 3ISPA 3QP5A 3F6VA 3M7GA 2HYGD 5D5UB 4HZFA 3KP4A 5TRDA 4YIIA 4P96A 3WTWC 1TW3A 1E2XA 2P4WA 1F1ZA 1TNSA 3MCZA 1S7AA 2QM3A 3BPVA 2VE9A 2NNYA 2V9VA 1H9GA 3U1DA 4FX4A 1XMAA 2QWWA 3P9IA 4ENNA 1SFUA 2VBWA 3V4GA 4ENKA 3CUOA 4I2OA 3IWZA 1F9NA 5BS6A 3KETA 1D3YA 1FYKA 5ILVA 3RKWA
chains in the Genus database with same CATH superfamily
4BEHA 1X1AA 3V42A 4XRMA 2AXLA 3HYIA 3G1OA 1ZN2A 2IS6A 2BY2A 1OCCH 1O7LA 4FQGA 1IF1A 1ACIA 2Q0OA 3QP6A 3RDIA 3FK7A 1KQ0A 4LB6B 3K1PA 1K4TA 3M8FA 2VQGA 2IS1A 4M9ZA 2XRLA 1T33A 5D5XB 4Y13A 1WQ2A 2DJIA 5F1RA 4Z6YA 3LFUA 2NYXA 2KJBA 3OOPA 4ABZA 1Z0XA 2IT0A 3H9QA 3CMAI 1JT0A 4WF2A 4CYCB 1QQIA 2YX7A 1QVTA 1TP4A 4XRSG 2L9SA 4XK4A 3KP7A 3PFYA 3ZPLA 5FD5A 5K7ZA 3RYRA 3CC2I 2YU3A 1RUOA 2R7ZJ 2VASA 2JJ7A 2CH0A 2XGEA 5IOZA 4PFOA 3J81K 2K3PA 2VQCA 3S17J 3ULQB 4HOBA 3I4MJ 1M1EB 5GAEJ 1JT6A 4ZYDA 1WJDA 2RC4A 3OS2A 4EJTA 2DMUA 3K4JA 5F08A 3SJMA 2BVMA 2FOWA 1YS6A 2IJLA 2LR8A 2BHZA 3KFWX 4GCVA 4ASNA 4S04A 1XMKA 5CYVA 2XSJC 1K6OA 1KQ8A 1NH3A 4XKVA 1MD0A 5KNLA 3ZMVA 2PMHA 2HOTA 2EINH 3BZCA 3GO5A 3H3UA 2ESHA 3WGHA 1UMQA 3Q5FA 1QRYA 5FGMA 1BJAA 2W84A 4NC6A 1IUFA 1JTXA 4OAZA 4CCOA 1HSTA 1EH6A 2E1MC 3IP4B 2LKXA 3F22A 3WTTC 3EPZA 2QQ8A 5HOOA 1YO5C 1J5YA 1KU7A 2F5FA 4LOCA 3FKJA 5DD4A 2LF8A 3S3MA 1NK3P 1P7IA 1VQ5I 2OF7A 3TO7A 2M45A 3L2UA 1NHAA 2V9PA 1UAAA 2VJIA 4KN7X 3FHNA 3IHUA 4U0WA 4KUMA 5E17F 5LGTA 4F93B 1CQTA 4HDUA 1B9NA 1YITI 4JX4A 2XGXA 2NXNB 4GXOA 3NARA 1XB4A 4HLYA 4BACA 1IGNA 2MC4A 3H0GJ 1Z67A 4IHVA 3FXJA 2ZFWA 3I9V2 1LJ9A 1SAXA 1Y8RB 2LH9A 3BR2A 4HW0A 3S14J 4I0AA 1V5EA 3EYYA 1U8BA 4CCMA 1RZ4A 3RCOA 4IL6C 4JX5A 4XIDA 3GZNB 1LNWA 4EJUA 3HKZN 2EK5A 2O03A 4OIPF 5FKNA 5KHDA 3T0YA 4A3GJ 4GYIA 2IA0A 2VIXA 5FKMA 4IRGA 5GADJ 4BQQA 4EQQA 4FCYA 1D1AA 1JUSA 4IPAA 2MA3A 1OCRH 5ED4A 3G3ZA 4BQNA 2IGOA 2COBA 5EZGA 4Z2YA 1MBHA 4L9JA 1UHSA 3JRAA 1GXPA 3PUBA 1R9TJ 2IEKA 2JA2A 3FM5A 3G1LA 3X2QH 1ZH5A 4OMYA 4EV0A 1MNDA 4A5MA 3MKLA 4BS9A 1ZREA 1WKMA 5M3MJ 3CCLI 3RPUD 1X3UA 2ZJ2A 2CFOA 3HKZA 5BOXA 2X1DA 2HVSA 1JHHA 1RPWA 4PJJA 3LQRA 3OS0A 1SD4A 2GA1A 1WJEA 1SC7A 1XCVA 3C18A 5DUIA 3QOPA 3LSMA 4M72A 3BWGA 2FBIA 2H1KA 3I4PA 2QSFX 5J3LA 2DAOA 2EA2A 1FC3A 1IXCA 2M4GA 3NWSA 1R5HA 3FK6A 2KDZA 2LY1A 1MNMC 3F8MA 1WHUA 4XL9A 4DIQA 2Z2SB 1O3SA 2M9HA 2FQ3A 2P5KA 2XPWA 3QPTA 4BQAA 1VQOI 1MBFA 2CUFA 5BQTA 2K9QA 3D1NI 3IRQA 1GV5A 2K9MA 3ABUA 1MJBA 5IYBJ 2PJRA 1U3EM 3A4CA 3GFJA 5JVGF 3M1CA 4WXCA 5B1BH 5HS9A 2ZCWA 1K83J 1ON1A 3ZRGA 4KN4X 3GZ5A 2VXZA 4A2UA 3DKXA 3Q0VA 1W1WE 3HTUA 2R3SA 2W82A 5JVTA 1VQ7I 2JUGA 1HSJA 3GF2A 1ZLJA 2X85A 1MSEC 5EGOB 2KT0A 3E97A 3Q9VA 2DMNA 4ZYEA 3JRCA 3BTLA 2OD5A 2MD0A 2Q2EB 1O3TA 2VT2A 5F0CA 2DJNA 1QA6A 2DI3A 5J4YA 3HEFA 2AS5F 3U1KA 3HJEA 2CG4A 2DDAA 2ID6A 2M0CA 1MBEA 1ZR2A 5E3LA 1ZQ3P 4J00A 2QF7A 1LDDA 2KZVA 2GIVA 1F4KA 1W36C 4KYWA 3ZMSA 4I0BA 3GFLA 3IV5A 3F8FA 4OMZA 2CJJA 2BXYA 1F5TA 2L9VA 2PMUA 1BOBA 1AWCA 4FT8A 2IGMA 3Q3SA 2YR2A 3HZJA 3IAS2 3UKGA 1Z9CA 4BJ5C 3BG5A 4TV7A 3RIRA 1TTYA 2LD5A 4KIFA 5EDNA 1Y1WJ 1U0JA 4ZH4F 3F0CA 1SEUA 1ZKGA 4J19A 5L3DA 2HOAA 3RJPA 1AOYA 4EATA 2JVGA 5CQGA 1DPUA 4CZCA 1T0FA 5EYRA 4WCGA 3PIPF 3A1YA 1QPIA 1E17A 4B48A 5AIQA 3I0TA 1X1DA 3KP2A 5DTDA 3TW7A 5LBQA 2N8GA 1UHMA 4RLFA 3KZIC 4Y15A 3K4LA 3H92A 1Z77A 1VF9A 2L54A 1ZARA 1GUUA 5EEHA 3BTIA 3R0JA 1IAWA 1JE8A 5A2QK 4RB2C 2H6BA 1N77A 2NVTJ 4P55A 2EV0A 3D5RC 3K0LA 2OCEA 3IKVA 3W2VA 1VQPI 3W6KB 2DPDA 3KEYA 4BQOA 1G3TA 1REPC 2CGPA 4LLGF 1XMXA 2P8TA 2JN6A 3HOZJ 4LFUA 1Y1VJ 1AKHA 2DMTA 2XAUA 4G7ZF 5IYCJ 3BG3A 3QYFA 1MGTA 2M7BA 3OYEA 4I09A 3OWTA 4PFPA 3HXLA 3F72A 1HW2A 5CVIA 5BNGA 4EM1A 3CCRI 4DJAA 4EM0B 1FMVA 1G4DA 1KU3A 3J81Z 3MZ8A 2IVMA 1WH5A 4BHPA 1JKPC 1OYYA 2LYCA 2R7XA 1S6LA 3REOA 3MZHA 4RS8A 2X1EA 2CW8A 3EDPA 1W7PB 1XS9A 4ESJA 2IA1A 1LUJB 3CJRB 4U0VA 2KIMA 1U8RA 1I3AA 9ANTA 2FJ1A 2E5NA 1XSVA 4DZJA 2WAEA 1HC8A 3EUHA 3B6AA 1OCPA 2Y2ZA 4CCJA 2ZO4A 2BEOA 2BV6A 2CS3A 2FD5A 3IL2A 1ZGAA 2QBYA 1IN4A 4GRIA 1O57A 2HZDA 3DQVC 3WG9A 2W00A 2KDOA 3CTAA 3ZQCA 2XF6A 1EH8A 2WAQN 5B66C 3MFKA 4E7KA 2CV0A 1UG0A 2R7RA 1UZCA 2JZYA 5IPAA 2J5PA 3SEQA 3WE3A 1OQYA 2GLOA 1MMNA 4DOZA 2ZSHB 5LD2C 2BBYA 2R7DA 3GTGJ 4FX0A 1G3YA 1R58A 2E2JJ 5FRNA 3SZGA 2KIUA 2K9SA 2GAUA 2L9NA 1MBGA 3CZ6A 1S8NA 1SANA 3IKTA 4UV9A 3L2RA 4RB1A 4Y3OA 3OYFA 3NAUA 1I6HJ 3DBLB 3E5XA 1AHDP 4XBFA 3QQAA 5E18F 4DBQA 4XLPF 2VLAA 4BDYA 1R00A 1IO2A 1G6NA 4BKXA 4FE4A 2M4KA 2WAQA 5D8LB 2P81A 4PSWA 4RGUA 2C6YA 1P9QC 5HLTA 1VTNC 1J75A 1OMIA 1YS7A 2V7FA 5GTIC 5E20A 4DYQA 1WCMJ 2CUZA 3RKQA 1BR2A 2MLGA 4ZDPA 1IW7F 5D6FA 4L9TA 1FTTA 1ETQA 4RLQA 2O8XA 1KYWA 4F3QA 2H27A 6PAXA 2OCCH 2E5ZA 3QAHA 1PP7U 3ESWB 1U9OA 2A6EF 3LSHA 3OYLA 3L09A 1MH3A 2VOPA 2W48A 4HF0A 2BGCA 2M34A 2VPRA 3CDHA 1R1UA 3H9GA 3KP5A 4M3GA 2CQKA 3JSOA 1IZ1A 5ICCA 4FASD 3J7YJ 1R5GA 2VL8A 2HU9A 2OTJI 3ECHA 4YELA 4LG0A 2G0EA 5HDGA 4HV5A 3BT9A 1PDNC 2DODA 2CMPA 2D1HA 4BBSJ 4EGYA 3BJ6A 3RTRA 3PIOF 4R79A 4E7SA 1SFKA 2WTEA 4XN0A 2YPRA 1Z91A 2H8WA 2JRTA 3K4CA 2VBYA 2ZJPF 2Z1DA 1VQMI 4B44A 2BY1A 1G8XA 3H9JA 3TBIA 3J7AY 4ETSA 3V8KA 3UR3C 2MG4A 2RDPA 2VN2A 3DF8A 3PNYA 3HHHA 2W24A 3L9FA 3Q0WA 4MEYF 5L3BA 3E6BA 3JTHA 1B1BA 1XCBA 2NNNA 1MIJA 3T1BA 5BPIA 2KP6A 3S1MJ 2Q1ZB 2R4GA 5L3GA 1FSEA 3O6BB 3NRVA 4A5NA 5HLGA 3S3NA 4I01A 3BLYA 2DU9A 2HQAA 4ITVA 4MO7A 2ZXIA 3GBGA 1KYZA 4CDGA 1BW6A 3LMMA 3TEDA 1GV2A 5C44J 2LTPA 3DPLC 3OIOA 4AVZA 1SVMA 2XAGA 3I59B 4DBRA 4RB3C 4EM2A 4BH9A 4E6KG 5FO5A 2HS5A 1A36A 5EEGA 3PUFA 1Q1VA 2XPVA 2LOOA 2R7VA 2DFHA 4N4OB 2QGUA 4BJTA 2X1CA 1GXQA 3IUOA 1I50J 2E60A 2KISA 3RPQA 3OY9A 2LBFA 2XKPA 5K5RA 1HOMA 3RKXA 4GFBA 3EQLF 2ZC2A 5FLMJ 4LK0F 3GTMJ 2UUZA 3BZKA 1QO0D 4HSTA 3BCAA 1OR7C 1FEXA 3FDYA 5D4RA 3ERED 1WZ2A 4MQ9F 2V1UA 3FIWA 2GBYA 1VQ4I 2DMQA 2OU2A 3JW4A 2OA4A 3ZXSA 4A69C 5ILUA 4KDPA 4A3CJ 3CJNA 2DTRA 3BR6A 4C9YA 1R5ID 5FD6A 5J1YA 1WJBA 3CLQA 2LREA 4ZDLA 4M3BA 3S1QJ 5K5OA 3TO6A 2I5UA 3DXJF 5HVQC 1DP3A 2VKHA 4CCLA 3WU2C 1YJ9I 1K61A 2LK2A 1MBJA 2RV8A 2ZMEB 4G7HF 2LKPA 2UWMA 1TQIA 5GAHJ 4ON0A 3GTKJ 2K9LA 4E7LA 3DLLF 4DYRA 2QZ8A 4QPOA 1OJLA 3BP8A 3WHCA 1USSA 1S7EA 3B02A 3DPTA 1OYWA 2HZTA 2JTVA 4XSXF 5ERIA 1S3JA 2WADA 3WGGA 1YW8A 3N05A 3AAFA 3HRUA 3KLOA 3M8EA 3G2BA 1PUEE 1A04A 3N97A 3TP0A 3HRSA 4LIVA 4Q47A 4M74A 3HL2A 3CP8A 2CYYA 1VQ8I 1NK2P 1KQ9A 2OJED 3K70D 3LWFA 2ZXHA 2QYOA 2ZNYA 3TO9A 5A2QZ 4HDVA 4GO1A 1LFBA 2ELJA 2L7ZA 2R92J 2G7UA 2X9DA 3E5QA 4F7ZA 2EZIA 1LE8B 2G9WA 1YJNI 1BN5A 1B9MA 2V6CA 1UELB 4DGWB 4M71A 2L4AA 5TISC 2M1BA 5CVVA 2X6WA 3HUGB 3NWTA 1ITYA 3I5UA 1ZRFA 4CZZA 2M2EA 3L2VA 2AXTC 3HPHA 3DLAA 4D9JA 1TNTA 1BI3A 1A31A 4HSRA 3T8TA 3CF5F 4N9HA 2VJ4A 3CMMA 5K7FA 1J59A 1MNEA 4XICA 2E7WA 5KAFC 2L7KA 2RVCA 1CGPA 2ACJA 4F55A 2L9RA 3HTSB 4F92B 3E5UA 2HNHA 3OYKA 2ZBKA 3HBLA 2L3DA 5B1AH 4CCKA 3K10A 2CUEA 4PZJA 1XDUA 2A6TA 3ZN1A 5J6XA 4ZDOA 4B3AA 2XROA 3TMOA 2DFEA 2ZFUA 3A01B 1SFEA 3AKZA 3FZVA 1YIOA 1IRGA 4N4NB 1IUYA 1TWCJ 1QVUA 1WGXA 2LMDA 1X19A 2RNJA 4JX6A 1YLFA 2L2OA 4W97A 4Y17A 1DGRM 2DT5A 4BJ6C 5LHHA 4M73A 1JKRC 1NG6A 1ZYRF 3L7WA 3OYBA 2OQGA 3OYIA 4CSWA 4UUVA 1HXDA 1I1SA 4UVCA 2BY0A 4UVBA 4KT5C 2GM4A 4LB5A 3C2HA 4S05A 1ZGWA 1FPQA 1I1GA 1YE9A 2R5YB 5LHIA 4C3IJ 2AQFA 4OIOF 3SYTA 2OTLI 3VFZA 2XAQA 5EG0B 1P2FA 1MMGA 2BZTA 1W0UA 3EETA 3CP2A 1S72I 3IC7A 1FWZA 4QIWN 2B63J 4OWRB 4UB6C 1E3PA 4FHTA 3ABLH 3M4OJ 4O5VA 1OYIA 5DM6F 2ZNZA 4XRSA 4X6AJ 2GQQA 4Y33A 4RDUA 2K86A 1IC8A 2PI0A 3HB9A 4IHSA 4PDKA 4RAGA 1UFMA 2LY2A 3P9CA 3K69A 2G7HA 3CCMI 4JBAA 2Y9ZA 3OYJA 1TT0A 5FROA 2E71A 3T5XA 3OYGA 4IRIA 3FXOA 5DCFA 4XNFA 3GTQJ 4HYEA 2HI3A 2LVSA 4L0YB 4UNOA 3OV8A 1FP2A 1HCRA 2JA8J 3ZQFA 2COMA 2ID3A 4DW6A 2WAFA 5HS7A 4AIJA 1QBJA 2HTSA 4UUSA 2W57A 1YRNA 1LDKB 1V5FA 1HBXG 3HOWJ 2FMYA 3AG2H 3JAMZ 1RKTA 2F4OB 3V8LA 2XIGA 2ELHA 2VJJA 4XLHA 3BG9A 4BU2A 3G73A 3CLOA 2ICWG 5GP9A 3VYRB 2QQBA 2HQRA 5LLQA 2FOKA 2IS2A 3MKZA 4LD5A 1R1TA 3SXYA 2CW7A 4MFDA 2HVQA 2R7QA 2E1CA 1V55H 3FM3A 1ETXA 3NEUA 2FQ4A 2PFBA 4KJZA 5E79C 3LL7A 4HX8A 3W3CA 3WTZA 4LMYA 1FBSA 3ZQGA 1PJRA 3BR1A 2TRTA 3DWLE 1NG7A 1BI0A 3T8RA 5LEKA 1K79A 4IF4A 3LAPA 4IO9F 2FBKA 4CH7A 3FXLA 4A3IJ 4X1EA 2A5WA 4RAZA 3WODF 5F1JA 4HG2A 4BE1A 2E35A 2NAZA 3L00A 1MW7A 2HDDA 1BJZA 4MGRA 4MQVA 2ZXJA 4XLFA 1J2XA 1X58A 1KONA 2BHYA 3JRHA 2FNPA 3WTVC 1TC3C 2J5OA 3CO6C 2CW0F 5H2FC 1JJ8C 2XGCA 4KA4A 3VSKA 1JHFA 2DOAA 1LVKA 2EFWA 1MH4A 5JI6A 2ZMEC 1K78B 2O0YA 1WJCA 2YX4A 3O3KA 4E7ZA 1IG7A 1USTA 4DZPA 1UHWA 1LE8A 2XPUA 1BI2A 3BQYA 4ENJA 2VC0A 5DCMB 1ZGJA 2NS7A 4PJMA 1XG1A 4B09A 4IJAA 1Z6RA 1H89C 3CCVI 2WV0A 3A03A 1S29A 5DEQA 4V2FA 3WTXC 3OS1A 2D1VA 4EJVA 4LITA 1Y8QB 4V2GA 1YW9A 3FMQA 4MNUA 3HOTA 3OYAA 4HNVA 1EH7A 4RBOA 4XKCA 4J01A 2OZUA 5E1ZB 2L7FP 4CYCA 4L18B 2JK3A 3K4NA 2QLZA 2PMZN 2XB5A 3TL4X 3K2ZA 1FIAA 5H6QA 1HDDC 4NQWB 2DTZA 4YIRX 1P4AA 3FKIJ 3AG4H 3SDBA 1TWFJ 2JA7J 2A07F 2UXXA 1EF4A 3C3WA 2D2WA 2IXSA 2I10A 1FNNA 3J80K 4YEJA 3MZYA 3F8CA 2IA2A 3PSIA 2XHKA 3BQZA 4ZYAA 3ZMDA 4B4CA 2CO5A 3OR1C 1YQAA 2A6HF 4XMYA 3V7SA 1L0OC 3CJQB 4EVIA 1L3LA 2OZ6A 1T38A 2JA5J 4A0XA 1H8AC 4YFXF 4U7DA 4L5IA 4R8HA 5J47A 4BDZA 2Y48A 2YU9J 3ZCOA 3C1DA 2QVOA 3FHZA 2AHQA 3OYHA 3R4KA 4BE2A 3GYHX 4KFCA 2K7LA 3ZGKA 3GXOA 3OL3A 2PMZA 4QLCU 4ESBA 5IT3A 2YSRA 3K4BA 5CJ9A 3HGYA 5C4XJ 1X3WB 3FISA 2HOEA 2X48A 1ZLKA 2VKDA 3I71A 2LY9A 1TWAJ 1JGSA 5IP7J 2ECCA 5ICFA 3ZQIA 2F2EA 2M87A 4HQEA 3RZDJ 2DOFA 4A3FJ 4XLCA 3COAC 5EG0A 1VQ9I 3JCUC 1WJ5A 4XR6A 4IOCF 1TQMA 4IHXA 3MN2A 4WX9A 3W2WA 4XN3A 1WH7A 4F91B 3W2AA 2FBHA 3TQNA 5F04A 4EMSA 4CICA 4I76A 4P9FA 2HYJA 5F27A 4XQFA 2XVCA 2Y0SN 4N9IA 1LB2A 4I7HA 4EGZA 5IOYA 1LVAA 1PUFB 2IGNA 2RQQA 4XSZF 2FE3A 2WWYA 5IYDJ 3SQNA 2Z5UA 2FA5A 4C3HJ 2H1LA 4RM3A 2DW4A 1A35A 3CUQB 5C4JJ 3E6DA 1HLVA 3L2QA 3MVPA 4C2UA 4BYYA 3F21A 5DUKA 2KZGA 3S8PA 3L2WA 2OAZA 4LG3A 4BAYA 2VOOA 2VI6A 3FXMA 2XRNA 1B6AA 3FBIB 2GXGA 1Z7UA 4HF2A 4M3DA 5BMZA 1A6IA 2KHMA 2HEOA 1Z05A 4KIBA 3PSFA 1R4MB 4HNTA 2O6GE 1B72B 5KCMA 1J0RA 1D0ZA 1TWHJ 5E3MA 1OISA 4PJNA 2EB7A 3DTIA 3M8JA 3OSGA 2Y0SA 3UNGC 1VQLI 3K2AA 2GWRA 3WTYC 1ERDA 1JJ6C 5J8CA 4BY1J 2RREA 4L5EA 3GTPJ 4L0ZB 3WHBA 5HLIA 1POGA 4AIKA 3CC4I 3DKYA 4II3A 2DA6A 1DP7P 4JQFA 4O6JA 2F48A 4Q4ZF 4A93J 2HTJA 5KAIC 3RQ4A 5BPDA 3BTJA 4EEFG 1D5VA 2FRHA 4OAYA 1JI8A 2K4BA 2IGKA 3HSFA 3LSJA 2E1OA 4X0GA 1IV8A 2KJCA 5ILSA 2R5ZB 2LNBA 3J7AO 1QNTA 2YS9A 1Y39A 1ZR4A 4IXAA 2WB1A 5JHFA 3ABTA 5IP9J 3QOEA 3GTLJ 1TZLA 4BXFA 2BYVE 3LSRA 1EKEA 4E7JA 3GCMA 3RQIA 4IQ4A 4CYDA 2OPTA 1IXSB 2EV6A 3HPGA 2D45A 3JRBA 2V4JC 2MH2A 3ECOA 4G8XA 5CLSA 3AL0B 1GLNA 2DBBA 2O9LA 1RESA 4O3MA 5IT9K 4DQ2A 2A61A 2X6OA 1K6YA 5HDKA 3SEZA 3JR9A 3CCEI 3R6SA 1F43A 2CRGA 2EA4A 3MWMA 2RGVA 3C2BA 5ICGA 4UVAA 1J09A 4MEXF 2DXIA 2DK5A 5CVRA 3HM5A 2DK8A 3JRFA 4PJ0C 2NS8A 3WU0A 2M8GX 4JOMA 3MAJA 4OU0A 3BROA 2BOLA 4C2TA 3FXQA 2GIZA 1XN7A 1Q1HA 1SD5A 3VPRA 3CQZJ 4D1QA 2V79A 1ONVA 1J9IA 3LSIA 1O3QA 5GPAA 3L1PA 2VJ5A 4M6XA 3CCQI 5F0HA 2ECBA 1IN5A 5HS8A 4H0EA 2Q8KA 1UCRA 2HVRA 4HQMA 1J7KA 3RPUA 3VSLA 2E34A 2P7CB 5ICEA 4HEA2 5EGOA 2EQRA 3JRIA 3DU6A 3GTOJ 4IVNA 2ZXWH 2RN7A 3BY6A 4NQWA 3HRTA 2DQRA 2LF7A 2Q2EA 5C3EJ 2XKOA 4A3EJ 3U9GA 1X1CA 2VKEA 2GZWA 3E6MA 3ZQHA 4E4HA 3CC7I 3DCFA 4S0HB 1XPXA 1BIBA 5CVUA 3VDXA 2K27A 2R7OA 4C3JJ 1DGWY 4UXNA 1V4RA 5EZHA 4BEHB 3TP3A 2FEZA 1X2NA 2L7MP 1WRJA 3DP7A 3QU3A 2VE8A 1HW1A 3R60A 3HOVJ 2DO7A 4NUBA 4BXUA 1IRFA 3DEWA 2R7TA 5B3SH 2KIFA 1XDSA 3EUAA 4GGGA 1ENHA 4BNCA 3BR5A 1PYVA 3VWBA 4M9SA 3G4SI 3QRFF 1IRZA 2OV7A 1ZK8A 1KU2A 2CWEA 3S2WA 3HRMA 4IHWA 1CF7B 1KA8A 2QUFA 3DEEA 2K3FA 1OLTA 3TDZC 5IY5H 3GTJJ 1KZHA 3OYCA 3E7LA 4I98B 4NC8A 5FFXA 1YHQI 1IN8A 3QYBA 4LIUA 2M8EA 1SMYF 4P9UA 3F23A 2PLYA 3HC7A 1ETWA 1FYMA 2EWNA 1HKSA 4IQJA 1YJWI 2DYRH 3FXKA 3V7CA 1W5CC 1S9HA 1FT9A 4LJZF 5DM7F 3HSRA 2PJPA 2WV1A 2JSPA 4K2EA 4OINF 3PNTA 2KPMA 1ETOA 4LLLA 1P6RA 3QODA 3BR3A 5HODA 5D8KB 1VQKI 2X6YA 4B1RA 4CXFA 4A6DA 5F0FA 1MJAA 1GVJA 4B43A 2EV5A 2LDUA 2EFQA 3E1SA 2RKHA 5DD8A 1OR7A 2CQQA 3K1MA 1SFXA 3ONQA 2ME0A 3OMYA 2HKOA 1D5YA 1JUMA 4BL0B 3ABKH 3LA2A 3MD2A 4B8XA 5HNHA 5LRSA 3IWFA 4ZYHA 4A3KJ 4BY7J 2QQ9A 2A05A 2GA2A 3VYSB 1P4XA 1QPMA 1E3OC 2EZHA 3GMEA 1O7FA 3D5LA 4PUSA 4WXDA 4CHUA 3KEOA 2EPFA 1PP8F 3C2GA 1MSFC 2LFBA 3CUQC 1EV7A 5LRRA 2KRHA 4JP0A 3J80Z 2PG4A 1R22A 1T2KA 3KZZA 4MFEA 5HLHA 2JRMA 5L3CA 4XLNF 2Z9OA 3H35A 2P7VB 1ON2A 2V26A 3WU1B 1W7PA 2K9NA 1LEAA 2F6CA 2IRFG 1UB9A 4WK8F 2F5CA 2OBPA 1FOKA 1F36A 1WFXA 3VYTB 5K7HA 4I6ZA 3KYLA 4HX7A 5CKTA 2W1OA 5L3FA 2GOXB 1FP1D 3WTSC 2QQAA 5FLXK 3G6EI 1G3SA 4UUTA 3AG1H 3OOUA 3E6CC 2P0WA 1D0XA 3DBHB 1DU0A 2CQNA 4MTEA 4GYGA 4PSXA 5AONA 2R7WA 2H6CA 4IZZA 3K4MA 2NOJB 4HLXA 4HAMA 5GPCA 3CCSI 3BTCA 3K9TA 3SZPA 2HPIA 1O4XA 4M3FA 3MKWB 1HKTA 2HGCA 1W5TA 1XD7A 1FX7A 3K4KA 3S93A 2R7SA 3ML6A 4RGRA 2IAIA 3BPXA 4RGSA 2O8KA 3J7ZI 4Y52J 1U5TC 2F5DA 3S1RJ 1U6GA 4FETA 4OIRF 2YUSA 4D5CA 3S32A 2VQHA 5JLXA 3BR0A 4HX4A 4RA2A 3AL0C 3S1NJ 4XRFA 1QHHD 3LSKA 1YX5A 4M9XA 3M07A 2EZLA 1XX5A 2PN6A 1G2HA 1T95A 4HPQA 2XSDC 3ERMA 2H94A 3S2HJ 2UXNA 3HGGA 1ZG1A 1DPRA 2XV4S 1R23A 2Y31A 3GWZA 2LC2A 1IN6A 4KNYA 2HXOA 3CMEI 2HQNA 3RI4A 3A02A 1XSDA 2JMWA 5FKOA 1QHGA 5TGTA 3S16J 1JKQC 2STTA 4C2MJ 1PVEA 1YI2I 1FMWA 3KE2A 1QU3A 2EJRA 2BXZA 2Y75A 1Z6TA 3QPHA 4AVPA 2L0KA 1BR1A 1N78A 2DMPA 4RAFA 2KRCA 2LLKA 3CD6I 3IRRA 2GXAA 2PJRB 4RMNA 4WXHA 2CU7A 2HDCA 1SD6A 4BHBA 4KITB 1BBYA 1FTZA 3I55I 2DLLA 2CQXA 1R1VA 2M5WA 4QPQA 2EH3A 1CF7A 4A3BJ 3PQKA 4ESFA 2XUBA 3SFZA 2HFHA 4ZC3A 2BW3B 2M3AA 4XM3A 1R7JA 1T98A 1LQ1A 1U2WA 4RM2A 5IT9Z 2MSYA 2QKMB 4HBLA 3OSFA 2CSOA 3I58A 3MQ0A 3FF5A 4NBQA 4P1WA 1WPKA 4BHCA 4G94A 3CCUI 4KISA 3GEZA 1YTYA 2XDVA 2ISZA 2EIKH 5M3FJ 1TQPA 4D5FA 2IS4A 2MH9A 1MJ9A 1RIOH 4YFKF 2CV2A 4AU7A 1OCOH 1XGMA 1RI7A 2IBDA 2VONA 2A68F 5LGUA 4XOPA 2NVUB 5J4VA 4U7BA 1LFPA 1BIAA 2UV1A 2XAFA 2IP2A 3ROUA 5EJCA 2XAHA 4WWCA 2QKLB 4CO8A 1ZRCA 2R0QC 4OIQF 2FMLA 1P4WA 4IHTA 3FMRA 1X4PA 3GZ6A 1LPQA 2W85A 5H20A 5E1XA 2PBIA 1LDJA 2X0LA 3C7JA 1BW5A 1YW7A 1IN7A 1OKRA 3LAJA 1TBXA 2DOEA 2XGDA 3I59A 1OPCA 3RKYA 2FF4A 2AO9A 5LEJA 1YFHA 2JQ7A 1QZEA 4E70A 4IHYA 4G7OF 1X1PA 3DKWA 4M6VA 5CQEA 3OYNA 4HA8A 3SZTA 2B9SA 1VQNI 1YX3A 2PX9A 1Z1DA 2JPBA 2GXBA 1RUNA 3FBNB 2HQ5A 2VT3A 4YFNF 2VKVA 4E7IA 3HDDA 4LLNA 3KX2A 2A69F 3ZMTA 3QPLA 1XGSA 4DNCA 1T39A 3H0DA 5E8IA 1KGSA 2K40A 3BG7A 3NQOA 4L9NA 3P5JA 1XTAA 1GT0C 1DQUA 3KEQA 5LFAA 3G1MA 3HOUJ 1ETYA 3I3LA 2XB0X 3TOAA 2LRDA 5JLWA 3OIPA 4QSHA 4FISA 4DYCA 3WGIA 3Q9SA 3D5SC 2TDXA 4C30A 2P6SA 1HW5A 1JGGA 5K5QA 1H9TA 2KIQA 3BZ6A 2MABA 1W0TA 5GAGJ 3RZOJ 1T6SA 1I27A 1D1CA 3KLNA 4Y7NJ 1XC5A 1R49A 3B6CA 1Z7LA 1AKHB 5D6EA 3LSPA 2ZMEA 3OYDA 4U88A 2XASA 4MLOA 5LGNA 4LK1F 3BC8A 1I3QJ 5F64A 4A3JJ 3JSPA 1V54H 1MMDA 4AD9A 3F8BA 4XONA 1FOYA 1T56A 3RSNA 2DA3A 4D7NA 2I8DA 2KL4A 1I6XA 4LGWA 1FBQA 1BR4A 2IW5A 1R36A 2F5EA 2HWVA 2QEXI 1LFUP 1MDMB 5FB2A 1I39A 5J1RA 2A3SA 2JWTA 4L5JA 1WI9A 3HOYJ 1VQ6I 1D8KA 2DA7A 4OOIA 4KMFA 1BA5A 3N4MA 1FY7A 1HQCA 1FYLA 3A0HC 4G6DA 1A6QA 3OL4A 2DPUA 1TW2A 2KKOA 1RC9A 1R6RA 5FJ8J 4BE0A 1MBKA 3QPSA 4YG2F 1H0MA 2M7AA 4L9VA 2QBYB 5JHUA 2VUMJ 2MD5A 2ZKZA 3WTUC 3F3XA 3HUGA 1STZA 2VC1A 2K02A 2LP0A 3GFIA 5E3NA 2O7OA 2R7UA 1NTCA 2E2HJ 1FOXA 2W7NA 3I53A 1QGPA 3BCBA 3L2CA 1MMAA 1ZG3A 5LHGA 5KK1A 2XC7A 2P5LC 2FNAA 2KFDA 2R93J 2QSHX 3KP3A 3EYIA 5JR3A 1B59A 5FRMA 2CV1A 2E19A 1C0WA 3DU5A 4ZTJA 3ELKA 3VB2A 5D4SA 1FZPB 3FXUA 1Z21A 1YIJI 1T08B 2V9KA 3LQQA 3A01A 3P7NA 4PJLA 4HF1A 2X51A 2DA2A 1OCZH 5K1YA 3A2KA 1DUXC 2M30A 1Z3XA 4AM3A 5E1WA 2K5CA 3KP6A 5FLXZ 1K4SA 3SDGA 2BW3A 1HA8A 2DQLA 2EFPA 5HNFA 1SMTA 3H1CA 3R0AA 1BI1A 5M5YJ 1Y0UA 4EJOA 5EF6A 3I54A 2STWA 3PFIA 3ASOH 2X6XA 1W4MA 3U2RA 1XGNA 3WG7H 3PO3J 2Z3YA 1FIPA 3OIQA 5DV5A 3H5RA 5DDGA 2D5VA 3AFHA 3LA3A 1X1BA 4CUGA 2DCEA 4I99C 4KICA 1IJWC 5AIPA 2Y0MA 4KMUX 2EIJH 2FUG2 3VOEA 1ETVA 1XGOA 2ME6A 1ZELA 3BDDA 4ZYGA 4PK4A 2R5YA 1Z3YA 4UV8A 4IEJA 3MKYB 2MBFA 2BVLA 2DA4A 3I4NJ 2QA4I 2PEXA 1BL0A 2L4MA 1GDTA 3K70C 3ZQLA 2DDBA 1K7AA 4NNJA 4NB5A 3LA7A 4LG0B 3P9KA 4PGGA 2O61A 1WJAA 3HSEA 3OYMA 1N25A 4RB0A 1D8JA 3BOQA 5FKLA 1HF0A 2JPCA 1EA3A 1LKXA 4JK1X 3M1EA 3BJAA 4CGZA 3U21A 2W4SA 1V3FA 3VYUB 2V6EA 3CJTB 4G6TB 4YIFA 1ZRDA 3PJRA 2KLOA 1JTYA 4YRVA 2F5VA 2FX0A 5GTHC 4AYBN 2WB1N 1IDYA 1W7PD 1OFCX 1YOVB 1ETKA 4G9YA 4MHGA 5J8FA 1G59A 4M6YA 2R7FA 2VB6A 2ADUA 3OR2C 4F52A 2RQPA 4A0ZA 4AWXB 1S7OA 2JT1A 1IRXA 5M5XJ 4N0BA 1FSHA 2XAJA 3KPHA 3F9KA 3WE2A 4EJWA 3JRGA 2L02A 2GOMA 3IH2A 2NVYJ 2MC3A 4B47A 3PNVA 4KIGA 4RAYA 5D5VB 2WC2A 2MW8A 2ZJRF 1SVLA 2F4IA 1T0FC 2L01A 3GFMA 1U78A 3DV8A 1U9NA 4BGDA 3K7AJ 3CMYA 2V1XA 2NVQJ 4ZTFA 3HG9A 4NHJA 2Y30A 3I64A 2FSWA 4Q48A 2UZKA 3H36A 3LNQA 3MMYB 3TW6A 4AYBA 5E3OA 4XKBA 2LKSA 3SFIA 2EIMH 2VBZA 1E3HA 3IH3A 3QYEA 2KMUA 3KYCB 1X4OA 1Y56A 4UB8C 1U5TB 2MGQA 4UHTA 3G71I 4A12A 1VFCA 3PO2J 1RETA 3FWEA 1ZG5A 4HV6A 4KT6A 5DYMA 1HKQA 3E0JB 2V1DA 2HYFA 5EEAA 2LBFB 1EJ9A 1HDPA 2ELKA 1TLHB 1MDMA 3KCCA 1H88C 4PGHA 3V8JA 4B3XA 3AG3H 2VXDA 2JA6J 2XF5A 2VPLA 2P6TA 3ASNH 4MIMA 3CO7C 1ODDA 1RNLA 3ZMZA 3H5AA 2BE5F 2EFOA 1RKWA 1K78A 2WY8Q 1VZ0A 4IRHA 2EFNA 2Z16A 1WVRA 2DT7B 5DCMA 3LFKA 4H4KC 4A6EA 1XSXA 3H3ZA 5J40A 3FX3A 1A5JA 3DBRB 1IXRC 4XOTA 3H5NA 4D7MA 1ORKA 2LSOA 5IP6A 2O5RA 4A3MJ 1SVOA 3RYPA 4RGXA 3GLXA 2HOSA 5TJJA 1TL8A 1OCTC 1B8IB 2CFXA 3TGNA 2TCTA 3GVAA 2ETHA 3CDIA 1UG2A 5KVRA 2Z33A 2HKXA 4HNUA 3W6VA 1SFOJ 3LSTA 1YYVA 3EUHC 3QU6A 4U87A 2P5VA 1ZAOA 2E36A 4NC7A 1AA7A 3GLLA 2DT6A 1YG2A 4QTRA 4I02A 1GHCA 1BM9A 3K6GA 5H6RA 2MFZA 2B7EA 4IKFA 1WJFA 2AQEA 1FBUA 1BOAA 1ZHFA 4ZZLA 3S3OA 1JXSA 2HDWA 2ISYA 1FLIA 4AC0A 2WA0A 4ZZDA 1P92A 4V19K 3O2PE 3LOCA 2NRAC 3GUDA 1MZBA 2PQ8A 3FMSA 1V5GA 3HOSA 2WBMA 2CQ7A 2HXIA 1VI0A 3CESA 1GVDA 3JREA 3PL8A 4IOAF 1Y0NA 2RAEA 4D0PA 3MEXA 3V7RA 3FXRA 3JRDA 4ENMA 1N75A 3BJOA 4ANJA 2QENA 5FLVA 2X4HA 2DFFA 4XLAA 2RNGA 1SD7A 3IAM2 2L5QA 1RR8C 1X3ZB 3JAMK 3A0BC 4Q5SF 2HR3A 1O3RA 2B0LA 2K4JA 1FOWA 1RR7A 1R4NB 1IDZA 1W5SA 2WY7Q 3SHFA 1T8IA 5CVJA 1MMSA 5F6FA 1QZYA 4A3DJ 1G3WA 2DN0A 1UJ8A 3ZP5A 4PCQA 2Y9YA 2XF7A 1WI3A 3JTGA 4IX7A 2E7XA 2CUJA 2E1MB 1JKOC 3ABMH 3PQJA 2JSCA 4CCNA 3DPUA 1B4AA 4A0YA 1PUFA 1P7JA 1ULYA 3R61A 2FU4A 2ZB9A 3KZYA 4XLEA 4MTDA 3CDLA 4AIDA 4II2A 1WWXA 2EZKA 3K1NA 4CA0A 5D5WB 3ZN0A 2O3FA 2E1NA 3M9AA 1BC7C 3CUQA 2DA1A 2K85A 3GW2A 5L3EA 4FE7A 4R1HA 4AIHA 3ZMUA 2F4MB 3CCYA 2Y69H 3ZQQA 4BUPA 3VODA 3ZQ7A 4AUXA 4U0YA 2VQLA 3H3VK 1E0EA 2FXAA 2VBXA 3GX4X 1LEBA 2KRFA 1B72A 2KQRA 3VEPA 2QCOA 1BC8C 5FKKA 2H09A 3DEUA 1Y6IA 5J1UA 3KYDB 3I56I 2VODA 3DTKA 5DS9A 1MKMA 2MYSA 3E3VA 4GDFA 2ZSIB 2OUMA 1I5ZA 3O8HA 4QWQA 4HRIA 2BY3A 3HHGA 2Z99A 2JVHA 4P5OA 3LSGA 2MLKA 3CF2A 4G12A 4BBRJ 5HDNA 2OQRA 3HIFA 1VNDA 3TOBA 5B5EC 4BXXJ 5E8GA 3B73A 3F8NA 1APLC 3M3YJ 2HPMA 2R5ZA 1DDNA 2QSGX 2JUCA 3S15J 4A3LJ 4ZJZA 3HOXJ 4G6QA 3DFGA 3D0SA 3W6JB 1QZZA 2A5YB 2V1NA 1AU7A 5FFZA 3TKYA 2DA5A 3BG6A 1U5TA 1WSUA 2DFIA 3IH4A 2DYSH 2M0MA 3O8GA 2W25A 3ZR8X 4UUSB 1JUPA 1KU9A 2NS0A 4M3EA 1YRNB 5JFRA 1S5LC 1TT5B 4FTHA 2E2IJ 4E7HA 3F6OA 2IPQX 3TDUC 2ESNA 3ISPA 1X2MA 1SAUA 1ZTRA 1D0YA 3QP5A 4XORA 2EILH 3F6VA 3M7GA 1R71A 2HYGD 3DTEA 5D5UB 2ZJQF 4HZFA 3KP4A 3QWLA 5TRDA 4YIIA 4P96A 3WTWC 1TW3A 1E2XA 2LG4A 3KIOA 2P4WA 3CCJI 1W36D 3Q0UA 1FJLA 1F1ZA 1IV6A 1TNSA 3EUKL 1TWGJ 3MCZA 3S2DJ 4XKWA 1S7AA 2NVXJ 4Y4RA 2QM3A 3BPVA 2VE9A 2NOGA 1B8IA 2NNYA 4UY8I 2V9VA 3ZOBA 1H9GA 3U1DA 4FX4A 1XMAA 2QWWA 3P9IA 1DU6A 1D1BA 4ENNA 1SFUA 2VBWA 3V4GA 3PM1A 4ENKA 3CUOA 5M5WJ 4I2OA 3IWZA 1F9NA 5BS6A 2OC6A 3KETA 5CPRB 4W1UA 4JYKA 1D3YA 2H8RA 4NDLA 1RRJA 1FYKA 5ILVA 2EBIA 3RKWA
chains in the Genus database with same CATH topology
2AXLA 3HYIA 1ZN2A 1O7LA 1IF1A 2Q0OA 3QP6A 3RDIA 1KQ0A 4LB6B 3K1PA 3M8FA 4M9ZA 5D5XB 4Y13A 1WQ2A 5F1RA 2NYXA 2KJBA 3OOPA 2IT0A 4WF2A 1QQIA 2YX7A 3KP7A 3ZPLA 5FD5A 3RYRA 2YU3A 1RUOA 3J81K 3ULQB 4HOBA 4ZYDA 2RC4A 4EJTA 1YS6A 2IJLA 3KFWX 4GCVA 4ASNA 4S04A 1XMKA 5CYVA 1K6OA 1KQ8A 1MD0A 3ZMVA 2PMHA 3GO5A 3H3UA 2ESHA 3WGHA 3Q5FA 5FGMA 1BJAA 2W84A 1HSTA 1EH6A 3F22A 3WTTC 5HOOA 1YO5C 1J5YA 1KU7A 2F5FA 5DD4A 2LF8A 3TO7A 2M45A 1NHAA 4KN7X 3IHUA 4U0WA 4KUMA 5E17F 5LGTA 4HDUA 1B9NA 2XGXA 4GXOA 1XB4A 4HLYA 2ZFWA 1LJ9A 1SAXA 4HW0A 4I0AA 3EYYA 1RZ4A 1LNWA 4EJUA 2EK5A 2O03A 4OIPF 3T0YA 4GYIA 2IA0A 4IRGA 4EQQA 4IPAA 2MA3A 5ED4A 3G3ZA 4Z2YA 4L9JA 1GXPA 3FM5A 1ZH5A 4OMYA 4EV0A 4A5MA 1ZREA 1WKMA 1X3UA 2ZJ2A 5BOXA 1JHHA 3LQRA 1SD4A 2GA1A 1XCVA 3C18A 5DUIA 3QOPA 4M72A 3BWGA 2FBIA 3I4PA 2DAOA 2EA2A 1FC3A 1IXCA 1R5HA 3F8MA 1O3SA 2FQ3A 2P5KA 3QPTA 4BQAA 5BQTA 3IRQA 3ABUA 1MJBA 1U3EM 3GFJA 4WXCA 5HS9A 2ZCWA 1ON1A 4KN4X 3GZ5A 2VXZA 4A2UA 3HTUA 2R3SA 5JVTA 1HSJA 3GF2A 1ZLJA 3E97A 3Q9VA 4ZYEA 2OD5A 1O3TA 2VT2A 2DI3A 2AS5F 2CG4A 1LDDA 2GIVA 1F4KA 4KYWA 3ZMSA 4I0BA 3GFLA 3F8FA 4OMZA 1F5TA 2PMUA 1AWCA 4FT8A 2YR2A 1Z9CA 4TV7A 3RIRA 1TTYA 4KIFA 4ZH4F 5L3DA 3RJPA 1AOYA 1DPUA 1T0FA 4WCGA 1E17A 5AIQA 3I0TA 3KP2A 5LBQA 1UHMA 4Y15A 3H92A 2L54A 1ZARA 5EEHA 3R0JA 1IAWA 1JE8A 5A2QK 4RB2C 2H6BA 4P55A 2EV0A 3K0LA 3IKVA 3W6KB 2DPDA 1G3TA 1REPC 2CGPA 4LLGF 2P8TA 4LFUA 4G7ZF 1MGTA 4I09A 3F72A 1HW2A 5CVIA 4EM1A 4EM0B 1G4DA 1KU3A 3J81Z 2IVMA 4BHPA 1OYYA 1S6LA 3REOA 3MZHA 4RS8A 3EDPA 1W7PB 4ESJA 2IA1A 4U0VA 2KIMA 1U8RA 1XSVA 3EUHA 2ZO4A 2BEOA 2BV6A 2QBYA 3IL2A 1ZGAA 1IN4A 1O57A 3WG9A 3DQVC 3CTAA 1EH8A 3MFKA 2JZYA 2J5PA 3WE3A 2BBYA 2R7DA 4FX0A 1G3YA 1R58A 2KIUA 2GAUA 3IKTA 1S8NA 4UV9A 4RB1A 3E5XA 4XBFA 5E18F 4XLPF 1R00A 1G6NA 5D8LB 4RGUA 2C6YA 1VTNC 1J75A 1OMIA 1YS7A 5E20A 2MLGA 1IW7F 5D6FA 4L9TA 2O8XA 1KYWA 6PAXA 2H27A 3QAHA 1PP7U 2A6EF 3L09A 2VOPA 4HF0A 2BGCA 3CDHA 1R1UA 3KP5A 2CQKA 3JSOA 1IZ1A 5ICCA 1R5GA 3ECHA 4LG0A 5HDGA 4HV5A 1PDNC 2D1HA 4EGYA 3BJ6A 3RTRA 4R79A 2WTEA 2YPRA 1Z91A 2JRTA 2VBYA 4ETSA 3V8KA 2RDPA 2VN2A 3DF8A 3HHHA 2W24A 3L9FA 4MEYF 5L3BA 3E6BA 3JTHA 1B1BA 1XCBA 2NNNA 3T1BA 5BPIA 5L3GA 1FSEA 3O6BB 3NRVA 4A5NA 5HLGA 4I01A 2DU9A 1KYZA 4CDGA 3DPLC 3I59B 2XAGA 4RB3C 4EM2A 4BH9A 5FO5A 2HS5A 5EEGA 1GXQA 3RPQA 2XKPA 5K5RA 3RKXA 3EQLF 4LK0F 1QO0D 5D4RA 3ERED 4MQ9F 2V1UA 2OU2A 3JW4A 5ILUA 2OA4A 4KDPA 3CJNA 2DTRA 5FD6A 5K5OA 3TO6A 3DXJF 5HVQC 2RV8A 2ZMEB 4G7HF 2LKPA 2UWMA 1TQIA 4ON0A 2QZ8A 3BP8A 1USSA 3B02A 3DPTA 1OYWA 2HZTA 2JTVA 4XSXF 5ERIA 1S3JA 3WGGA 1YW8A 3AAFA 3HRUA 3KLOA 3M8EA 1PUEE 1A04A 3N97A 3HRSA 4Q47A 4M74A 2CYYA 1KQ9A 3LWFA 2QYOA 2ZNYA 3TO9A 5A2QZ 4HDVA 4GO1A 2G7UA 3E5QA 4F7ZA 2G9WA 1BN5A 1B9MA 2V6CA 4M71A 2L4AA 2M1BA 5CVVA 3I5UA 1ZRFA 4CZZA 1TNTA 1BI3A 3T8TA 4N9HA 1J59A 2E7WA 2RVCA 1CGPA 2ACJA 3HTSB 3E5UA 2ZBKA 2L3DA 4PZJA 1XDUA 3ZN1A 5J6XA 2XROA 1SFEA 3FZVA 1YIOA 1IRGA 1IUYA 2RNJA 1YLFA 4Y17A 2DT5A 5LHHA 4M73A 1ZYRF 3L7WA 2OQGA 4UUVA 1HXDA 1I1SA 4UVCA 4UVBA 4KT5C 4LB5A 4S05A 1FPQA 1I1GA 5LHIA 4OIOF 3VFZA 2XAQA 1P2FA 3EETA 3IC7A 1FWZA 4FHTA 4O5VA 1OYIA 2ZNZA 2GQQA 2K86A 2PI0A 4IHSA 4PDKA 1UFMA 3P9CA 3K69A 2G7HA 4JBAA 3T5XA 4IRIA 5DCFA 4HYEA 4L0YB 4UNOA 3OV8A 1FP2A 2COMA 1QBJA 5HS7A 4AIJA 2HTSA 2W57A 1LDKB 1HBXG 2FMYA 3JAMZ 3V8LA 2XIGA 2ELHA 3G73A 3CLOA 2QQBA 2HQRA 5LLQA 2FOKA 4LD5A 1R1TA 3SXYA 2E1CA 3FM3A 3NEUA 2PFBA 4HX8A 3WTZA 4LMYA 1FBSA 1BI0A 3T8RA 5LEKA 1K79A 4IF4A 3LAPA 2FBKA 4RAZA 3WODF 2NAZA 3L00A 4MGRA 4MQVA 2ZXJA 1J2XA 2FNPA 3WTVC 2J5OA 3CO6C 2CW0F 4KA4A 1JHFA 2EFWA 5JI6A 1K78B 2O0YA 2YX4A 3O3KA 1USTA 1UHWA 1BI2A 4ENJA 2VC0A 5DCMB 1ZGJA 4B09A 4IJAA 1Z6RA 2WV0A 1S29A 5DEQA 3WTXC 2D1VA 4EJVA 1YW9A 3FMQA 4MNUA 3HOTA 1EH7A 2OZUA 5E1ZB 4L18B 2QLZA 3K2ZA 5H6QA 1P4AA 2A07F 2UXXA 3C3WA 2D2WA 1FNNA 3J80K 3MZYA 3F8CA 2IA2A 2XHKA 3ZMDA 2CO5A 1YQAA 2A6HF 3V7SA 1L0OC 4EVIA 1L3LA 2OZ6A 1T38A 4A0XA 4YFXF 4U7DA 4L5IA 4R8HA 2Y48A 3C1DA 2QVOA 3FHZA 3R4KA 3GYHX 4KFCA 2K7LA 3GXOA 4QLCU 4ESBA 5IT3A 2YSRA 5CJ9A 2HOEA 1ZLKA 3I71A 1JGSA 5ICFA 2F2EA 2M87A 4HQEA 3COAC 1TQMA 4WX9A 2FBHA 3TQNA 4EMSA 4CICA 4P9FA 1LB2A 2XVCA 4N9IA 4I7HA 4EGZA 1LVAA 2WWYA 4XSZF 2FE3A 3SQNA 2Z5UA 2FA5A 2DW4A 3CUQB 3E6DA 4BYYA 3F21A 5DUKA 2OAZA 4BAYA 2VOOA 2XRNA 1B6AA 2GXGA 1Z7UA 4HF2A 5BMZA 2HEOA 1Z05A 4KIBA 2O6GE 1J0RA 2EB7A 2GWRA 3WTYC 5J8CA 4L0ZB 5HLIA 4AIKA 1DP7P 4JQFA 4O6JA 4Q4ZF 2HTJA 1D5VA 5BPDA 2FRHA 2K4BA 3HSFA 2KJCA 5ILSA 2LNBA 3J7AO 1QNTA 4IXAA 3ABTA 2BYVE 4CYDA 1IXSB 2EV6A 2D45A 2MH2A 3ECOA 4G8XA 5CLSA 2DBBA 4O3MA 5IT9K 4DQ2A 2A61A 5HDKA 3R6SA 2EA4A 3MWMA 2RGVA 5ICGA 4UVAA 4MEXF 2DK5A 5CVRA 2DK8A 3WU0A 3MAJA 4OU0A 3BROA 3FXQA 1XN7A 1Q1HA 1SD5A 2V79A 1ONVA 1J9IA 1O3QA 4M6XA 4H0EA 1IN5A 5HS8A 2Q8KA 1UCRA 4HQMA 1J7KA 3RPUA 2P7CB 5ICEA 4IVNA 3BY6A 2RN7A 4NQWA 3HRTA 2DQRA 2LF7A 2Q2EA 2XKOA 3U9GA 2GZWA 3E6MA 1BIBA 5CVUA 2K27A 4UXNA 1V4RA 2FEZA 1WRJA 3DP7A 3QU3A 2VE8A 1HW1A 3R60A 2DO7A 4BXUA 1IRFA 2KIFA 1XDSA 4GGGA 4BNCA 4M9SA 3QRFF 1KU2A 2CWEA 3S2WA 3HRMA 1CF7B 1KA8A 2QUFA 3TDZC 4I98B 5FFXA 1IN8A 2M8EA 1SMYF 4P9UA 3F23A 2PLYA 1FYMA 2EWNA 1HKSA 3V7CA 1FT9A 4LJZF 2PJPA 3HSRA 4K2EA 4OINF 4LLLA 1P6RA 5D8KB 4CXFA 4A6DA 1MJAA 1GVJA 2EV5A 2LDUA 2EFQA 2RKHA 5DD8A 1OR7A 3K1MA 1SFXA 2HKOA 3LA2A 4B8XA 5LRSA 3IWFA 4ZYHA 2QQ9A 2GA2A 1P4XA 1QPMA 1O7FA 3D5LA 4WXDA 4CHUA 3KEOA 1PP8F 3CUQC 1EV7A 5LRRA 3J80Z 2PG4A 1R22A 1T2KA 3KZZA 5HLHA 5L3CA 4XLNF 2Z9OA 2P7VB 1ON2A 3WU1B 1W7PA 1LEAA 2IRFG 1UB9A 4WK8F 2F5CA 2OBPA 1FOKA 4HX7A 5L3FA 1FP1D 3WTSC 2QQAA 5FLXK 1G3SA 3E6CC 4MTEA 4GYGA 5AONA 2H6CA 4HLXA 4HAMA 3K9TA 3SZPA 1HKTA 2HGCA 1W5TA 1XD7A 1FX7A 3ML6A 4RGRA 3BPXA 4RGSA 1U5TC 2F5DA 1U6GA 4OIRF 4HX4A 4XRFA 4M9XA 2PN6A 2H94A 2UXNA 1ZG1A 1DPRA 2XV4S 1R23A 3GWZA 1IN6A 4KNYA 2HQNA 3RI4A 1XSDA 2STTA 3KE2A 2EJRA 2Y75A 1Z6TA 3QPHA 4AVPA 3IRRA 4WXHA 2HDCA 1SD6A 4BHBA 1BBYA 2DLLA 2M5WA 1R1VA 1CF7A 3PQKA 4ESFA 2XUBA 3SFZA 2HFHA 1R7JA 1T98A 1LQ1A 1U2WA 5IT9Z 4HBLA 2CSOA 3I58A 3MQ0A 3FF5A 4BHCA 4G94A 3GEZA 1YTYA 2ISZA 1TQPA 2MH9A 1MJ9A 1RIOH 4YFKF 1XGMA 1RI7A 2VONA 2A68F 5LGUA 4U7BA 1BIAA 2XAFA 2IP2A 3ROUA 2XAHA 4WWCA 4CO8A 1ZRCA 4OIQF 2FMLA 1P4WA 4IHTA 3FMRA 3GZ6A 2W85A 5H20A 5E1XA 2PBIA 1LDJA 2X0LA 3C7JA 1YW7A 1IN7A 1OKRA 3LAJA 1TBXA 3I59A 1YFHA 1OPCA 3RKYA 2FF4A 5LEJA 4E70A 4G7OF 3DKWA 4HA8A 3SZTA 1Z1DA 2JPBA 2GXBA 1RUNA 2VT3A 4YFNF 4LLNA 2A69F 3ZMTA 1XGSA 4DNCA 1T39A 5E8IA 1KGSA 3NQOA 4L9NA 3KEQA 3TOAA 3WGIA 3Q9SA 2TDXA 2P6SA 1HW5A 5K5QA 1H9TA 3BZ6A 1T6SA 1I27A 3KLNA 5D6EA 2ZMEA 4U88A 2XASA 5LGNA 4LK1F 5F64A 3JSPA 4AD9A 3F8BA 1I6XA 4LGWA 1FBQA 2IW5A 1R36A 2F5EA 2HWVA 1MDMB 5FB2A 2A3SA 4L5JA 1WI9A 1D8KA 4OOIA 4KMFA 3N4MA 1FY7A 1HQCA 1FYLA 4G6DA 2DPUA 1TW2A 2KKOA 4YG2F 1H0MA 4L9VA 2QBYB 5JHUA 2MD5A 2ZKZA 3WTUC 3F3XA 3HUGA 1STZA 2VC1A 2K02A 3GFIA 3I53A 1QGPA 3L2CA 1ZG3A 5LHGA 5KK1A 2P5LC 2FNAA 3KP3A 3EYIA 5JR3A 1B59A 1C0WA 3ELKA 3VB2A 5D4SA 1FZPB 3FXUA 3LQQA 3P7NA 4HF1A 5K1YA 1DUXC 2M30A 5E1WA 3KP6A 5FLXZ 2DQLA 2EFPA 1SMTA 3R0AA 1BI1A 1Y0UA 4EJOA 3I54A 2STWA 3PFIA 1W4MA 3U2RA 1XGNA 2Z3YA 5DV5A 5DDGA 3LA3A 4KICA 5AIPA 2Y0MA 4KMUX 3VOEA 1XGOA 4ZYGA 3BDDA 4UV8A 2MBFA 2PEXA 2L4MA 1K7AA 4NB5A 3LA7A 4LG0B 3P9KA 4PGGA 2O61A 3HSEA 4RB0A 1D8JA 3BOQA 2JPCA 4JK1X 3M1EA 3BJAA 4CGZA 1V3FA 4YIFA 1ZRDA 1W7PD 4G9YA 4MHGA 5J8FA 4M6YA 2R7FA 2ADUA 2RQPA 4A0ZA 4AWXB 1S7OA 2JT1A 4N0BA 1FSHA 2XAJA 4EJWA 3WE2A 2L02A 2MC3A 4KIGA 4RAYA 5D5VB 2WC2A 2L01A 1U78A 3GFMA 3DV8A 2V1XA 4NHJA 3I64A 2FSWA 4Q48A 2UZKA 2VBZA 1U5TB 4UHTA 4A12A 3FWEA 1ZG5A 4HV6A 5DYMA 1HKQA 2V1DA 2HYFA 1MDMA 1TLHB 3KCCA 4PGHA 3V8JA 2P6TA 3CO7C 1ODDA 1RNLA 3ZMZA 2BE5F 2EFOA 1K78A 4IRHA 2EFNA 5DCMA 3LFKA 4A6EA 1XSXA 3H3ZA 3FX3A 1IXRC 2LSOA 3RYPA 4RGXA 3GLXA 5TJJA 2CFXA 3TGNA 3GVAA 2ETHA 5KVRA 2Z33A 2HKXA 3LSTA 1YYVA 3QU6A 2P5VA 1ZAOA 1YG2A 1GHCA 4I02A 1BM9A 5H6RA 1FBUA 1BOAA 1ZHFA 4ZZLA 1JXSA 2ISYA 1FLIA 4ZZDA 1P92A 3O2PE 2NRAC 3GUDA 1MZBA 2PQ8A 3FMSA 3HOSA 4D0PA 3MEXA 3V7RA 3FXRA 4ENMA 3BJOA 2QENA 2X4HA 1SD7A 3JAMK 4Q5SF 2HR3A 1O3RA 2B0LA 2K4JA 1W5SA 3SHFA 5CVJA 5F6FA 1QZYA 1G3WA 3ZP5A 4PCQA 3JTGA 2E7XA 3PQJA 2JSCA 1B4AA 4A0YA 1ULYA 3R61A 2FU4A 4MTDA 3KZYA 1WWXA 3K1NA 5D5WB 3ZN0A 2O3FA 2E1NA 3M9AA 1BC7C 3CUQA 3GW2A 5L3EA 4R1HA 4AIHA 3ZMUA 3VODA 3ZQ7A 4U0YA 2FXAA 2VBXA 3GX4X 1LEBA 2KRFA 3VEPA 1BC8C 2H09A 3DEUA 2VODA 1MKMA 3E3VA 1I5ZA 4QWQA 3HHGA 2Z99A 4P5OA 2MLKA 5HDNA 2OQRA 3HIFA 3TOBA 5E8GA 3B73A 3F8NA 1DDNA 4G6QA 3DFGA 3D0SA 3W6JB 1QZZA 2A5YB 5FFZA 3TKYA 1U5TA 1WSUA 2DFIA 2W25A 1KU9A 2NS0A 5JFRA 3F6OA 2IPQX 3TDUC 2ESNA 3ISPA 3QP5A 3F6VA 3M7GA 2HYGD 5D5UB 4HZFA 3KP4A 5TRDA 4YIIA 4P96A 3WTWC 1TW3A 1E2XA 2P4WA 1F1ZA 1TNSA 3MCZA 1S7AA 2QM3A 3BPVA 2VE9A 2NNYA 2V9VA 1H9GA 3U1DA 4FX4A 1XMAA 2QWWA 3P9IA 4ENNA 1SFUA 2VBWA 3V4GA 4ENKA 3CUOA 4I2OA 3IWZA 1F9NA 5BS6A 3KETA 1D3YA 1FYKA 5ILVA 3RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXL A;  3HYI A;  1ZN2 A;  1O7L A;  1IF1 A;  2Q0O A;  3QP6 A;  3RDI A;  1KQ0 A;  4LB6 B;  3K1P A;  3M8F A;  4M9Z A;  5D5X B;  4Y13 A;  1WQ2 A;  5F1R A;  2NYX A;  2KJB A;  3OOP A;  2IT0 A;  4WF2 A;  1QQI A;  2YX7 A;  3KP7 A;  3ZPL A;  5FD5 A;  3RYR A;  2YU3 A;  1RUO A;  3J81 K;  3ULQ B;  4HOB A;  4ZYD A;  2RC4 A;  4EJT A;  1YS6 A;  2IJL A;  3KFW X;  4GCV A;  4ASN A;  4S04 A;  1XMK A;  5CYV A;  1K6O A;  1KQ8 A;  1MD0 A;  3ZMV A;  2PMH A;  3GO5 A;  3H3U A;  2ESH A;  3WGH A;  3Q5F A;  5FGM A;  1BJA A;  2W84 A;  1HST A;  1EH6 A;  3F22 A;  3WTT C;  5HOO A;  1YO5 C;  1J5Y A;  1KU7 A;  2F5F A;  5DD4 A;  2LF8 A;  3TO7 A;  2M45 A;  1NHA A;  4KN7 X;  3IHU A;  4U0W A;  4KUM A;  5E17 F;  5LGT A;  4HDU A;  1B9N A;  2XGX A;  4GXO A;  1XB4 A;  4HLY A;  2ZFW A;  1LJ9 A;  1SAX A;  4HW0 A;  4I0A A;  3EYY A;  1RZ4 A;  1LNW A;  4EJU A;  2EK5 A;  2O03 A;  4OIP F;  3T0Y A;  4GYI A;  2IA0 A;  4IRG A;  4EQQ A;  4IPA A;  2MA3 A;  5ED4 A;  3G3Z A;  4Z2Y A;  4L9J A;  1GXP A;  3FM5 A;  1ZH5 A;  4OMY A;  4EV0 A;  4A5M A;  1ZRE A;  1WKM A;  1X3U A;  2ZJ2 A;  5BOX A;  1JHH A;  3LQR A;  1SD4 A;  2GA1 A;  1XCV A;  3C18 A;  5DUI A;  3QOP A;  4M72 A;  3BWG A;  2FBI A;  3I4P A;  2DAO A;  2EA2 A;  1FC3 A;  1IXC A;  1R5H A;  3F8M A;  1O3S A;  2FQ3 A;  2P5K A;  3QPT A;  4BQA A;  5BQT A;  3IRQ A;  3ABU A;  1MJB A;  1U3E M;  3GFJ A;  4WXC A;  5HS9 A;  2ZCW A;  1ON1 A;  4KN4 X;  3GZ5 A;  2VXZ A;  4A2U A;  3HTU A;  2R3S A;  5JVT A;  1HSJ A;  3GF2 A;  1ZLJ A;  3E97 A;  3Q9V A;  4ZYE A;  2OD5 A;  1O3T A;  2VT2 A;  2DI3 A;  2AS5 F;  2CG4 A;  1LDD A;  2GIV A;  1F4K A;  4KYW A;  3ZMS A;  4I0B A;  3GFL A;  3F8F A;  4OMZ A;  1F5T A;  2PMU A;  1AWC A;  4FT8 A;  2YR2 A;  1Z9C A;  4TV7 A;  3RIR A;  1TTY A;  4KIF A;  4ZH4 F;  5L3D A;  3RJP A;  1AOY A;  1DPU A;  1T0F A;  4WCG A;  1E17 A;  5AIQ A;  3I0T A;  3KP2 A;  5LBQ A;  1UHM A;  4Y15 A;  3H92 A;  2L54 A;  1ZAR A;  5EEH A;  3R0J A;  1IAW A;  1JE8 A;  5A2Q K;  4RB2 C;  2H6B A;  4P55 A;  2EV0 A;  3K0L A;  3IKV A;  3W6K B;  2DPD A;  1G3T A;  1REP C;  2CGP A;  4LLG F;  2P8T A;  4LFU A;  4G7Z F;  1MGT A;  4I09 A;  3F72 A;  1HW2 A;  5CVI A;  4EM1 A;  4EM0 B;  1G4D A;  1KU3 A;  3J81 Z;  2IVM A;  4BHP A;  1OYY A;  1S6L A;  3REO A;  3MZH A;  4RS8 A;  3EDP A;  1W7P B;  4ESJ A;  2IA1 A;  4U0V A;  2KIM A;  1U8R A;  1XSV A;  3EUH A;  2ZO4 A;  2BEO A;  2BV6 A;  2QBY A;  3IL2 A;  1ZGA A;  1IN4 A;  1O57 A;  3WG9 A;  3DQV C;  3CTA A;  1EH8 A;  3MFK A;  2JZY A;  2J5P A;  3WE3 A;  2BBY A;  2R7D A;  4FX0 A;  1G3Y A;  1R58 A;  2KIU A;  2GAU A;  3IKT A;  1S8N A;  4UV9 A;  4RB1 A;  3E5X A;  4XBF A;  5E18 F;  4XLP F;  1R00 A;  1G6N A;  5D8L B;  4RGU A;  2C6Y A;  1VTN C;  1J75 A;  1OMI A;  1YS7 A;  5E20 A;  2MLG A;  1IW7 F;  5D6F A;  4L9T A;  2O8X A;  1KYW A;  6PAX A;  2H27 A;  3QAH A;  1PP7 U;  2A6E F;  3L09 A;  2VOP A;  4HF0 A;  2BGC A;  3CDH A;  1R1U A;  3KP5 A;  2CQK A;  3JSO A;  1IZ1 A;  5ICC A;  1R5G A;  3ECH A;  4LG0 A;  5HDG A;  4HV5 A;  1PDN C;  2D1H A;  4EGY A;  3BJ6 A;  3RTR A;  4R79 A;  2WTE A;  2YPR A;  1Z91 A;  2JRT A;  2VBY A;  4ETS A;  3V8K A;  2RDP A;  2VN2 A;  3DF8 A;  3HHH A;  2W24 A;  3L9F A;  4MEY F;  5L3B A;  3E6B A;  3JTH A;  1B1B A;  1XCB A;  2NNN A;  3T1B A;  5BPI A;  5L3G A;  1FSE A;  3O6B B;  3NRV A;  4A5N A;  5HLG A;  4I01 A;  2DU9 A;  1KYZ A;  4CDG A;  3DPL C;  3I59 B;  2XAG A;  4RB3 C;  4EM2 A;  4BH9 A;  5FO5 A;  2HS5 A;  5EEG A;  1GXQ A;  3RPQ A;  2XKP A;  5K5R A;  3RKX A;  3EQL F;  4LK0 F;  1QO0 D;  5D4R A;  3ERE D;  4MQ9 F;  2V1U A;  2OU2 A;  3JW4 A;  5ILU A;  2OA4 A;  4KDP A;  3CJN A;  2DTR A;  5FD6 A;  5K5O A;  3TO6 A;  3DXJ F;  5HVQ C;  2RV8 A;  2ZME B;  4G7H F;  2LKP A;  2UWM A;  1TQI A;  4ON0 A;  2QZ8 A;  3BP8 A;  1USS A;  3B02 A;  3DPT A;  1OYW A;  2HZT A;  2JTV A;  4XSX F;  5ERI A;  1S3J A;  3WGG A;  1YW8 A;  3AAF A;  3HRU A;  3KLO A;  3M8E A;  1PUE E;  1A04 A;  3N97 A;  3HRS A;  4Q47 A;  4M74 A;  2CYY A;  1KQ9 A;  3LWF A;  2QYO A;  2ZNY A;  3TO9 A;  5A2Q Z;  4HDV A;  4GO1 A;  2G7U A;  3E5Q A;  4F7Z A;  2G9W A;  1BN5 A;  1B9M A;  2V6C A;  4M71 A;  2L4A A;  2M1B A;  5CVV A;  3I5U A;  1ZRF A;  4CZZ A;  1TNT A;  1BI3 A;  3T8T A;  4N9H A;  1J59 A;  2E7W A;  2RVC A;  1CGP A;  2ACJ A;  3HTS B;  3E5U A;  2ZBK A;  2L3D A;  4PZJ A;  1XDU A;  3ZN1 A;  5J6X A;  2XRO A;  1SFE A;  3FZV A;  1YIO A;  1IRG A;  1IUY A;  2RNJ A;  1YLF A;  4Y17 A;  2DT5 A;  5LHH A;  4M73 A;  1ZYR F;  3L7W A;  2OQG A;  4UUV A;  1HXD A;  1I1S A;  4UVC A;  4UVB A;  4KT5 C;  4LB5 A;  4S05 A;  1FPQ A;  1I1G A;  5LHI A;  4OIO F;  3VFZ A;  2XAQ A;  1P2F A;  3EET A;  3IC7 A;  1FWZ A;  4FHT A;  4O5V A;  1OYI A;  2ZNZ A;  2GQQ A;  2K86 A;  2PI0 A;  4IHS A;  4PDK A;  1UFM A;  3P9C A;  3K69 A;  2G7H A;  4JBA A;  3T5X A;  4IRI A;  5DCF A;  4HYE A;  4L0Y B;  4UNO A;  3OV8 A;  1FP2 A;  2COM A;  1QBJ A;  5HS7 A;  4AIJ A;  2HTS A;  2W57 A;  1LDK B;  1HBX G;  2FMY A;  3JAM Z;  3V8L A;  2XIG A;  2ELH A;  3G73 A;  3CLO A;  2QQB A;  2HQR A;  5LLQ A;  2FOK A;  4LD5 A;  1R1T A;  3SXY A;  2E1C A;  3FM3 A;  3NEU A;  2PFB A;  4HX8 A;  3WTZ A;  4LMY A;  1FBS A;  1BI0 A;  3T8R A;  5LEK A;  1K79 A;  4IF4 A;  3LAP A;  2FBK A;  4RAZ A;  3WOD F;  2NAZ A;  3L00 A;  4MGR A;  4MQV A;  2ZXJ A;  1J2X A;  2FNP A;  3WTV C;  2J5O A;  3CO6 C;  2CW0 F;  4KA4 A;  1JHF A;  2EFW A;  5JI6 A;  1K78 B;  2O0Y A;  2YX4 A;  3O3K A;  1UST A;  1UHW A;  1BI2 A;  4ENJ A;  2VC0 A;  5DCM B;  1ZGJ A;  4B09 A;  4IJA A;  1Z6R A;  2WV0 A;  1S29 A;  5DEQ A;  3WTX C;  2D1V A;  4EJV A;  1YW9 A;  3FMQ A;  4MNU A;  3HOT A;  1EH7 A;  2OZU A;  5E1Z B;  4L18 B;  2QLZ A;  3K2Z A;  5H6Q A;  1P4A A;  2A07 F;  2UXX A;  3C3W A;  2D2W A;  1FNN A;  3J80 K;  3MZY A;  3F8C A;  2IA2 A;  2XHK A;  3ZMD A;  2CO5 A;  1YQA A;  2A6H F;  3V7S A;  1L0O C;  4EVI A;  1L3L A;  2OZ6 A;  1T38 A;  4A0X A;  4YFX F;  4U7D A;  4L5I A;  4R8H A;  2Y48 A;  3C1D A;  2QVO A;  3FHZ A;  3R4K A;  3GYH X;  4KFC A;  2K7L A;  3GXO A;  4QLC U;  4ESB A;  5IT3 A;  2YSR A;  5CJ9 A;  2HOE A;  1ZLK A;  3I71 A;  1JGS A;  5ICF A;  2F2E A;  2M87 A;  4HQE A;  3COA C;  1TQM A;  4WX9 A;  2FBH A;  3TQN A;  4EMS A;  4CIC A;  4P9F A;  1LB2 A;  2XVC A;  4N9I A;  4I7H A;  4EGZ A;  1LVA A;  2WWY A;  4XSZ F;  2FE3 A;  3SQN A;  2Z5U A;  2FA5 A;  2DW4 A;  3CUQ B;  3E6D A;  4BYY A;  3F21 A;  5DUK A;  2OAZ A;  4BAY A;  2VOO A;  2XRN A;  1B6A A;  2GXG A;  1Z7U A;  4HF2 A;  5BMZ A;  2HEO A;  1Z05 A;  4KIB A;  2O6G E;  1J0R A;  2EB7 A;  2GWR A;  3WTY C;  5J8C A;  4L0Z B;  5HLI A;  4AIK A;  1DP7 P;  4JQF A;  4O6J A;  4Q4Z F;  2HTJ A;  1D5V A;  5BPD A;  2FRH A;  2K4B A;  3HSF A;  2KJC A;  5ILS A;  2LNB A;  3J7A O;  1QNT A;  4IXA A;  3ABT A;  2BYV E;  4CYD A;  1IXS B;  2EV6 A;  2D45 A;  2MH2 A;  3ECO A;  4G8X A;  5CLS A;  2DBB A;  4O3M A;  5IT9 K;  4DQ2 A;  2A61 A;  5HDK A;  3R6S A;  2EA4 A;  3MWM A;  2RGV A;  5ICG A;  4UVA A;  4MEX F;  2DK5 A;  5CVR A;  2DK8 A;  3WU0 A;  3MAJ A;  4OU0 A;  3BRO A;  3FXQ A;  1XN7 A;  1Q1H A;  1SD5 A;  2V79 A;  1ONV A;  1J9I A;  1O3Q A;  4M6X A;  4H0E A;  1IN5 A;  5HS8 A;  2Q8K A;  1UCR A;  4HQM A;  1J7K A;  3RPU A;  2P7C B;  5ICE A;  4IVN A;  3BY6 A;  2RN7 A;  4NQW A;  3HRT A;  2DQR A;  2LF7 A;  2Q2E A;  2XKO A;  3U9G A;  2GZW A;  3E6M A;  1BIB A;  5CVU A;  2K27 A;  4UXN A;  1V4R A;  2FEZ A;  1WRJ A;  3DP7 A;  3QU3 A;  2VE8 A;  1HW1 A;  3R60 A;  2DO7 A;  4BXU A;  1IRF A;  2KIF A;  1XDS A;  4GGG A;  4BNC A;  4M9S A;  3QRF F;  1KU2 A;  2CWE A;  3S2W A;  3HRM A;  1CF7 B;  1KA8 A;  2QUF A;  3TDZ C;  4I98 B;  5FFX A;  1IN8 A;  2M8E A;  1SMY F;  4P9U A;  3F23 A;  2PLY A;  1FYM A;  2EWN A;  1HKS A;  3V7C A;  1FT9 A;  4LJZ F;  2PJP A;  3HSR A;  4K2E A;  4OIN F;  4LLL A;  1P6R A;  5D8K B;  4CXF A;  4A6D A;  1MJA A;  1GVJ A;  2EV5 A;  2LDU A;  2EFQ A;  2RKH A;  5DD8 A;  1OR7 A;  3K1M A;  1SFX A;  2HKO A;  3LA2 A;  4B8X A;  5LRS A;  3IWF A;  4ZYH A;  2QQ9 A;  2GA2 A;  1P4X A;  1QPM A;  1O7F A;  3D5L A;  4WXD A;  4CHU A;  3KEO A;  1PP8 F;  3CUQ C;  1EV7 A;  5LRR A;  3J80 Z;  2PG4 A;  1R22 A;  1T2K A;  3KZZ A;  5HLH A;  5L3C A;  4XLN F;  2Z9O A;  2P7V B;  1ON2 A;  3WU1 B;  1W7P A;  1LEA A;  2IRF G;  1UB9 A;  4WK8 F;  2F5C A;  2OBP A;  1FOK A;  4HX7 A;  5L3F A;  1FP1 D;  3WTS C;  2QQA A;  5FLX K;  1G3S A;  3E6C C;  4MTE A;  4GYG A;  5AON A;  2H6C A;  4HLX A;  4HAM A;  3K9T A;  3SZP A;  1HKT A;  2HGC A;  1W5T A;  1XD7 A;  1FX7 A;  3ML6 A;  4RGR A;  3BPX A;  4RGS A;  1U5T C;  2F5D A;  1U6G A;  4OIR F;  4HX4 A;  4XRF A;  4M9X A;  2PN6 A;  2H94 A;  2UXN A;  1ZG1 A;  1DPR A;  2XV4 S;  1R23 A;  3GWZ A;  1IN6 A;  4KNY A;  2HQN A;  3RI4 A;  1XSD A;  2STT A;  3KE2 A;  2EJR A;  2Y75 A;  1Z6T A;  3QPH A;  4AVP A;  3IRR A;  4WXH A;  2HDC A;  1SD6 A;  4BHB A;  1BBY A;  2DLL A;  2M5W A;  1R1V A;  1CF7 A;  3PQK A;  4ESF A;  2XUB A;  3SFZ A;  2HFH A;  1R7J A;  1T98 A;  1LQ1 A;  1U2W A;  5IT9 Z;  4HBL A;  2CSO A;  3I58 A;  3MQ0 A;  3FF5 A;  4BHC A;  4G94 A;  3GEZ A;  1YTY A;  2ISZ A;  1TQP A;  2MH9 A;  1MJ9 A;  1RIO H;  4YFK F;  1XGM A;  1RI7 A;  2VON A;  2A68 F;  5LGU A;  4U7B A;  1BIA A;  2XAF A;  2IP2 A;  3ROU A;  2XAH A;  4WWC A;  4CO8 A;  1ZRC A;  4OIQ F;  2FML A;  1P4W A;  4IHT A;  3FMR A;  3GZ6 A;  2W85 A;  5H20 A;  5E1X A;  2PBI A;  1LDJ A;  2X0L A;  3C7J A;  1YW7 A;  1IN7 A;  1OKR A;  3LAJ A;  1TBX A;  3I59 A;  1YFH A;  1OPC A;  3RKY A;  2FF4 A;  5LEJ A;  4E70 A;  4G7O F;  3DKW A;  4HA8 A;  3SZT A;  1Z1D A;  2JPB A;  2GXB A;  1RUN A;  2VT3 A;  4YFN F;  4LLN A;  2A69 F;  3ZMT A;  1XGS A;  4DNC A;  1T39 A;  5E8I A;  1KGS A;  3NQO A;  4L9N A;  3KEQ A;  3TOA A;  3WGI A;  3Q9S A;  2TDX A;  2P6S A;  1HW5 A;  5K5Q A;  1H9T A;  3BZ6 A;  1T6S A;  1I27 A;  3KLN A;  5D6E A;  2ZME A;  4U88 A;  2XAS A;  5LGN A;  4LK1 F;  5F64 A;  3JSP A;  4AD9 A;  3F8B A;  1I6X A;  4LGW A;  1FBQ A;  2IW5 A;  1R36 A;  2F5E A;  2HWV A;  1MDM B;  5FB2 A;  2A3S A;  4L5J A;  1WI9 A;  1D8K A;  4OOI A;  4KMF A;  3N4M A;  1FY7 A;  1HQC A;  1FYL A;  4G6D A;  2DPU A;  1TW2 A;  2KKO A;  4YG2 F;  1H0M A;  4L9V A;  2QBY B;  5JHU A;  2MD5 A;  2ZKZ A;  3WTU C;  3F3X A;  3HUG A;  1STZ A;  2VC1 A;  2K02 A;  3GFI A;  3I53 A;  1QGP A;  3L2C A;  1ZG3 A;  5LHG A;  5KK1 A;  2P5L C;  2FNA A;  3KP3 A;  3EYI A;  5JR3 A;  1B59 A;  1C0W A;  3ELK A;  3VB2 A;  5D4S A;  1FZP B;  3FXU A;  3LQQ A;  3P7N A;  4HF1 A;  5K1Y A;  1DUX C;  2M30 A;  5E1W A;  3KP6 A;  5FLX Z;  2DQL A;  2EFP A;  1SMT A;  3R0A A;  1BI1 A;  1Y0U A;  4EJO A;  3I54 A;  2STW A;  3PFI A;  1W4M A;  3U2R A;  1XGN A;  2Z3Y A;  5DV5 A;  5DDG A;  3LA3 A;  4KIC A;  5AIP A;  2Y0M A;  4KMU X;  3VOE A;  1XGO A;  4ZYG A;  3BDD A;  4UV8 A;  2MBF A;  2PEX A;  2L4M A;  1K7A A;  4NB5 A;  3LA7 A;  4LG0 B;  3P9K A;  4PGG A;  2O61 A;  3HSE A;  4RB0 A;  1D8J A;  3BOQ A;  2JPC A;  4JK1 X;  3M1E A;  3BJA A;  4CGZ A;  1V3F A;  4YIF A;  1ZRD A;  1W7P D;  4G9Y A;  4MHG A;  5J8F A;  4M6Y A;  2R7F A;  2ADU A;  2RQP A;  4A0Z A;  4AWX B;  1S7O A;  2JT1 A;  4N0B A;  1FSH A;  2XAJ A;  4EJW A;  3WE2 A;  2L02 A;  2MC3 A;  4KIG A;  4RAY A;  5D5V B;  2WC2 A;  2L01 A;  1U78 A;  3GFM A;  3DV8 A;  2V1X A;  4NHJ A;  3I64 A;  2FSW A;  4Q48 A;  2UZK A;  2VBZ A;  1U5T B;  4UHT A;  4A12 A;  3FWE A;  1ZG5 A;  4HV6 A;  5DYM A;  1HKQ A;  2V1D A;  2HYF A;  1MDM A;  1TLH B;  3KCC A;  4PGH A;  3V8J A;  2P6T A;  3CO7 C;  1ODD A;  1RNL A;  3ZMZ A;  2BE5 F;  2EFO A;  1K78 A;  4IRH A;  2EFN A;  5DCM A;  3LFK A;  4A6E A;  1XSX A;  3H3Z A;  3FX3 A;  1IXR C;  2LSO A;  3RYP A;  4RGX A;  3GLX A;  5TJJ A;  2CFX A;  3TGN A;  3GVA A;  2ETH A;  5KVR A;  2Z33 A;  2HKX A;  3LST A;  1YYV A;  3QU6 A;  2P5V A;  1ZAO A;  1YG2 A;  1GHC A;  4I02 A;  1BM9 A;  5H6R A;  1FBU A;  1BOA A;  1ZHF A;  4ZZL A;  1JXS A;  2ISY A;  1FLI A;  4ZZD A;  1P92 A;  3O2P E;  2NRA C;  3GUD A;  1MZB A;  2PQ8 A;  3FMS A;  3HOS A;  4D0P A;  3MEX A;  3V7R A;  3FXR A;  4ENM A;  3BJO A;  2QEN A;  2X4H A;  1SD7 A;  3JAM K;  4Q5S F;  2HR3 A;  1O3R A;  2B0L A;  2K4J A;  1W5S A;  3SHF A;  5CVJ A;  5F6F A;  1QZY A;  1G3W A;  3ZP5 A;  4PCQ A;  3JTG A;  2E7X A;  3PQJ A;  2JSC A;  1B4A A;  4A0Y A;  1ULY A;  3R61 A;  2FU4 A;  4MTD A;  3KZY A;  1WWX A;  3K1N A;  5D5W B;  3ZN0 A;  2O3F A;  2E1N A;  3M9A A;  1BC7 C;  3CUQ A;  3GW2 A;  5L3E A;  4R1H A;  4AIH A;  3ZMU A;  3VOD A;  3ZQ7 A;  4U0Y A;  2FXA A;  2VBX A;  3GX4 X;  1LEB A;  2KRF A;  3VEP A;  1BC8 C;  2H09 A;  3DEU A;  2VOD A;  1MKM A;  3E3V A;  1I5Z A;  4QWQ A;  3HHG A;  2Z99 A;  4P5O A;  2MLK A;  5HDN A;  2OQR A;  3HIF A;  3TOB A;  5E8G A;  3B73 A;  3F8N A;  1DDN A;  4G6Q A;  3DFG A;  3D0S A;  3W6J B;  1QZZ A;  2A5Y B;  5FFZ A;  3TKY A;  1U5T A;  1WSU A;  2DFI A;  2W25 A;  1KU9 A;  2NS0 A;  5JFR A;  3F6O A;  2IPQ X;  3TDU C;  2ESN A;  3ISP A;  3QP5 A;  3F6V A;  3M7G A;  2HYG D;  5D5U B;  4HZF A;  3KP4 A;  5TRD A;  4YII A;  4P96 A;  3WTW C;  1TW3 A;  1E2X A;  2P4W A;  1F1Z A;  1TNS A;  3MCZ A;  1S7A A;  2QM3 A;  3BPV A;  2VE9 A;  2NNY A;  2V9V A;  1H9G A;  3U1D A;  4FX4 A;  1XMA A;  2QWW A;  3P9I A;  4ENN A;  1SFU A;  2VBW A;  3V4G A;  4ENK A;  3CUO A;  4I2O A;  3IWZ A;  1F9N A;  5BS6 A;  3KET A;  1D3Y A;  1FYK A;  5ILV A;  3RKW A; 
#chains in the Genus database with same CATH topology
 4BEH A;  1X1A A;  3V42 A;  4XRM A;  2AXL A;  3HYI A;  3G1O A;  1ZN2 A;  2IS6 A;  2BY2 A;  1OCC H;  1O7L A;  4FQG A;  1IF1 A;  1ACI A;  2Q0O A;  3QP6 A;  3RDI A;  3FK7 A;  1KQ0 A;  4LB6 B;  3K1P A;  1K4T A;  3M8F A;  2VQG A;  2IS1 A;  4M9Z A;  2XRL A;  1T33 A;  5D5X B;  4Y13 A;  1WQ2 A;  2DJI A;  5F1R A;  4Z6Y A;  3LFU A;  2NYX A;  2KJB A;  3OOP A;  4ABZ A;  1Z0X A;  2IT0 A;  3H9Q A;  3CMA I;  1JT0 A;  4WF2 A;  4CYC B;  1QQI A;  2YX7 A;  1QVT A;  1TP4 A;  4XRS G;  2L9S A;  4XK4 A;  3KP7 A;  3PFY A;  3ZPL A;  5FD5 A;  5K7Z A;  3RYR A;  3CC2 I;  2YU3 A;  1RUO A;  2R7Z J;  2VAS A;  2JJ7 A;  2CH0 A;  2XGE A;  5IOZ A;  4PFO A;  3J81 K;  2K3P A;  2VQC A;  3S17 J;  3ULQ B;  4HOB A;  3I4M J;  1M1E B;  5GAE J;  1JT6 A;  4ZYD A;  1WJD A;  2RC4 A;  3OS2 A;  4EJT A;  2DMU A;  3K4J A;  5F08 A;  3SJM A;  2BVM A;  2FOW A;  1YS6 A;  2IJL A;  2LR8 A;  2BHZ A;  3KFW X;  4GCV A;  4ASN A;  4S04 A;  1XMK A;  5CYV A;  2XSJ C;  1K6O A;  1KQ8 A;  1NH3 A;  4XKV A;  1MD0 A;  5KNL A;  3ZMV A;  2PMH A;  2HOT A;  2EIN H;  3BZC A;  3GO5 A;  3H3U A;  2ESH A;  3WGH A;  1UMQ A;  3Q5F A;  1QRY A;  5FGM A;  1BJA A;  2W84 A;  4NC6 A;  1IUF A;  1JTX A;  4OAZ A;  4CCO A;  1HST A;  1EH6 A;  2E1M C;  3IP4 B;  2LKX A;  3F22 A;  3WTT C;  3EPZ A;  2QQ8 A;  5HOO A;  1YO5 C;  1J5Y A;  1KU7 A;  2F5F A;  4LOC A;  3FKJ A;  5DD4 A;  2LF8 A;  3S3M A;  1NK3 P;  1P7I A;  1VQ5 I;  2OF7 A;  3TO7 A;  2M45 A;  3L2U A;  1NHA A;  2V9P A;  1UAA A;  2VJI A;  4KN7 X;  3FHN A;  3IHU A;  4U0W A;  4KUM A;  5E17 F;  5LGT A;  4F93 B;  1CQT A;  4HDU A;  1B9N A;  1YIT I;  4JX4 A;  2XGX A;  2NXN B;  4GXO A;  3NAR A;  1XB4 A;  4HLY A;  4BAC A;  1IGN A;  2MC4 A;  3H0G J;  1Z67 A;  4IHV A;  3FXJ A;  2ZFW A;  3I9V 2;  1LJ9 A;  1SAX A;  1Y8R B;  2LH9 A;  3BR2 A;  4HW0 A;  3S14 J;  4I0A A;  1V5E A;  3EYY A;  1U8B A;  4CCM A;  1RZ4 A;  3RCO A;  4IL6 C;  4JX5 A;  4XID A;  3GZN B;  1LNW A;  4EJU A;  3HKZ N;  2EK5 A;  2O03 A;  4OIP F;  5FKN A;  5KHD A;  3T0Y A;  4A3G J;  4GYI A;  2IA0 A;  2VIX A;  5FKM A;  4IRG A;  5GAD J;  4BQQ A;  4EQQ A;  4FCY A;  1D1A A;  1JUS A;  4IPA A;  2MA3 A;  1OCR H;  5ED4 A;  3G3Z A;  4BQN A;  2IGO A;  2COB A;  5EZG A;  4Z2Y A;  1MBH A;  4L9J A;  1UHS A;  3JRA A;  1GXP A;  3PUB A;  1R9T J;  2IEK A;  2JA2 A;  3FM5 A;  3G1L A;  3X2Q H;  1ZH5 A;  4OMY A;  4EV0 A;  1MND A;  4A5M A;  3MKL A;  4BS9 A;  1ZRE A;  1WKM A;  5M3M J;  3CCL I;  3RPU D;  1X3U A;  2ZJ2 A;  2CFO A;  3HKZ A;  5BOX A;  2X1D A;  2HVS A;  1JHH A;  1RPW A;  4PJJ A;  3LQR A;  3OS0 A;  1SD4 A;  2GA1 A;  1WJE A;  1SC7 A;  1XCV A;  3C18 A;  5DUI A;  3QOP A;  3LSM A;  4M72 A;  3BWG A;  2FBI A;  2H1K A;  3I4P A;  2QSF X;  5J3L A;  2DAO A;  2EA2 A;  1FC3 A;  1IXC A;  2M4G A;  3NWS A;  1R5H A;  3FK6 A;  2KDZ A;  2LY1 A;  1MNM C;  3F8M A;  1WHU A;  4XL9 A;  4DIQ A;  2Z2S B;  1O3S A;  2M9H A;  2FQ3 A;  2P5K A;  2XPW A;  3QPT A;  4BQA A;  1VQO I;  1MBF A;  2CUF A;  5BQT A;  2K9Q A;  3D1N I;  3IRQ A;  1GV5 A;  2K9M A;  3ABU A;  1MJB A;  5IYB J;  2PJR A;  1U3E M;  3A4C A;  3GFJ A;  5JVG F;  3M1C A;  4WXC A;  5B1B H;  5HS9 A;  2ZCW A;  1K83 J;  1ON1 A;  3ZRG A;  4KN4 X;  3GZ5 A;  2VXZ A;  4A2U A;  3DKX A;  3Q0V A;  1W1W E;  3HTU A;  2R3S A;  2W82 A;  5JVT A;  1VQ7 I;  2JUG A;  1HSJ A;  3GF2 A;  1ZLJ A;  2X85 A;  1MSE C;  5EGO B;  2KT0 A;  3E97 A;  3Q9V A;  2DMN A;  4ZYE A;  3JRC A;  3BTL A;  2OD5 A;  2MD0 A;  2Q2E B;  1O3T A;  2VT2 A;  5F0C A;  2DJN A;  1QA6 A;  2DI3 A;  5J4Y A;  3HEF A;  2AS5 F;  3U1K A;  3HJE A;  2CG4 A;  2DDA A;  2ID6 A;  2M0C A;  1MBE A;  1ZR2 A;  5E3L A;  1ZQ3 P;  4J00 A;  2QF7 A;  1LDD A;  2KZV A;  2GIV A;  1F4K A;  1W36 C;  4KYW A;  3ZMS A;  4I0B A;  3GFL A;  3IV5 A;  3F8F A;  4OMZ A;  2CJJ A;  2BXY A;  1F5T A;  2L9V A;  2PMU A;  1BOB A;  1AWC A;  4FT8 A;  2IGM A;  3Q3S A;  2YR2 A;  3HZJ A;  3IAS 2;  3UKG A;  1Z9C A;  4BJ5 C;  3BG5 A;  4TV7 A;  3RIR A;  1TTY A;  2LD5 A;  4KIF A;  5EDN A;  1Y1W J;  1U0J A;  4ZH4 F;  3F0C A;  1SEU A;  1ZKG A;  4J19 A;  5L3D A;  2HOA A;  3RJP A;  1AOY A;  4EAT A;  2JVG A;  5CQG A;  1DPU A;  4CZC A;  1T0F A;  5EYR A;  4WCG A;  3PIP F;  3A1Y A;  1QPI A;  1E17 A;  4B48 A;  5AIQ A;  3I0T A;  1X1D A;  3KP2 A;  5DTD A;  3TW7 A;  5LBQ A;  2N8G A;  1UHM A;  4RLF A;  3KZI C;  4Y15 A;  3K4L A;  3H92 A;  1Z77 A;  1VF9 A;  2L54 A;  1ZAR A;  1GUU A;  5EEH A;  3BTI A;  3R0J A;  1IAW A;  1JE8 A;  5A2Q K;  4RB2 C;  2H6B A;  1N77 A;  2NVT J;  4P55 A;  2EV0 A;  3D5R C;  3K0L A;  2OCE A;  3IKV A;  3W2V A;  1VQP I;  3W6K B;  2DPD A;  3KEY A;  4BQO A;  1G3T A;  1REP C;  2CGP A;  4LLG F;  1XMX A;  2P8T A;  2JN6 A;  3HOZ J;  4LFU A;  1Y1V J;  1AKH A;  2DMT A;  2XAU A;  4G7Z F;  5IYC J;  3BG3 A;  3QYF A;  1MGT A;  2M7B A;  3OYE A;  4I09 A;  3OWT A;  4PFP A;  3HXL A;  3F72 A;  1HW2 A;  5CVI A;  5BNG A;  4EM1 A;  3CCR I;  4DJA A;  4EM0 B;  1FMV A;  1G4D A;  1KU3 A;  3J81 Z;  3MZ8 A;  2IVM A;  1WH5 A;  4BHP A;  1JKP C;  1OYY A;  2LYC A;  2R7X A;  1S6L A;  3REO A;  3MZH A;  4RS8 A;  2X1E A;  2CW8 A;  3EDP A;  1W7P B;  1XS9 A;  4ESJ A;  2IA1 A;  1LUJ B;  3CJR B;  4U0V A;  2KIM A;  1U8R A;  1I3A A;  9ANT A;  2FJ1 A;  2E5N A;  1XSV A;  4DZJ A;  2WAE A;  1HC8 A;  3EUH A;  3B6A A;  1OCP A;  2Y2Z A;  4CCJ A;  2ZO4 A;  2BEO A;  2BV6 A;  2CS3 A;  2FD5 A;  3IL2 A;  1ZGA A;  2QBY A;  1IN4 A;  4GRI A;  1O57 A;  2HZD A;  3DQV C;  3WG9 A;  2W00 A;  2KDO A;  3CTA A;  3ZQC A;  2XF6 A;  1EH8 A;  2WAQ N;  5B66 C;  3MFK A;  4E7K A;  2CV0 A;  1UG0 A;  2R7R A;  1UZC A;  2JZY A;  5IPA A;  2J5P A;  3SEQ A;  3WE3 A;  1OQY A;  2GLO A;  1MMN A;  4DOZ A;  2ZSH B;  5LD2 C;  2BBY A;  2R7D A;  3GTG J;  4FX0 A;  1G3Y A;  1R58 A;  2E2J J;  5FRN A;  3SZG A;  2KIU A;  2K9S A;  2GAU A;  2L9N A;  1MBG A;  3CZ6 A;  1S8N A;  1SAN A;  3IKT A;  4UV9 A;  3L2R A;  4RB1 A;  4Y3O A;  3OYF A;  3NAU A;  1I6H J;  3DBL B;  3E5X A;  1AHD P;  4XBF A;  3QQA A;  5E18 F;  4DBQ A;  4XLP F;  2VLA A;  4BDY A;  1R00 A;  1IO2 A;  1G6N A;  4BKX A;  4FE4 A;  2M4K A;  2WAQ A;  5D8L B;  2P81 A;  4PSW A;  4RGU A;  2C6Y A;  1P9Q C;  5HLT A;  1VTN C;  1J75 A;  1OMI A;  1YS7 A;  2V7F A;  5GTI C;  5E20 A;  4DYQ A;  1WCM J;  2CUZ A;  3RKQ A;  1BR2 A;  2MLG A;  4ZDP A;  1IW7 F;  5D6F A;  4L9T A;  1FTT A;  1ETQ A;  4RLQ A;  2O8X A;  1KYW A;  4F3Q A;  2H27 A;  6PAX A;  2OCC H;  2E5Z A;  3QAH A;  1PP7 U;  3ESW B;  1U9O A;  2A6E F;  3LSH A;  3OYL A;  3L09 A;  1MH3 A;  2VOP A;  2W48 A;  4HF0 A;  2BGC A;  2M34 A;  2VPR A;  3CDH A;  1R1U A;  3H9G A;  3KP5 A;  4M3G A;  2CQK A;  3JSO A;  1IZ1 A;  5ICC A;  4FAS D;  3J7Y J;  1R5G A;  2VL8 A;  2HU9 A;  2OTJ I;  3ECH A;  4YEL A;  4LG0 A;  2G0E A;  5HDG A;  4HV5 A;  3BT9 A;  1PDN C;  2DOD A;  2CMP A;  2D1H A;  4BBS J;  4EGY A;  3BJ6 A;  3RTR A;  3PIO F;  4R79 A;  4E7S A;  1SFK A;  2WTE A;  4XN0 A;  2YPR A;  1Z91 A;  2H8W A;  2JRT A;  3K4C A;  2VBY A;  2ZJP F;  2Z1D A;  1VQM I;  4B44 A;  2BY1 A;  1G8X A;  3H9J A;  3TBI A;  3J7A Y;  4ETS A;  3V8K A;  3UR3 C;  2MG4 A;  2RDP A;  2VN2 A;  3DF8 A;  3PNY A;  3HHH A;  2W24 A;  3L9F A;  3Q0W A;  4MEY F;  5L3B A;  3E6B A;  3JTH A;  1B1B A;  1XCB A;  2NNN A;  1MIJ A;  3T1B A;  5BPI A;  2KP6 A;  3S1M J;  2Q1Z B;  2R4G A;  5L3G A;  1FSE A;  3O6B B;  3NRV A;  4A5N A;  5HLG A;  3S3N A;  4I01 A;  3BLY A;  2DU9 A;  2HQA A;  4ITV A;  4MO7 A;  2ZXI A;  3GBG A;  1KYZ A;  4CDG A;  1BW6 A;  3LMM A;  3TED A;  1GV2 A;  5C44 J;  2LTP A;  3DPL C;  3OIO A;  4AVZ A;  1SVM A;  2XAG A;  3I59 B;  4DBR A;  4RB3 C;  4EM2 A;  4BH9 A;  4E6K G;  5FO5 A;  2HS5 A;  1A36 A;  5EEG A;  3PUF A;  1Q1V A;  2XPV A;  2LOO A;  2R7V A;  2DFH A;  4N4O B;  2QGU A;  4BJT A;  2X1C A;  1GXQ A;  3IUO A;  1I50 J;  2E60 A;  2KIS A;  3RPQ A;  3OY9 A;  2LBF A;  2XKP A;  5K5R A;  1HOM A;  3RKX A;  4GFB A;  3EQL F;  2ZC2 A;  5FLM J;  4LK0 F;  3GTM J;  2UUZ A;  3BZK A;  1QO0 D;  4HST A;  3BCA A;  1OR7 C;  1FEX A;  3FDY A;  5D4R A;  3ERE D;  1WZ2 A;  4MQ9 F;  2V1U A;  3FIW A;  2GBY A;  1VQ4 I;  2DMQ A;  2OU2 A;  3JW4 A;  2OA4 A;  3ZXS A;  4A69 C;  5ILU A;  4KDP A;  4A3C J;  3CJN A;  2DTR A;  3BR6 A;  4C9Y A;  1R5I D;  5FD6 A;  5J1Y A;  1WJB A;  3CLQ A;  2LRE A;  4ZDL A;  4M3B A;  3S1Q J;  5K5O A;  3TO6 A;  2I5U A;  3DXJ F;  5HVQ C;  1DP3 A;  2VKH A;  4CCL A;  3WU2 C;  1YJ9 I;  1K61 A;  2LK2 A;  1MBJ A;  2RV8 A;  2ZME B;  4G7H F;  2LKP A;  2UWM A;  1TQI A;  5GAH J;  4ON0 A;  3GTK J;  2K9L A;  4E7L A;  3DLL F;  4DYR A;  2QZ8 A;  4QPO A;  1OJL A;  3BP8 A;  3WHC A;  1USS A;  1S7E A;  3B02 A;  3DPT A;  1OYW A;  2HZT A;  2JTV A;  4XSX F;  5ERI A;  1S3J A;  2WAD A;  3WGG A;  1YW8 A;  3N05 A;  3AAF A;  3HRU A;  3KLO A;  3M8E A;  3G2B A;  1PUE E;  1A04 A;  3N97 A;  3TP0 A;  3HRS A;  4LIV A;  4Q47 A;  4M74 A;  3HL2 A;  3CP8 A;  2CYY A;  1VQ8 I;  1NK2 P;  1KQ9 A;  2OJE D;  3K70 D;  3LWF A;  2ZXH A;  2QYO A;  2ZNY A;  3TO9 A;  5A2Q Z;  4HDV A;  4GO1 A;  1LFB A;  2ELJ A;  2L7Z A;  2R92 J;  2G7U A;  2X9D A;  3E5Q A;  4F7Z A;  2EZI A;  1LE8 B;  2G9W A;  1YJN I;  1BN5 A;  1B9M A;  2V6C A;  1UEL B;  4DGW B;  4M71 A;  2L4A A;  5TIS C;  2M1B A;  5CVV A;  2X6W A;  3HUG B;  3NWT A;  1ITY A;  3I5U A;  1ZRF A;  4CZZ A;  2M2E A;  3L2V A;  2AXT C;  3HPH A;  3DLA A;  4D9J A;  1TNT A;  1BI3 A;  1A31 A;  4HSR A;  3T8T A;  3CF5 F;  4N9H A;  2VJ4 A;  3CMM A;  5K7F A;  1J59 A;  1MNE A;  4XIC A;  2E7W A;  5KAF C;  2L7K A;  2RVC A;  1CGP A;  2ACJ A;  4F55 A;  2L9R A;  3HTS B;  4F92 B;  3E5U A;  2HNH A;  3OYK A;  2ZBK A;  3HBL A;  2L3D A;  5B1A H;  4CCK A;  3K10 A;  2CUE A;  4PZJ A;  1XDU A;  2A6T A;  3ZN1 A;  5J6X A;  4ZDO A;  4B3A A;  2XRO A;  3TMO A;  2DFE A;  2ZFU A;  3A01 B;  1SFE A;  3AKZ A;  3FZV A;  1YIO A;  1IRG A;  4N4N B;  1IUY A;  1TWC J;  1QVU A;  1WGX A;  2LMD A;  1X19 A;  2RNJ A;  4JX6 A;  1YLF A;  2L2O A;  4W97 A;  4Y17 A;  1DGR M;  2DT5 A;  4BJ6 C;  5LHH A;  4M73 A;  1JKR C;  1NG6 A;  1ZYR F;  3L7W A;  3OYB A;  2OQG A;  3OYI A;  4CSW A;  4UUV A;  1HXD A;  1I1S A;  4UVC A;  2BY0 A;  4UVB A;  4KT5 C;  2GM4 A;  4LB5 A;  3C2H A;  4S05 A;  1ZGW A;  1FPQ A;  1I1G A;  1YE9 A;  2R5Y B;  5LHI A;  4C3I J;  2AQF A;  4OIO F;  3SYT A;  2OTL I;  3VFZ A;  2XAQ A;  5EG0 B;  1P2F A;  1MMG A;  2BZT A;  1W0U A;  3EET A;  3CP2 A;  1S72 I;  3IC7 A;  1FWZ A;  4QIW N;  2B63 J;  4OWR B;  4UB6 C;  1E3P A;  4FHT A;  3ABL H;  3M4O J;  4O5V A;  1OYI A;  5DM6 F;  2ZNZ A;  4XRS A;  4X6A J;  2GQQ A;  4Y33 A;  4RDU A;  2K86 A;  1IC8 A;  2PI0 A;  3HB9 A;  4IHS A;  4PDK A;  4RAG A;  1UFM A;  2LY2 A;  3P9C A;  3K69 A;  2G7H A;  3CCM I;  4JBA A;  2Y9Z A;  3OYJ A;  1TT0 A;  5FRO A;  2E71 A;  3T5X A;  3OYG A;  4IRI A;  3FXO A;  5DCF A;  4XNF A;  3GTQ J;  4HYE A;  2HI3 A;  2LVS A;  4L0Y B;  4UNO A;  3OV8 A;  1FP2 A;  1HCR A;  2JA8 J;  3ZQF A;  2COM A;  2ID3 A;  4DW6 A;  2WAF A;  5HS7 A;  4AIJ A;  1QBJ A;  2HTS A;  4UUS A;  2W57 A;  1YRN A;  1LDK B;  1V5F A;  1HBX G;  3HOW J;  2FMY A;  3AG2 H;  3JAM Z;  1RKT A;  2F4O B;  3V8L A;  2XIG A;  2ELH A;  2VJJ A;  4XLH A;  3BG9 A;  4BU2 A;  3G73 A;  3CLO A;  2ICW G;  5GP9 A;  3VYR B;  2QQB A;  2HQR A;  5LLQ A;  2FOK A;  2IS2 A;  3MKZ A;  4LD5 A;  1R1T A;  3SXY A;  2CW7 A;  4MFD A;  2HVQ A;  2R7Q A;  2E1C A;  1V55 H;  3FM3 A;  1ETX A;  3NEU A;  2FQ4 A;  2PFB A;  4KJZ A;  5E79 C;  3LL7 A;  4HX8 A;  3W3C A;  3WTZ A;  4LMY A;  1FBS A;  3ZQG A;  1PJR A;  3BR1 A;  2TRT A;  3DWL E;  1NG7 A;  1BI0 A;  3T8R A;  5LEK A;  1K79 A;  4IF4 A;  3LAP A;  4IO9 F;  2FBK A;  4CH7 A;  3FXL A;  4A3I J;  4X1E A;  2A5W A;  4RAZ A;  3WOD F;  5F1J A;  4HG2 A;  4BE1 A;  2E35 A;  2NAZ A;  3L00 A;  1MW7 A;  2HDD A;  1BJZ A;  4MGR A;  4MQV A;  2ZXJ A;  4XLF A;  1J2X A;  1X58 A;  1KON A;  2BHY A;  3JRH A;  2FNP A;  3WTV C;  1TC3 C;  2J5O A;  3CO6 C;  2CW0 F;  5H2F C;  1JJ8 C;  2XGC A;  4KA4 A;  3VSK A;  1JHF A;  2DOA A;  1LVK A;  2EFW A;  1MH4 A;  5JI6 A;  2ZME C;  1K78 B;  2O0Y A;  1WJC A;  2YX4 A;  3O3K A;  4E7Z A;  1IG7 A;  1UST A;  4DZP A;  1UHW A;  1LE8 A;  2XPU A;  1BI2 A;  3BQY A;  4ENJ A;  2VC0 A;  5DCM B;  1ZGJ A;  2NS7 A;  4PJM A;  1XG1 A;  4B09 A;  4IJA A;  1Z6R A;  1H89 C;  3CCV I;  2WV0 A;  3A03 A;  1S29 A;  5DEQ A;  4V2F A;  3WTX C;  3OS1 A;  2D1V A;  4EJV A;  4LIT A;  1Y8Q B;  4V2G A;  1YW9 A;  3FMQ A;  4MNU A;  3HOT A;  3OYA A;  4HNV A;  1EH7 A;  4RBO A;  4XKC A;  4J01 A;  2OZU A;  5E1Z B;  2L7F P;  4CYC A;  4L18 B;  2JK3 A;  3K4N A;  2QLZ A;  2PMZ N;  2XB5 A;  3TL4 X;  3K2Z A;  1FIA A;  5H6Q A;  1HDD C;  4NQW B;  2DTZ A;  4YIR X;  1P4A A;  3FKI J;  3AG4 H;  3SDB A;  1TWF J;  2JA7 J;  2A07 F;  2UXX A;  1EF4 A;  3C3W A;  2D2W A;  2IXS A;  2I10 A;  1FNN A;  3J80 K;  4YEJ A;  3MZY A;  3F8C A;  2IA2 A;  3PSI A;  2XHK A;  3BQZ A;  4ZYA A;  3ZMD A;  4B4C A;  2CO5 A;  3OR1 C;  1YQA A;  2A6H F;  4XMY A;  3V7S A;  1L0O C;  3CJQ B;  4EVI A;  1L3L A;  2OZ6 A;  1T38 A;  2JA5 J;  4A0X A;  1H8A C;  4YFX F;  4U7D A;  4L5I A;  4R8H A;  5J47 A;  4BDZ A;  2Y48 A;  2YU9 J;  3ZCO A;  3C1D A;  2QVO A;  3FHZ A;  2AHQ A;  3OYH A;  3R4K A;  4BE2 A;  3GYH X;  4KFC A;  2K7L A;  3ZGK A;  3GXO A;  3OL3 A;  2PMZ A;  4QLC U;  4ESB A;  5IT3 A;  2YSR A;  3K4B A;  5CJ9 A;  3HGY A;  5C4X J;  1X3W B;  3FIS A;  2HOE A;  2X48 A;  1ZLK A;  2VKD A;  3I71 A;  2LY9 A;  1TWA J;  1JGS A;  5IP7 J;  2ECC A;  5ICF A;  3ZQI A;  2F2E A;  2M87 A;  4HQE A;  3RZD J;  2DOF A;  4A3F J;  4XLC A;  3COA C;  5EG0 A;  1VQ9 I;  3JCU C;  1WJ5 A;  4XR6 A;  4IOC F;  1TQM A;  4IHX A;  3MN2 A;  4WX9 A;  3W2W A;  4XN3 A;  1WH7 A;  4F91 B;  3W2A A;  2FBH A;  3TQN A;  5F04 A;  4EMS A;  4CIC A;  4I76 A;  4P9F A;  2HYJ A;  5F27 A;  4XQF A;  2XVC A;  2Y0S N;  4N9I A;  1LB2 A;  4I7H A;  4EGZ A;  5IOY A;  1LVA A;  1PUF B;  2IGN A;  2RQQ A;  4XSZ F;  2FE3 A;  2WWY A;  5IYD J;  3SQN A;  2Z5U A;  2FA5 A;  4C3H J;  2H1L A;  4RM3 A;  2DW4 A;  1A35 A;  3CUQ B;  5C4J J;  3E6D A;  1HLV A;  3L2Q A;  3MVP A;  4C2U A;  4BYY A;  3F21 A;  5DUK A;  2KZG A;  3S8P A;  3L2W A;  2OAZ A;  4LG3 A;  4BAY A;  2VOO A;  2VI6 A;  3FXM A;  2XRN A;  1B6A A;  3FBI B;  2GXG A;  1Z7U A;  4HF2 A;  4M3D A;  5BMZ A;  1A6I A;  2KHM A;  2HEO A;  1Z05 A;  4KIB A;  3PSF A;  1R4M B;  4HNT A;  2O6G E;  1B72 B;  5KCM A;  1J0R A;  1D0Z A;  1TWH J;  5E3M A;  1OIS A;  4PJN A;  2EB7 A;  3DTI A;  3M8J A;  3OSG A;  2Y0S A;  3UNG C;  1VQL I;  3K2A A;  2GWR A;  3WTY C;  1ERD A;  1JJ6 C;  5J8C A;  4BY1 J;  2RRE A;  4L5E A;  3GTP J;  4L0Z B;  3WHB A;  5HLI A;  1POG A;  4AIK A;  3CC4 I;  3DKY A;  4II3 A;  2DA6 A;  1DP7 P;  4JQF A;  4O6J A;  2F48 A;  4Q4Z F;  4A93 J;  2HTJ A;  5KAI C;  3RQ4 A;  5BPD A;  3BTJ A;  4EEF G;  1D5V A;  2FRH A;  4OAY A;  1JI8 A;  2K4B A;  2IGK A;  3HSF A;  3LSJ A;  2E1O A;  4X0G A;  1IV8 A;  2KJC A;  5ILS A;  2R5Z B;  2LNB A;  3J7A O;  1QNT A;  2YS9 A;  1Y39 A;  1ZR4 A;  4IXA A;  2WB1 A;  5JHF A;  3ABT A;  5IP9 J;  3QOE A;  3GTL J;  1TZL A;  4BXF A;  2BYV E;  3LSR A;  1EKE A;  4E7J A;  3GCM A;  3RQI A;  4IQ4 A;  4CYD A;  2OPT A;  1IXS B;  2EV6 A;  3HPG A;  2D45 A;  3JRB A;  2V4J C;  2MH2 A;  3ECO A;  4G8X A;  5CLS A;  3AL0 B;  1GLN A;  2DBB A;  2O9L A;  1RES A;  4O3M A;  5IT9 K;  4DQ2 A;  2A61 A;  2X6O A;  1K6Y A;  5HDK A;  3SEZ A;  3JR9 A;  3CCE I;  3R6S A;  1F43 A;  2CRG A;  2EA4 A;  3MWM A;  2RGV A;  3C2B A;  5ICG A;  4UVA A;  1J09 A;  4MEX F;  2DXI A;  2DK5 A;  5CVR A;  3HM5 A;  2DK8 A;  3JRF A;  4PJ0 C;  2NS8 A;  3WU0 A;  2M8G X;  4JOM A;  3MAJ A;  4OU0 A;  3BRO A;  2BOL A;  4C2T A;  3FXQ A;  2GIZ A;  1XN7 A;  1Q1H A;  1SD5 A;  3VPR A;  3CQZ J;  4D1Q A;  2V79 A;  1ONV A;  1J9I A;  3LSI A;  1O3Q A;  5GPA A;  3L1P A;  2VJ5 A;  4M6X A;  3CCQ I;  5F0H A;  2ECB A;  1IN5 A;  5HS8 A;  4H0E A;  2Q8K A;  1UCR A;  2HVR A;  4HQM A;  1J7K A;  3RPU A;  3VSL A;  2E34 A;  2P7C B;  5ICE A;  4HEA 2;  5EGO A;  2EQR A;  3JRI A;  3DU6 A;  3GTO J;  4IVN A;  2ZXW H;  2RN7 A;  3BY6 A;  4NQW A;  3HRT A;  2DQR A;  2LF7 A;  2Q2E A;  5C3E J;  2XKO A;  4A3E J;  3U9G A;  1X1C A;  2VKE A;  2GZW A;  3E6M A;  3ZQH A;  4E4H A;  3CC7 I;  3DCF A;  4S0H B;  1XPX A;  1BIB A;  5CVU A;  3VDX A;  2K27 A;  2R7O A;  4C3J J;  1DGW Y;  4UXN A;  1V4R A;  5EZH A;  4BEH B;  3TP3 A;  2FEZ A;  1X2N A;  2L7M P;  1WRJ A;  3DP7 A;  3QU3 A;  2VE8 A;  1HW1 A;  3R60 A;  3HOV J;  2DO7 A;  4NUB A;  4BXU A;  1IRF A;  3DEW A;  2R7T A;  5B3S H;  2KIF A;  1XDS A;  3EUA A;  4GGG A;  1ENH A;  4BNC A;  3BR5 A;  1PYV A;  3VWB A;  4M9S A;  3G4S I;  3QRF F;  1IRZ A;  2OV7 A;  1ZK8 A;  1KU2 A;  2CWE A;  3S2W A;  3HRM A;  4IHW A;  1CF7 B;  1KA8 A;  2QUF A;  3DEE A;  2K3F A;  1OLT A;  3TDZ C;  5IY5 H;  3GTJ J;  1KZH A;  3OYC A;  3E7L A;  4I98 B;  4NC8 A;  5FFX A;  1YHQ I;  1IN8 A;  3QYB A;  4LIU A;  2M8E A;  1SMY F;  4P9U A;  3F23 A;  2PLY A;  3HC7 A;  1ETW A;  1FYM A;  2EWN A;  1HKS A;  4IQJ A;  1YJW I;  2DYR H;  3FXK A;  3V7C A;  1W5C C;  1S9H A;  1FT9 A;  4LJZ F;  5DM7 F;  3HSR A;  2PJP A;  2WV1 A;  2JSP A;  4K2E A;  4OIN F;  3PNT A;  2KPM A;  1ETO A;  4LLL A;  1P6R A;  3QOD A;  3BR3 A;  5HOD A;  5D8K B;  1VQK I;  2X6Y A;  4B1R A;  4CXF A;  4A6D A;  5F0F A;  1MJA A;  1GVJ A;  4B43 A;  2EV5 A;  2LDU A;  2EFQ A;  3E1S A;  2RKH A;  5DD8 A;  1OR7 A;  2CQQ A;  3K1M A;  1SFX A;  3ONQ A;  2ME0 A;  3OMY A;  2HKO A;  1D5Y A;  1JUM A;  4BL0 B;  3ABK H;  3LA2 A;  3MD2 A;  4B8X A;  5HNH A;  5LRS A;  3IWF A;  4ZYH A;  4A3K J;  4BY7 J;  2QQ9 A;  2A05 A;  2GA2 A;  3VYS B;  1P4X A;  1QPM A;  1E3O C;  2EZH A;  3GME A;  1O7F A;  3D5L A;  4PUS A;  4WXD A;  4CHU A;  3KEO A;  2EPF A;  1PP8 F;  3C2G A;  1MSF C;  2LFB A;  3CUQ C;  1EV7 A;  5LRR A;  2KRH A;  4JP0 A;  3J80 Z;  2PG4 A;  1R22 A;  1T2K A;  3KZZ A;  4MFE A;  5HLH A;  2JRM A;  5L3C A;  4XLN F;  2Z9O A;  3H35 A;  2P7V B;  1ON2 A;  2V26 A;  3WU1 B;  1W7P A;  2K9N A;  1LEA A;  2F6C A;  2IRF G;  1UB9 A;  4WK8 F;  2F5C A;  2OBP A;  1FOK A;  1F36 A;  1WFX A;  3VYT B;  5K7H A;  4I6Z A;  3KYL A;  4HX7 A;  5CKT A;  2W1O A;  5L3F A;  2GOX B;  1FP1 D;  3WTS C;  2QQA A;  5FLX K;  3G6E I;  1G3S A;  4UUT A;  3AG1 H;  3OOU A;  3E6C C;  2P0W A;  1D0X A;  3DBH B;  1DU0 A;  2CQN A;  4MTE A;  4GYG A;  4PSX A;  5AON A;  2R7W A;  2H6C A;  4IZZ A;  3K4M A;  2NOJ B;  4HLX A;  4HAM A;  5GPC A;  3CCS I;  3BTC A;  3K9T A;  3SZP A;  2HPI A;  1O4X A;  4M3F A;  3MKW B;  1HKT A;  2HGC A;  1W5T A;  1XD7 A;  1FX7 A;  3K4K A;  3S93 A;  2R7S A;  3ML6 A;  4RGR A;  2IAI A;  3BPX A;  4RGS A;  2O8K A;  3J7Z I;  4Y52 J;  1U5T C;  2F5D A;  3S1R J;  1U6G A;  4FET A;  4OIR F;  2YUS A;  4D5C A;  3S32 A;  2VQH A;  5JLX A;  3BR0 A;  4HX4 A;  4RA2 A;  3AL0 C;  3S1N J;  4XRF A;  1QHH D;  3LSK A;  1YX5 A;  4M9X A;  3M07 A;  2EZL A;  1XX5 A;  2PN6 A;  1G2H A;  1T95 A;  4HPQ A;  2XSD C;  3ERM A;  2H94 A;  3S2H J;  2UXN A;  3HGG A;  1ZG1 A;  1DPR A;  2XV4 S;  1R23 A;  2Y31 A;  3GWZ A;  2LC2 A;  1IN6 A;  4KNY A;  2HXO A;  3CME I;  2HQN A;  3RI4 A;  3A02 A;  1XSD A;  2JMW A;  5FKO A;  1QHG A;  5TGT A;  3S16 J;  1JKQ C;  2STT A;  4C2M J;  1PVE A;  1YI2 I;  1FMW A;  3KE2 A;  1QU3 A;  2EJR A;  2BXZ A;  2Y75 A;  1Z6T A;  3QPH A;  4AVP A;  2L0K A;  1BR1 A;  1N78 A;  2DMP A;  4RAF A;  2KRC A;  2LLK A;  3CD6 I;  3IRR A;  2GXA A;  2PJR B;  4RMN A;  4WXH A;  2CU7 A;  2HDC A;  1SD6 A;  4BHB A;  4KIT B;  1BBY A;  1FTZ A;  3I55 I;  2DLL A;  2CQX A;  1R1V A;  2M5W A;  4QPQ A;  2EH3 A;  1CF7 A;  4A3B J;  3PQK A;  4ESF A;  2XUB A;  3SFZ A;  2HFH A;  4ZC3 A;  2BW3 B;  2M3A A;  4XM3 A;  1R7J A;  1T98 A;  1LQ1 A;  1U2W A;  4RM2 A;  5IT9 Z;  2MSY A;  2QKM B;  4HBL A;  3OSF A;  2CSO A;  3I58 A;  3MQ0 A;  3FF5 A;  4NBQ A;  4P1W A;  1WPK A;  4BHC A;  4G94 A;  3CCU I;  4KIS A;  3GEZ A;  1YTY A;  2XDV A;  2ISZ A;  2EIK H;  5M3F J;  1TQP A;  4D5F A;  2IS4 A;  2MH9 A;  1MJ9 A;  1RIO H;  4YFK F;  2CV2 A;  4AU7 A;  1OCO H;  1XGM A;  1RI7 A;  2IBD A;  2VON A;  2A68 F;  5LGU A;  4XOP A;  2NVU B;  5J4V A;  4U7B A;  1LFP A;  1BIA A;  2UV1 A;  2XAF A;  2IP2 A;  3ROU A;  5EJC A;  2XAH A;  4WWC A;  2QKL B;  4CO8 A;  1ZRC A;  2R0Q C;  4OIQ F;  2FML A;  1P4W A;  4IHT A;  3FMR A;  1X4P A;  3GZ6 A;  1LPQ A;  2W85 A;  5H20 A;  5E1X A;  2PBI A;  1LDJ A;  2X0L A;  3C7J A;  1BW5 A;  1YW7 A;  1IN7 A;  1OKR A;  3LAJ A;  1TBX A;  2DOE A;  2XGD A;  3I59 A;  1OPC A;  3RKY A;  2FF4 A;  2AO9 A;  5LEJ A;  1YFH A;  2JQ7 A;  1QZE A;  4E70 A;  4IHY A;  4G7O F;  1X1P A;  3DKW A;  4M6V A;  5CQE A;  3OYN A;  4HA8 A;  3SZT A;  2B9S A;  1VQN I;  1YX3 A;  2PX9 A;  1Z1D A;  2JPB A;  2GXB A;  1RUN A;  3FBN B;  2HQ5 A;  2VT3 A;  4YFN F;  2VKV A;  4E7I A;  3HDD A;  4LLN A;  3KX2 A;  2A69 F;  3ZMT A;  3QPL A;  1XGS A;  4DNC A;  1T39 A;  3H0D A;  5E8I A;  1KGS A;  2K40 A;  3BG7 A;  3NQO A;  4L9N A;  3P5J A;  1XTA A;  1GT0 C;  1DQU A;  3KEQ A;  5LFA A;  3G1M A;  3HOU J;  1ETY A;  3I3L A;  2XB0 X;  3TOA A;  2LRD A;  5JLW A;  3OIP A;  4QSH A;  4FIS A;  4DYC A;  3WGI A;  3Q9S A;  3D5S C;  2TDX A;  4C30 A;  2P6S A;  1HW5 A;  1JGG A;  5K5Q A;  1H9T A;  2KIQ A;  3BZ6 A;  2MAB A;  1W0T A;  5GAG J;  3RZO J;  1T6S A;  1I27 A;  1D1C A;  3KLN A;  4Y7N J;  1XC5 A;  1R49 A;  3B6C A;  1Z7L A;  1AKH B;  5D6E A;  3LSP A;  2ZME A;  3OYD A;  4U88 A;  2XAS A;  4MLO A;  5LGN A;  4LK1 F;  3BC8 A;  1I3Q J;  5F64 A;  4A3J J;  3JSP A;  1V54 H;  1MMD A;  4AD9 A;  3F8B A;  4XON A;  1FOY A;  1T56 A;  3RSN A;  2DA3 A;  4D7N A;  2I8D A;  2KL4 A;  1I6X A;  4LGW A;  1FBQ A;  1BR4 A;  2IW5 A;  1R36 A;  2F5E A;  2HWV A;  2QEX I;  1LFU P;  1MDM B;  5FB2 A;  1I39 A;  5J1R A;  2A3S A;  2JWT A;  4L5J A;  1WI9 A;  3HOY J;  1VQ6 I;  1D8K A;  2DA7 A;  4OOI A;  4KMF A;  1BA5 A;  3N4M A;  1FY7 A;  1HQC A;  1FYL A;  3A0H C;  4G6D A;  1A6Q A;  3OL4 A;  2DPU A;  1TW2 A;  2KKO A;  1RC9 A;  1R6R A;  5FJ8 J;  4BE0 A;  1MBK A;  3QPS A;  4YG2 F;  1H0M A;  2M7A A;  4L9V A;  2QBY B;  5JHU A;  2VUM J;  2MD5 A;  2ZKZ A;  3WTU C;  3F3X A;  3HUG A;  1STZ A;  2VC1 A;  2K02 A;  2LP0 A;  3GFI A;  5E3N A;  2O7O A;  2R7U A;  1NTC A;  2E2H J;  1FOX A;  2W7N A;  3I53 A;  1QGP A;  3BCB A;  3L2C A;  1MMA A;  1ZG3 A;  5LHG A;  5KK1 A;  2XC7 A;  2P5L C;  2FNA A;  2KFD A;  2R93 J;  2QSH X;  3KP3 A;  3EYI A;  5JR3 A;  1B59 A;  5FRM A;  2CV1 A;  2E19 A;  1C0W A;  3DU5 A;  4ZTJ A;  3ELK A;  3VB2 A;  5D4S A;  1FZP B;  3FXU A;  1Z21 A;  1YIJ I;  1T08 B;  2V9K A;  3LQQ A;  3A01 A;  3P7N A;  4PJL A;  4HF1 A;  2X51 A;  2DA2 A;  1OCZ H;  5K1Y A;  3A2K A;  1DUX C;  2M30 A;  1Z3X A;  4AM3 A;  5E1W A;  2K5C A;  3KP6 A;  5FLX Z;  1K4S A;  3SDG A;  2BW3 A;  1HA8 A;  2DQL A;  2EFP A;  5HNF A;  1SMT A;  3H1C A;  3R0A A;  1BI1 A;  5M5Y J;  1Y0U A;  4EJO A;  5EF6 A;  3I54 A;  2STW A;  3PFI A;  3ASO H;  2X6X A;  1W4M A;  3U2R A;  1XGN A;  3WG7 H;  3PO3 J;  2Z3Y A;  1FIP A;  3OIQ A;  5DV5 A;  3H5R A;  5DDG A;  2D5V A;  3AFH A;  3LA3 A;  1X1B A;  4CUG A;  2DCE A;  4I99 C;  4KIC A;  1IJW C;  5AIP A;  2Y0M A;  4KMU X;  2EIJ H;  2FUG 2;  3VOE A;  1ETV A;  1XGO A;  2ME6 A;  1ZEL A;  3BDD A;  4ZYG A;  4PK4 A;  2R5Y A;  1Z3Y A;  4UV8 A;  4IEJ A;  3MKY B;  2MBF A;  2BVL A;  2DA4 A;  3I4N J;  2QA4 I;  2PEX A;  1BL0 A;  2L4M A;  1GDT A;  3K70 C;  3ZQL A;  2DDB A;  1K7A A;  4NNJ A;  4NB5 A;  3LA7 A;  4LG0 B;  3P9K A;  4PGG A;  2O61 A;  1WJA A;  3HSE A;  3OYM A;  1N25 A;  4RB0 A;  1D8J A;  3BOQ A;  5FKL A;  1HF0 A;  2JPC A;  1EA3 A;  1LKX A;  4JK1 X;  3M1E A;  3BJA A;  4CGZ A;  3U21 A;  2W4S A;  1V3F A;  3VYU B;  2V6E A;  3CJT B;  4G6T B;  4YIF A;  1ZRD A;  3PJR A;  2KLO A;  1JTY A;  4YRV A;  2F5V A;  2FX0 A;  5GTH C;  4AYB N;  2WB1 N;  1IDY A;  1W7P D;  1OFC X;  1YOV B;  1ETK A;  4G9Y A;  4MHG A;  5J8F A;  1G59 A;  4M6Y A;  2R7F A;  2VB6 A;  2ADU A;  3OR2 C;  4F52 A;  2RQP A;  4A0Z A;  4AWX B;  1S7O A;  2JT1 A;  1IRX A;  5M5X J;  4N0B A;  1FSH A;  2XAJ A;  3KPH A;  3F9K A;  3WE2 A;  4EJW A;  3JRG A;  2L02 A;  2GOM A;  3IH2 A;  2NVY J;  2MC3 A;  4B47 A;  3PNV A;  4KIG A;  4RAY A;  5D5V B;  2WC2 A;  2MW8 A;  2ZJR F;  1SVL A;  2F4I A;  1T0F C;  2L01 A;  3GFM A;  1U78 A;  3DV8 A;  1U9N A;  4BGD A;  3K7A J;  3CMY A;  2V1X A;  2NVQ J;  4ZTF A;  3HG9 A;  4NHJ A;  2Y30 A;  3I64 A;  2FSW A;  4Q48 A;  2UZK A;  3H36 A;  3LNQ A;  3MMY B;  3TW6 A;  4AYB A;  5E3O A;  4XKB A;  2LKS A;  3SFI A;  2EIM H;  2VBZ A;  1E3H A;  3IH3 A;  3QYE A;  2KMU A;  3KYC B;  1X4O A;  1Y56 A;  4UB8 C;  1U5T B;  2MGQ A;  4UHT A;  3G71 I;  4A12 A;  1VFC A;  3PO2 J;  1RET A;  3FWE A;  1ZG5 A;  4HV6 A;  4KT6 A;  5DYM A;  1HKQ A;  3E0J B;  2V1D A;  2HYF A;  5EEA A;  2LBF B;  1EJ9 A;  1HDP A;  2ELK A;  1TLH B;  1MDM A;  3KCC A;  1H88 C;  4PGH A;  3V8J A;  4B3X A;  3AG3 H;  2VXD A;  2JA6 J;  2XF5 A;  2VPL A;  2P6T A;  3ASN H;  4MIM A;  3CO7 C;  1ODD A;  1RNL A;  3ZMZ A;  3H5A A;  2BE5 F;  2EFO A;  1RKW A;  1K78 A;  2WY8 Q;  1VZ0 A;  4IRH A;  2EFN A;  2Z16 A;  1WVR A;  2DT7 B;  5DCM A;  3LFK A;  4H4K C;  4A6E A;  1XSX A;  3H3Z A;  5J40 A;  3FX3 A;  1A5J A;  3DBR B;  1IXR C;  4XOT A;  3H5N A;  4D7M A;  1ORK A;  2LSO A;  5IP6 A;  2O5R A;  4A3M J;  1SVO A;  3RYP A;  4RGX A;  3GLX A;  2HOS A;  5TJJ A;  1TL8 A;  1OCT C;  1B8I B;  2CFX A;  3TGN A;  2TCT A;  3GVA A;  2ETH A;  3CDI A;  1UG2 A;  5KVR A;  2Z33 A;  2HKX A;  4HNU A;  3W6V A;  1SFO J;  3LST A;  1YYV A;  3EUH C;  3QU6 A;  4U87 A;  2P5V A;  1ZAO A;  2E36 A;  4NC7 A;  1AA7 A;  3GLL A;  2DT6 A;  1YG2 A;  4QTR A;  4I02 A;  1GHC A;  1BM9 A;  3K6G A;  5H6R A;  2MFZ A;  2B7E A;  4IKF A;  1WJF A;  2AQE A;  1FBU A;  1BOA A;  1ZHF A;  4ZZL A;  3S3O A;  1JXS A;  2HDW A;  2ISY A;  1FLI A;  4AC0 A;  2WA0 A;  4ZZD A;  1P92 A;  4V19 K;  3O2P E;  3LOC A;  2NRA C;  3GUD A;  1MZB A;  2PQ8 A;  3FMS A;  1V5G A;  3HOS A;  2WBM A;  2CQ7 A;  2HXI A;  1VI0 A;  3CES A;  1GVD A;  3JRE A;  3PL8 A;  4IOA F;  1Y0N A;  2RAE A;  4D0P A;  3MEX A;  3V7R A;  3FXR A;  3JRD A;  4ENM A;  1N75 A;  3BJO A;  4ANJ A;  2QEN A;  5FLV A;  2X4H A;  2DFF A;  4XLA A;  2RNG A;  1SD7 A;  3IAM 2;  2L5Q A;  1RR8 C;  1X3Z B;  3JAM K;  3A0B C;  4Q5S F;  2HR3 A;  1O3R A;  2B0L A;  2K4J A;  1FOW A;  1RR7 A;  1R4N B;  1IDZ A;  1W5S A;  2WY7 Q;  3SHF A;  1T8I A;  5CVJ A;  1MMS A;  5F6F A;  1QZY A;  4A3D J;  1G3W A;  2DN0 A;  1UJ8 A;  3ZP5 A;  4PCQ A;  2Y9Y A;  2XF7 A;  1WI3 A;  3JTG A;  4IX7 A;  2E7X A;  2CUJ A;  2E1M B;  1JKO C;  3ABM H;  3PQJ A;  2JSC A;  4CCN A;  3DPU A;  1B4A A;  4A0Y A;  1PUF A;  1P7J A;  1ULY A;  3R61 A;  2FU4 A;  2ZB9 A;  3KZY A;  4XLE A;  4MTD A;  3CDL A;  4AID A;  4II2 A;  1WWX A;  2EZK A;  3K1N A;  4CA0 A;  5D5W B;  3ZN0 A;  2O3F A;  2E1N A;  3M9A A;  1BC7 C;  3CUQ A;  2DA1 A;  2K85 A;  3GW2 A;  5L3E A;  4FE7 A;  4R1H A;  4AIH A;  3ZMU A;  2F4M B;  3CCY A;  2Y69 H;  3ZQQ A;  4BUP A;  3VOD A;  3ZQ7 A;  4AUX A;  4U0Y A;  2VQL A;  3H3V K;  1E0E A;  2FXA A;  2VBX A;  3GX4 X;  1LEB A;  2KRF A;  1B72 A;  2KQR A;  3VEP A;  2QCO A;  1BC8 C;  5FKK A;  2H09 A;  3DEU A;  1Y6I A;  5J1U A;  3KYD B;  3I56 I;  2VOD A;  3DTK A;  5DS9 A;  1MKM A;  2MYS A;  3E3V A;  4GDF A;  2ZSI B;  2OUM A;  1I5Z A;  3O8H A;  4QWQ A;  4HRI A;  2BY3 A;  3HHG A;  2Z99 A;  2JVH A;  4P5O A;  3LSG A;  2MLK A;  3CF2 A;  4G12 A;  4BBR J;  5HDN A;  2OQR A;  3HIF A;  1VND A;  3TOB A;  5B5E C;  4BXX J;  5E8G A;  3B73 A;  3F8N A;  1APL C;  3M3Y J;  2HPM A;  2R5Z A;  1DDN A;  2QSG X;  2JUC A;  3S15 J;  4A3L J;  4ZJZ A;  3HOX J;  4G6Q A;  3DFG A;  3D0S A;  3W6J B;  1QZZ A;  2A5Y B;  2V1N A;  1AU7 A;  5FFZ A;  3TKY A;  2DA5 A;  3BG6 A;  1U5T A;  1WSU A;  2DFI A;  3IH4 A;  2DYS H;  2M0M A;  3O8G A;  2W25 A;  3ZR8 X;  4UUS B;  1JUP A;  1KU9 A;  2NS0 A;  4M3E A;  1YRN B;  5JFR A;  1S5L C;  1TT5 B;  4FTH A;  2E2I J;  4E7H A;  3F6O A;  2IPQ X;  3TDU C;  2ESN A;  3ISP A;  1X2M A;  1SAU A;  1ZTR A;  1D0Y A;  3QP5 A;  4XOR A;  2EIL H;  3F6V A;  3M7G A;  1R71 A;  2HYG D;  3DTE A;  5D5U B;  2ZJQ F;  4HZF A;  3KP4 A;  3QWL A;  5TRD A;  4YII A;  4P96 A;  3WTW C;  1TW3 A;  1E2X A;  2LG4 A;  3KIO A;  2P4W A;  3CCJ I;  1W36 D;  3Q0U A;  1FJL A;  1F1Z A;  1IV6 A;  1TNS A;  3EUK L;  1TWG J;  3MCZ A;  3S2D J;  4XKW A;  1S7A A;  2NVX J;  4Y4R A;  2QM3 A;  3BPV A;  2VE9 A;  2NOG A;  1B8I A;  2NNY A;  4UY8 I;  2V9V A;  3ZOB A;  1H9G A;  3U1D A;  4FX4 A;  1XMA A;  2QWW A;  3P9I A;  1DU6 A;  1D1B A;  4ENN A;  1SFU A;  2VBW A;  3V4G A;  3PM1 A;  4ENK A;  3CUO A;  5M5W J;  4I2O A;  3IWZ A;  1F9N A;  5BS6 A;  2OC6 A;  3KET A;  5CPR B;  4W1U A;  4JYK A;  1D3Y A;  2H8R A;  4NDL A;  1RRJ A;  1FYK A;  5ILV A;  2EBI A;  3RKW A; 
#chains in the Genus database with same CATH homology
 2AXL A;  3HYI A;  1ZN2 A;  1O7L A;  1IF1 A;  2Q0O A;  3QP6 A;  3RDI A;  1KQ0 A;  4LB6 B;  3K1P A;  3M8F A;  4M9Z A;  5D5X B;  4Y13 A;  1WQ2 A;  5F1R A;  2NYX A;  2KJB A;  3OOP A;  2IT0 A;  4WF2 A;  1QQI A;  2YX7 A;  3KP7 A;  3ZPL A;  5FD5 A;  3RYR A;  2YU3 A;  1RUO A;  3J81 K;  3ULQ B;  4HOB A;  4ZYD A;  2RC4 A;  4EJT A;  1YS6 A;  2IJL A;  3KFW X;  4GCV A;  4ASN A;  4S04 A;  1XMK A;  5CYV A;  1K6O A;  1KQ8 A;  1MD0 A;  3ZMV A;  2PMH A;  3GO5 A;  3H3U A;  2ESH A;  3WGH A;  3Q5F A;  5FGM A;  1BJA A;  2W84 A;  1HST A;  1EH6 A;  3F22 A;  3WTT C;  5HOO A;  1YO5 C;  1J5Y A;  1KU7 A;  2F5F A;  5DD4 A;  2LF8 A;  3TO7 A;  2M45 A;  1NHA A;  4KN7 X;  3IHU A;  4U0W A;  4KUM A;  5E17 F;  5LGT A;  4HDU A;  1B9N A;  2XGX A;  4GXO A;  1XB4 A;  4HLY A;  2ZFW A;  1LJ9 A;  1SAX A;  4HW0 A;  4I0A A;  3EYY A;  1RZ4 A;  1LNW A;  4EJU A;  2EK5 A;  2O03 A;  4OIP F;  3T0Y A;  4GYI A;  2IA0 A;  4IRG A;  4EQQ A;  4IPA A;  2MA3 A;  5ED4 A;  3G3Z A;  4Z2Y A;  4L9J A;  1GXP A;  3FM5 A;  1ZH5 A;  4OMY A;  4EV0 A;  4A5M A;  1ZRE A;  1WKM A;  1X3U A;  2ZJ2 A;  5BOX A;  1JHH A;  3LQR A;  1SD4 A;  2GA1 A;  1XCV A;  3C18 A;  5DUI A;  3QOP A;  4M72 A;  3BWG A;  2FBI A;  3I4P A;  2DAO A;  2EA2 A;  1FC3 A;  1IXC A;  1R5H A;  3F8M A;  1O3S A;  2FQ3 A;  2P5K A;  3QPT A;  4BQA A;  5BQT A;  3IRQ A;  3ABU A;  1MJB A;  1U3E M;  3GFJ A;  4WXC A;  5HS9 A;  2ZCW A;  1ON1 A;  4KN4 X;  3GZ5 A;  2VXZ A;  4A2U A;  3HTU A;  2R3S A;  5JVT A;  1HSJ A;  3GF2 A;  1ZLJ A;  3E97 A;  3Q9V A;  4ZYE A;  2OD5 A;  1O3T A;  2VT2 A;  2DI3 A;  2AS5 F;  2CG4 A;  1LDD A;  2GIV A;  1F4K A;  4KYW A;  3ZMS A;  4I0B A;  3GFL A;  3F8F A;  4OMZ A;  1F5T A;  2PMU A;  1AWC A;  4FT8 A;  2YR2 A;  1Z9C A;  4TV7 A;  3RIR A;  1TTY A;  4KIF A;  4ZH4 F;  5L3D A;  3RJP A;  1AOY A;  1DPU A;  1T0F A;  4WCG A;  1E17 A;  5AIQ A;  3I0T A;  3KP2 A;  5LBQ A;  1UHM A;  4Y15 A;  3H92 A;  2L54 A;  1ZAR A;  5EEH A;  3R0J A;  1IAW A;  1JE8 A;  5A2Q K;  4RB2 C;  2H6B A;  4P55 A;  2EV0 A;  3K0L A;  3IKV A;  3W6K B;  2DPD A;  1G3T A;  1REP C;  2CGP A;  4LLG F;  2P8T A;  4LFU A;  4G7Z F;  1MGT A;  4I09 A;  3F72 A;  1HW2 A;  5CVI A;  4EM1 A;  4EM0 B;  1G4D A;  1KU3 A;  3J81 Z;  2IVM A;  4BHP A;  1OYY A;  1S6L A;  3REO A;  3MZH A;  4RS8 A;  3EDP A;  1W7P B;  4ESJ A;  2IA1 A;  4U0V A;  2KIM A;  1U8R A;  1XSV A;  3EUH A;  2ZO4 A;  2BEO A;  2BV6 A;  2QBY A;  3IL2 A;  1ZGA A;  1IN4 A;  1O57 A;  3WG9 A;  3DQV C;  3CTA A;  1EH8 A;  3MFK A;  2JZY A;  2J5P A;  3WE3 A;  2BBY A;  2R7D A;  4FX0 A;  1G3Y A;  1R58 A;  2KIU A;  2GAU A;  3IKT A;  1S8N A;  4UV9 A;  4RB1 A;  3E5X A;  4XBF A;  5E18 F;  4XLP F;  1R00 A;  1G6N A;  5D8L B;  4RGU A;  2C6Y A;  1VTN C;  1J75 A;  1OMI A;  1YS7 A;  5E20 A;  2MLG A;  1IW7 F;  5D6F A;  4L9T A;  2O8X A;  1KYW A;  6PAX A;  2H27 A;  3QAH A;  1PP7 U;  2A6E F;  3L09 A;  2VOP A;  4HF0 A;  2BGC A;  3CDH A;  1R1U A;  3KP5 A;  2CQK A;  3JSO A;  1IZ1 A;  5ICC A;  1R5G A;  3ECH A;  4LG0 A;  5HDG A;  4HV5 A;  1PDN C;  2D1H A;  4EGY A;  3BJ6 A;  3RTR A;  4R79 A;  2WTE A;  2YPR A;  1Z91 A;  2JRT A;  2VBY A;  4ETS A;  3V8K A;  2RDP A;  2VN2 A;  3DF8 A;  3HHH A;  2W24 A;  3L9F A;  4MEY F;  5L3B A;  3E6B A;  3JTH A;  1B1B A;  1XCB A;  2NNN A;  3T1B A;  5BPI A;  5L3G A;  1FSE A;  3O6B B;  3NRV A;  4A5N A;  5HLG A;  4I01 A;  2DU9 A;  1KYZ A;  4CDG A;  3DPL C;  3I59 B;  2XAG A;  4RB3 C;  4EM2 A;  4BH9 A;  5FO5 A;  2HS5 A;  5EEG A;  1GXQ A;  3RPQ A;  2XKP A;  5K5R A;  3RKX A;  3EQL F;  4LK0 F;  1QO0 D;  5D4R A;  3ERE D;  4MQ9 F;  2V1U A;  2OU2 A;  3JW4 A;  5ILU A;  2OA4 A;  4KDP A;  3CJN A;  2DTR A;  5FD6 A;  5K5O A;  3TO6 A;  3DXJ F;  5HVQ C;  2RV8 A;  2ZME B;  4G7H F;  2LKP A;  2UWM A;  1TQI A;  4ON0 A;  2QZ8 A;  3BP8 A;  1USS A;  3B02 A;  3DPT A;  1OYW A;  2HZT A;  2JTV A;  4XSX F;  5ERI A;  1S3J A;  3WGG A;  1YW8 A;  3AAF A;  3HRU A;  3KLO A;  3M8E A;  1PUE E;  1A04 A;  3N97 A;  3HRS A;  4Q47 A;  4M74 A;  2CYY A;  1KQ9 A;  3LWF A;  2QYO A;  2ZNY A;  3TO9 A;  5A2Q Z;  4HDV A;  4GO1 A;  2G7U A;  3E5Q A;  4F7Z A;  2G9W A;  1BN5 A;  1B9M A;  2V6C A;  4M71 A;  2L4A A;  2M1B A;  5CVV A;  3I5U A;  1ZRF A;  4CZZ A;  1TNT A;  1BI3 A;  3T8T A;  4N9H A;  1J59 A;  2E7W A;  2RVC A;  1CGP A;  2ACJ A;  3HTS B;  3E5U A;  2ZBK A;  2L3D A;  4PZJ A;  1XDU A;  3ZN1 A;  5J6X A;  2XRO A;  1SFE A;  3FZV A;  1YIO A;  1IRG A;  1IUY A;  2RNJ A;  1YLF A;  4Y17 A;  2DT5 A;  5LHH A;  4M73 A;  1ZYR F;  3L7W A;  2OQG A;  4UUV A;  1HXD A;  1I1S A;  4UVC A;  4UVB A;  4KT5 C;  4LB5 A;  4S05 A;  1FPQ A;  1I1G A;  5LHI A;  4OIO F;  3VFZ A;  2XAQ A;  1P2F A;  3EET A;  3IC7 A;  1FWZ A;  4FHT A;  4O5V A;  1OYI A;  2ZNZ A;  2GQQ A;  2K86 A;  2PI0 A;  4IHS A;  4PDK A;  1UFM A;  3P9C A;  3K69 A;  2G7H A;  4JBA A;  3T5X A;  4IRI A;  5DCF A;  4HYE A;  4L0Y B;  4UNO A;  3OV8 A;  1FP2 A;  2COM A;  1QBJ A;  5HS7 A;  4AIJ A;  2HTS A;  2W57 A;  1LDK B;  1HBX G;  2FMY A;  3JAM Z;  3V8L A;  2XIG A;  2ELH A;  3G73 A;  3CLO A;  2QQB A;  2HQR A;  5LLQ A;  2FOK A;  4LD5 A;  1R1T A;  3SXY A;  2E1C A;  3FM3 A;  3NEU A;  2PFB A;  4HX8 A;  3WTZ A;  4LMY A;  1FBS A;  1BI0 A;  3T8R A;  5LEK A;  1K79 A;  4IF4 A;  3LAP A;  2FBK A;  4RAZ A;  3WOD F;  2NAZ A;  3L00 A;  4MGR A;  4MQV A;  2ZXJ A;  1J2X A;  2FNP A;  3WTV C;  2J5O A;  3CO6 C;  2CW0 F;  4KA4 A;  1JHF A;  2EFW A;  5JI6 A;  1K78 B;  2O0Y A;  2YX4 A;  3O3K A;  1UST A;  1UHW A;  1BI2 A;  4ENJ A;  2VC0 A;  5DCM B;  1ZGJ A;  4B09 A;  4IJA A;  1Z6R A;  2WV0 A;  1S29 A;  5DEQ A;  3WTX C;  2D1V A;  4EJV A;  1YW9 A;  3FMQ A;  4MNU A;  3HOT A;  1EH7 A;  2OZU A;  5E1Z B;  4L18 B;  2QLZ A;  3K2Z A;  5H6Q A;  1P4A A;  2A07 F;  2UXX A;  3C3W A;  2D2W A;  1FNN A;  3J80 K;  3MZY A;  3F8C A;  2IA2 A;  2XHK A;  3ZMD A;  2CO5 A;  1YQA A;  2A6H F;  3V7S A;  1L0O C;  4EVI A;  1L3L A;  2OZ6 A;  1T38 A;  4A0X A;  4YFX F;  4U7D A;  4L5I A;  4R8H A;  2Y48 A;  3C1D A;  2QVO A;  3FHZ A;  3R4K A;  3GYH X;  4KFC A;  2K7L A;  3GXO A;  4QLC U;  4ESB A;  5IT3 A;  2YSR A;  5CJ9 A;  2HOE A;  1ZLK A;  3I71 A;  1JGS A;  5ICF A;  2F2E A;  2M87 A;  4HQE A;  3COA C;  1TQM A;  4WX9 A;  2FBH A;  3TQN A;  4EMS A;  4CIC A;  4P9F A;  1LB2 A;  2XVC A;  4N9I A;  4I7H A;  4EGZ A;  1LVA A;  2WWY A;  4XSZ F;  2FE3 A;  3SQN A;  2Z5U A;  2FA5 A;  2DW4 A;  3CUQ B;  3E6D A;  4BYY A;  3F21 A;  5DUK A;  2OAZ A;  4BAY A;  2VOO A;  2XRN A;  1B6A A;  2GXG A;  1Z7U A;  4HF2 A;  5BMZ A;  2HEO A;  1Z05 A;  4KIB A;  2O6G E;  1J0R A;  2EB7 A;  2GWR A;  3WTY C;  5J8C A;  4L0Z B;  5HLI A;  4AIK A;  1DP7 P;  4JQF A;  4O6J A;  4Q4Z F;  2HTJ A;  1D5V A;  5BPD A;  2FRH A;  2K4B A;  3HSF A;  2KJC A;  5ILS A;  2LNB A;  3J7A O;  1QNT A;  4IXA A;  3ABT A;  2BYV E;  4CYD A;  1IXS B;  2EV6 A;  2D45 A;  2MH2 A;  3ECO A;  4G8X A;  5CLS A;  2DBB A;  4O3M A;  5IT9 K;  4DQ2 A;  2A61 A;  5HDK A;  3R6S A;  2EA4 A;  3MWM A;  2RGV A;  5ICG A;  4UVA A;  4MEX F;  2DK5 A;  5CVR A;  2DK8 A;  3WU0 A;  3MAJ A;  4OU0 A;  3BRO A;  3FXQ A;  1XN7 A;  1Q1H A;  1SD5 A;  2V79 A;  1ONV A;  1J9I A;  1O3Q A;  4M6X A;  4H0E A;  1IN5 A;  5HS8 A;  2Q8K A;  1UCR A;  4HQM A;  1J7K A;  3RPU A;  2P7C B;  5ICE A;  4IVN A;  3BY6 A;  2RN7 A;  4NQW A;  3HRT A;  2DQR A;  2LF7 A;  2Q2E A;  2XKO A;  3U9G A;  2GZW A;  3E6M A;  1BIB A;  5CVU A;  2K27 A;  4UXN A;  1V4R A;  2FEZ A;  1WRJ A;  3DP7 A;  3QU3 A;  2VE8 A;  1HW1 A;  3R60 A;  2DO7 A;  4BXU A;  1IRF A;  2KIF A;  1XDS A;  4GGG A;  4BNC A;  4M9S A;  3QRF F;  1KU2 A;  2CWE A;  3S2W A;  3HRM A;  1CF7 B;  1KA8 A;  2QUF A;  3TDZ C;  4I98 B;  5FFX A;  1IN8 A;  2M8E A;  1SMY F;  4P9U A;  3F23 A;  2PLY A;  1FYM A;  2EWN A;  1HKS A;  3V7C A;  1FT9 A;  4LJZ F;  2PJP A;  3HSR A;  4K2E A;  4OIN F;  4LLL A;  1P6R A;  5D8K B;  4CXF A;  4A6D A;  1MJA A;  1GVJ A;  2EV5 A;  2LDU A;  2EFQ A;  2RKH A;  5DD8 A;  1OR7 A;  3K1M A;  1SFX A;  2HKO A;  3LA2 A;  4B8X A;  5LRS A;  3IWF A;  4ZYH A;  2QQ9 A;  2GA2 A;  1P4X A;  1QPM A;  1O7F A;  3D5L A;  4WXD A;  4CHU A;  3KEO A;  1PP8 F;  3CUQ C;  1EV7 A;  5LRR A;  3J80 Z;  2PG4 A;  1R22 A;  1T2K A;  3KZZ A;  5HLH A;  5L3C A;  4XLN F;  2Z9O A;  2P7V B;  1ON2 A;  3WU1 B;  1W7P A;  1LEA A;  2IRF G;  1UB9 A;  4WK8 F;  2F5C A;  2OBP A;  1FOK A;  4HX7 A;  5L3F A;  1FP1 D;  3WTS C;  2QQA A;  5FLX K;  1G3S A;  3E6C C;  4MTE A;  4GYG A;  5AON A;  2H6C A;  4HLX A;  4HAM A;  3K9T A;  3SZP A;  1HKT A;  2HGC A;  1W5T A;  1XD7 A;  1FX7 A;  3ML6 A;  4RGR A;  3BPX A;  4RGS A;  1U5T C;  2F5D A;  1U6G A;  4OIR F;  4HX4 A;  4XRF A;  4M9X A;  2PN6 A;  2H94 A;  2UXN A;  1ZG1 A;  1DPR A;  2XV4 S;  1R23 A;  3GWZ A;  1IN6 A;  4KNY A;  2HQN A;  3RI4 A;  1XSD A;  2STT A;  3KE2 A;  2EJR A;  2Y75 A;  1Z6T A;  3QPH A;  4AVP A;  3IRR A;  4WXH A;  2HDC A;  1SD6 A;  4BHB A;  1BBY A;  2DLL A;  2M5W A;  1R1V A;  1CF7 A;  3PQK A;  4ESF A;  2XUB A;  3SFZ A;  2HFH A;  1R7J A;  1T98 A;  1LQ1 A;  1U2W A;  5IT9 Z;  4HBL A;  2CSO A;  3I58 A;  3MQ0 A;  3FF5 A;  4BHC A;  4G94 A;  3GEZ A;  1YTY A;  2ISZ A;  1TQP A;  2MH9 A;  1MJ9 A;  1RIO H;  4YFK F;  1XGM A;  1RI7 A;  2VON A;  2A68 F;  5LGU A;  4U7B A;  1BIA A;  2XAF A;  2IP2 A;  3ROU A;  2XAH A;  4WWC A;  4CO8 A;  1ZRC A;  4OIQ F;  2FML A;  1P4W A;  4IHT A;  3FMR A;  3GZ6 A;  2W85 A;  5H20 A;  5E1X A;  2PBI A;  1LDJ A;  2X0L A;  3C7J A;  1YW7 A;  1IN7 A;  1OKR A;  3LAJ A;  1TBX A;  3I59 A;  1YFH A;  1OPC A;  3RKY A;  2FF4 A;  5LEJ A;  4E70 A;  4G7O F;  3DKW A;  4HA8 A;  3SZT A;  1Z1D A;  2JPB A;  2GXB A;  1RUN A;  2VT3 A;  4YFN F;  4LLN A;  2A69 F;  3ZMT A;  1XGS A;  4DNC A;  1T39 A;  5E8I A;  1KGS A;  3NQO A;  4L9N A;  3KEQ A;  3TOA A;  3WGI A;  3Q9S A;  2TDX A;  2P6S A;  1HW5 A;  5K5Q A;  1H9T A;  3BZ6 A;  1T6S A;  1I27 A;  3KLN A;  5D6E A;  2ZME A;  4U88 A;  2XAS A;  5LGN A;  4LK1 F;  5F64 A;  3JSP A;  4AD9 A;  3F8B A;  1I6X A;  4LGW A;  1FBQ A;  2IW5 A;  1R36 A;  2F5E A;  2HWV A;  1MDM B;  5FB2 A;  2A3S A;  4L5J A;  1WI9 A;  1D8K A;  4OOI A;  4KMF A;  3N4M A;  1FY7 A;  1HQC A;  1FYL A;  4G6D A;  2DPU A;  1TW2 A;  2KKO A;  4YG2 F;  1H0M A;  4L9V A;  2QBY B;  5JHU A;  2MD5 A;  2ZKZ A;  3WTU C;  3F3X A;  3HUG A;  1STZ A;  2VC1 A;  2K02 A;  3GFI A;  3I53 A;  1QGP A;  3L2C A;  1ZG3 A;  5LHG A;  5KK1 A;  2P5L C;  2FNA A;  3KP3 A;  3EYI A;  5JR3 A;  1B59 A;  1C0W A;  3ELK A;  3VB2 A;  5D4S A;  1FZP B;  3FXU A;  3LQQ A;  3P7N A;  4HF1 A;  5K1Y A;  1DUX C;  2M30 A;  5E1W A;  3KP6 A;  5FLX Z;  2DQL A;  2EFP A;  1SMT A;  3R0A A;  1BI1 A;  1Y0U A;  4EJO A;  3I54 A;  2STW A;  3PFI A;  1W4M A;  3U2R A;  1XGN A;  2Z3Y A;  5DV5 A;  5DDG A;  3LA3 A;  4KIC A;  5AIP A;  2Y0M A;  4KMU X;  3VOE A;  1XGO A;  4ZYG A;  3BDD A;  4UV8 A;  2MBF A;  2PEX A;  2L4M A;  1K7A A;  4NB5 A;  3LA7 A;  4LG0 B;  3P9K A;  4PGG A;  2O61 A;  3HSE A;  4RB0 A;  1D8J A;  3BOQ A;  2JPC A;  4JK1 X;  3M1E A;  3BJA A;  4CGZ A;  1V3F A;  4YIF A;  1ZRD A;  1W7P D;  4G9Y A;  4MHG A;  5J8F A;  4M6Y A;  2R7F A;  2ADU A;  2RQP A;  4A0Z A;  4AWX B;  1S7O A;  2JT1 A;  4N0B A;  1FSH A;  2XAJ A;  4EJW A;  3WE2 A;  2L02 A;  2MC3 A;  4KIG A;  4RAY A;  5D5V B;  2WC2 A;  2L01 A;  1U78 A;  3GFM A;  3DV8 A;  2V1X A;  4NHJ A;  3I64 A;  2FSW A;  4Q48 A;  2UZK A;  2VBZ A;  1U5T B;  4UHT A;  4A12 A;  3FWE A;  1ZG5 A;  4HV6 A;  5DYM A;  1HKQ A;  2V1D A;  2HYF A;  1MDM A;  1TLH B;  3KCC A;  4PGH A;  3V8J A;  2P6T A;  3CO7 C;  1ODD A;  1RNL A;  3ZMZ A;  2BE5 F;  2EFO A;  1K78 A;  4IRH A;  2EFN A;  5DCM A;  3LFK A;  4A6E A;  1XSX A;  3H3Z A;  3FX3 A;  1IXR C;  2LSO A;  3RYP A;  4RGX A;  3GLX A;  5TJJ A;  2CFX A;  3TGN A;  3GVA A;  2ETH A;  5KVR A;  2Z33 A;  2HKX A;  3LST A;  1YYV A;  3QU6 A;  2P5V A;  1ZAO A;  1YG2 A;  1GHC A;  4I02 A;  1BM9 A;  5H6R A;  1FBU A;  1BOA A;  1ZHF A;  4ZZL A;  1JXS A;  2ISY A;  1FLI A;  4ZZD A;  1P92 A;  3O2P E;  2NRA C;  3GUD A;  1MZB A;  2PQ8 A;  3FMS A;  3HOS A;  4D0P A;  3MEX A;  3V7R A;  3FXR A;  4ENM A;  3BJO A;  2QEN A;  2X4H A;  1SD7 A;  3JAM K;  4Q5S F;  2HR3 A;  1O3R A;  2B0L A;  2K4J A;  1W5S A;  3SHF A;  5CVJ A;  5F6F A;  1QZY A;  1G3W A;  3ZP5 A;  4PCQ A;  3JTG A;  2E7X A;  3PQJ A;  2JSC A;  1B4A A;  4A0Y A;  1ULY A;  3R61 A;  2FU4 A;  4MTD A;  3KZY A;  1WWX A;  3K1N A;  5D5W B;  3ZN0 A;  2O3F A;  2E1N A;  3M9A A;  1BC7 C;  3CUQ A;  3GW2 A;  5L3E A;  4R1H A;  4AIH A;  3ZMU A;  3VOD A;  3ZQ7 A;  4U0Y A;  2FXA A;  2VBX A;  3GX4 X;  1LEB A;  2KRF A;  3VEP A;  1BC8 C;  2H09 A;  3DEU A;  2VOD A;  1MKM A;  3E3V A;  1I5Z A;  4QWQ A;  3HHG A;  2Z99 A;  4P5O A;  2MLK A;  5HDN A;  2OQR A;  3HIF A;  3TOB A;  5E8G A;  3B73 A;  3F8N A;  1DDN A;  4G6Q A;  3DFG A;  3D0S A;  3W6J B;  1QZZ A;  2A5Y B;  5FFZ A;  3TKY A;  1U5T A;  1WSU A;  2DFI A;  2W25 A;  1KU9 A;  2NS0 A;  5JFR A;  3F6O A;  2IPQ X;  3TDU C;  2ESN A;  3ISP A;  3QP5 A;  3F6V A;  3M7G A;  2HYG D;  5D5U B;  4HZF A;  3KP4 A;  5TRD A;  4YII A;  4P96 A;  3WTW C;  1TW3 A;  1E2X A;  2P4W A;  1F1Z A;  1TNS A;  3MCZ A;  1S7A A;  2QM3 A;  3BPV A;  2VE9 A;  2NNY A;  2V9V A;  1H9G A;  3U1D A;  4FX4 A;  1XMA A;  2QWW A;  3P9I A;  4ENN A;  1SFU A;  2VBW A;  3V4G A;  4ENK A;  3CUO A;  4I2O A;  3IWZ A;  1F9N A;  5BS6 A;  3KET A;  1D3Y A;  1FYK A;  5ILV A;  3RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...