5E2TH

Crystal structure of anti-tau antibody at8 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
209
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT8 LIGHT CHAIN
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2tH01
4AH2A 32C2B 4I9WD 3X3GH 1H3UA 1FNEA 4HFUH 4JRXD 1YPZE 1HHGA 1WK0A 5GRVK 5JORB 1OCWL 5CZXC 4NQEA 1D5IH 4JHBA 4PG9B 1FN4B 1R3JA 3SPVB 4AL8L 5EDXA 2AXHA 2W91A 4I9WE 4U1SA 3EO0A 3R1GL 5D1ZD 5D7LD 5HGBB 4K71C 1U58A 3SGKA 1X6LA 4JRXE 3OAUH 2Q20A 5E8PA 5B8CC 2WV3A 4LVHB 4P5KA 1VDGA 1QBLL 1P6AB 3TYFA 4OZHE 43CAA 5I1EL 2ARJB 3FONB 1VFAB 3TBWB 2A9ML 1SMAA 5L7XH 1K3ZA 1G7PA 2H1PH 1A7BA 1FVEB 3OQ3B 4WHCA 5D7LE 1R3LA 1YEHH 4CVXA 1FO0L 1Y18A 3KAAA 1E0OB 2H8PB 1PFCA 3PWLB 5GRUL 3GKZA 1CVSC 5LKNA 1HZHH 1E4XH 4PJ9B 4JFFD 4UNUA 5FHAL 2APXA 2NY5C 3T2NL 2X4OA 2YPLD 3D3VB 4JPKH 1KJ2L 1IRAY 1CGSL 3NIGE 2RFXA 2N7AA 4KQ3L 1T22B 1K4DA 4I0PD 4DAGH 2Z35A 3SDYH 4LPUA 1Z0MA 5B38A 3VFVA 5D1QA 3I85A 1IKFH 2XTJB 2YPLE 2W0KA 1ROWA 1UXWA 2KH2B 4R4NC 4YXKL 3MRHA 1JPFB 1CGWA 4QCIB 4M7JH 1AKJB 3GSVB 5K33A 4JPVH 5HHNB 3QG7H 3VFWB 2PYFA 1SEQH 4RFOH 4ZG1A 5E08H 1AE6L 2B1AL 4XAWH 3UO1H 2GAZB 4LSPH 3S35H 2ICWB 4I3GA 1AFVH 4GS7B 4ELMF 3S9DB 1U3HD 4KKNA 4KHXL 3MXVL 4QHLB 4RAHA 4PJBA 4OI7A 4R4BA 4HWUA 5EU6D 4HCRA 1TQBB 4RWYH 3HR5A 5EH1A 4JDZA 4M93C 1SYSB 2E3VA 2JELL 4UTAH 2W9LA 3IFNL 32C2A 4WWKC 4J23A 4UDUB 5L8LB 4S2SB 5DUMH 4L29B 3FZUC 2NY7L 5CKAA 5EU6E 1G9NC 2DDQL 4JHWL 4PJGF 5JORA 4QRTB 3GHEL 2DF3A 2VLJB 1FN4A 3SPVA 3OZ9L 1OL0A 2FB4H 2D9QB 1GC1L 5SWQB 5MEPB 3CX5K 5JW5B 5EFIB 2J1KA 5HGBA 5DMYA 3G5XB 4TQEH 1QG3A 4M1CD 5B38G 5FGCB 4HWBH 1T03H 3TFKC 4X4YB 1YUHB 2ARJA 4ZPVB 3SO5A 5CJQL 1DSFL 4JJ5B 4MXQC 3B43A 3FONA 5EU7E 4ZOBA 4RMRA 4PJHB 1VFAA 3TBWA 4D0DB 3IXTB 4PY8J 1RUKH 4TTGA 2P5EB 5EOQL 3TP4A 4FFYH 2H8PA 1ZANL 4MS8C 4WV1C 1IGCH 2PO6C 3KVQA 5IVZB 2YMXL 1BGXL 4PJ9A 1HK6A 4BZYA 3L7FB 3HMWH 3D3VA 4X99B 5JOPD 3RWFB 4LIQH 1IT9L 5BCAA 4JG1L 1OTTD 1T22A 2WUBH 4JPIB 1X3DA 2BNRA 4UILL 1WF5A 4I2XB 3S4SB 3HI5L 1WBZB 2VLKB 1MLBB 1VEPA 3GMPB 5ALCH 1C8PA 1IILE 5FIEA 1DUYB 5JOPE 5GJTL 4LARL 3KPMB 3G6JF 1JPFA 2XYCA 1MWAL 4QCIA 1SBBA 3T3PF 2EXYD 3QUYD 2DTSA 1MI5D 1AKJA 5AYUH 2NY0C 3GSVA 1XIWD 5HHNA 3LEVL 3CFCL 4NC1E 2HAZA 4P59H 2GAZA 4G9FD 4MDIB 1MCIA 4HUNB 3I9GL 2DQDH 2ICWA 4WW2F 4XPHH 4F57H 3KLHD 3AM8C 1QZ1A 1UJTA 2ARWA 2AEWA 3DXAD 3NCBB 1X5AA 4FN0A 4QHLA 1J11A 2K7PA 1BHGA 1FAKT 2Y23A 1T7VA 4MQTB 4E5XA 1YA5A 4I8DA 3PDDA 2EDTA 2DJUA 5EU5A 1D9KB 4FQJL 3QIWB 1SYSA 4LAQL 8FABB 4CJ1A 5C71A 1KPRB 3DXAE 3V4VH 4M3KB 5EPMB 4UDUA 1DQLH 1K4CB 3BD4A 4S2SA 1HWHB 4G6FB 2JE8A 4L29A 5TE6H 4P46C 1U91B 1WTLA 1GGYA 2ORBH 3SGEI 5IGXH 3VFSB 3C6SB 4QRTA 4M5ZL 4XC1H 2VLJA 3D0LB 5B21A 1Y6NR 5KSBF 5SWQA 1NGPH 2B1HL 3NPSB 5MEPA 1A14H 5JW5A 5E70A 3DVIA 5EFIA 3RVXD 3VA6A 3CVHH 3G5XA 4YZFE 3MQIA 4YBHA 1R0AH 3ZKND 4X4YA 4YJZL 1YUHA 3U9PH 1NCCH 1CDUA 1N6VA 4JJ5A 4P3DB 4S1QL 4PJHA 4KTDL 3IXTA 2G75B 3EOBB 4KK8C 1GZPB 3EYUL 2P5EA 2D7PA 2X4RB 4IOFC 3AS1A 5J12B 3CD4A 3D9AL 3DX9B 3N85H 3SO3C 1D5ZB 1UCTA 4OLZL 1E4WL 3V5DB 5EU3B 4Q9QL 3B9DA 5IVZA 1BQUA 1J86A 2CUIA 3GKWH 3HUJE 1N7ML 3VRLE 1CF8L 1Y6KR 5EO1B 2E7CA 2MHAB 2NW3B 3LEXB 3L7FA 1YYLL 4X99A 3C8HA 3RWFA 5CS7A 5DEFB 2XZAL 1I9EA 1OD9A 2OR7A 4JPIA 5FCSH 5T5FH 1F90L 3I50L 1OW0C 1RZ7H 4I2XA 3S4SA 4TNWF 4RA0C 4WU7A 2X05A 2H26B 1YNTA 5DC9B 2WBJC 3EDJA 3VFOB 1JBJA 2B7DT 2VLKA 4JFDE 1MLBA 5TDPB 4DKDC 4QRPD 4NBZB 1XMWA 1KCRH 3DMMC 3GMPA 2F19L 1KCSL 3UEZA 4G8EB 4LBEA 3BH8B 4Y4FB 1J0KA 3U1SH 1DUYA 1FCGA 5SV4A 5GS0L 1GCFA 1CFTB 3KPMA 4HKJB 4OQTA 4CRPA 3BRDA 2VAJA 5F44A 4GAJH 2DQUL 3HB3D 3DOSA 4PJAA 3UCRA 4HS6B 4JFOB 5ADOL 3UMTA 4MDIA 4QRPE 2XKSA 4OCYH 4GBXD 5EOCJ 3QPQD 3BDYL 1AHWC 3P3YA 5E56A 4HKZB 1JHKL 3VWKB 4DKEL 2DLTA 3C87A 3BJLA 4S0SD 4QLRA 4XP4H 2HFFB 4JKPH 5C0AD 5MP6L 1CGTA 4P3CL 3N1QC 3AROA 1B6UA 4X9IA 3S3JA 3MRMB 1D9KA 3QIWA 3U4EB 2DLFH 3STBA 8FABA 3TZVB 3WIHA 2ICES 1KPRA 4QT5B 3CU1A 1FSKC 1NFDE 4YK4B 3O11B 5EPMA 2I9LB 2IJ0C 5LQBH 1K4CA 4DKFH 2QL1A 3MRFB 5HI4C 5C0AE 1H0DB 4FNLL 2QQKL 1R6VA 1U91A 5DMIH 1I8IB 3U7AA 1R3KB 4PJDF 2K1MA 2RGSA 2Y36L 1J05B 3JZ7A 3C6SA 3UYRH 3C2AL 1MFBL 3GSUB 1L0QA 3D0LA 5HXMA 2VABB 4HAGA 4QXGL 5ALBH 4M62H 4LLQB 1JL8A 3QO0B 2QSVA 3C5JB 1FRGL 3UC0H 2HRPL 3S4SG 3BT2H 1FNAA 3TO2B 1P84K 3TWCH 3V2AR 2ZPKH 3T04D 2Y06H 3BE1L 4Z7WF 2FCBA 2A6IA 1WIUA 1T5WB 2DTML 4P3DA 4PIRF 5C9JB 1EGJA 3MJ9L 2W60B 2Y4SA 5HVWA 3FO9B 2DB8A 2DQEH 2G75A 1GZPA 2QSCH 3EOBA 3SN6N 2X4RA 4R26H 5DLMH 4N5EC 2KL6A 3LRHA 3CFEB 3PJSA 2OK0L 3DX9A 1D5ZA 3QFJD 3EDEA 5GQBA 5FGSA 3V5DA 5EU3A 5JXED 12E8H 5CSBA 4UTBL 4JVUA 5EO1A 2MHAA 2NW3A 3DUSB 1WCQA 2WZPD 2OSLB 3DECA 3RVUD 3M45A 3GRWA 3QFJE 1QLEH 4KZEL 1P7QD 1MF2L 1DBKH 1MCOL 2IQ9H 4JO4L 5DJZB 2H26A 1V7NH 3VFOA 3VD4A 3ZL4H 5IUSA 5TDPA 5FO9B 5IMMB 4G8EA 3BH8A 2CH8A 1GAFL 2R2BB 1CFTA 4HKJA 1AR1D 5JUEL 3T77B 3X3FH 3B3IB 4U1JB 1J1PH 1VFUA 3H9SD 4HS6A 3FMGL 5CGYC 4JFOA 4O00A 1KN4H 3BD3A 2WIIB 1QBBA 3J7HA 1U2HA 3V6OA 1JF6A 2I5YL 3QQ9D 2HFGH 4Q6IC 1JMZA 3A0OA 4HKZA 2F5BL 3VWKA 3S98A 3H6JA 4R6UA 4OTXH 1GZQB 4RMQA 5CEYB 2IPTL 4GXVL 4P99A 2HFFA 5ANME 1EO8H 2RHEA 5C0GA 3H9SE 3RUGF 3OX8B 2AAVA 5FDYA 2EDKA 1OP5H 2Q7YB 4XP6H 3OB0H 5ESQA 5INDB 3MTRA 3MRMA 4FQQB 1S78C 4JO1H 3ARYA 3U4EA 4Z9KB 1ZVSB 5CILL 4QT5A 5FM5O 1JRHL 4Q9CA 4ZAKD 3O11A 2I9LA 4HXBH 1DBAH 2EC8A 3MRFA 5DEZA 4JB9L 4M7LH 1ZTXL 3CU7A 3SDAD 1I8IA 5GRWA 1R3KA 4ETQB 2ZUTA 1WV7T 1J05A 3UTTB 3GSUA 4U1LB 3BD5A 2VABA 3B2UD 3FCTB 2JTDA 4LL9A 4Y4HC 4GAYB 4LLQA 1ZLSH 3QO0A 3HR6A 3C5JA 1E6JL 1V8HA 4R0LC 1FFRA 4OF7A 3TO2A 3O2DA 4AEIH 5FUZH 1SJEB 4XCFL 1UG9A 4HF5H 4TN9A 1FYHB 1U8JB 5C9KA 3SCMD 3INUL 3KJ6H 5IVXF 5C9JA 1S7VA 1IAKB 2W60A 1X5ZA 3B9KB 3FO9A 1D7FA 2E7HA 3KPRB 1U8QB 3FN0H 3D0VB 1RIVH 3MO1B 4KI5F 5H94B 4LEXL 1MQKL 4DQOH 5ECJE 3C08L 5I1HL 3SOBH 2A0LD 3L5HA 4ZTOL 1BZ7A 1NBVH 2M26A 4JM2B 2CRMA 4IRSD 3O6FD 3RGVB 2X4SB 2ICCA 5EZJB 2O61B 4RMSA 2FX9H 2OSLA 4XCCL 4UINL 4UBDC 3TIEA 4I0PC 2OXHA 3VWJD 1FNHA 1DVFB 1J0JA 2Z4QB 4OGAC 5IB1A 3VJ6B 2OL3L 3LIZH 5DF0A 3W39B 1SVZA 1CTNA 2NY5L 3G6DL 4OIAA 4ODXA 5DJZA 4O58L 1T04B 2A1WL 5HHVL 4EN3D 1HKFA 2L7JA 5FO9A 3RIFK 5IMMA 3MR9B 4PUBL 1QYGL 4RNRB 3O3DB 1B90A 2R2BA 3RAJH 1KFAL 4OV5B 3T2PA 3T77A 1D6VH 2XFXB 3B3IA 3DURB 2Z9TA 4U1JA 4ODSH 3KR3L 5LGJB 2WAHA 2FEDD 1X5JA 3QJHB 5DHVB 5D7IF 2PW2B 1T2QH 4KUZH 3HZMB 1GZQA 5CEYA 1ZV5A 1RZJH 25C8L 4U4BA 2VDML 4L4VE 1UB5A 2NXYD 2VN4A 3OX8A 3CC5B 4IOSD 2RIKA 2Q7YA 5CKGA 5KOMC 4MD5A 4FQQA 4M6NH 1I9RH 1ZVSA 3GBMH 3IT8D 3U7WL 3QFDB 1NCUA 3SDCC 4X83A 4HWZB 4M7KH 1DBBH 3TT1H 1YYML 1ZLVK 3MJ8B 4YE4L 1NEUA 4Y88A 2COQA 4ETQA 5D96C 5F96L 4YDKL 1OWRM 3UTTA 3O3AB 4U1LA 4OZGF 3RIAK 5E6IC 3FCTA 5JDSB 5C6WH 2YA0A 1X5KA 4GAYA 1EHXA 4PS4L 4QXUH 2EDYA 3H8NA 4M1CC 5HPMA 2FBOJ 1UH2A 3NFSH 5AZ2H 3B83A 2H32B 4PJEB 4ZODA 2VZOA 3DYMA 3SJVB 1U8JA 4GLRI 2DQCH 5DFTA 3RWHA 3L5JA 1IGYB 3T4YB 5DRZB 1F6FB 3B9KA 3PUCA 4N90D 4KPHL 2QR0B 3KPRA 5D9SB 1U8QA 4XTRD 3D0VA 3BWAB 1Z3GH 5H94A 4WHDA 3PDGA 1GPOH 1HH9B 4ONHB 2YD1A 1LNUB 4UQ2B 2I9TB 3OAZH 4JM2A 2IFFH 2X4SA 2BJML 5EZJA 2O61A 3MV01 2R1WA 1JPTL 4UAOC 5I74B 3QUZB 4N90E 3VXOB 5HHOD 4PJCF 2Z4QA 3BIBX 2Z31D 3VJ6A 3V0VB 2BY1A 3K3QA 2DL9A 5T1DH 3W39A 4KVCL 2JB5L 2L7UA 3TH3T 4ORZC 1RQ5A 3IJHA 4Z18A 4FFZL 1T04A 3P4MB 1H3VA 4P2OD 4P9ML 4XZUA 3ESVF 4MAYB 4CN1A 3MR9A 4PD4K 4XHQA 5TQ0L 4RNRA 3O3DA 2DOCA 3QUYC 4HPYH 1J1XH 3AS2A 1JNNH 4M8VA 4NNYB 1XIWC 5HHOE 3GK8H 5E0QA 3MLXH 4OV5A 3VD9A 2XFXA 4NIKB 4RBPH 3DURA 3P0GB 4HUXB 4MGXA 4NCDA 4OF8A 3QPXH 5IB4A 3LQAH 5LGJA 2J8OA 4PV8B 1N6QH 4OCNC 3ALPA 3PHQB 4OF6A 1UCBH 4S1SH 5DHVA 3CMGA 4YXHL 3EKCA 5ESVB 2PW2A 1JFQH 3H2WA 3MNWB 3HZMA 3ZE2F 3WDHA 3VXQB 3CK0H 4LNRB 4N0CC 1F4YL 1C16B 2CDGB 1I3GL 1UWEL 4JRXB 3CC5A 2NY1C 4UQ3B 2R0KL 4G6AD 1L7IH 5LWYH 4XVSH 2R69H 2M1KA 4QGTA 3MLVH 3FB6B 4Q9BA 5IROA 4LSSL 2E6PA 4HWZA 3VXUB 3EUUA 1BWMA 4JLRB 2X70B 5D7LB 5IW3A 3MJ8A 3R0NA 3ZDZF 5CEZD 1I8LA 4G6KH 2R0WH 1PEZA 4JZOB 3O3AA 3MRJB 5I6XB 5JDSA 3EFFB 2R2EB 3VW3L 4G42B 3O0RL 4GRWF 2X1OA 3JWDH 5GPRA 3WHXB 5TF0A 5DR5H 4PJEA 1IKNA 4FZ8L 5HD8D 5CEZE 1EEQA 5F7NC 5E7FA 3BKCH 4CU7A 3VXPA 3SJVA 3G5VB 3GMRB 3OXSB 1IGML 4ODWB 3T4YA 5DRZA 1YNLL 3L5XL 4HWEL 2YPLB 2QR0A 5D9SA 4NQSB 2XTLA 4Q9RH 1ZSDB 4M03A 4U1GB 4XHJC 2WM0A 3EZJB 1HH9A 3WKMH 3LH2L 4ONHA 1JYXA 1LNUA 2I9TA 3P4NB 3D18B 5E9DD 5IK3B 3LB6D 5L88H 4XI5C 2CRIA 3AAZB 5DYOB 3BW9B 4MD0A 1DDHB 2ESVE 3WFZA 4JO2L 3QUZA 2D03H 4XNZB 4QTHB 2Q3ZA 5C0IB 3TCLB 4NKOB 2X89D 3DUHA 3IDIB 4PRID 3V0VA 4ZO9A 1LO4L 5I17B 2FD6L 4EOWL 5E9DE 3FTGB 1KOAA 1NGYA 2ZG2A 2CXKA 1FGVL 4MAYA 3V4UH 2DLEA 1X5HA 4W4NA 2BP3A 1HOCB 4NNYA 1HCVA 5DD6B 1U3HB 2FHBA 3P11L 1T1ZB 4NHCH 3KPQB 2GSIB 4PRIE 9CGTA 3KPPB 3PWVB 3GBNH 4HUXA 4DGYL 5JW3L 1CFNB 4DJMA 4L4TD 4GBXC 4PV8A 4YHLL 5EU6B 4Z7VF 3MGAA 3PHQA 3NAAH 4JGMA 4V1DA 1JWSB 5HYSB 1IGFH 1K6QL 4NWUL 3G04A 5JIPA 1HKLH 1S7WB 1ZOXA 3MNWA 4KU1A 2CXGA 2NXZD 3CSYA 5C6TL 1RURH 3O2VH 3MV7D 2QQNL 4LNRA 3TJHD 1S9YB 3UDWC 2CDGA 4JRXA 4L4TE 4UQ3A 1DQMH 3IJSB 3LEYH 4X6CB 4Y4KC 4XPFH 4IOIB 4FQXD 2NY3B 1QFHA 1ITCA 3FB6A 4LPYA 5HDBF 4XPAH 1JWMB 1T89A 5I0DA 3VXUA 3F62A 1RK0B 3MV7E 4WO4B 4JLRA 2X70A 5D7LA 3EYFA 4L9LB 2FSEB 2ZUQC 4M43L 4YWGL 3DNKA 3SE8H 3RWIB 3HC4L 4JZOA 3MRJA 4JFXB 2W0PA 1Q1JH 4HIIA 3LKRB 3RWEB 4H0IA 3EFFA 2R2EA 3GIZH 4G42A 5I30H 1OT1A 5K9QG 3QNZB 1J0IA 4ZS6D 3WHXA 1QBAA 4MXWH 5T3XH 1VENA 4Z95H 1BJ8A 4KI1A 3AY4C 4P5TD 4NQXA 3MXWH 3ZLQC 3N9GL 3GMRA 5FKAB 3OXSA 3SKMB 4ODWA 3VCLB 4LPWA 1PLGH 3QUXD 2QSTA 3UZVB 3RJDA 4LU5L 5J7CC 2E5EA 3MBEC 3VFGH 3WXVH 2F53D 1T0PB 2YPLA 3ECBB 4NQSA 4FQIL 5JIHA 5IF0B 1ZSDA 4WEBL 4L8SA 2Y1VA 4ELME 4NO2B 2CKBL 1V7MH 4MJ6B 1XF3B 3P4NA 3D18A 5IK3A 1JNJA 4YHMH 3AAZA 2P1YA 1BJ1J 1NFIB 3E6HB 5DYOA 3BW9A 4PJXB 1DDHA 2IWGA 3QRGH 1AXTH 1DFBH 1I7RB 1OTUC 4QTHA 5C0IA 3QCVH 1WFTA 2XXMB 4NKOA 3IDIA 1TJIH 5KSVB 5I17A 4PJ8B 5HHQB 1G6RH 1TQCC 1QSED 3FTGA 4RCAA 4ZTPH 3UAJC 4YBLB 1HOCA 5I15L 3MLZL 4N5UA 4CVWA 2VZ3A 4G3YH 4PJGE 5GGVH 1JI2A 5DD6A 1T1ZA 1M7IB 3KPQA 2GSIA 3KPPA 3PWVA 4KK6D 2GEEA 1CFNA 5FA3B 1LE9B 1QSEE 4WWID 5EU6A 1S5HB 1JWSA 4BQ6A 3T2OA 2ZNXA 1S7WA 2WWKO 1C7SA 1P7KB 1DBMH 2IGFH 3WFDL 1S9YA 5B39A 3E3QE 2OI9B 2RAMA 3EHBD 3IJSA 4X6CA 4BJLA 1T21B 4IOIA 2HKHL 3ETBF 5IEKB 1IFHL 2FEEI 3IDNB 4QWWD 1JZ8A 2DLGA 1JWMA 1KGCD 5JIKA 3WO4C 4MJ2A 1DL7H 3DBXB 4WO4A 5HI3D 4ODVH 1EMTH 4L9LA 2FSEA 2R0ZL 4B0MM 4FTVB 1MCKA 3FOLB 3RWIA 3NH7L 1DBJH 4JFXA 1DQDH 4TTDD 3RBGA 4RGOL 3TVMD 3UPAA 3LKRA 4EI6B 5ICYB 1EEZB 1Z0NA 3P0VH 2B5IB 2VDKL 3QEQD 4LQFH 2R8SL 5BRZE 5F89A 3QNZA 2I60L 1TJGH 1OAYL 3QXDB 5T3ZD 4ZO6A 3G6JE 3QUMH 5IV2B 5FKAA 4QYOB 3JV0A 3SGDH 3SKMA 3T3PE 3VCLA 1YEIH 2YKLH 1U3JA 4JFDB 5CLWA 1KCKA 3WJLC 5KSAC 3BQUC 3QEQE 5DRWB 5ACMA 1NUFA 1P84J 3ECBA 1SEBB 3Q6GH 5IF0A 2A0LC 1BFVH 4KRPC 1M7DB 2DKMA 4FQLL 4CVZA 1CK0L 5T3ZE 4NO2A 4MJ6A 1XF3A 3MUJA 4MNHB 3QYCA 4JR9H 3E6HA 5DC4B 3P0YL 4QRPB 3VD5A 5ITBH 4PJXA 4K2UH 5DHXB 1A5FL 5B39G 1I7RA 1N4XL 5EC1B 2IBGA 4YQXL 5EC2B 3DO7B 1KCLA 1U3YA 5KSVA 1CFBA 4PJ8A 5HHQA 1X5LA 4S1RH 2FJFB 3REVB 1RUMH 4MJIE 5DMGC 4HG4K 1UA6L 4LCWE 3T09A 4YHOH 3V0AC 1G9ML 3WN5B 4Y0GA 1NFDB 3N1FC 4K7PH 3WFBH 3DUUB 2VDLH 3WFEL 4FRWA 1WZMA 3RIFF 4FABL 3DO3A 1CGVA 4N1CA 5KSBE 1DQJB 3SE4C 3DETD 5FA3A 4X5XB 1LE9A 3IETB 1S5HA 4IMLB 1HYSD 1RJCA 4K3JL 3MCLL 1DE4B 1KG0B 4GT7A 1INEH 3ZHLA 4H5SA 3QHFH 4KFZC 1L7TL 1P7KA 2AK1H 1F58H 4ZNCD 1S3KL 3LDBB 3MACH 5CAYB 5ADPL 1JGVH 4HH9B 2ZJSH 4TOYL 2MOVA 1FFNB 1QSFE 4XXDB 2OR9L 1T21A 3K2UL 2KUTA 4KY1H 5IEKA 1BWWA 3IDNA 1FVDB 2L4OA 5E6YA 4NQDD 1LK3H 3WIIH 3KWWB 3RU8L 1PKOA 3FFDB 3DBXA 3BPOC 1IARB 1DANT 4PRHA 5SX5H 3I84A 1M1SA 4WFFE 3GFUA 2CO7B 5TE7H 5BO1L 4FTVA 3FOLA 3RZCB 1D6EB 3CDCA 4JY5H 5F7LB 4Y1AD 1NAML 1I7TB 3PGFH 3MA9L 4PJHF 4EI6A 5ICYA 2A6DB 1EEZA 4NQDE 3ARED 3MLWL 1NJ9B 4G8IB 1PG7L 1RJZB 2WUCL 5F6HI 3RIAF 3QXDA 5B4MD 4CKVX 4MCYB 3O4OB 2R4RL 3K4ZA 4OFYA 1BREA 3IYLW 2P42B 5IV2A 1VHPA 4QYOA 4A6YB 4BSVB 1Q38A 4JFDA 1FAIL 3ARQA 2DD8H 5TGBA 5IIEB 4YUEH 5DRWA 1DCLA 1SEBA 2BK8A 4XPTL 4J6RL 3K8LA 4X80H 5E2TL 4X7EC 1M7DA 4F58L 4LPVA 1QRNE 3GB7B 2VERN 3BZ4B 3KHOA 2DQTH 4RIRB 1MRFH 2VYRE 2R4SL 4WI2A 4MNHA 4Z7OF 1CICB 4IIQA 4OKVB 4QRPA 5C2BL 5KN5B 1RUAH 1N64L 2Z31C 2DM7A 1J7VR 5EC1A 4HUWB 2HT2D 4FQHA 1C5CL 5EC2A 1ADQA 3DO7A 4PJAF 1AI1L 5C0FB 4XP5H 2GJJA 4TUOB 3LKOB 4Z7UF 3ARBD 5ID1B 2AP2A 3L3GB 4PBWD 2LVEA 3F58H 1P1ZB 4ERSL 4M6AA 5JQHC 4HKXB 3REVA 2W9EL 5F88B 4PJDE 2ICWJ 3P30H 3WN5A 1IMHC 1NFDA 3IVKB 1OD7A 3IJYB 3QDHA 3DUUA 1NMCC 3LPFA 4YPGB 3T0ED 3JBG7 4X5XA 3QIBB 5E8OB 2VZTA 3IETA 2YUZA 1L0YA 1NBQA 4IMLA 1EERB 4R7NB 1F4WL 3TGXA 1DE4A 1KG0A 2OZ4L 3QULA 2FECL 3LMJL 2BMKB 1XF4B 4P2QD 4Z7WE 4ZAKB 3GMNB 4HH9A 3ME0A 1B4JL 4G6AC 5IW1A 2QADC 3T0EE 1FPTH 1CN4A 2ED7A 5GJSL 4FXGB 4N68A 1FFNA 1I1AC 4XXDA 4OBRA 1KIRA 5I0ZA 5GGSY 4R9HA 3HE6D 1FVDA 2ZUVA 5CBEB 4NUGL 3KWWA 2A9MH 4X7SH 3DYPA 4UZGA 3MRLB 4NUJB 3THMH 4P2QE 3FFDA 1A7PL 3N1PC 2PTTB 1CXEA 3WBDA 4IBLT 1FO0H 2BSED 2W59A 3U4AA 1B4RA 2UV3A 1D6EA 3RZCA 3MV8D 3LZFH 4PRAB 3DWTA 1U95B 1I7TA 3WD5L 3SCMB 4PGJA 4PRPD 1Y6MR 1UEYA 4G8IA 5IHBA 4TSCL 4U7KA 1KJ2H 1YJDC 2BCKB 2DQHH 4HUKB 5DK3A 1RJZA 1BF2A 1U8PB 5DJYB 1GSMA 3NCEB 1CGSH 3FB7B 2NMSA 1P9MA 4Y2DC 4LF3B 3LS4H 3MV8E 1JYVA 5DUPL 2IMNA 2P4AB 4A6YA 4EXPX 5C7XL 4BSVA 2GIYA 4OD1L 1NC4B 5EUOF 1JZ6A 4WTZG 1LO5B 4WTWA 1G7HB 2BVPB 4XXCC 3PGCB 3VXME 1CFVH 5IJKC 5TFSH 4BQ8A 3SHSA 3GB7A 3BZ4A 4M9OA 4RIRA 1BBDH 1CICA 2XPGB 4EN3B 5HI5D 4OKVA 1WTGT 4AMKL 5KN5A 3RUGE 4EQ2A 1FVCB 1LWRA 1NEZB 3L3DB 1NC2D 3H7LA 2CLVB 5MENB 4JZNB 1BVLB 2VISB 3NABH 3I6GB 3ET9F 5EWIL 5T1KB 1D5IL 4PJ7F 2V9TA 3CIQA 3O9WD 5C0FA 4MMZC 5DXWA 1B0RB 4GQPH 4TUOA 3LKOA 1GHFH 4L4VB 3L3GA 5ID1A 5IQ7H 4X4XB 1P1ZA 1Z9OA 1KLFA 3MRKB 1LEKA 3O6MH 3OAUL 4MA7L 5CSZB 1K3IA 1RK1B 1I1RA 1JPSH 5F88A 2JELH 1EHLL 1WWWX 5I8OH 2LE9A 3IVKA 3IJYA 3SGJA 3MYZA 3QDAA 4YPGA 1M05A 1E4JA 1I85C 2NY7H 3QIBA 2H1PL 4F7MB 3DLQR 3RNQA 3OJMB 5C3LD 2J3SA 4KAQH 4R7NA 2ZUYA 3RVWD 2EEBA 4WGWB 4ACPA 4KGJA 3E6FB 4WWKB 2BDNL 4FHBD 2BMKA 3VFTA 1XF4A 4NJ9L 3EAKA 4ZAKA 3GMNA 1HZHL 3QHTC 4KK5C 5IVXE 3EJZC 1JHLH 3FQUB 1JIBA 4FXGA 3VMPA 4LSRH 2APVA 1AD0B 2D0FA 3FT2B 3MREA 4KI5E 4GRMB 5MI0C 1DSFH 1BQLL 4DAGL 2X4NB 4LLUB 2BOCB 4P4KC 5CBEA 3SDYL 3MRLA 4NUJA 5H37G 3T65B 2PTTA 1IKFL 5EZLB 1A7NH 1QNZL 4PRAA 3I2CL 1U95A 5BW7A 2YD8A 4M7JL 1N5AB 5CZKA 2YMXH 3ESUF 4YFDB 4ZS6C 4JPVL 3QG7L 1SEQL 4RFOL 4DCQA 1FZMB 5E08L 1W72B 4XAWL 3UO1L 4LSPL 2BCKA 1RZJC 1U8PA 5DJYA 3S35L 5CIPB 3TPUB 1NCTA 3R0MA 1TPXC 2HMIC 3RL1A 3HI5H 4APQB 1KN2H 3KPSD 3A6BH 2OMNA 4DWHA 3S96B 1NC4A 1CDGA 4BQBA 3QEGH 1SMOA 1YY9C 4RWYL 1LO5A 1G7HA 2BVPA 4UOW0 3PGCA 3OG4B 1GH7A 4UTAL 5D7IE 5ISZD 3EOTH 5CMAB 2J6EA 3CFCH 3R06B 3KPSE 5AEAA 5DUML 4LKXB 2XPGA 4P2OB 1KJ3H 4NNXB 1S7XB 1MFDH 4MLSA 4TVPH 4JQIL 4X0KB 1CLYH 1IC4H 2A2QT 1FVCA 4NZTH 1KPUB 2Z91B 3L3DA 5IOPB 5MENA 4JZNA 1BVLA 2VISA 3HG1E 3I6GA 5T1KA 1WUNT 4ODTL 1ZA3B 5HYEA 5ISZE 2FB4L 1B0RA 4BQCA 4IRJC 3QWRD 1DJSA 3CMOL 4L4VA 1FZOA 1R5VA 4AG4H 4X4XA 2EKSB 3ILQC 3OF6A 3MRKA 1ED3B 4TQEL 2P44B 4FQJH 5CSZA 1RK1A 3CCHB 4DOHE 4HWBL 5F6HJ 4KK6C 1T03L 5FGBC 4OZGE 4Q74A 4ENED 4ZSOE 5K9OB 3QNYA 4YGVB 2F5AH 3U9UB 2VE6B 4F7MA 1RUKL 5DJCA 3EYQC 3HNSH 1R5IB 4N0YH 4NJAH 1OT2A 4HCRH 2YRPA 4LCCC 4F15C 3ARFD 3RHWK 1EO5A 3E6FA 4WWKA 1IGCL 2B1HH 4TYUA 2UZYB 4PYGA 1YC8A 3JV5A 5FF6B 3STZB 2FJHB 4FQPA 3FQUA 5SX4I 1CWVA 3SE3C 3B9VA 3W2DH 1B9ZA 3CFDB 3IDMB 4QWWC 1AD0A 3RX7A 5JZ7C 4YEEA 1RJYB 5K9QI 4GRMA 4NOFA 2WUBL 4J3SA 4S1QH 2X4NA 4LLUA 2BOCA 3HE7D 4HQQH 1F3DH 4KTDH 3T65A 4OLUL 3LN5B 3PABB 5ALCL 1SJVA 5EZLA 3LQAC 4EDWH 4OLZH 1HXYB 5D7JB 3SQOH 1E4WH 1J1OH 4PJCE 3KDMA 3C5ZC 1N5AA 1N7MH 4G7YH 5AYUL 2DBLH 1CT8B 1MAJA 2VDNH 1FZMA 1W72A 4ZDHB 2ESVB 4P59L 2BVTA 3HTLX 3S34H 3SO3B 2DQDL 4F57L 5CIPA 2XZAH 3TPUA 5K93A 2FRGP 5GGSB 4NCC1 2OTUA 1OP9A 4JM2F 4APQA 1TZGH 4P23C 4RGMC 3S96A 2ATPB 5LJYH 5MEQB 4EXKA 2IBBA 2V2TB 2F19H 3UTPD 1CIUA 4HEME 2I25N 4M6MH 3UTQB 2AVGA 4MNGE 4PRIB 1ZHBB 3T4AA 3ZE2E 3U7YL 1DQLL 5CMAA 1AD9B 3HA0A 2X44D 3R06A 4XNYL 5C2UB 4LKXA 3LQZA 4UOJA 4P2OA 4NNXA 1S7XA 4X0KA 3KG5A 3FO2B 3UTPE 3QIUD 1KPUA 2Z91A 4J2XA 4NQVB 5BXFB 3BDYH 3JWDC 5IOPA 1JHKH 4DKEH 3O6KH 1J8KA 4XC1L 5IEHB 1ZA3A 4OFKA 1SBSH 1J18A 1NGPL 4YBQD 4DW2L 1A14L 1RIHH 4X6DF 5D93B 2EKSA 1T2JA 3CVHL 1ED3A 4QRRD 5HYFA 1KTDB 3AM8A 5DD0L 3ZDZE 1KT2A 3CCHA 1R0AL 4GAGL 3RY4A 3U9PL 3MLYH 3DETC 1L6XA 2NXZB 2GK0B 1QTYT 5K9OA 3MV7B 1LK2B 4YGVA 5GXBB 2E7MA 3U9UA 4GRWE 5I1AB 2VE6A 1HYSC 2YD5A 3ALWA 4PLJC 3MUY1 5EOTB 1A3QA 1R5IA 2Y36H 4QRRE 4H0GA 3RQ3A 3VGFA 1MFBH 5ABDE 4C83B 3O4LD 1FSKB 1AO7D 2NY2D 5C70A 1BVKB 3HAEB 3TH2T 3RTQB 4F9PC 1T1XB 2FDBP 3BZDA 5J06A 3STZA 3CLEL 5FF6A 5GGTA 2FJHA 4XVTL 2ZOLA 5DJ6B 3CFDA 3IDMA 5F1KC 5DJAA 1U8NB 1AP2B 2CDFB 2EDHA 1MFEH 4YHPA 3VGEA 1RJYA 4KKBD 3BE1H 3C8KB 3O4LE 1IVLA 1AO7E 2DTMH 3TV3H 1RZ7L 3OTTA 5M94B 3MJ9H 4QHMB 1G1YA 1CQYA 3LS5H 3LN5A 3PABA 3K74B 4PREB 3U1SL 1UWGL 1HXYA 5D7JA 4Y5XC 2XACC 1A7OH 4ELMB 5D8JH 4GAJL 4LVNC 4OM1L 1MIMH 2CKBB 1CT8A 4MSWB 5MEOB 4E41B 3V6FB 2Q6WB 4ZDHA 2ESVA 5EZIH 2XXCB 4OCYL 4KZEH 5GGSA 5FXCH 5D70L 1MF2H 1OARH 2EDXA 5C6PB 4HDIB 5ACZB 1A7QH 4XP4L 5JLZB 3Q5TA 4X7CC 4JKPL 5JPNB 5E5RB 2ATPA 4RISL 4UV7H 2V2TA 3GSWB 5C0BB 1GAFH 1UZ6F 3T0XA 5HSFA 1WSST 4PJGB 4NQED 4XAKD 1OW0A 3UTQA 4PJIF 4I18B 4OZFB 2IPUG 5LQBL 3WMSA 1AD9A 4DKFL 2V2XB 5FUCE 4U49A 3FO2A 1TNNA 1EFQA 4DVBB 5MERA 3SKJL 4NQVA 2F8VA 4LGPB 5BXFA 3OV6A 4J3WA 2F5BH 4U7MA 3NMEA 3EDFA 4NQEE 3N1MC 1CXHA 5IEHA 4XAKE 2VZSA 3ARBC 2O26U 2VZVA 2YPKB 5ALBL 3WV0A 5DURD 5HDBE 3VG0H 3QRFM 2XQBL 5GRYA 2A9NH 4XPBH 5LGKA 1H8NA 3UC0L 4UV4H 3BT2L 1IQWH 1KTDA 4Q6IB 3TWCL 1YEKL 3D39E 3ULUH 4HUVA 2ZPKL 4MCZB 5CILH 4PFEA 2Y06L 1LILA 4N8CH 5DA0B 4ZFOB 4FQ1H 2GK0A 4P49A 3MOBL 4BH7B 1CLZH 1LK2A 1E4KC 4AIZB 4XMLL 5I1AA 1U8MB 5EOTA 1SVCP 5DLML 1I9IH 2X2YA 4L8DB 4JKLA 1BVKA 5B22A 3HAEA 2HJLB 2EDOA 12E8L 4N1HB 3RTQA 5F8RC 3WIHH 1T1XA 3JWNC 1E6JH 5BRZB 5D1QD 4I3SL 3RBSA 4YHIB 5DJ6A 1F6AB 5I1LB 2WK2A 3T3MF 1U8NA 1AP2A 2CDFA 4PJFB 5A2JH 2OJZL 3G6JB 5JNYB 5E8NB 3C8KA 1QLEL 1KB5B 1ZAGA 1NANH 3JVGC 3TVMB 1DBKL 2YA1A 2IQ9L 4YDLC 4QHMA 1V7NL 1JUFB 4R0LB 4NRZB 4FFVC 4G8FA 4KKLD 4HJGB 1WLHA 4I77H 4PREA 2GY7B 1MQKH 4WW2B 4YNYB 2IAMD 2HP4A 4ELMA 4QXTA 4WI7A 5CEZL 3X3FL 1S9KC 5E99H 2CKBA 2X5PA 3P4OB 3TA3B 4MSWA 4KRNA 3NOIA 5MEOA 4E41A 5D2NC 3V6FA 5EO9B 4U6HB 2Q6WA 4Y16D 1AJ7H 4XCCH 1H8OA 4PRDB 1U8HB 5DMJB 1GGCH 2AW2A 1A02N 1AC6A 2HFGL 3OR7B 4X8JA 3EOYG 3REWB 2J12B 3K0WA 4EUPB 4OTXL 2HJFB 4LCIL 4HDIA 5ACZA 4O58H 1YJDL 1QQDA 5JLZA 1FBIH 1EO8L 5JPNA 3GSWA 4PUBH 5C0BA 4M7LT 3S8WA 1NCNA 4MJIB 1GGIL 3BKJH 4XP6L 4LCWB 4MD4B 4JO1L 3O8XC 4PJGA 4QHUB 1KFAH 3DJ9A 2VLLB 4DTGL 3WLBA 3W5MA 2F54B 1OF2B 2LU4A 4OZFA 5KSBB 4OZIA 1BX2B 4HXBL 1DBAL 3KR3H 4MQXC 1FIEA 4XMPL 2BNQB 2V2XA 4AEHH 1KENH 3HAEG 3RX8A 4MA1B 4JEGB 3HLAB 4DVBA 3F8UB 1OSPH 2VITB 1Q72H 2AGJH 5BZDB 2VXSH 3M07A 3BH9B 3O9WC 2X4PB 1UACH 2YPKA 3GM8A 1ZLSL 3GI8L 4XMKH 4WFGE 3ZYZA 3MLUL 4UT9H 4ESKA 3VI3F 5E94B 3KYOB 1EAJA 1QSFB 4Q6IA 1SY6L 5FUZL 1MJUL 4MCZA 5E1AB 4HF5L 4CMHB 4ZFOA 4GG8A 4PJ9D 3KJ6L 4OFDA 5F3HB 4BH7A 4BH8B 4AIZA 5EA0H 3D3VD 5J1AA 4HAFA 1U8MA 1T0MB 5F96H 1NGXB 3ARGC 2VIRB 3UP1A 2B8OT 2HT3D 4L8DA 1RIVL 4M61B 1MNUL 4ODUB 1NL0L 4DQOL 3S97C 3SDCB 2BNRD 4H8WH 3SOBL 2HJLA 4HEPG 4PS4H 5IJVB 2EEDA 2XY1A 2CK2A 1OQOA 5BRZA 1KYOK 1I75A 1YQVL 5D96B 2XTJD 3JWOL 2FX9L 5I1LA 2GY5A 5A40E 4RX4A 4Y2OA 3QUKB 4PJFA 3ISWA 5E6IB 3SBWC 6FABL 3G6JA 5JNYA 2JJWA 5E8NA 3T1FB 3LIZL 3K4AA 1CGXA 43C9A 3PE9A 3S7GA 1KB5A 1ONQB 2BNRE 3TVMA 2WWMD 4N8VA 5EORL 2NZ9C 4R0LA 5F9WB 2KZWA 4NRZA 4S1DC 1R5WB 2VZUA 4K9EL 3BP5B 1KCVL 2XTJE 3K8MA 3OAYH 4WW2A 3UZQA 4YNYA 4HMEA 5AG9A 1J0ZA 1QRNB 3BIKB 3DI2B 1QD0A 3PV6B 2YC1A 3TBTB 4PV9B 3TA3A 2JKXA 2HT4D 3P4OA 5FO8B 2BJMH 4QGYA 4ODSL 1X4XA 1JPTH 3ZMRA 5EO9A 4R97C 5DD5H 4PRDA 1Z9LA 1U8HA 4UT7H 4OI8A 5FO7B 3OR7A 4I4WB 3REWA 4YHZH 1T2QL 4KUZL 4EUPA 3KLSA 2HJFA 3MRDB 1QHPA 1C5BH 1RZJL 4AK1A 4P9MH 4PJXF 3B5TA 3OG6B 5TF1H 4NP4H 4MJIA 2Y07H 4KTEH 2CUMA 2OCFD 1XT5A 4LCWA 4MD4A 3P40A 4QHUA 1I9RL 1ZA6A 1BPVA 4N1EA 4CMMB 3GBML 2F54A 1OF2A 1HSBB 5KSBA 1BX2A 4M7KL 2VDQH 5I75C 4G8GD 4O4YH 2HTLD 2BNQA 3TT1L 2BFVL 2IQAA 4GKOA 3AMKA 3HLAA 2VITA 1NMAL 5BZDA 5GSVB 3BH9A 4G6JH 4NZRL 2IPUK 1SM3H 4AEEA 3DRQB 4Q7DA 4OGZA 3CXDH 4Z7WB 2X41A 1F4YH 1JTPA 1Q94B 4JREC 3T0EB 2UZXB 2P5ED 4G8GE 3GMQB 1OTSD 5E94A 3KYOA 3BUTA 1QSFA 3NFSL 4N8VG 5AZ2L 1K9TA 3K1DA 5E1AA 1MLCB 4ENEC 3DARA 2HYMA 4YDJB 5F72S 3BZEB 4LHUB 2X9YA 4GRLC 2XIDA 4LPTA 2DQCL 4P2QB 4WEMB 5F3HA 1WT5A 4BH8A 4PJHE 4LLDB 3WIFB 4MVBC 2HLFD 3ARFC 2LQRA 4YLQT 4EI5C 1T0MA 3KYMB 1NGXA 4QKXB 4M61A 1Z3GL 5J11C 3C60C 3IDJB 1ZHLB 2VSDA 4MNQB 5DRXB 1GPOL 3SDCA 5GS1B 2ILLA 4LLWA 5IJVA 3O0RH 1U0QA 4JFPB 2VLKD 4ZUSB 2IFFL 4X5WB 2MPAH 4NSKB 4EUPG 1MREH 2LTQC 3RHWF 1F11B 3BGAA 5HHMB 5KOVC 2E9BA 1CFSB 3QUKA 4C55A 4KK9D 1JGDA 4Y19E 5E6IA 5CD5C 4CADB 1DLHB 4NCC2 3MV8B 3T1FA 4LVOC 4GSDH 1IGMH 1ONQA 4D3CL 2EZ0D 1U8LB 5T1LB 4KWUA 4CDHA 1YNLH 3L5XH 2VLKE 4Z7OE 3BP5A 4AM0A 1MVUB 2EDNA 1KC5H 3RI5K 3VXMB 3O81A 5JA8B 4HPYL 1J1XL 1JNNL 1QRNA 3GK8L 3MLXL 3DV4B 3PV6A 3MZTA 3TBTA 3SE9H 5IHZB 4PV9A 1JRHI 4PJAE 3ULVH 5FO8A 3QPXL 4O2CB 3F6LA 4D8PB 3CVIH 3QCTL 4Z7UE 2FHCA 3RUGB 3ZDXF 2EH7H 4JO2H 4I13B 3QIWD 5ENWA 5FO7A 4H1LB 3TLRA 1EBPA 4KVNH 1A9BA 2X1WL 1JFQL 5KW9H 4EOWH 5KANG 3CK0L 2HH0H 1W8NA 4G6FD 2H3NB 2D2OA 3B6SB 3I75B 2YD7A 1RFDL 1L7IL 5LWYL 1NC2B 2QHRL 2R69L 4CMMA 2GCYB 5E5MB 1GOFA 3MLVL 5IM7B 2HTKC 5JW3H 1HSBA 3ZKXB 5I71C 4YHLH 4HK0B 2DIBA 5KAQF 3C9NB 1K6QH 3O3EA 3S36H 4G6KL 2R0WL 5DDHB 1FDLH 4D9RD 2Z8VC 1H3XA 2PW1B 1TTGA 4Z7WA 3TN0B 4KJPC 1Q94A 3L1OL 1C1EL 3MRGB 4MJ5B 3JWDL 5T33H 1G7QB 3DVNB 7CGTA 3GMQA 1J87A 3BUYB 3L6FB 1MLCA 2F8OA 4YDJA 3BKCL 3GEWB 3FOMB 4LHUA 3VRIB 1G0DA 4D9RE 4C57C 3G5ZB 4QNPF 3RZWA 1CDIA 5T1MB 3WIFA 4B5EA 5CP3H 1PD6A 3KYMA 5J56B 3HC4H 4Q6YA 2YD6A 1VEOA 3BN9C 4Q9RL 3IDJA 1ZHLA 4MNQA 5DRXA 2GI7A 5GS1A 4P57B 3PP3H 4J4PC 5HVHB 3R4DA 1QSZA 3ES6B 2C4FT 4JFPA 4ZUSA 3MLPA 4X5WA 3PF2A 4ZFZB 2XKUA 1M71B 4NSKA 5EUOE 1F11A 2HVJB 3AFLA 2D03L 1SYVB 2QEJA 3QZWB 4XCYB 4CADA 4EZMA 3HPJB 3MV8A 3N9GH 4WTXA 4GAFB 3QH3B 1U8LA 5T1LA 2EIZB 3OKNB 3AXLB 1MVUA 5BOPA 3V4UL 3CZJA 4NKMB 5LCVH 3VXMA 4ZXBC 3VWKD 5D7IB 3AS3A 4WEBH 4TSAL 2H32H 5E95B 1Q9KB 3NGBC 5HHXH 1OWWA 4JANB 4YHKL 4NHCL 3DV4A 3V5HB 4PJ7E 5IHZA 2J8UA 3GBNL 3KPSB 3MBEB 4D8PA 1QFWM 1ZLWH 3RUGA 3Q5YA 1B0GB 3V6OE 4TUKL 3NAAL 2D7NA 3U36A 5HGDB 3HG1B 5C86A 3LHPL 4H1LA 5KVMC 3K4DA 1HKLL 3IKCB 5ISZB 3WLWD 2RB8A 3GDBA 1PY9A 5GIRB 3O2VL 1OAQH 2H3NA 4LHUG 3I75A 5IW6B 4PB0H 2UVEA 2MQCA 3BP6A 1DQML 3MLZH 3EJYD 5H2BB 5FYLE 4BUGA 1NC2A 5I76B 2GCYA 3SKNA 5E5MA 1WEJH 4OZGB 5IM7A 4ELKB 4XPAL 1TQCB 2ZCKL 4X4ZA 3K8KA 1HXMB 2APWA 4TPRH 4HK0A 1KSRA 3AB0C 4LP4A 3T0BA 3C9NA 1CBVL 3SE8L 5DDHA 4CU8A 2PW1A 1Q1JL 1TMCB 3TN0A 3WFDH 3CUPB 4LRNH 1EJ6A 5I30L 3MRGA 1G7QA 5CEXB 3DVNA 1GYAA 2RJMA 4MXWL 3BUYA 5T3XL 3FL7A 3L6FA 5DQDH 1IFHH 2AKRB 4O2FB 3HS0B 3QDJA 2X4TB 3FOMA 1EDQA 3MXWL 3VRIA 2BHZA 1ZT1B 3UDWA 1KB9J 1DR9A 1GGTA 3G5ZA 4JY6A 3UYOD 4R2GB 3MLTB 5T1MA 1LE5B 1MHCA 5TQ2L 3VFGL 3S37H 3WXVL 5D1XB 2MJWA 2WIMA 1KTKE 4GG6B 1JVKA 3QEUB 4PJCB 5FYKD 4RGOH 3WO4B 4B7LA 2VZ1A 4P57A 1X5IA 1V7ML 4K3EH 4NZDA 4OF3A 4H1LG 2R8SH 2NR6D 3ES6A 1XAUA 4YHML 4YO0B 4P2RA 4ZFZA 1M71A 3ABZA 4J1UB 3AMLA 3V7AG 1WQVT 2HVJA 3QRGL 1DFBL 5IBTH 1MCWM 1SYVA 2E8YA 3QZWA 4XCYA 1A1MB 3QCVL 3HPJA 5FYKE 4FXLA 2AS5M 1IAOB 1XH3B 2AJSH 3JSSA 1G6RL 2J8HA 2EIZA 4QHKI 2MCG1 1F8TH 4JRYE 1C7TA 3AXLA 3OKNA 4ZTPL 4NKMA 4KXZI 4Q0XH 1XGPB 4U0RB 5D7IA 4G3YL 1CK0H 1Q9KA 4JANA 4YR6B 5J13C 5IVNA 3E2HC 5FDWB 5IR1A 3V5HA 1UYWL 3OR6B 4TNVK 3ARVA 5IKCB 3MBEA 4QRQB 5KSAB 3BQUB 3P0YH 5E00B 2NX5B 2YXMA 3OJ2C 2BVQB 1N4XH 4QY8B 4H26B 3HG1A 3W11D 4YQXH 4MA3A 3QQ4B 3IKCA 5EBGA 5ISZA 1U6AH 4PLKD 4ZFFB 5GIRA 1NFKA 1DBML 2IGFL 4UT6L 1ETZB 5IW6A 3M8OL 5GS2D 3HC0B 4G5ZH 4WCYL 2YSSB 5DJ0B 5H2BA 1TVBA 1UA6H 5E6ZA 3UTTD 5HHPB 1G9MH 5I76A 4OZGA 4HWBA 5F7KC 3RDTB 4ELKA 1GRWA 5J4MA 4FABH 4P4RB 1KJVB 1HXMA 1DL7L 4GRWB 4N9GB 4LVHC 1EMTL 2DI7A 4K3JH 3MCLH 1AGBB 5J6GB 5F1SA 35C8H 3PHOB 3U4BH 3UTTE 1Q8MA 5A3ID 1HH6B 1DQDL 1S3KH 4XNUH 2RCSL 3CUPA 4OGXH 5EB9A 3QZWG 3P0VL 3BGFB 3WFHB 1T80A 3O41B 4TOYH 1Y0LB 5CEXA 4JG0H 1TJGL 2OR9H 3T2QA 3K2UH 3HN3A 5GRVL 2AKRA 4IM8A 4O2FA 3O4LB 2X4TA 2NY2B 3QUML 4Q2ZB 5DSCB 1ZT1A 3GMOB 3Q48A 4JM2D 3RU8H 3BWUC 3ZKMD 2YZ8A 2Z8RA 1H15B 2YKLL 3MLTA 1LE5A 3HFMH 4CGTA 2EXWC 1CXLA 4LPXA 4K3DL 5D1XA 3OPZH 3Q6GL 4GG6A 2HVKA 1IC7H 4JFEB 4WJ5B 3QEUA 3D69B 2J2ZA 1NAMH 1RZ8B 3MA9H 4JZJC 4Z0BH 3BPOB 3PV7A 4WUUD 2VWEE 3MLWH 3S3PA 4W81A 4JR9L 2P8MB 4YO0A 1JGLL 5ITBL 1FH5H 2XWBB 4K2UL 4RZCB 4U1IB 5BV7B 1A1MA 2R4RH 3GHBH 2VDOL 1IAOA 4FA8A 1FAIH 3U0TB 1U36A 4WUUE 3U2SB 3KPOB 2CPCA 1PZUB 3OSKA 4S1RL 3X11B 4Z7VB 4J6RH 2GITB 2AQ2A 4F58H 4YHOL 5A16B 2HT4C 3HZVB 4YXLH 4AH2B 2R4SH 4FP8H 5FDWA 4XB8A 5EULV 3WFBL 1TQBC 2VDLL 3OR6A 3JTSB 5IKCA 1UM4H 1FNEB 4QRQA 5KSAA 1HNGA 3BQUA 1G6VK 5E00A 1OPGH 3RVTD 1WITA 1S9VB 2NX5A 4KMQA 4X6DE 2BVQA 3GSXB 3BEVB 3L9RB 4QY8A 4H26A 5C0CD 4JQXA 3QQ4A 3TO4C 5HYJB 3Q1SH 1AI1H 2AK1L 5I66B 1F58L 4ZFFA 2ZJSL 1ETZA 4YC2B 3HC0A 2YSSA 3D39B 4QRUB 5DJ0A 1HNFA 3BRFA 2PR4H 5J3HD 5HHPA 1FGNH 5C0CE 1OSZB 3TYFB 4WHYH 3O3BB 3RDTA 1AQDB 2HTLC 1LK3L 3WIIL 2AEQH 2FO4A 2QKIB 4JGJA 2NYYD 4P4RA 1KJVA 4N9GA 1G7PB 3AS0A 1QEWB 1VERA 2ITDA 1A4KB 1Y18B 2M8XA 3JXAA 1AGBA 3GI9L 5DK2A 5J6GA 4M1DH 5TE7L 3PHOA 2OZ4H 5TJWK 5D2LB 3SJVD 4JY5L 1HH6A 3HC3H 4LSUH 2EICA 3PGFL 2R2HB 3SE4A 5DJXB 5TPWH 1UADC 3WFHA 2R9HC 1T7XA 4PB9L 2PKDA 5GJSH 4JFHD 2VQTA 4PJEE 1L6ZA 1A7RH 1UVQA 1F2XK 3O4LA 5DSCA 3GMOA 4NUGH 4KJQD 2BRRL 3F7QA 3MBXH 4G6MH 1H15A 4HUMB 4PJ5B 4U31A 3VFVB 4P9HH 1I1AB 4NM4H 3QUZD 3DV6B 4KKAD 2Z92B 4JFHE 1KJMB 4PR5B 3CH1A 4X80L 1KV3A 4JFEA 4WJ5A 1CVRA 3D69A 2Z8WC 1DN0B 1RZ8A 3ZTNH 1ND0A 3FT3B 2DQTL 1MRFL 4Y5VC 1HSAA 2P8MA 2JCCA 3GJFK 4TSCH 4KQ4H 5FUOH 4MAYD 4MYWB 2NY4C 1RUAL 5E5UB 2XWBA 4RZCA 1GOHA 3FQXB 1HQ4B 1UZ6E 2I26N 2IAMB 3D48R 5FOJA 2EZ0C 2D7OA 5K9JL 2Y6SD 3ULUC 1WFOA 4PJIE 2DL2A 3U0TA 3BP4B 1KYOJ 5F7YC 3U2SA 3KPOA 4X9HA 3F58L 4V1DD 4Y16B 3X11A 4ETYA 4Z7VA 2GITA 3KYNB 1YECL 5FCUL 3RX5A 3P30L 5A16A 3HZVA 5TE4H 2P49B 3GSOA 3JTSA 3NN8B 3RI5F 1C08A 1OP3H 3VI4F 1D9KC 3ARZA 4AMKH 2PCPA 1S9VA 4P48A 1AGDA 1AGCB 2Y7QB 3GSXA 4V1DE 3BEVA 3L9RA 1MY7A 5EWIH 5DC0A 1JI1A 5I19H 5HYJA 15C8H 3ZHKA 3QNXB 5I66A 3VXUD 4J8RB 1FPTL 4MA7H 3LY6A 3V4PL 3D39A 1MFNA 4QRUA 1G7JA 1EHLH 4Z7QF 3NPSC 1OSZA 4PP1D 1OGAB 3O3BA 1AQDA 3UJJH 1NQBA 3MV9D 1EVUA 2QKIA 4X7SL 1ADQH 3U0PB 3VXUE 3THML 4AT6A 4L1DA 1QEWA 3NCFB 3V6ZB 1A4KA 5CJBA 3V52L 2VL4A 1VCAA 1AY1L 1ZLUK 3T3ME 4GKZB 3CNKA 2BDNH 5D2LA 5JOFA 1P6FA 3LZFL 4NJ9H 1KELH 2R2HA 2NNAA 2N56A 4O02H 5DJXA 3MV9E 4Z6AT 1NMBH 3MRIB 4GKNB 5DO2D 5DQJB 2DQHL 2JJTC 3EJJX 5JQ6L 1JE6A 1BQLH 2BNRB 3LS4L 3NACL 3X12B 1BM3L 1ZLUH 4PJ5A 2UY6A 5CJXA 5LXGL 3LKPB 1I1AA 4MWFB 1RUQL 3DV6A 2Z92A 1KEGH 4PR5A 1KJMA 5MI0B 1TIUA 4YGAB 1F13A 1QNZH 1CFVL 3I2CH 4L8CB 1DN0A 5TFSL 4HW6A 3FT3A 4QTIL 1BBDL 4Y4FC 4YHYC 1ZGLB 4MQSB 1KTRL 3BMWA 3TT3H 2J5LB 4UB0L 2ZUSA 1HILB 1T66D 3FQXA 1HQ4A 3I6KB 2IAMA 3NABL 1GJIA 2CIKB 2NPLX 1QKZH 3PNWB 2A6KB 3BP4A 1GHFL 3D6GA 5IQ7L 3S5LB 4E5XB 1KULA 4Y16A 1JZ4A 3FKUS 3O6ML 5EU5B 4AYFA 2NY6D 5KANI 1TVHB 4PG2C 1JPSL 2B4CL 3MCKA 3KYNA 2MSPA 4NYLB 5GZND 4NNPH 2J7LA 5I8OL 3T0VA 1Q9OB 2XZZA 3NN8A 2YRLA 4H8WC 4A6YH 4JQIH 3VFRA 3BPNB 2A74B 4XXCA 3TZVC 1V05A 1AGCA 1QLRB 2Y7QA 3VI3E 4KAQL 2R56L 2NY3D 4ODTH 2XICA 4WENB 4Z76A 4OZIF 4NRYB 3QNXA 2V5TA 4DZBA 1PW3A 3CMOH 1AXSA 3UROR 4WO4D 1CDBA 4G8GB 1JHLL 1N3NB 4J8RA 4HS8L 2C3HA 4LGRB 3QEHB 1MRCL 4X6CE 1A6PA 2H2PD 4LSRL 5SWZB 4DEPB 4FG6C 5E8EB 3C2SA 4U1NB 3EBAA 1OGAA 1CXFA 4IRJB 4XC3L 5GRJL 3U0PA 1N26A 1H5BC 1NCDH 5DZOA 3V6ZA 1VGKB 5L6YH 1A7NL 4OSUH 1MY5A 2PTUA 5ILTH 3RPKA 3NIFF 4GKZA 5EIIB 5GGVY 2YUXA 1I85A 3GSNB 4HXAL 2DQGH 2XI9A 4ZPTA 2VXTL 3MRIA 4GKNA 5DQJA 1G0YR 3OGOE 2ZUWA 4Y19B 3RVVD 5AAWA 1A0QL 4WU7B 2EC9U 3X12A 1YNTB 1KN2L 4OLUH 3A6BL 4JM4H 4H88L 1PG7X 1QBMH 3LKPA 1KTLA 4MWFA 3QEGL 4LBEB 4F80A 3PWNB 4PJFF 4XPGH 4M1GH 4L8CA 2E7BA 1WWAX 4P4KA 2WWKT 4JVPA 4U1KB 3FHAA 4WI3A 1WFNA 1QA9B 4PJAB 4PJ8D 5CLTA 3EOTL 4PTUA 1ZGLA 2Q7NA 4Z7UB 3MNZB 5E8DL 1H8SA 1KJ3L 1BP3B 3HI6H 1MFDL 4TVPL 1CLYL 4PJXE 1IC4L 4NZTL 4UUJB 1HILA 2LFGA 3I6KA 5J1SC 3ZSSA 4XX1E 4ONFH 3LAFA 4HGMA 4O5LH 1ODAA 1F97A 4GJTB 1SJHB 4M00A 2CIKA 5DS8B 1P4BL 1XF5B 3PNWA 2A6KA 3LSOB 4AG4L 3S5LA 4NBXB 5FM8A 1TVHA 4ONGH 3ZTJH 4NYLA 1Q9OA 1PBYA 3SKOA 3U7YH 4XNYH 3NPZB 3L3HB 3BPLB 3VA2C 2F5AL 4NGHL 2NCMA 4PBVC 3EYSH 1RV6X 2A74A 3BAEL 5E2JA 3HNSL 1QLRA 2BVUA 2QTEA 4N0YL 4NJAL 1CE1H 4HCRL 1QFUL 4NZUL 4TNVF 5JXAH 4NRYA 4WUKH 4DW2H 3QI9B 4C54A 2KQNA 4PRHD 4G8GA 1N3NA 5AWNL 3W2DL 4RGNC 3QEHA 5DD0H 4FTVD 5SWZA 1RVFL 2LABA 4FFWC 5E8EA 4GAGH 4U1NA 2V17H 4B7IA 2XWTB 4IRJA 2A6IB 2R0LL 4NWTL 4HQQL 3PL6C 3QG6B 4OQ1A 4F37K 1HHIB 4IJ3C 4PRHE 1A9EB 3VE0B 2O5YL 1VGKA 2O5ZL 4HC1A 3ULVC 1EA9C 3PJSB 3S88H 1KXVC 4H20H 3V0WH 4FTVE 5FGBA 4EDWL 3SQOL 4OFYD 5EIIA 1J1OL 2F8XC 4EKXA 3B9KC 2E7LC 4XP1H 3ROLB 4G7YL 4K7PY 2IANA 4JFDD 4JCLA 2DBLL 1CDJA 3B2VH 3CLEH 3GSNA 3GSRB 4OGYL 2VDNL 4XVTH 4ZOCA 5J8OA 5EUOB 3MOAL 2GFBB 3P73B 4LCCA 4GXUM 3RWCB 3S34L 1WZ1H 4MB3A 4Y19A 3S5LG 1HYRC 4J3VA 3RGVC 1N59B 1LGVA 3NCJH 1N5YH 4XWOD 3MUZ1 1CFQB 1TZGL 1ES0B 3U0WL 3SE3A 5A43C 4MLIA 1DVFC 3X13B 3ZDXE 3PWNA 1UWGH 3TCXA 1ZWIB 1HIML 4OM1H 2XZQH 2MCPH 4M6ML 4C56D 4U1KA 4CDGC 4PJ7B 2WANA 1QA9A 1F42A 1RIUL 3RP1A 4Z7UA 3MNZA 3OMZA 4JN1H 3BHBA 1BQHG 4N0UE 2VQUA 4UUJA 4PRBA 4KUCD 5D70H 3O6KL 3IDYC 3TBYB 1SJHA 4BA8A 4C56E 1SBSL 4YX2H 4XB7A 5DS8A 1XF5A 4D9LL 2XKNB 4RISH 3LSOA 1KEMH 1E4XI 1RIHL 5C0GB 4ISVA 3D5OF 5IBLD 2PETA 6CGTA 2V9QA 1RUPH 5ESQB 3W0WB 1W72H 4AEFA 3GMLB 3F6IA 2OP4H 1HI6B 2EYRB 3EZ8A 4IDLA 4P23A 3GIVB 2YRZA 3MLYL 1K5NA 3RVTC 3RKDD 1PZ5B 2Y72A 3AC0A 3L3HA 1MUJB 3GGWB 1XEDA 1EUUA 2UYLB 3C6LC 2QJDA 3SKJH 4E0RB 4OF0A 5IROC 5FAAA 1OQXA 1TJHH 4ZYKB 1FG2B 4CL7A 4WNQA 1IM3A 4YH6A 3QI9A 5EU4B 2XQBH 4EBQH 4QNPE 2AK4A 4W6WB 1YEKH 3WYRA 3FN3A 3T0WA 3RZCD 3UPRB 1YDPB 1JHTB 5FV2A 2N7BA 1MFEL 4HSQA 2X42A 2XWTA 5L8KB 1F00I 1E6OH 3MOBH 1IAIH 3TV3L 3QG6A 1S7VB 1BBJB 4GO6B 4XMLH 1HHIA 3LS5L 3KHQA 4P5MB 1A9EA 1BMGA 3VE0A 1BFSA 1FJ1B 4POZD 3FQWB 4D9QE 1A7OL 5D8JL 5F1IB 1BZ7B 3ROLA 1MIML 1X9QA 4XWGH 3F7PC 3GSRA 4I3SH 2W38A 3BMVA 3DSFH 3EOAB 5EUOA 5EZIL 2GFBA 2XG4A 3P73A 5FYKU 3TIEB 3RWCA 5DJDA 1ZEAH 1HDMA 1CL7H 1X44A 5IB1B 2OJZH 4Y8AA 4X7FC 1N59A 4F9PA 1OARL 4ODXB 1A7QL 2ZSWB 1CFQA 5I74C 3GUTB 1CICD 1ES0A 3L3OA 4KKAC 4JRYB 3K80A 4UV7L 5AYQA 1NBYA 1G6RB 1WISA 3S35X 1NGQH 3X13A 5GGTH 5I18H 5DFWH 4OUOA 1ZWIA 5CEZH 1OP5K 4YDLB 4KKCD 1KBGL 3OB0K 1MFCL 2DI8A 4PJ7A 5MHSD 2J4WH 3RWJB 3OHXB 4NQCB 1YZZA 4KJWC 4K55A 2MKLC 2CR3A 3DYOA 5ERWB 4G43B 2X9WA 3ZKQD 4LCIH 4KHTH 3TBYA 2J8UF 3VXSD 2C7UA 1YJDH 3B8YA 4OQTL 5D2NB 3KXFB 5MHSE 3VG0L 2XKNA 1UB5B 3QIBD 4BQ9A 2A9NL 4XPBL 5C0ND 3WNNA 1W2KT 1GGIH 4JAMB 5DD3H 4MD5B 4UV4L 2VXVH 1YNKL 5F7HA 3ULUL 1IQWL 3W0WA 3WHE0 1UENA 3GMLA 3MGOB 3QXWA 4DTGH 1WAAF 1HI6A 2EYRA 4N8CL 3GIVA 4ZS7L 5IQ9B 1A6UL 1PZ5A 4FQ1L 5E2WH 3VXSE 1CLZL 2EDBA 4XMPH 8CGTA 1MUJA 3GGWA 2UYLA 3I02B 1WGOA 3O8XB 5CZXD 4E0RA 2D0GA 4ZYKA 2YBRB 4MHHG 1BD2A 1I9IL 1FG2A 3ZT6A 5D1ZC 2FJGB 1W0VB 2GJ6B 3NZ8B 5EU4A 3GI8H 3WIHL 2A77H 3MLUH 5HPMB 3QA3B 2E6JA 5I6XC 4N9OB 1SY6H 1MJUH 3GMMB 1EJOL 1YDPA 1JHTA 4K94H 3UPRA 3QDMD 1PJ9A 3RWHB 1CG9B 1LO3H 1BBJA 4QOKB 2UWEB 1J9CT 3FO1B 1VKXA 4P5MA 4OM0L 3EYVA 1FJ1A 3FQWA 5KBNC 4I77L 5KZCB 1X7QB 1MNUH 1NL0H 2ED8A 3ARRA 5C09D 4M8QB 5I8CB 1ZMYA 2BVOA 2OM5A 5F1IA 3QSKB 1E4KA 3HZKB 3QDME 5E99L 1NC4D 4DUVA 5HBBA 4XP9H 2R1WB 2D7MA 1YQVH 2XQYK 3EOAA 4U1GC 3JWOH 3IAGC 1AJ7L 1EGJL 4IMKA 1GGCL 1FNFA 6FABH 3SDXA 4OV6F 2FLBT 3DTXB 3OJDB 5C09E 2QQQA 4YHNB 4LCYB 2DQJL 5EORH 3IJHB 4AJ0A 2ZSWA 1G9MC 3GUTA 4WUUB 3HAEH 1FBIL 4JRYA 4K9EH 3SKUD 4XZUB 2CDEB 4HV8A 2YEZB 1KCVH 4R4ND 1G6RA 2FO1A 5DVNA 5MEND 3BKJL 5T1KD 3WO3B 4LAJH 3JVGA 5IT2H 3HRZB 2XA8H 3RWJA 3PQYB 5E2VH 3GRWL 5IB4B 4L4VD 1F6LL 3OHXA 4NQCA 1ITBB 3W81A 3CX2A 4TUJB 3OF6D 1QP1A 3UPCA 4X6DB 2XN9B 4AEHL 1KENL 1U3HC 4WU5B 4LFHG 4NN6B 1OSPL 1Q72L 2AGJL 2HN7A 2VXSL 5ERWA 4G43A 5MENE 4JO3H 1BVZA 1JZ3A 1UACL 4R7DA 5D2NA 3KXFA 3HNVH 2YWYA 3BFOA 3H7BB 1G7MB 4XMKL 4UT9L 5JDJA 5L0QB 3UTSE 4JAMA 3VMOA 5DVLA 3MGOA 4WWKD 2JJUA 5C0CB 2YPVL 5IQ9A 2ADJB 3FZUD 2H6PB 1G7IB 3QDGA 2EE3A 2H9GA 1CS6A 2YD9A 3AUVA 4KDWA 4CAGA 2BFVH 3I02A 5EA0L 2XRAL 5IG7B 3TJEH 1NMAH 3EDKA 3O8XA 3Q6FA 3MOQA 1TTFA 5EU7C 2A83A 2HRLA 2YBRA 4NZRH 3VRJB 5F1NB 1F4HA 3MFGB 4H8WL 2FJGA 2N1KA 1W0VA 2GJ6A 3ZE0E 3NZ8A 4HT1H 3FRUB 4OZFH 4NQUA 2H2PC 3QA3A 4U1HA 3OAZK 1EHNA 2WP3O 4JDTH 3GMMA 1EBAA 1UKTA 2AABH 3N0PB 2D7QA 4MXQD 3VXPB 1NUDA 1TNMA 3RY6C 4JREB 3V6BR 1OY3B 1CG9A 4QOKA 1XF1A 1B2WL 2JIXB 2UWEA 3FO1A 1LMKA 4KTYA 3H0TB 4MS8D 1X7QA 1EAPB 2C9AA 1IC5L 4GRLB 4M8QA 5I8CA 3O2DL 1R3IH 4HPOH 3FJTA 4APQD 3EGSB 1A21A 5CWSB 3HMXH 5AZEH 4GW4B 3HZKA 2C1OB 1TZIB 4M48H 1MCBA 4EI5B 4M6OH 2EH8L 4MD0B 4RBPK 1OTTC 1I3RB 4OFPA 5DD5L 3GNML 4RRPA 4Z7NE 4GG6F 2IG2H 4UT7L 3C60B 3LD8B 1HEZB 4V2BA 1II4E 4DK3A 3DTXA 3OJDA 4YHZL 1MSPA 4NC1C 4D3CH 4PJIB 4LCYA 4YHNA 5ELIA 5D4QA 5C0JB 3ZSTA 4WUUA 1C5BL 1BAFL 3D85B 1NGYB 2WMPA 1JF5A 1BZQK 1RI8A 2CDEA 3P4LA 1E28B 2YEZA 3PHSA 5TF1L 4NP4L 2Y07L 4KTEL 2EXYC 4LVOB 1YMMD 5GSRB 4BYHA 3HRZA 4LMQI 3PQYA 3KJ4B 3QCTH 3C5SA 4J3TA 1A1NA 5FYKL 5JW4Q 1KB5H 2VDQL 4OLEA 4TUJA 3KLHC 4O4YL 3HCVB 4X6DA 3MYJB 2XN9A 4WU5A 4V1DB 3CFJB 3QAZC 3G04B 5EOCH 4G6JL 1SM3L 1YMME 1YN6A 2BZDA 3CSYB 3CXDL 5T3ZH 2CIIB 1VFOA 1PKQB 3H7BA 5F1OB 5I16B 1G7MA 4J3UA 2FYYB 4HK3N 2B2XL 1RFDH 1UWXH 1UZ8B 2QHRH 2VKWA 3JTTB 5EBLB 3S6CA 4P9HC 3VGAC 5C0CA 2VUYA 4OT1H 2DYPA 4X5LA 3NZHH 5IB5B 4QXWA 3MSPA 2OI9C 2ADJA 2H6PA 3ZZ1A 1S7RB 1G7IA 3BO8B 1ACYH 1FFOB 3EYFB 1P5VA 1MCPH 5IG7A 2AJXH 3QT2A 5EIVA 1FO0B 3VRJA 5F1NA 3RJQB 4RRPG 4HIIB 4JQVC 3QWOB 3RVXC 3MV9B 3L1OH 2EE6A 1C1EH 2Q8AH 2CUHA 2VO5A 1NGWB 3FRUA 4BUHA 2MPAL 3ZKNC 4PGDB 1MREL 3JUYA 2VDPL 1ZVYA 4LP5A 4Y5YC 5D7JD 1KJ2B 4NQXB 1F3RB 2B5IC 2ENYA 3L3JB 1EX0A 1M6OB 4GSDL 3UJIH 5CP7B 4KK8D 2DLHA 3CX5J 2GQHA 2P7TB 2JIXA 5IESH 4IOFD 2VTFA 5HTSA 2ESVD 1I1FB 1KC5L 3H0TA 4XVJH 1EAPA 4GRLA 4L8SB 4F7PB 5F8QC 3MCG1 1JK8B 2AJZA 3EGSA 4F37F 2YZ1A 5CWSA 1UQSB 3SE9L 4GW4A 2C1OA 5SV3A 3ULVL 1TZIA 3CVIL 3H42L 4NBYB 3ARDB 4L1HA 4EI5A 3L3KA 3L7EB 4WY7L 5F7EL 1I3RA 1RULL 2EH7L 3MJGX 3QJFB 4HS3A 4NN5B 1Q9WB 3C60A 5BMFH 1HEZA 4KRLB 4KVNL 2WBJD 4U1MB 1FE8H 2EYSB 3VDBA 2CLRB 1JNLL 4PJIA 5KW9L 5C0JA 3CAFA 2JCCF 2HH0L 3D85A 3VI4E 1E28A 1PY4A 4V2CB 5SWSE 5A2LH 4LRIC 3ARWA 1VFBB 5HJ3B 3HB3C 2WLYA 4ODBD 3WSQL 4TSAH 5GSRA 3ZDYF 4YHKH 2FGZA 2ZNWA 5KG9B 3VG9C 1RY7B 4M7ZB 1CYGA 4AQ1B 1UEMA 1QR1B 1ZE3C 1A6ZB 3HCVA 1MCDA 3MYJA 3QPQC 3WN5C 4TUKH 4G7VL 3CFJA 4PY8I 3LHPH 2NY6B 3QQNA 3S36L 5M95B 4Z7QE 1A22B 4HBCH 1FDLL 4RSVA 3DSNA 3IAQA 5B39B 2CIIA 1MELA 1PKQA 5I16A 1MCJA 3MA7A 2FYYA 5T33L 2QLVB 2DM4A 3FRPA 1A64A 1UZ8A 5EBLA 3JTTA 3P9LB 1U93B 3MPCA 5IB5A 2MWCA 5HI4D 3RTQD 2ZCKH 4AIOA 3LPWA 1S7RA 3BO8A 4L3ED 4LDLB 1FFOA 1I7UB 3JUZA 4HX1B 3E8UH 2MTPA 1CBVH 1FO0A 3VGHA 1FIGH 3C09B 2DQIH 1VACB 4IS6B 3HI1B 4CJ0A 3QWOA 3MV9A 3ZHDA 3WS6C 1NGWA 2CGRH 5F89B 4L3EE 3RZCC 3V9FA 3RA7L 3VH8A 4PGDA 3IU3B 3I3DA 4OCSH 1NBZB 1KJ2A 5D2LF 4D94A 5KS9B 3L3JA 1M6OA 1C5DB 1LD9B 5CP7A 4POUB 5GHWL 1ACZA 4E41D 2XT1B 2P7TA 1T0NA 5TQ2H 4LLMB 4N5ED 3AVEA 1I1FA 1RHHB 5LCVL 4R8WL 1VFMA 5JXEC 1V3JA 2CKNA 4X9FA 2GTWA 3OKKB 5TDOB 4CVZB 2R29H 4F7PA 5HHXL 1JK8A 1MWAB 5JW4R 5I1KL 1IQDA 1UQSA 5INCB 3NTCL 3RVUC 5IB2B 3QXTA 4E41E 5C0BD 5DK0A 3ARDA 4LCUB 3L7EA 3QJFA 4PLOB 5DTFB 4ORGB 4LDEB 1Q9WA 2W07A 4PBXA 2HG5B 5JMOC 4IHOB 5C07A 2LAGB 2CK0L 4J4PA 4N0FB 3SGEH 1T7YA 2DRUA 4U1MA 2EYSA 4R4FH 3M1BB 2CLRA 3D87B 3FRPG 4MX7B 1MJ7H 2VR9A 3PGDA 1OAQL 4NT6B 3LN4B 3MJ6A 1PQZB 4PB0L 5C0BE 1BJMA 3PWJB 1AR1C 1VFBA 1FHGA 2AXFB 2EYTB 5HJ3A 5IHUH 4OJFH 1NLDH 1V5JA 5KG9A 1WEJL 1MCHA 1UYWH 1WVZA 4WIQA 4NPYB 3CH8A 4OZIE 3GBLA 1QR1A 4U6YB 2ICEB 3QQ9C 1A6ZA 2CD0A 5A2FA 4TPRL 4ZXBA 5D6DA 3QHZH 4KV5F 5JW4N 5DHYA 2QHLA 5C0EB 5J13B 3E2HB 4H5SB 4JE4B 3VH8G 1I1YB 1IBGH 4UT6H 1ZGLM 1GVIA 4LRNL 3M8OH 5A1AA 5ICXB 2ADFL 4WCYH 1E27B 1S78D 1UM6L 2NTSP 5KVDL 5L9DH 4OAWB 3P9LA 1U93A 1F3JB 4ZAKC 1FC1A 5DQDL 3NIFE 2Y25A 2UUDH 3RPIA 5LAXB 1TXKA 4H1LH 4A2LA 4U0QB 1L4IA 4U6TA 5BRZD 4U6VH 1RZFH 3SDAC 2MFNA 2AJYL 3FO0L 2VN7A 4PRHB 3WDIA 3L5IA 4OCRH 1I7UA 3S37L 4NKDB 1A8JH 4HX1A 1G1CA 5JTWA 4RX4D 3B2UC 4XBPB 4OB5H 4Y4HD 1HINH 5LGHH 4K3HA 1VACA 4IS6A 3HI1A 2RCSH 4K3EL 3MUGA 1ORSA 3IU3A 1NBZA 5BW7C 4XBGB 1BOYA 1TVDA 2PNDA 3SCMC 5IBTL 1QUNA 4PJFE 5KS9A 3PWUB 3V79C 1C5DA 1LD9A 2YS4A 3TA3D 2AJSL 5FYJD 1F45A 4HWNA 3EO9H 5FV1L 5TGBB 4LLMA 4K3DH 1F8TL 1AC0A 1X4YA 1RHHA 4FMFA 2IBZY 4Q0XL 2E9JA 3ALXA 2ZCLL 3FB5B 3OKKA 5TDOA 4IRSC 3O6FC 4HLZG 4N0RA 2YXFA 3NCCB 5I9QB 1MWAA 4F33B 5INCA 4KGLA 5FYJE 5IB2A 4IIQB 1JGLH 4LCUA 4UBDD 3D25B 3VXNB 3VWJC 4MJID 4N0UB 5DTFA 4ORGA 4OGAD 4LCWD 3CLFL 3TF7C 2HG5A 4ZO8A 4K07A 4IHOA 4FQHB 4JFFE 2VDOH 4JZJB 4N0FA 2F54D 2R1XB 4EN3C 4C56B 3M1BA 1U6AL 4MX7A 4I0CC 1FNGB 3VXRB 2BNQD 5CD3B 4NT6A 3LN4A 3U79A 3LKNB 3QCUH 4NFCA 1PQZA 3IU4L 3NA4A 4G5ZL 3PWJA 4LSVH 3MRNB 2AXFA 2EYTA 2HFTA 4LGSB 5L2JB 2LVCA 1A3RL 4XBEL 2J88H 2F54E 2FEDC 4NPYA 1LO2H 4PGBB 2W65B 3WNPA 2BXYA 3BKYH 2EEAA 4U6YA 2ICEA 5E2UH 2HWZH 5J57B 4GUPB 2BNQE 1QSFD 1JYNA 1EK3A 2V5RA 35C8L 1FL3B 5C0EA 1CDCA 5SX5K 3U4BL 3QULB 2X4UB 1I1YA 1T5XB 2NXYC 2EIDA 3DX7B 2FWOA 4XNUL 3P9WB 2BNUB 3DVFA 4OGXL 3SDDB 4MHHI 1PSKL 5IW1B 2FX8L 3KPTA 5ICXA 4WFFD 1E27A 2P47B 4JG0L 2M2DA 4GMSL 5IFAL 3R8BB 1KPVB 4R90H 4OAWA 1KIRB 1QOKA 1F3JA 3BKML 3TO4B 3SDCD 3DI3B 1XR9B 5LAXA 1ZHNB 2YD4A 1RZKH 1NAKH 2DI9A 4GW5B 4Q58C 4PG9A 3HFML 1F02I 3ZKSD 4NKDA 5F21B 3GI9H 1AH1A 3OPZL 4XBPA 5E6ID 1IC7L 1P5UA 2VDRL 5I1IH 5I73B 5CHNB 1CGUA 1J8HD 1V3MA 4Z0BL 4XX1G 1AXIB 4X7DC 1X5XA 4PB9H 5DVMA 5CUSH 3MC0A 2VOTA 4G9DB 1GGBL 1FH5L 4XBGA 1QRND 1FVEA 3GHBL 3PWUA 2NLJB 2BRRH 4WI4A 2OS7A 1J8HE 3B9AA 3MLRL 4XTRC 3PWLA 5DGRA 3W9EB 3IFLL 4BK5A 4APQC 3FB5A 3HZYB 3NCMA 4FQCL 1ERNA 2FLRT 4YXLL 4FP8L 4F33A 4NO0B 4LPCA 1UM4L 1DP0A 3Q0HA 1OPGL 3D25A 3VXNA 3NFNB 4N0UA 7FABH 3WXWL 4F7EB 3MJ7B 5EUKB 1P2CB 1J5OH 3NBNA 5K9JH 2PXYB 4JZJA 2R1XA 4P2OC 4C56A 3Q1SL 4Y5VB 1FNGA 3VXRA 5CD3A 1Q0XL 3RWDB 3MROB 2NY4B 1H3PH 3LKNA 5JA9A 5I1JH 1MRDH 1LEKB 4OBSA 3STLB 3MRNA 4BKLB 3VFWA 4XT1C 2PR4L 1YECH 4KROB 5FCUH 5L2JA 4LLYB 1FGNL 4U33A 5HGGS 1BQSA 4WTZA 1MPAL 3VXSB 4PGBA 1NH6A 1P4LB 2AEQL 2W65A 1M05B 4LEOB 4GUPA 2AJUL 1WBXB 3RNQB 1JTTA 3G08B 4KH2A 1MI5E 1OAUL 4EVNB 3SY0B 4M1DL 1FL3A 3IDGB 4LHUD 4X8XA 1XCQB 2X4UA 4N0CD 1T5XA 3VFTB 3HC3L 4LSUL 4M5YH 4G9FE 3U48A 3DX7A 3TC9A 5TPWL 2BNUA 2NY1D 3SDDA 1U3ZA 4JPWH 1S7QB 1LO0L 3V4PH 2JLLA 1KPVA 5I1CL 2ITCB 3RGHA 3MREB 1A7RL 2ERJC 3TO4A 4MNQD 5F71A 1XR9A 5D6CB 1X5GA 1ZHNA 3IFOB 1EFXB 3EYOB 4GW5A 2P46B 4K71B 3MBXL 4G6ML 3UJTL 3MJ9A 5B8CB 4P9HL 5HHMD 4NM4L 3V52H 4YEFA 1AY1H 1T1YB 2XWJB 4ZOEA 3CPLB 1AQKH 4LASL 1KIUA 4MNQE 1ZHKB 1T4KB 5CHNA 3ZTNL 3QDMB 2VXUH 5T1LD 1CZ8H 3BVNB 4IRZH 4DCQB 5C92A 5HD8C 4F2MB 4KQ4L 5D7JC 5FUOL 1T83C 2Q8BH 4ZPVA 4G9DA 4GRWH 4GQ9H 3VXMD 2JJVA 5HHME 4D0DA 1FC2D 5JQ6H 3VFMB 5C09B 2H45A 3NACH 3RL1B 2OL3B 5KAQG 2NLJA 5EBMB 1BM3H 5KVEH 1QR4A 4L5FH 5LXGH 3W9DB 1I9JL 3W9EA 1RUQH 4WW1B 1MAMH 3HNTL 4F7CB 4XHJD 2DKUA 1EVTC 3HZYA 2H2SD 2KBGA 3LB6C 3WJJC 2HKFL 4QTIH 4XI5D 3TBSB 4NO0A 5TE4L 4OLYL 1MIEL 2J8UE 1EXUB 1CXIA 5ETUB 2N4IA 1YEJH 4MAUH 4UB0H 1BJ1H 3NFNA 4F7EA 3MJ7A 1WBZA 3O2WH 5EUKA 1P2CA 3CDGB 2PXYA 5F7DB 1Z9MA 4K8RH 1J10A 1DLFH 1WAAE 5I19L 15C8L 1N0XH 4Y5VA 2IPKB 4YHYB 4K94C 3V7AE 5E4EC 2CSPA 1JGUL 1FZOB 1R5VB 1MJ8H 2ZOKB 3RWDA 3MROA 3IDUA 3UTSB 3OKMB 3W82A 3TIDB 3HPLB 4O9HH 3STLA 1N8ZB 4BKLA 2ADGB 4UOW1 1J0HA 2B4CH 5HYQB 1XGUB 4LLYA 1FNSL 5HGAB 2EO9A 4JHAL 5BV7H 5D93C 3TN0D 3AU1B 3UJJL 4S11A 3VXSA 1P4LA 3QNYB 1ADQL 1VSCA 4GLRH 3SGDI 5E03A 4LEOA 3U83A 1URLA 5DJCB 1WBXA 4M93B 4PD4J 1T1WB 4O51B 3G08A 4KI5D 4EVNA 2NXZC 2R56H 3SY0A 5JMRA 3QDJD 3IDGA 3JWOC 1XCQA 1MFAH 2VRAA 5FM5M 3TJHC 3WUWB 4B53A 1KELL 3ZE1F 4OFIA 2VMFA 4O02L 1NMBL 4Y4KD 4HS8H 4WI6A 1S8DB 1S7QA 4FQXC 1AGFB 2ZG1A 1MRCH 1CLOL 1KIQB 3LCYA 2ITCA 4K9EC 3RTQC 2VJXA 4HIXH 3QDJE 4XC3H 4YDIH 5D6CA 5D7SL 4K3GA 5GRJH 1MHHB 3IFOA 3VFSA 1EFXA 3EYOA 4P2RD 3KYAA 2GK2A 5B8CA 3UXFA 4UMGA 3RFZC 1KEGL 1T1YA