5E2TH

Crystal structure of anti-tau antibody at8 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
209
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords AT8 LIGHT CHAIN
total genus 44
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2tH01
3BQUC 1QFWH 3QB7C 4U0RB 4E41A 1FJ1A 1ORSB 5KVGL 1IAMA 1FZOB 5GRJH 5HVGB 1JGLH 2BVOA 4X8JB 4RMWA 2MCG1 2HJLB 5BZWB 2EC9T 4RGND 1YJDC 1IEBB 1HHHA 4PY8I 3HN3A 4ZD3L 2PW2A 3MLUH 4FQJL 2FHBA 1R3LA 2C1PB 3U0WL 4RFOH 1CICD 3MRBA 5D7IA 5LVEA 4BSWB 4OGAC 5IM7A 4NFDA 1JNNH 2CRYA 5J6GB 2DQDH 5ACZA 1IGJA 1RURH 5I9QC 2NXYC 3LKOA 5E2UL 2X4PB 4GBXA 4M1DH 4ZPTB 1QPPA 4I8DA 5EB9A 4E41B 4UIMA 2YEZA 3UTSD 1QNZL 4C4KT 5JIIA 4KKBD 4P46D 3MRIA 2FX8L 4FQXC 2NX5D 1NGYA 3HRZA 4I3SL 2FJHA 3OB0K 1JF5A 2CIIA 1F97A 4JGUA 1M05A 2VLRE 4WW1B 2GJ6E 2HTLC 4NPYB 3OAYK 4U49A 3HS0B 4AIXA 1IT9L 4G80B 3OKMA 3TJEL 1SJEA 5B38A 5IHUL 3V2AR 4GRLA 4B0MM 3DYPA 3AM8A 5C08D 5MP6L 3IJYB 1U3HB 5IFHH 3VFTA 2AK1L 3FQUA 3W11D 1JWUA 2HKHL 4WY7H 1ZHKB 2V6HA 2WUCL 2OZ4A 1PVHA 4L4VB 5T3XE 3GMNB 3Q5YA 1M71B 4L1HA 1XMWA 4LCUB 1D5MB 1IM9B 3I85A 3HZKA 3CVIL 4QHLB 3SJVD 2E5EA 4XP6H 1ES0A 4QHMB 3TIEA 3QIUD 1QUNA 3MMEA 3JWNC 1SYVB 4ZOAA 1DE4A 3BWAA 2DI7A 3WHE1 2AXGB 2OSLA 3HPLB 4QTHA 3KG5A 2HAZA 4I2XA 2OXHA 4HXAH 3GB7B 4PRHA 5JORB 3M8OL 3S97C 1RUPH 4HIEA 5SX4H 5BZDA 2JJWA 2DJSA 5DD0H 4PJBF 4LLQB 5F88A 5CEZL 3L7EB 5IT2H 4TTDC 4XPHL 4HFUH 4KRPD 3UPAA 1D5MA 4BELD 4DZ8B 3VDBA 4U3HA 2R0LH 4UQ3B 1RZ8B 2I24N 2XQYK 2EH8L 3ABZA 4IOFC 3GSNH 5GSVB 5F9OH 1RZJL 2PXYD 3WS3A 1INDL 1JRHL 2WQRA 3VXSA 1YC7A 3L3HB 5ICZA 2Q8AL 1YPZE 3WFDH 3RDTB 4PGDA 2H45A 2RHEA 1KCVH 5TE6L 4K7FA 1HNFA 4RRPG 4OAWB 2HJFA 3FKUS 4ODSL 2BVEA 1JNNL 2CD0A 4X0KB 3IFPA 1WC7A 3GB7A 4PRHB 4JDVA 5F6HJ 5IIEA 1NH6A 1FE8H 1U8IA 3KR3H 3WLWD 4WHYH 3DXAB 4TUJB 5CBAA 2DM2A 4L8SC 5F1NA 3V7AE 5DHVH 1I7TA 3JTTB 2NNAA 1J8HD 4XBGB 3GSUA 1PD6A 1VEOA 1J1XH 5SWQA 4OIIH 4DUWA 2OTWA 3VRIB 2EKSA 2YUWA 2JELL 3QUMB 4Y4HD 4OFIA 1PZ5B 3JTSB 4LCIH 2PXYC 1Q9OB 4HCRA 1LD9B 1AC0A 1EHXA 2KBGA 4MJIA 2HLFD 5H2BB 3I6KB 5C0RH 5B39B 3G5YB 1KXQE 3HG1D 3MNZA 3JVGA 2X4TA 1H3UA 1EO5A 3BZDA 4LSTL 3OJDA 3PP3H 4XMPH 4WTXA 5KSBE 3BUYA 3CJJA 5EU4B 3FHAA 4X5WB 2JTDA 5TPWH 5DK0B 1AD0B 4MXWL 4NO2A 1ZT1A 4GSDH 3SCMC 1LP9B 3VWJB 3A6BH 2HKFH 2I26N 4P3DB 4A6YA 4L5FH 3T0VA 5I1DA 4MDIA 4JB9H 4XI5C 1A1OB 1MIEL 3AREB 5DJDB 1LHZA 1T1XB 1LDPH 5CWSB 3C8KA 3FONB 4JFDD 4S1QL 1OWRM 4KRPB 3LD8B 5FM5M 3RIAK 1CFTA 4Q9RH 1G6RA 1DLFL 1NMCC 1FO0H 1SM3L 3GSVB 2FR4B 3S5LB 4V2BA 4G9DA 2WZPD 3IDNA 3X13B 5CAYB 1QFUL 2GK0A 1PLGL 1WEJH 4X9FA 5DFTA 1AE6L 5F93C 1CDHA 4BUHA 2A1WL 5J11B 5FYLL 1E6OH 3AXLA 1H5BC 1AGCB 5BV7L 4Z7VF 1RZKH 3QFDA 5D7SH 5LBSH 2I9TA 4WCYL 1RZIA 1FBIH 4I9WE 4JRYE 5C09B 2AJVH 5E5MA 3EJJX 1SEBA 1CLYH 5AZEL 1CZ8H 1ZHLA 3GIVB 2MTPA 2HYMA 1I1AA 3MCKA 5F7UA 3BKJL 3K2UL 1H15A 5DWUL 4ENEC 1F42A 2ZJSL 5DQ9B 5AAMA 4XP4H 3CZFA 4JHWH 1GRWA 3IJHB 4XHJC 3KLSA 5IBTH 2CLRA 2OK0L 3CVHH 1FYTD 4G6FD 5IVXB 5D1ZB 1TTFA 4H88H 3FB7B 5ICYB 4WDIA 5HHME 4NZDA 4TVPL 2BY0A 2EDRA 3T2PA 4JO1L 3FQXA 1QZ1A 1MVUB 1W0WB 3BT2H 1ZLSH 3NN8B 4JKLA 3RGVA 1A22B 2FO4B 5GRYA 3U0PB 2XTJE 1CGVA 2XN9E 2H2PD 2R1XB 3QO0A 5AZ2H 2X05A 1G6VK 4P2YA 5JW3H 3AB0C 4CNIA 2M8XA 3RJQB 3KYKH 4YZFE 3RDTC 4Y89A 1I9RH 3TN0B 4WGVB 1P53A 2FWOB 2Y5EA 4JFPA 1HKLH 1N26A 3GIVA 4C83B 4DKEH 2HT3D 3QFJE 1U8PA 4ZG1A 1D9KC 5I71B 1MFCL 1Q0XH 2BZDA 1AKJA 1YMHA 1BVLB 1FNGB 4PJ7A 5GGVL 5GHWL 4GKSB 2EXWD 4KVNH 2JJTC 2HN7A 2BSRB 4KI5D 5CMAB 4NGHL 4M1CD 4YDIH 4YWGL 1J1PH 5F70A 3DTXB 2WBWB 4M1GH 5GRVK 4QCIB 1BQHA 3TA3C 2ZCHL 4CW1A 4H5SA 5CZKA 2UZIL 4PFEA 4CL7A 2CDGB 1KELL 5F3BA 3U36B 2UVEA 3PHSA 1G7QB 1XCQB 2F5BH 3FN3A 3ROLB 2XWJA 2DBLL 1BOYA 1JPSL 1A7OL 3MLTA 4ZODA 1MRDH 4NO0D 4CDGC 4QRSB 3NABH 1DQML 1RUAL 4MJIE 2ICCA 3QDMB 4G42A 4H8WH 4HWUA 3HNSL 1MFAL 4XPGL 3CC5A 1T3FB 4M48H 2IPKB 3V52L 3BUYB 1OB1B 2OYPA 4U05A 3L3GB 3SCMB 2WW8A 2BCKA 4N0RA 5ISZD 4M7ZC 1MFEH 3MBXH 3D25B 4B53A 1TNMA 3T3ME 5IEHA 3E2HB 5D1ZC 4WI7A 4P3CL 1JUFA 3MUGA 3X11B 4X6BB 4WUKL 1PX4A 2NW2B 3KPPB 4K9EH 4FFYH 3WD5L 5C0FB 1A4KB 1EEZA 3SCMD 3U9PL 5KAQF 3GHBL 4MXVE 4HIXL 2PCPB 4LPXA 1NCWH 2X4QB 2HLAB 1HCVA 4UZGA 1Z9SA 3BZEB 2YPLA 1FCGA 4JZJC 3MV9E 5CJQH 5IHLB 5DRNB 4Z18A 1R3KB 3EYQC 1GZQA 1IFHH 3U7AA 5B8CC 2A74B 3HC4H 3D25A 5C0GB 2A9NH 4YK4C 4YHIB 4XRCA 1EERB 1J8HA 4LKCB 5CEZE 1AO7D 3HI1B 2AV1A 4QRPA 3MLPA 4QHUB 3C87A 4KJWC 4MNGE 3IFLL 1CDUA 4BZ2L 1T2JA 1CDYA 1U58A 1KB9J 4TNWF 2HFEA 2DQFB 1QYGH 3D69A 4EUPG 3IFOB 3QSKB 2NY6D 3PWNA 4PGJA 2W9EH 5BJTB 3MRIB 5ALBH 2A38A 3HAEH 3NGBB 4P3WA 5L2KA 2GK2A 2MKLC 2BRRH 2XN9A 3VD3A 4GRLB 3DRTB 4LCWE 3F5WB 1YEHL 2IAMA 4UBDD 3CUPB 1OD7A 3UDWA 1LO5B 4ZXBB 4PJFF 1S7RA 5DD1H 3RWIA 4KJWD 2I07A 1OVZA 2BY1A 2HT4C 2D03H 5I1KH 2VWEC 1OGTB 3B5TA 1CN4A 2EDKA 3ZHLA 4AIOA 1RIVL 3DVIA 3TV3L 1KFAH 3P30L 4HWZB 1BQLL 2ZOLB 1MLBB 1DBMH 4I77L 4DGVH 3UDWC 3HS0A 3MBED 4PJ8C 4YDLB 1X6NA 1CIDA 1WGOA 4JFDA 5C0CD 2CUHA 3BQUD 4QWWD 3AC0A 5D1QB 4NSKB 1U8NB 4K8RL 5MEPB 4PJHF 5F8RC 4L8DB 2FJGA 2VL5B 3X17A 4X7SL 3VFTB 4C83A 3TZVD 2R29L 3BOVA 3KPMA 5E8NA 4PLJD 5E2UH 1XGYH 3EOTH 3MR9A 4K3EH 3ROLA 2IH1A 4NC2B 5DZLA 3SDDC 1OD9A 1D6VL 5CSZA 1MCWM 3CDCA 2Y07L 5F1SA 5ILTL 3U83A 1CGSL 1U93B 1OAUL 3ZL4L 4WW2A 1W8OA 1T3FA 1A6ZB 1RK1B 4P5KB 3VXUA 4HWZA 4GO6B 3LS5H 5F6IC 5IQ9A 1R3LB 4FXGB 3NFSL 2ADIA 1WZMA 4YHPA 5DQDH 3BH8B 4Z8FL 2IPTH 1U2CA 3JWOH 4MQXD 1FN4B 3S6CA 3S8WA 4Y5VC 4PJCA 2B1AH 4MAUL 5GS0C 2DLHA 4NSKA 1VB9A 2FBOJ 4FFVD 1KJ2L 5FUZH 2UWEB 1HKFA 5FO9A 1NLBL 1Z6JT 3GKWH 4ACPA 3VH8G 4NP4L 3BYYA 4G42B 4K2UH 1CE1L 4QTIL 1ZLVH 4PJBA 3TBSB 1FE8L 2R2EA 3FQTB 3LV3A 4NQDB 3HI6L 4E0RA 3QIWA 1PG7H 1A3RL 3I2CL 1JHKL 3QDJB 3ETBF 4PV8B 4XPAH 4PRPB 4NM8H 5D9SB 1SEQH 3ZMRA 2YPLB 2VE6A 2YD4A 4XNYL 3GJFB 5L6YL 3ARFB 5I1GH 1FIGL 4URTB 4KQ3H 1FLTX 3QCTH 1B0RB 4MZ3A 5DJZB 3WNOA 4Y4FB 5IR1A 1I8LC 1EH9A 5IBTL 4HXAL 5FM5O 2BOBB 2QEJA 2DJ4A 3MLYL 3MFFB 3PNWB 1V3KA 3CIQA 5D2LA 2ADGB 2FECI 1P4LA 1ERNA 3F12B 4HDIA 5HI4C 2DLIA 1BJMA 3I50H 3OF6A 1NGPH 1F4AA 4M93C 3UC0H 4GAYA 2HTLD 1YPZA 1TQCB 3DRQA 3ESUF 1DSFH 1INDH 2X5PA 2R4RH 5EUOB 3PG2A 4YPGA 5I66B 2YHGA 3GBLA 2R0WL 5I76A 4Y19A 3PP4L 4XC1L 4LCCB 2VSDA 4L5FL 5C0EA 1HEZA 3RVWC 5JOFA 3BPNB 2QSTA 5HD8C 3W0WE 5E70A 1IC1A 3VE0A 5E08H 4J12A 3MRHB 4JRWA 5FYJL 4LLQA 2DWEB 5HI4D 2IQAA 3QFJB 3C08H 4MNQA 3WHXB 4P23A 4NGHH 3EFDH 1OW0A 2QBWA 3MGTA 4FQ2L 4GKOA 4NWTH 4P5TB 2RB8A 3PWPD 3U1SH 2YS4A 1GC1H 2A77L 4KHTL 2NY5C 1MH5B 1MRCL 3QPQD 2DICA 1E6JH 5FGCE 1BWMA 4MJ5B 5IJKC 4F9PC 4NJ9L 4OLVH 3RWHB 4P9HH 2X1OA 1FFPB 5AYUL 1MPAH 3P4OB 4Q6IA 4ZYKB 5IB1B 5D1QC 5D1QA 4RGNC 2GTWB 5IKCA 4NCC2 4U1HB 3VWKA 1VKXA 3T2QA 2FBJH 4MAYB 2NY0D 4L4JA 2DBLH 1QSEA 1JPFB 2WUCH 3EDEA 3ZE0F 4HKBB 4Q2ZB 1YYLH 3RI5K 5E8OB 3VXME 1KENH 4YQXL 3DXAA 4V1DB 2WBJC 5A16B 4ONFH 5A2LH 5HYJA 2QSCH 3ARTA 3VD7A 3LN4B 4WENB 4LMQI 5B8CA 3SDYH 3GIZL 4FTVE 4QNPF 2V9QA 3L7FB 4NO0B 1SVZA 2X09A 4J3OC 2LAAA 2NQCA 5BV7C 5GS0L 2J8UF 3F6LA 3BX7C 4EDWH 5EU6B 4R8WL 4GMTH 4M03A 3GMMA 1XR9A 3CXDL 3GMOA 1MJJB 2I9LA 3QUZA 5GRZA 3TVMD 3MLVL 2DN7A 1EK3A 3P4OA 5IB1A 4ZYKA 4N0CD 4Y16A 1AGDB 3HNVL 5GGRY 4HKJB 4J6RL 1DBBL 1YEGH 3CZFB 4LVOC 4YAQB 4YHLL 3BXNA 2EE9A 3NCBB 3VJ6B 5CEXB 1NSNH 3ARWA 5E8OA 3HI6H 4YK4B 4ZNCD 4WTWA 1G0YR 4BQ9A 3T8XA 4WW2B 2EYTB 4OI8A 5DZOA 1OLLA 2BNQB 3QEUB 3L7FA 4NO0A 4X4YB 4PJFE 2UV3A 1ZK9A 3RIFF 4X6DB 1ZVSB 2EE6A 4XP9L 4E41D 4FQLL 1MI5A 4PJEE 1MJJA 3ZE2F 1TCMA 4S1SL 3T0XA 4D9LL 2E7CA 2QQLL 4DN3L 5KSBB 1T0MB 5SX4I 3WN5B 1A9EA 1J88A 4WFEE 3RWCB 3C8KB 3FONA 1F00I 3PP3K 3BKJH 4LSSL 3WE6A 4JO4H 1I7ZA 4W4NA 3HE6A 3EYUH 1I1RA 4NZUL 1YEKH 3TA3A 1EXUB 1C5DB 2DLTA 4ODUA 1AD9B 1XGQA 3LDBC 4X99B 1YZZA 2CKBL 2BRRL 4H8WL 1LE9B 1R3IH 4M6NL 3GBNL 2E9IA 3F7VB 2ICWI 2XT1B 3UTZA 3KLHD 2YD5A 2V2TA 1IGJB 2XIDA 5C0NC 1BAFH 5HVHB 1XF5B 1T0PB 3F65A 5HI5C 2NYYC 1VEMA 4JJ5B 1V7ML 1DR9A 2JB5H 4DQOH 1ODAA 4KROC 3KPRE 4XCEA 3T0BA 4HS3B 5GRUH 2D7TH 4BSVA 3HB3C 1JWSB 4K9EL 4IRJC 4ZTOL 2R8SH 1MRCH 5F71A 4CN6A 3IDMA 4F9PA 2XWTA 5DK2B 3U0PA 3RHWK 3CFDA 2D7OA 4TUKH 3THMH 1IGTA 1GYAA 1I7RB 2KH2B 4HZLA 3KLHC 1F02I 1N64H 3CU1A 5IGXL 3VXNB 4DEPB 4P23C 4JVPA 4PG9A 4N8CL 3O2DL 3P2TA 1IC4L 4NCC1 1AXTH 4CU8A 4I18B 5DUPL 5F96L 2J3SA 1ITBB 3FOLA 5EN2B 4IRZH 5IUSA 2CKBA 4I9WD 2ZCKH 4KZDH 4OZGA 2YD6A 3UZQA 5IB2B 4OZHA 4N0CC 1HI6B 1HDMA 3WHXA 4IOFD 4BH7A 1S3KL 2BK8A 3FQWB 1A7OH 2HRPL 4XPTL 2AJ3B 3QDMD 3MV8B 2J4WH 1NUDA 4G5ZH 4ZOEA 1DUYB 2FEDD 2NY5H 2AABL 3C5SB 3HMWH 5SWSA 2P8LA 1YMMB 2O5XH 5C0CE 4MB3A 3JWOL 3E6FA 1NFDF 3GMOB 4G6MH 1QACA 2VDKH 4JM2D 3MRQB 4WI9A 2F54B 2ED8A 4HSQA 4O58L 2ICWJ 2PYEE 5T3ZE 4HULB 5DYOB 3ZE1E 1C08A 2HJFB 3STLA 2COQA 3LDBB 1JGLL 5D71L 3TPUB 5GGSA 4D9RE 4AMKL 2J8UE 5D7KE 3HR6A 4GXUM 4DW2H 1N8ZB 4NUGH 4LSRL 4OLYH 1R3JA 4KZEL 3TBWA 1WCQA 3P4NB 1RZ8A 1YEJH 4I1NB 3DIFB 2LV4A 4KQ3L 4U7MA 3SCMA 5CSBA 5T5NG 1CE6A 1G7PB 3RIAF 3KLDA 1GGBL 3FFCD 5FB8A 4I77H 3T77B 1ZTXH 2N56A 2GY7B 1JRHH 4FMFA 1CLZL 4PGDB 3CDFA 4OM1L 1IBGL 2DLGA 3QQ3A 3VXRA 4JDVB 2EYSB 1AQDA 2BVYA 5DD5H 3IXAB 4ZO6A 5SWZD 4KJYA 1QNZH 4HEME 1RIVH 3TV3H 5JPNA 3MV7E 4F7PB 3SDCB 3L3OA 2VABA 1F4XH 1NMAL 1UH4A 5CHNB 4DVBA 5LKNA 1U8OA 4NPYA 3MLRH 4P4KC 4HFWA 1UKTA 3QUXB 3BW9B 1ZSDA 1T83A 1IKNA 4YHPB 2VJXA 2BHYA 4RGMC 1BMGA 3LRSA 4L8CB 4Z7VA 1S9WA 2RBLA 3RVUC 5K9QI 1P84J 1OSZA 4HS6B 1S7XB 2A73B 4ODTL 2HFGL 3LQAC 4XPFL 4O02L 5DI8A 4OD1L 1GHFH 3A0OA 3BSZL 4JQIH 2GJ6A 4EBQH 2GI7A 5CJXC 1LDSA 1GC1L 2GAZB 5C2UB 4R97B 2UY7A 3GFUA 5INCA 2VAAA 4PRAA 3GMLA 1QOKA 2F5AL 4PGEA 4NO3A 1UZ6E 3JV4A 5ETUB 5C0AA 1T22B 2ESVE 3KXFA 4I3SH 3F7YA 3QUYA 4JPKL 5DFVD 2BX5A 3PGFL 3FO2A 2VC2L 1WCBA 4G6JL 2FD6L 2MOVA 1MJ8H 4UV7H 5TH2A 2VDML 4ZAKC 5IFAH 4ZFGL 4Q7DA 4OF6A 2YK1H 4U31A 1IEAA 2R2HA 2HLFC 4PRIE 4DOHE 3OXSA 5L8KB 4HS3A 4RFEB 3LKPB 5B22A 3N1QC 5ANME 1W2KT 3GHBH 4Y8AA 5D2LB 4LGRB 4F7TB 4HGWA 3E0GA 3S34L 5KVDL 5C0BE 1A3RH 4G5ZL 5B3JE 3D0LB 1G9MH 4LMQE 4HPOH 1GPOL 2RCSH 3QAZB 1JZ2A 1NGYB 3HRZB 3HZMB 3QISA 3TCLB 1PKQA 5ISZE 4NNYA 5KG9B 1J86A 2IFFH 4PY8J 2IANB 3OGCA 1RIUH 3RDTA 1IGIH 5EO1B 4BK4A 3O0RL 5C0CA 4PJ5E 1FORH 4N5EC 3BO8B 4CUCA 5C07A 1MREL 4UU9A 2J5LC 2AJZB 4P5TD 4G3YH 1VERA 5DQ9A 3TWCL 4YO0B 4PBXA 3QFJD 4RFEA 3GRWL 4P4KB 3CLEH 4CDHA 1T04A 5FO7B 3X3FL 3L3IB 5DJCA 4ERSH 4LBEA 1M71A 1MNUL 4K3DH 3BPOB 3B4NA 4B7LA 3HUJF 1N6UA 1R3JB 3K3QA 3DXAD 3TPKA 2FJHB 5L88L 3VRLE 4V2CB 3GI9L 5HHVL 1CT8B 3MUJA 1XCTA 5E1AB 5CJOL 2YZ1A 2XKSA 1D6EA 1TTGA 2CXGA 3LRHA 1DZBA 3SE4A 4LLWA 5DYOA 1X4ZA 5AD0B 3MOAH 3MLXL 4MAYA 3V6OC 4HPYH 4RMUA 1IKFL 1UWGH 5C86A 4RZCB 2A2QT 4XCFH 4NQCB 4YPJA 1IGMH 1OTTC 2DQTH 5ISZB 1F3JB 1NFKA 3SDDD 3BIBX 3Q5TA 4QOKE 3KNBA 4LSQH 1DQQB 4G8FA 4PV9A 4MYWB 1CBVH 2JK5B 3IVKB 2BSRA 3HMXL 4WUUE 4X7CC 2YPKA 4HH8A 4YDVB 1ZANL 1BFOB 5FB8B 2FH8A 4XNQA 3VFNA 4OZHE 1V3MA 1XR9B 1FV1A 4UIKH 5E6YA 5MERB 1EEUA 2R29H 2F19L 3GK8H 4JFZH 2CK0H 4HLJA 4PYHA 5F1IA 3HNTH 1BBDL 3RWJA 2DRUA 2WWKO 1IZJA 1JV5B 3O45A 1DDHB 2NY2C 4RGNE 1MI5D 1U91A 4U6XB 4ZUWB 2F58H 5LCVL 6CGTA 2XZAL 3ARBD 2ZSWA 2NX5B 1NSNL 3GSOB 2E8ZA 5GQBA 5HDLA 1KLGB 2VXTH 1DBJL 4RAVB 1NGZA 4U0QB 1MHPH 4JRYD 2Z31C 3T4AA 4X80L 2FSEB 1BFOA 2BVUA 2C7UB 4KY1L 4N9OB 4EUPH 3ALWA 4RBPK 2E9WA 4LNRA 3D9AH 4L8BA 2DQHL 3D3VE 4NKDA 1KLFA 3B6SA 3OAYH 3KLAB 1I9IH 1G0DA 2Z91A 4LLVB 5IMOA 1Q9LB 4OQTL 2XNAA 4MXQC 2YA0A 3DMMD 3OGOE 1FVCA 3FZUD 4ODVH 3R06A 3HZKB 2HT3C 1I3GH 1GGIH 1QHOA 3TH3T 1WAAE 3TZVB 3ZTNH 4F33B 5DA4A 4PJEA 3D3VB 1MNUH 3EDDA 3GJFK 4LASL 1ZA6A 3DX8B 2VZSA 3TCLA 2FL5B 3C9NB 2FSEA 5C2BL 3BZ4A 5FOBB 2Y6SD 3RWCA 3UTTA 4G6KL 3PIQB 2P8PB 4LU5H 2JCCF 4UNTA 4LSUL 1A1OA 3JWDL 3EO9L 2QL1A 1X5JA 1JPGB 3LHPH 2DQUH 4GAJL 4WHTA 3ULUL 1CK0H 3F7QA 2OQJA 4X4MA 3RPIA 4I13B 4MX7B 5CD5D 4RGNB 3GSWA 4LCCC 2J2ZA 2CLVB 2HN7B 1PEWA 5F72S 3AS3A 1KPRB 1PSKH 4WI3A 3ILPB 3QI9C 1A6UH 1CWVA 4RIRA 1PKQB 2CMRH 1CFQA 4M7LL 4OF3A 4XVTH 4QCIA 1HILB 1J1XL 5EBWA 4ZAKB 3CMGA 4KUZL 1J12A 3REWA 4I2XB 1M4KA 2Z9TA 4IRJA 4RFOL 2ZSVA 1T03H 3HA0A 5E94B 4W6YB 5E6ID 3DARA 4Q6IC 4U1SB 3AREA 4YFEA 1CDCA 1BM3H 2AK1H 1T5WA 1R5WA 2J88L 1UQSB 4U6HB 3RGVD 3C09C 3L1OH 5HHMB 4UOW1 4M62L 2K9UA 5D2NA 5JOPD 5DJCB 4YFLF 5CP7B 5I1LB 1FZKB 5E4IA 3SQOH 4DVRH 4PJ9A 1KXVC 2XWTB 5EWIL 3OKEB 1OPGH 3LKQA 4XP5L 1OAYL 3MV8E 3UAJC 1B6UA 1O7SA 1OTUC 5KTEL 4HJJL 4UDTA 4ONOA 5FDYA 4AEIL 4MAYD 4EI5A 2IAMD 2NY5L 4JAMA 4MXWH 1I8MA 2ADIB 1MF2L 5GRWA 1R0AH 1FG2B 3LD8C 4OCSH 1BBDH 2Z31D 3ZKMD 1OCWL 2CO7B 2R23B 2Q7NA 4R4BA 1J05A 1UFUA 1IM3A 3ZTJG 4M61B 2IMMA 1OLZA 5IESL 5CILL 2VOTA 4OCRL 4QRQB 5IK3A 4WY7L 2YD3A 1R5VB 3NIGF 1MJ7L 4GXVH 3QXTA 4PRDB 3G08A 1G9EA 1MAKA 2ZSWB 1KTDA 4HK3N 5ACLA 4NOFA 1O0VA 5ICXA 3TNNA 4ZTOH 1KT2B 5DJAB 1OQXA 2E6QA 4HWEL 3IKKA 4KY1H 5F6IB 1NMBH 1CQYA 1B88A 3L3JB 4FNLH 1KPUB 2BP3A 5F89A 4LRIC 3ZKQD 4HWBH 1IAKB 3W39B 2VZ3A 4QRTA 4IS6B 3IU4L 3J7HA 4HIHA 1G9NH 2XTJC 1EA9C 1HWHB 4O2FA 4OSUL 2DQEL 3T1FA 3O45B 3HC3H 2F8VA 1LO3L 3VXMD 1U92B 5DVOA 2FCBA 3V0WL 4Z9KB 1I8LA 1BFTA 1IC5H 1F58L 3FB8A 2XWJB 2VZTA 3R1GH 1P84K 2Y36L 3MRPA 4M7JH 5ALCL 1R5VA 3DOSA 2NTFB 1GPOH 1KEGH 5CEYB 2Y1VA 3CXHJ 5EZJA 4KXZI 3V5HB 4JQXA 3IJSB 3FOMB 3MLZL 1AI1L 4KQ4L 4C59B 3H7BB 1SVCP 1DQLL 1H8NA 4O9HH 5HGBA 1FL5B 1CGTA 5T3ZL 1R3HA 4HGKC 3DMMC 43C9A 2Y23A 4HIHB 2EDQA 2Q76A 3C5ZC 1EV2E 1XGUB 3BKCL 2VN4A 5C7XL 1IE5A 3CPLA 3HCVA 4PJ7E 5DR5H 3H9ZA 2BVOB 3QQNA 4MQ7A 3DBXB 3BKYL 4M1DL 4UAOB 3UMTA 4DAGL 3EOBB 2BVQB 32C2B 1S8DB 1VENA 1BVKA 4PRHE 3FMGH 3O3AA 5E9DE 2IPKA 1QVOB 4PJCE 4Q58C 4Y4FD 4XC3H 3NCCB 4M93B 2EDDA 1ZA6B 3JV4B 1F2QA 4N90E 1UT9A 5LGJB 1YPZB 5JR1H 4LKXB 3NCFB 4J3TA 3BP5B 1A47A 5D5MB 3WO4C 1UWXH 3WDHA 3I9GH 2FECL 2R0WH 4PJEF 5E6IB 5IFAL 4Y7MA 43C9B 4YHKL 4AENB 1MFDH 1KB5B 5E8PA 3DX9B 4NQVA 3VG0H 4GAGL 1DQJB 1UH2A 4L4VA 1T1ZA 1XGTA 2XKUA 3G5ZA 3S3JA 5CD3A 4J3XA 2W91A 2VAAB 1I75A 5LAXA 3VH8B 2BVPB 1RK1A 1IGYA 2X70A 1MLCB 2VLME 3O3AB 2VH5L 2NXZD 1TCRB 1YEDB 1Y18B 3K8KA 3V52H 1G9MC 1DQDL 4NZRL 3SKNB 1A0QL 3V0VA 3QNYB 4C58B 1RY7B 5F6HI 2P8MB 1X5IA 1A5FL 5H94B 2IFFL 2JJUA 3VFGH 4N8PA 1AFVL 3O2VL 3QQ4A 1U3YA 3LKRA 2J8UB 4L4TD 2XI9A 4MNGA 4JFDE 1QPXA 4QRQA 3IDGB 3NZ8A 4XPTH 5IK3B 3U4BH 5J6HB 4BFGA 1G9ML 5DEFA 1JHLH 1CFSB 3EDKA 4X7EC 4F7PA 4Q97A 1EO7A 2EXYC 4K3JL 4ZUSB 3QA3A 3I3DA 4LHUG 2O5YL 1J0IA 5I0DA 3ULVD 4M6MH 3WN5C 1SYSA 1QQDA 1VDGA 2G75A 3MJ8A 4P2RD 1XCTB 3L3JA 1FVDB 5FV1L 3GO1H 2ICES 3J8F7 3BN9D 5C0CB 5D5MF 3N06B 3WFBH 2YN5A 5I8EA 3W0WB 1X7QB 5EUOF 3V4PL 1SY6H 3O3EB 1A14H 3VXMA 5IEHB 3RL1A 4XNXH 1IFHL 4UTBH 2AK4E 3P73B 4XCNB 4M8VA 4CN4A 2F8XC 5IW1A 4HDIB 5ALCH 1EJOL 3DLQR 3VW3H 4GW5A 3ZYOA 1N4XH 4Y5VA 4K2UL 1ZVHA 4QTIH 1XH3B 4C4KO 3U0TB 4YR6B 2OTUB 4H0HB 5DJAA 3TYGL 2A6IA 1JZ5A 5FXCH 4WUUA 4F2MB 4BZ2H 4NBXB 3B2UC 4MA3A 4NM8L 1UKSA 3C6SA 3UTTD 5EUOA 1OTTD 4Y4HB 5DRNA 5MEQA 4G80A 3SPVA 1CXKA 1FV1B 4G6KH 1EFXD 2FATH 4PJIA 2KPNA 3LQMA 5BVPH 1VADB 5GGQH 4XMLH 4PJCB 1G1YA 3LQZA 1HQRB 1HKLL 2KL6A 4K94C 1Q9WB 4U1MB 5KJRL 5AWNH 3QNXA 1KCRH 5JLZA 4U6YA 5HGHB 5F9AC 5GIRA 1RZGB 4APQC 4P5TA 5E95B 2L7UA 4CU6A 4U1GB 4X7TB 3REVA 3U1SL 1TITA 1RULL 2VERN 2IPUK 1UVQA 3OX8A 1KJMB 2Q6WA 4PIRF 1NGZB 5T5NF 3RDTD 4HUKB 1FGNH 1IAIL 1E27A 1NC2D 1EFQA 2OI9B 1SY6A 2DQDL 1MSPA 1RD6A 3GJFA 5DFVC 1DQDH 5HY9A 4LQ1A 5FA4B 4O02H 1T21B 1UJTA 3ALPA 2Z93A 3D9AL 2E7LC 1ZLVK 5KVFL 1DDHA 1NCBL 1AGBB 1UM5H 2FGZA 3LZFL 4JCLA 5E56A 4KROD 3OKKB 2W60B 4KMTL 4N9GB 2GQHA 4P46B 3EOBA 1Q9LA 2W0LA 2X4TB 4M1CC 3GSXB 3VFOB 1TVBB 3IDXL 1J1PL 3RP1A 4M7ZB 1FL6A 1CG9A 3D39E 1AGEB 4X80H 1LP9A 1PW3A 3VWJA 5BVJB 5L2KB 2DJUA 3GMQA 5A43C 2C3XA 4Z77B 2C1PA 2DLFL 2UVFA 2WWKT 5IF0A 3K1DA 4ZUTB 5IBUG 5TF1L 1RZKL 5D7SL 5CD5C 5JXAH 1E28A 5AD0A 3WNMA 4ZQKA 2G5RA 2F74A 4FN0A 3JUZA 3UTTB 1FNEA 2CK0L 4OZGB 3NACH 1T0NB 2Z0BA 1LGVA 1UCBH 4HK0B 3S34H 2P5ED 4EN3A 3UZEA 3VE0B 4QRRB 5DRZA 1UKQA 4ZFOA 4YDKL 1LEKA 1BZ7A 4KK8C 5EOCJ 4ELKA 5D4QA 4PUBL 5I73B 3KXFE 3PDOA 1CR9H 1KF9B 3WKMH 5KBNC 1K4DB 4DUVA 3GGWB 1FNFA 1T1WB 3DUUB 5JW4R 3VU2A 1UZ8B 3STZA 1I3VA 5C2BH 3T3PF 3PDGA 2CK2A 4GUPA 5F7NC 1SJEB 5I8EB 4AEEA 1IEHA 4PLNC 1U8KB 4IOIA 5C0EB 5I19H 1A6TA 2IEPA 5C0BA 4QXUL 4PJ5B 4HKXB 1D5BB 4RAUB 1G0XA 4XWGH 4FQIL 1DLHA 2ILLA 3QH3A 1P6FA 3ZDYE 3LEVL 1B2WH 1EXUA 4V1DA 4GW5B 5HBBA 3QHFL 3BN9C 3K4ZA 3KS0J 3OKEA 1WZLA 1NCCH 2EZ0D 5LGKA 1ZE3C 3MC0A 4OLYL 4XZUA 3C6SB 3FRPA 1MCFA 3UPRA 2ADFL 1FO0B 3IETB 4KUZH 3FO1B 3FQNA 5ANMB 2KDGA 2FIKA 3QUKA 2JELH 4KUCD 4OFVA 2BMKA 3FB6B 5DHYA 1UG9A 1QFWL 1CFNB 5F3HB 3IXTA 2UWEA 1S9YA 2A83B 2VDNL 3KR3L 3K80A 4F3FA 4HKBA 4XHJD 1TVHB 4X6DF 5FYJE 2ENYA 2WINA 2FB4H 1BD2D 3PL6B 3MCLH 4ETQA 3MV9B 1T66D 4B41A 4KRLB 5IESH 3SDXE 3BFOA 4JKWA 4QRUA 4WU7A 4X7TA 4WJ5B 5GSRB 5I1AA 3AMKA 5SX5H 2GK0B 4XWOD 4S0SD 5I15L 1ONQA 3I6LD 2WLZA 4FZEH 3W5MA 3S37H 4LLYA 3EFDL 1JNLH 4HFWB 4NO3B 2FJFA 5DMJB 3I02A 4NDMB 4PJ9C 5DJZA 5KSVB 1HN1A 2QKIA 4Z76A 1OSZB 5AYUH 4YBHA 1PYWA 1OGAA 4NQEE 2X4SA 5DHVA 3PV6B 5DMKA 1HSBB 1ZS8A 2GTZA 4KU1A 4NP4H 3CLFL 3KYNA 2OQJB 2Z35B 4HUWB 2BFVH 2J6EA 3HC0B 2X89D 3OWEA 4M62H 5TE7L 3DX7B 3LH2L 3S36L 1YY8B 4LP4A 1Q0YH 3O6KL 4WU7B 1NAKL 4Y5XB 3SHSA 4X4YA 4MXVF 3ZL4H 4YNYA 4OD2A 1BF8A 1G7JB 4Y4FC 4G6ML 2OTWB 1LE9A 3MV11 1KTRL 4JPWL 1S78C 2JIXA 3TYFB 1FNAA 2VLJE 3PQYE 4LCCA 3IU3A 5EOCH 3S3PA 3BEVB 3DUHA 3UBXI 4BFIA 5SWSE 1H5BB 2WBKA 1UQSA 1X5GA 4RISL 5F1KC 2DMKA 4OQTH 3WIHA 2B0SL 5IVNA 1KACB 1Z5LB 1DLFH 3QQ9D 4HX1B 2NR6D 4OCRH 2IBZY 2MPAH 3WFHA 4AQ1B 3BIKB 4O4YH 4YBQD 1WEJL 3LEVH 4P49A 4DGIH 1BEYH 3PWVA 1WBXB 4I0PC 3VGHA 3NCYP 3C09B 4ZFOL 3IFOA 3DURB 3NZHH 3C2AH 3GO1L 1D9KB 4L4TA 3BT2L 1V3LA 4HWEH 2B8OT 2MQCA 2B1AL 1SQ2N 3AGVA 1WQVT 2J6EL 3CFBA 2OSLB 3HPLA 2NYYD 4HV8B 3DYMA 2UY6A 4YXKH 2VDKL 5D96C 5EO9A 2HG5A 1J8HB 3F5WA 3W2DL 4HJ0C 4YHZH 4HUMB 1M7DB 1YDPA 4X98A 2G9HA 4Z7OE 4YAQA 2CKNA 1X5AA 3GSNA 1ETZB 3FT3A 3GKZA 4NCDA 3GSQB 1T2QH 2W0FB 5IOPB 3NOIA 2CRIA 4S11A 1YMME 1K4DA 4XXDA 3VH8A 1JYVA 1KTLB 2W59A 2YZ8A 3ULSB 3GSNL 4TVPD 4W4OC 2AJ3A 4DTGL 1Y0LB 1T7XA 3WIIH 2AERT 4NQSA 1JHTB 1LEGB 1ZVSA 1BD2B 4R2GC 4POZD 1OP3H 3V4VH 2E7BA 4PD4K 3RPKA 2D4FA 4IS6A 3VFNB 3A67L 5EC1A 2RJMA 2AXHA 2PN5A 2WBJA 4U1JB 4TOYH 4KRNA 4PGCB 2BY2A 3EHBD 1KIPB 1RJLB 1KCRL 3S9DB 1A7RL 4QGTA 2OX5A 1GH7A 1A2YA 2V7HB 1QKZH 1SJHB 2DL2A 3LKRB 1VFAB 1PQZB 2CLRB 5DD5L 3O8XD 5K59F 2NY0C 2XXCB 3MV8A 1H3VA 1D6VH 2OR9L 3QXWA 1FYHB 3BEWB 4NKIL 4H20H 1J87A 4YDVA 3V5HA 3W5NA 1KLGA 1OF2A 2FHCA 4LQFH 5EC2A 5I16A 3O6KH 3LAFA 1X4YA 4LARH 4P59H 1H8SA 5ANMA 1FLRL 3QG7H 1C12B 1R0AL 3EGSA 3FFCA 4UOJA 2C26A 2EO1A 3PXHA 4NN6C 5IWLC 4L8SA 3NFNB 4YEEA 1KELH 2R2HB 3F7PC 3AFLA 2L4OA 4QF1B 3PWLB 4N0YH 2FBJL 3WE6B 2EE2A 1NGWB 1BGXH 3DBXA 3KS0H 3LKSB 5ESQB 1FFQA 4NWTL 1F90L 4LFHD 5HYSB 5I1JH 4R26H 3KWWB 5L2KE 4HT1L 4PJXB 4LPTA 3QULB 1AD9A 2AEQL 1FFNB 1OAZH 1T7WA 4M6ML 3A6BL 1WFTA 5JHDE 4OF8A 3H0TA 4CN1A 1ADQL 2GSIB 4HZLB 3FFCE 4G6AD 5E7FA 2D31B 3TN0D 4I0PD 2O93L 1L0YA 4OF0A 4D9LH 5DO2D 3KLAA 3WJLA 4XNZC 2D2OA 3MRNB 3JV6B 3RVXC 1U9KA 3BN3B 3HPJA 5C0AD 3G6JE 1C7TA 2H9GA 4LHUB 4MA7H 4TUOB 3ALXA 2H3NA 4G8IB 5B21A 1HYSC 1PLGH 1S5HB 2GHWB 5EH1A 3JV5A 3S5LA 3U9UB 4MA8H 2DIJA 1KBGL 2Q86B 2NMSA 1TJGL 1W0WA 1DFBH 3Q6GL 2X1WL 3UXFA 2G2RB 2EE3A 2I9TB 1ZGLA 5HDBF 1CIUA 3FO2B 5LXGH 4HF5H 3TFKD 4YPGB 4JKKA 1NL0L 2VMFA 4HLZH 3WFBL 3VXSD 4BFBD 1S7XA 4HS6A 4HBCH 1T21A 2CR6A 2NY0B 4NIKB 5D7IF 1DBAH 2PTUA 2QQLH 3MNVB 4DN3H 3QDME 3BRFA 3MFFA 4FP8L 4GMSL 1KGCD 5GZND 3TT3H 1AY1L 5LGHL 4GG6A 4M5YL 4KMTH 4I48A 1UJ3B 3RA7L 1LK2B 4ZUVB 4DTGH 3W82A 1CF8H 2X6MA 3QO1A 4FS0A 1JGUH 1L7IL 4PBWD 5T1LB 1C16A 1NCTA 4RCAA 5T1MA 3B43A 2PTTA 3QEGH 4LVOB 5JR1L 1G7IB 3G6JF 3HZYA 5DUML 2XA3A 4XCYA 2DB8A 2WSKA 1A6UL 3GI9H 1WF5A 3MLSL 1ZMYA 4I18C 5HHVH 1JGDA 4PY7A 1JK8B 2FIRT 2UUDK 3DTXA 3X3GL 4QHNA 3JUYA 3PGDA 3MJ9L 4D8PB 2Z8RA 3IJYA 3MRJB 3RWJB 1TQBC 1QHPA 1AHWB 4Y2OA 4XAWH 4LDLB 3L6FA 5IB3A 3FCTB 1E4WH 2DIAA 3FAXA 3GEWB 4PRID 5DGRA 4L29B 4JR9H 4M61A 4P57A 4IMKA 3PHOB 5IWLA 1KULA 4F8QA 4XNMA 5DMIH 3TBWB 5B8CB 3LB6C 3B9KA 4OLXL 2YD7A 3QDMA 4EXKA 4TNVF 3INUH 1NDMB 3ULVL 4WEMB 4WHDA 3N85L 4I5BB 2YPVL 4IHOA 1W72L 2J8HA 4WI4A 1BQHG 4TSAL 5EU6A 5K9KB 3SE4C 1LO2H 4C56B 4LLMA 1B0RA 2VXSH 1NFDB 4TVSa 5GJTL 4H26B 5C6PB 5FFLA 3UBXG 3E6HB 5LBSL 2EICA 5IROA 3L5XL 3BDYH 1RZFL 3TO4B 3RY4A 1J05B 3PGDB 4YIQA 1A6WL 4DKFL 1JWMB 5JMOC 3MUGB 5D71H 1D5BA 4IRZL 3EYOA 4OFPA 3UTQB 2R0ZH 4QXUH 4NO5A 1S9KC 3LPFA 3AAZB 3ZKXB 3L3DA 3S88H 4KMQA 4LSPH 5HYEA 3GUTA 3V5KB 2UUDH 2YD9A 3O4LA 3MRMB 4JQXC 3IDXH 5C09E 3MBXL 1BREA 1T7YA 4Y0GA 5D72H 5JIKA 5TPWL 1KPUA 1FNLA 2IPTL 4HPOL 4I5BA 4EDXB 2A6KA 2CGRL 3BD5A 4K23H 3WL9A 4XP9H 5I76B 5FO8B 1UENA 5JW3L 5EU5A 4XVUD 4HF5L 3RUGE 1H3PL 3ZYJA 3KYKL 5FGBC 1A4JA 1K6QH 2HFFA 4WEBH 4OGXL 4NQCA 3OL2A 1UXWA 3DETC 4JRYA 5E2JA 2R2BA 2VIRA 1H0DA 1BIHA 2XA8L 1OSPH 5IVOA 4NKOA 1RJCA 4F57L 3ZYIA 3CFCH 5E9DB 5ETUA 2MSPA 3E3QC 3O81A 4NUGL 1MH5A 2EDXA 1D5XA 3UTPD 4HJGA 4XCCH 1AD0A 5DLMH 4FQXA 5ERWB 1K2DB 1RUML 4JZNA 3HC4L 1N3NB 4ZO7A 4JVWA 1PZ5A 3OGCB 3RWGB 1JMZA 1ZT4B 4JPIA 2R4SH 1A9EB 1NAML 3PDDA 4M1GL 2VUOA 5ADOH 1S7UB 1CLYL 2VKWA 1IC7H 3EOYG 2ITDB 1IILE 1S7SB 3VD9A 4XAWL 1JI2A 2H3NB 2NLJA 5T3ZD 4MGXA 3QWRA 3VA6A 4ZFOB 2EIBA 5GHWH 1RFDL 4WJ5A 5DVNA 2ENSA 5CJXA 1OWWA 1TPXC 3KPSB 1MRFH 2DIBA 5JHDB 4ZTPL 2G60L 4NRZB 4AEHH 3TIEB 4EQ3A 4PJGF 4D0BA 1C16B 3V6ZB 1XF3A 4O2EA 2BSSB 1DSFL 1ZGLB 1CD9B 2VYRE 4PJAF 2Q3ZA 1U3HD 3MA7B 2QKIB 1DEDA 2EO9A 3NA4A 4TSAH 4OLZL 1U0QA 3SGEH 43CAB 2IBBA 2Q8BL 4XCEB 2QQNL 1GGCL 3L5XH 4HKXA 4ZO8A 4YDLC 3KYNB 5E8NB 5C9JB 4IRSA 3L1OL 4L29A 4Q9QH 2EC8A 1I4FA 2NLJB 3P30H 4XAKE 1A9BA 4QRPE 4JQIL 4J3SA 3IF1B 3ULVH 5T1MB 1X5LA 4D0CB 1AIFA 4NQED 3UTSE 3D5OF 5EBLA 4XXCA 5I9QB 3CH8A 4GKNB 1W0VA 5FHAL 2DWDB 2D7MA 4WW1A 4JY5H 3BPLB 5INDB 1HIMH 2F9BT 3LMJH 4HCRH 3TO4D 3QUKB 2HFGH 1GOHA 4R8WH 4NC1E 5HGAB 1A6WH 2NXYD 1UGNA 4ODHL 1VFBA 3N1PC 1QSFE 2ZSVB 2P7TA 5CLTA 4NWUH 1KENL 1H15B 4AY0A 4C54A 3KGRA 3TZVC 5IFHL 3H9HA 4OI9A 4C57C 3QIUA 1BX2A 3T08A 3LSOA 4NNXA 5IT2L 5JPMB 1F4WH 3W9EA 1N7ML 4UI2A 4WDIB 4TYUA 3T65B 1EMTH 1TZGL 3Q2CA 1KPRA 4FG6D 1H8OA 1QBAA 3NA9L 5J11C 5DK0A 1QQDB 4JKPH 2NY2B 1VEPA 3T4AB 2EECA 2OJEA 2W0KA 1RSFA 5EBWB 4GKNA 4OIAA 1S5IH 3K81A 4OCNC 2HT4D 4LAQH 2HG5B 4RX4A 3HI5L 4ODSH 3SE3C 3KPLA 4Y1AE 1WT5C 3BKCH 1Z9LA 3RGHA 5C7XH 3VXTA 2Z31B 1F6AB 1QLFB 5H2BA 1FP5A 5B39A 3OV6A 4I2XE 3A6CH 3FO0H 4H1LH 3MXWL 1JYWA 1IBGH 3AS0A 1U8PB 3O6LL 2VLLA 1ORSA 3ARPA 1T89C 2FHFA 2W0FA 1VFAA 1NC4B 4FFYL 3WD5H 3DX7A 2XG5A 3TC9A 2OTUA 1TJGH 2W9EL 1MCHA 1VACA 3QWQB 3PE9A 1I8IA 2OTPA 4ZTPH 1RJYB 3VFWB 5F7EH 3P4LA 2VLKB 3L3GA 4J7RA 3GJEA 4JHAH 4YE4H 3QIWC 4HBCL 2W07A 3MRBB 4X9GA 1J5OL 3B6SB 4FQHA 3O3DB 4MMXC 1P4BH 4M43L 4XBEH 5IB4A 2HT2D 4KJPD 3FOLB 3P0YH 4R0LC 5C6WH 5EA0H 1BFVH 3IDIA 1AQDB 4BM7A 3D2UA 4O2FB 3MLXH 4GAGH 2E6JA 3HZVB 3EYUL 4NUJB 1JZ4A 4L4VD 1N0XH 1NJ9A 3DV6A 1R5IA 2DWEA 2PXYA 4BKLB 5GZNC 5I6XC 3GSXA 2C3VB 5C0IA 5T1KD 1OAXL 1P1ZB 4R26L 5I1HL 3GM0A 3JTTA 2UWEF 3F7YB 2AQ2A 1EHLH 2PO6C 1QO3A 4DCQB 5HYQB 4OT1H 1NMCB 1EEYB 1IAIH 5F97E 3RZCD 1QFHA 2YUVA 2P5WE 1MVFA 4NQEB 3T1FB 1O7VA 1R24B 2QLVB 3ZO0A 4S10A 2HTKD 4CKVX 3ZDZF 4JVUA 5AYQA 5KVEL 3D2UB 2CDEA 4KZDL 3GSWB 3OR6B 1QP1A 2D0FA 3T2NL 3OKNB 1T6WA 4ZUUB 1CXLA 4MQXC 1DN0B 1T2XA 5TQ0L 2B5IC 3TJHD 4WO4D 1RPQA 1NGXB 5CCKL 3FZUC 4QRRD 3TIDA 1K4CB 2P5WB 1IGCL 3BZEA 1SYSB 1CI5A 2NX5E 1K85A 5HPMA 5EBLB 2AI0L 4KKCC 1W0YT 3HMWL 1IVLA 4X83A 1YNTA 2VLRA 3SE3A 2ZKHL 3BE1L 3GZKA 5JMRA 4JFHD 2QTEA 4P3DA 1BQHB 4A6YB 4DWHA 4GQ9H 5CIPH 1A8JH 3U46A 3N0PB 1BZQK 3FO9B 3VFGL 4JG1H 4PREB 3DMMB 2PW1A 3MLTB 5JXED 1QFWI 3BP4B 2OXGA 1XH3A 4YR6A 4JDZB 2NY7L 5ECJE 1GOGA 1KTKE 4HIJB 4GJTB 4Q9RL 3BEWA 3WXVH 1WLHA 4DVBB 5HTSA 3STBA 2NY3D 3D85A 4ELME 3MRRB 4YC2B 3ZDZE 3G04B 3CFDB 3CAFA 2AGJL 3ECBB 4PTUB 4GRWB 5D1XA 5F7DB 4ZMAT 2OJEB 4NQCE 4QTHB 1FO0A 1KCSL 4PS4L 3E8UL 3RVXD 4U1KA 1OTSC 4UU9B 1WIUA 2FIKB 4DFHA 4BQBA 2VQTA 2BDNL 5E1HB 3U2SA 3M1BB 3L6FB 5IB3B 3ILQD 1Y6KR 2ICWA 4D0DA 2BSED 5E6IC 1HI6A 1IKFH 4GOSA 5EIQA 1WJ3A 4RGMB 4UNUA 3NH7H 1C5BL 5GGUB 1CGXA 5FHBH 1YN7B 3G6AA 2P47B 4JFOA 1EUTA 3GMLB 1PG7L 4HIJA 4GS7B 3HZYB 3TH4T 2VKXA 4Y19E 4JREC 3VGBA 2PKDA 1HHJA 4KVCL 5CIPA 1JGDB 2AV7B 2R4RL 4KHTH 3MRDB 5EZOL 4X8XA 3TT1H 1TIUA 2VLKD 5ADOL 2V17L 2W1NA 5KS9F 2ZNXA 5KSBA 1TETH 3RTQB 2YC1B 3MRKB 4P9MH 4PB9H 1XGUA 2XPGB 2H1PH 3EYFA 4LP5A 1D9KD 4MNGB 4XCNA 3WBDA 4FMKA 4OD1H 4HGWB 3GMPA 3B9KC 1ZGLM 5F1NB 3F58H 1WWWX 3UP1A 5DMIL 3WNLA 1LP9E 5EBMA 5LCVH 4AH2B 2R0ZL 2Y5TA 1U58B 1YN7A 3HE6D 3S4SA 1DQTA 1T5XB 3OKOA 4P5KA 3VXUB 2LVEA 4BUGA 3WJJA 5JA9A 1HH9A 1XF2B 1A64A 2FNBA 5HDBE 3ULVE 4FXKA 4NDMA 1CE6B 1G7PA 3M07A 4B5EA 5I1IL 4PRNB 4OLZH 5DVKA 3HFML 3E6HA 1YY9C 3DETD 3MRLB 4R6UA 2VNCA 1LDPL 3MYZA 3ULUC 2VWEE 1JV5A 5CZVH 1RAMA 1FH5L 4K7PH 5IMKA 3RL2A 3UYOD 2ZWLT 4YQXH 3DX6A 3FB5B 3BGMB 3V8CA 4ONHB 4BZ1H 1F58H 3WKNA 1KB5A 5E8PB 3T2NH 1DBBH 1YEGL 2P44B 5FO7A 1P7HL 4FABH 1UACH 1BVKB 3CMOH 1OAYH 3RY5A 3VGAB 5HYSG 4WV1A 2R1WA 3MLWL 2Y72A 4OTXL 1FRGH 5T5FL 2RR3A 4Z7UA 3FQRB 3SDCA 4QXWA 3V0AC 4PD4J 4NRXB 5D6DA 4AEIH 4LHJB 3DUSB 1CLCA 2ZOLA 2DTMH 3T04D 5IGXH 1JZ3A 3AVEA 4TPRL 4ZXBC 3P40A 4U1NB 1NMBL 2Z8WC 3BMWA 3R8QA 2ED9A 4WWKD 1JTOA 4XCCL 3DI2B 1LNUB 4D2NA 1NPUA 5HY9B 3BDXA 5C71A 2NZ9D 1RZFH 3TJHC 4JO3H 3BQUB 3JWDC 2B0SH 2NY3B 4HUNB 4U6TA 3SDCD 1F5WA 1IC5L 2BVPA 3RPIB 4Z7QF 4TVPH 1EEZB 1JPTH 3LQAH 5E99H 4UNVA 3VW3L 1D5IL 3K8MA 1RZJC 3WFCH 1IM9D 1FZMA 1HOCB 1G7LB 2BVTA 4XTRD 1HZHL 5DVMA 3RU8L 4NFBA 4MA1B 3V6FA 2BNRA 3HR5B 4O58H 3CSPA 4OKVA 1EGJL 5E5MB 5FKAB 1ZT4A 3R0NA 2VDNH 3KAAA 3UJIL 4Y4KB 4K71B 1MHEA 3IRZA 4N68A 3F8UB 1AGBA 4YXKL 4ZQKB 2A6DA 5FCUH 5C0GA 3MREB 2XFXA 4PJAA 1NLDH 4XPBH 3UJTH 5D7LB 2I27N 1BM3L 3JSSA 3O4OB 5JXEA 5C9JA 3SOBH 5D1ZA 3BPCB 2P49B 3SJVA 1C1EL 3WIFB 5B4MC 4LPUA 2D7TL 5MENB 2NY6B 4ZOBA 3RVVD 1RUQH 4ZUSA 4FZEL 5ABDE 2EIDA 3RGVB 1Y6NR 3FAWA 3VI3E 4OFYD 4BQ6A 4ZSOE 3CFCL 3VRJB 4P9HC 2EYRA 1JZ6A 2X4RB 4OUOA 1ES0B 1IL1B 1FZMB 1U8MB 1S7WA 5GPRA 4ZS6C 3BVNA 3RWHA 4A6YH 4RX4D 4Y4HA 5CGTA 5TQ2L 4TUKL 2K1MA 4FXLA 5C08A 5F8QC 2FWOA 2AKRB 3MODL 4MB5A 5C07B 1IGML 3T4YA 3MOBH 4EUPA 5JW5B 1JIBA 3F58L 3WSQL 4AQOA 3ARZA 4O5LH 5GGUA 2HMIC 4HQQH 2HJLA 1RV6X 3MV8D 2R8SL 3TO4C 2IADB 4S1DC 4M48L 1AIFB 1IGFH 5JPNB 1NAKH 3WIFA 4ELMB 3QEQB 4XP6L 4PJ7F 1CICC 4OUUB 5GZOC 1N7MH 1U95A 3WIHL 2O5ZL 3FFDB 4HBQA 5HHOD 1ZSDB 3UZVB 1HIML 3H9YA 3LMJL 4X6DA 4Y19D 4GUPB 5L8LB 1WWBX 4J8RB 3JVGC 1AJ7L 4U1GC 2M26A 2CLZA 4EKXA 1J8HE 1S7UA 4L3EB 5CJ8A 5FYKL 3MO1A 4LGPB 3IU4H 2MQ3A 2PYEA 1CGUA 3MRGB 4G9FA 2DDQH 4F15C 1NGWA 2FEEL 3DX6B 3C5JB 2VZ1A 4ORZC 3VJ6A 3MRHA 4EUPB 4W4OA 3HC3L 4MSWB 2O26U 4UOW0 2AVGA 1N4XL 2Y5TB 4F7TA 5CBEA 3D2UD 2VN7A 4RA0C 1YY9D 3QCVH 4HT1H 2XTLA 1MIMH 1XGPA 3QT2A 4F37F 4N1EA 4Y8DC 1JMXA 3DUSA 4GMTL 1KYOJ 1URLA 3QI9A 2VZVA 1I1FB 5ID1A 4EQ2A 3VWKD 4G7YL 2A1WH 3CFJA 2FX7H 4Y4KD 1JGEB 3F6IA 4R7DB 3SKMA 2Q3AA 1Y6MR 3F7VA 5IEKB 4LASH 3T0WA 1KCVL 4HUUA 5DRXB 3D0VB 2IGFL 4MD5B 1T0MA 1UJ3C 3L3KB 5J1AA 1NBQA 1CLZH 4O9HL 1JF6A 3IDIB 5D1XC 2IG2H 2OP4H 4UUJA 2AJZA 1T66C 5DZNA 3LEYL 3T0EA 3LQAL 2GT9A 2GTZB 3IFLH 2AQ1A 5FO9B 4QRRA 2MMXA 5DD0L 4MCZB 3PUCA 3RZWA 5ALBL 5F7KC 4NQXB 2I25N 3QO1B 1GC1C 1T1WA 4PJDE 2DQGL 3VFMB 1T1YB 4OZIF 5I1HH 3TN0C 2VE6B 1SY6L 1L9MA 2PR4H 4MNQD 4FQHB 1MREH 1T7ZA 4I3RL 2I5YH 2J6EH 2NY1D 5HHXL 2IBGA 4LRIA 5KVFH 3Q3GB 5C0ND 2GKIA 1FC1A 3V7AG 2LVCA 3OJ2C 2GSGA 8FABA 3HI1A 3AUVA 4FG6C 4QT5A 5FYJH 2IALA 3H2WA 3QDGD 1ZEAL 5IMMB 3RUGF 5IHZA 3MOBL 3VFUA 2EH7L 3CGTA 3HUJE 2V5SA 1NC4D 4ZFFB 3X12A 5E6ZA 5DF0A 1TJHH 2AXJA 3P9LB 2DQFA 3D69B 4PRPD 4PJXF 3DUUA 4CADB 1DVFB 1IGYB 5C6TL 3B9KB 4MQTB 4TULH 4HMCA 5CJBA 4R96B 4ZDHB 3ELAT 1G7JA 3DURA 5I8KL 3WFDL 3S37L 3UPRB 5TFSL 4AK1A 2EIZB 4LOUD 5FKPB 3V0VB 5K9KA 3S96A 4NNPL 3H6JA 2V5YA 3QEHB 3C8HA 5EFIB 4JKMA 4Z7QE 1V7NL 2DM7A 4K7FB 1AHWA 4PJHB 1OAKL 2FD6H 2DI9A 3CDGA 1N6QH 3QZWB 4P2OD 2MWCA 4OF5A 2CRZA 1DQJA 5E00A 1CICA 2E7MA 4WGWB 2ID5A 3OKNA 4IRSD 4O00A 3HAEB 2AEQH 4RDQG 2CO6B 1HSAA 1JFQL 2OMBA 1SMAA 4U7KA 4WWKC 3NN8A 1U8MA 3IRPX 4GT7A 4XPGH 3MRRA 3SBWA 4NHCH 1N2RB 4BH8A 1P2CA 1FBIL 4LOUC 4M7KH 2ZKHH 1AJ7H 3VGEA 1YJDL 3OPZH 3VXQA 3FB6A 3SGEI 3QG7L 4L8DA 3V4UL 4CNIB 5DTFB 1UM5L 4LNRB 5C0AE 2DDQL 1CL7H 3PGCB 1N5AA 2NY3C 4JJ5A 2H26B 9CGTA 5F9DC 3V6OA 3CNKA 2IG2L 2AAVA 4LLDA 1ZVYA 5L9DL 3I84A 2WLYA 2VXVL 2ZG2A 5HVHC 1U36A 5FYKE 1MWAB 4Y2DA 2C3VA 4Y2DC 1OTSD 2Z92A 4MWFA 1YQVH 4LVNB 3DVGA 4TPRH 4FFZL 2YD8A 4PLJC 1OT2A 1I9JH 1B4JH 5A2FA 3DHJA 3IDNB 3X13A 5L6YH 4CAGA 1DUZB 4M3JA 1RIUL 4QHKI 5JQHC 2KQMA 4L8BB 5F1OB 1SHMA 5C8JB 3ULVF 1CDJA 4P2QB 3GHEH 5I74B 2R69H 2KZWA 4YBLB 5SV4A 1MCOH 1QSEE 1KPVA 4NBYB 1EVUA 2JLLA 2Q8AH 2W92A 5T3ZH 1Q9KB 5AEAA 4LLVA 2XWBB 4UQ2B 3DI3B 3HTLX 4M5YH 1LO4H 1JNHB 1SM3H 3U7YL 5HYJE 4E41E 3BXNB 2ADGA 1T1ZB 4G7VL 1XGTB 4DZBA 4Z6AT 2VDRL 4JFFE 3QDJA 1B2WL 2P5EE 5LJYH 4OLUH 1T2QL 4ODWA 3B9AA 4ELMF 5C0BD 4NZJA 5K9OB 3CFJB 3BP7A 3KPNA 4Q0XH 3VG9C 1QFOA 4X9IA 5TF0A 3LB6D 4JEGB 3VXRD 1IAKA 3W39A 1ZT7B 4LU5L 5HHPB 4L8CA 3EYSH 4KMLB 5FYJD 3MRQA 4PS4H 2EDFA 4PB9L 1A6VH 3A67H 5EO9B 3BMVA 5DR5L 3H42H 1VPOL 2PO6B 2DQTL 4P2CG 1YEHH 3FB5A 4JFPB 1MRDL 2HTKC 3P0GB 4R4ND 2BFVL 3KPPA 1NCBH 1H3TA 4IIQA 3C8DA 4YHKH 3AY4C 4Y5XC 1Z0MA 2ATKA 5HYSA 3G5VA 3O4LD 5L7XH 3GJFH 4PRPE 1T5XA 4P2OB 1AXSB 2EIEA 3TNMA 5CEYA 4HWNA 4WO4C 5HJ3B 3U9UA 4A6YL 4F7CA 4FXKB 2YPVH 1KJVB 3PQYB 1KN4L 5I1IH 4KK9C 4R96A 3T0ED 2XRAL 3RHWF 2WNGA 2ITCB 2B4CL 1BD2A 4J2XA 2VXSL 4WVRA 5GJTH 4RNRB 3DGGB 5H35A 4U1NA 3C60A 2Y7QB 1JN6B 3MA9H 4U1KB 3U4AA 2ZPKH 1JPST 3ULVC 2V5MA 2DLFH 3WSQH 2IALB 1J0YA 1Q0XL 3LKPA 5FM4A 2Y25A 2ICWB 2IQAB 1HYSD 2H1PL 4QGYA 2N1KA 4JFYB 2J1KA 3EDJA 5GRVL 4ALAL 4YHYB 1RMFH 1BGXL 2YKLH 4BSVB 3SEPA 5FGRA 4YDKH 2P5EB 1MFAH 5EPMB 2GUOB 4JFFB 1MFBL 3WFEH 4MJ6B 4R0LB 3ZTNL 3PQYA 3WFCL 3QJHA 3C6LC 2YUXA 2J7LA 1SJVA 4MD0B 4JLRA 2ARJQ 1QSEB 1FGVL 3B8YA 3M17A 4KDTA 4JY4A 3BH9B 2IMNA 4P3CH 4GG6E 5EN2A 4NQDD 4U1MA 1KN2L 4CVZB 3P0VL 3TEUA 2NW2A 5GJSH 1I1CA 2ZJSH 2I07B 5KSAC 4W70A 5ISZA 3RNKB 4JFHE 1TZHA 2QADC 4QHKJ 4XBPA 3T65A 1TVDA 1EEQA 4Y2DB 4DEPC 4IJ3B 4DZ8A 2PW2B 2PNDA 5A2KH 1HZHH 4NQCD 3ZKSD 4NBZB 5JA8B 2DTML 3V7MA 4PRNA 1RJYA 4KGJA 5E2TH 3RQ3A 4WW2C 1NEZB 2NW3B 4OQ1A 1FIGH 3VRLF 2Z93B 1B0GB 4LSUH 5JQ6H 4DKAA 4BQCA 1Q9OA 3MCG1 3RL2B 3O6ML 1J1OL 2A6JA 1I9RL 3LN5B 4OZIB 5IIEB 1PJ9A 4G7VH 4UQ2A 1B4RA 1AH1A 4ZS6D 1I8KB 2EEAA 1RFDH 5FHBL 2GAZA 2HRLA 1EZVY 5HHOB 4NN6B 1BEYL 3TESA 2OLDA 1ZHNB 1JF1A 5FF6A 1F4XL 2X4QA 4LGSB 2EH8H 4XBPB 5SWZB 2CIIB 4IMKC 3EYQD 1QSVA 4O2EB 5EZJB 5FDWA 1JYNA 4FRWA 4JN2B 4APQD 4MVBD 4P59L 3O2WH 1EAPA 2FJFB 5D1QD 3MJ8B 5A3ID 4CMMB 5IMLA 4LEXL 1Z0NA 4XMLL 3SGKA 1EFXB 2VQ1A 4TQEL 3T77A 4RGOH 1NEZA 1UWGL 3RKDC 3QWOB 2ARJA 5JDSA 3DRTA 2AXFB 4M43H 1UWEL 1F6LL 1QD0A 3IAPA 5DVLA 1J8KA 1BFVL 3JWDH 1KLUA 3QUMH 4MQ7B 1A7RH 3G5YA 1F90H 2IAMC 2Y07H 5DURB 4GG6B 3IXAA 3K2MC 1H3WM 4XVJL 5CBEB 4APQA 1G6RB 1DN0A 3OKLA 5J1SC 2DQJL 3CVHB 4NRYA 1A6AA 5KOVC 1KJVA 3HFMH 4GBXC 2N4IA 2UZXB 1NUFA 4JN2A 2CMRL 4M7LH 1X9QA 1VFUA 3N85H 1YYML 4X6CA 2CXKA 1KIRA 4KTDL 2D9CA 2W9DL 1FPTH 1PYWB 5F7MC 3QXUA 1U3ZA 2P43B 3RWGA 4BSJA 3EIFA 3MNVA 3LRSB 5FUZL 4Z7VE 5T1KB 1I1AD 4A2LA 1HQRA 1DLHB 2R9HD 3KYMB 1U3HC 3BPCA 1OP3K 3DMMA 2H6PA 5EORL 3G5ZB 4WFHD 3ME0A 4MXQD 3IKCB 4Z0XB 1AXSA 4Q9BA 3AY4A 4Y5XA 2VDLH 2QQKL 4X6EA 2ADJA 2HJKA 3GIZH 1EBAA 1OOAA 3DV4B 1Y18A 2P46B 3PXJA 4PJXE 1LE5A 5ERWA 4OBRA 4R0LA 5F9WB 3MJ7B 5FYLH 5JHLL 4M02A 4EDWL 4PG2C 2OR8A 5CJQL 2JKXA 5MEPA 5T1DL 1AI1H 3MLZH 4DN4H 2Y6SC 3FO0L 4ODHH 1ULVA 1KN2H 4ZFGH 2YD2A 4GQ9L 4KV5E 3HNVH 3STLB 4U0RC 4XMKL 4P2OC 1ZWIA 3O8XB 2AW2A 1I1AC 5DEGB 4OGYL 1RQ5A 4YFLI 35C8L 3U30B 4WFGD 4KJQC 2E6PA 4KZEH 3FN0L 5GRJL 3AAZA 5I30H 4GW4B 3CFKA 3QXAA 5E2WH 4OZHF 3GSUB 5EPMA 4RA3A 3RUGB 1XAUA 4W68A 2NCMA 2CPCA 2EDWA 2CIKB 3JBG7 5GS0D 1MIML 5IQ9B 5D9SA 1XR8B 1HHIB 4Y1AD 4ZFZB 3KJ6H 4KQ4H 5J8OA 5D7JA 1A14L 1DTUA 4HK3J 4UDTB 2C7UA 1J5OH 4JRXE 1CZ8L 5I8CB 2BXZA 5FKPA 2LU4A 4XHQA 5IKCB 1QLRA 4R3SB 5KSAD 3CK0H 4L3EE 2PYEB 1VADA 2W65A 1IZKA 4XCFL 2R23A 1OHQA 1X5YA 2F53A 4JFFD 4LPVA 4LCWD 1UA6L 6FABH 1N5YL 1I8KA 5TDOB 5ESAB 3ARVA 1LK3H 4XPAL 1VHPA 3GMPB 5KZCD 4CADA 3WLWC 1NUGA 5DRWA 3UTSA 5EU4A 3HMXH 3L7EA 1C5BH 1YEKL 1NDGA 3C6LB 2X9YA 3TZVA 4QWWC 1FYTA 4P2QE 4KTEL 4N8VG 3DROA 3TBYB 4AEHL 5L88H 2OBGA 1NFDE 5MI0B 3S35L 1AHWC 2XV6B 1WFUA 3LKNB 4JM2B 1WTLA 4MJ4A 3CFEB 4CW1B 1M6OB 1T1XA 3UO1H 1VFBB 5C07E 2WQ8A 1NAMA 2V2WA 1KC5H 5DC9B 4KHXH 3VXRB 4FQQA 3F62A 5M7QA 4B7IA 4LF3B 1SJHA 2V5TA 5EG6C 1WSST 4P9ML 3MYJB 3O3BA 4LEOB 1N6VA 3IAQA 3LSOB 5EWIH 3CLFH 4U1IA 3QFJA 1MWAA 1WBYB 2YXFA 3B9VA 1HHGB 3WLBB 3MV9D 3U4BL 2XRAH 5GS3A 4O51A 4RWYH 3HMXA 1OB1A 1MQKL 1HH9B 1XF2A 3RTQD 3PJSA 1RZ7H 1YNKH 1YQ2A 3CVHA 2JB6A 3NCMA 4NRYB 5BO1L 4Z7NF 4XI5D 2X9WA 1FYTB 3X3GH 1DUZA 2ZG3A 1W72B 1HXMB 3ARED 5JO5A 3GM8A 3IETA 3KJ4B 4ONGL 5ENWB 5I66A 1N59A 1I1AB 3MCKB 2EDTA 1J18A 5HGBB 1INQB 5KS9A 4RMVA 4N8CH 3GK8L 4WEBL 1KPVB 2WP3T 2FEEI 4QT5B 2Q7YA 4JZJA 2Q76B 5EORH 2YKLL 4UTBL 4RISH 5IHZB 3TBTB 1H3GA 4S1RL 2C4XA 1S7QA 3UJJL 4OLXH 1PX3A 3S98A 5IFJB 1L6XA 4AIZB 3FT4A 4WW2F 3DV6B 4NRZA 4K8RC 5KSUA 3SKOB 3CMOL 3HG1B 5EU3B 1C5DA 5TDNA 35C8H 3SDYL 5F7WC 3NIFF 1E4KA 4X7DC 5FK9B 12E8L 1P1ZA 3K1KC 4GG8B 5E2WL 2ZUQB 1L7TL 5C09D 1B3JA 3ROOB 3MMEB 5IW3A 1SYVA 3FOMA 5D72L 3REWB 4NNYB 5KG9A 5DD3L 2GTWA 2FGWL 3QUYD 5IHBA 5HGAA 5KSBF 3RFZC 4UB0L 4TVPE 1BZ9A 4LKCA 5I71C 3UYRL 4R2GB 3FRPG 1CICB 3MREA 2XQBH 3NH7L 1VGEL 4PJ7B 4JFOB 5T33H 4D0CA 2PF6A 2XTJD 5ITFA 4JM4H 4AIZA 1B6DA 5GGTH 4CMHC 2EDOA 4P2OA 3PWJB 5EZLB 1WISA 4KK8D 3NBNA 1OF2B 4ZXBD 3SQBA 1ZOXA 1LE5B 5HHMD 5EIIA 3ULUF 2G2RA 1MLBA 3I50L 3VRJA 3BDBA 5I17B 1JCKA 4IDJL 2AGJH 2PYED 1EEYA 2A9NL 3G6DH 3PL6C 1ZV5A 5JORA 1AGDA 1ZTXL 3DVNA 1I3RA 5I18L 1PY4A 4S1SH 1KUMA 4NHUA 1JGVH 3CD4A 2OL3L 5DC4B 4OGZA 3DX9A 1CU4H 3V95A 5F88B 4OZHB 1SJXA 4F57H 4KTYA 4ZUVA 5FCSH 4HX1A 5SV3A 3FQWA 2DI8A 2FYYA 1K9TA 1GGYA 2EYTA 4N5ED 3UYPA 4TULL 5IVXA 1LO0L 4AEFA 2WMPA 1MLCA 4TN9A 2RIKA 2ADFH 5HPMB 1HHIA 3DO3A 4O2CA 4ODUB 2G60H 3H3BC 3OZ9H 3ARBB 3RZCB 4OZ4B 2Y7QA 2OL3B 2VLMD 5IW6A 2J8OA 3QUMA 2F19H 5DFWH 5JZ7D 4NZTL 5C3TA 3O4LE 2BY3A 5I6XB 1F6AA 5E5UB 3N50A 4JRXD 2F53B 3M17B 4OGAD 5CGMA 1MIEH 3U2SB 3G5XB 1GGCH 3MR9B 1R5WB 1U91B 3MYJA 3L5JA 4LSTH 3UTQA 1OAQL 1DQQA 5DO2C 1S5HA 2BJMH 1X5ZA 4L4TE 5I1JL 1WZ1H 1MOEA 1XGQB 4X99A 3O9WD 3ARRA 4KC3B 3RBGA 5BW7A 3U48A 3LY6A 1UEMA 5I1EH 3V4UH 3VI4F 4FQXD 1J11A 4MD0A 5J13C 5HGDB 1JYXA 2A74A 5I1DB 3MA9L 3QG6A 1TMCB 3RL1B 1MF2H 3QEQE 5J7CC 1XGYL 3EOTL 5DJDA 3MXWH 4L9DA 2APWA 4U6XA 4ZUWA 1HSBA 1H5BA 2DTSA 4OZIA 4YBQC 1II4E 4H1LG 4UUJB 1SMOA 2XPGA 1T20A 2BVQA 5DQJB 3L9RA 3OB0H 4BH7B 1ZAGA 4X5LA 1JP5A 1U8HB 3MXVH 4X5WA 4JANB 3ARGA 5D6CA 1QSFA 4MA3B 2NY4B 5JW4N 4MA8L 1GZPB 2AEPH 4XT1C 1DBKH 1I1FA 5ID1B 4TTGA 3ROOA 3VXSE 4RNRA 4JKPL 4LK4A 4YHML 3EOAB 3VXNA 3O2WL 1N3NA 4IDJH 3L95B 7FABL 3SKJH 5J3HD 2DF3A 2ZCKL 1CL7I 1ZHBA 2AJXL 5J1AB 5BXFB 2DQIH 4OLWL 5F9JA 4AT6B 1YEFL 4J4PC 1LEIA 1E4XL 2RFXB 2VIRB 4L3CB 3MSPA 1M7DA 4MS8D 3IDGA 3NZ8B 1P4IL 3WFHB 4JDZA 3VXPA 4LLAA 2YN3A 3U79A 2Y36H 2VDPL 5ITFB 2P5EA 3MLRL 4EIZC 4EN3C 5JDJA 5HI5D 1CQKA 3WJLC 3ECBA 1CG9B 2E7HA 1I3UA 1GL4B 2B20A 1FVDA 4PB0L 1NL0H 2AJSL 4YDIL 4NKQB 5DSCB 5J4MA 3IJSA 1ZHLB 2ARJB 1F8TH 3TBVB 4HG4K 3T4YB 1U3JA 3QEHA 4NZTH 4Y5YA 5HHXH 2F15A 4Z7WE 1FPTL 1WFOA 4ISVA 4YFDB 1NANI 3H9SD 4JFEE 3ARBC 1WIPA 1NCNA 1RVFH 5D6DC 2BNQD 4LSRH 4LHUA 2EDNA 1NFIB 4RBPH 4QYOB 3ULUE 4APQB 4PRIA 1S78D 4QXTA 3OB8A 1BBJB 2YSSB 5AUMB 5F7EL 1TTUA 3WUWA 1VESA 3MLSH 2HH0L 3CVIH 5T3XL 3QXVA 5HVFB 4NFCA 1C5CL 4YHNB 1ZXQA 2BNRD 1OCWH 1DL7H 2ZUYA 5FHAH 3MBEC 1IKNC 1T5WB 1T83C 2OS7A 4Z7WA 1WTGT 4Y16B 3RVTC 4Y4KA 2ZUVA 3QNZA 1A2YB 1FH5H 4K7PL 4ENED 2XFXB 1QLEL 4PJAB 3N1FC 4X8JA 1DP0A 4NKOB 2VLKE 1BVLA 1Z9MA 2AJYH 3LKQB 4M00A 1XGPB 2B1HL 4M4PA 1MCBA 5CP3A 3TNNB 4X9HA 5D7LD 4PR5A 2X70B 4N1HB 4HJGB 3RVUD 5IW6B 4J4PA 4Q9CA 4QEGA 2JJTA 1L9NA 3EGSB 4HUUB 4NHCL 3MGAA 1KB9K 4JFDB 1SBSL 1GIGH 3L3KA 4K3GA 2XOTA 3L5HA 2VUYA 1U8NA 4OCMC 1MHEB 1INEL 2AJUL 5M94B 4KRPC 3VXTB 3W11C 4X0KA 3WN5A 4FOMA 1I1YA 2R0KH 1VGKB 1TVHA 4FHBD 3VA2C 2YBRB 1RZGA 5JW4Q 4XVUC 4KPHH 2VL4A 4TUJA 3MXVL 5CBAB 2YEZB 5IQ7L 4OFKA 5I73C 4OZIE 3KNBB 4Q6YA 4UT7L 4U2ZA 3RUGA 3VD5A 4AMKH 1DVFD 1P7KB 1Q0YL 3NZHL 1HHKA 1ZLUK 1UM4L 1FL6B 2ED7A 2EZ0C 4NC1C 3CXDH 4G6JH 2ZOKA 3TFKC 1K8IB 3I6GB 3RTQC 2AJVL 3HRPA 4YGVB 2VITA 5B38B 4U2YA 5TJWK 4HC1L 4MZ2A 5IROC 5DLML 3VFRA 1IARB 1U6AL 5E4EC 4HPYL 3ARYA 1RHFA 1Q72H 2XY1A 2BNUA 1G84A 3OKKA 3RKDD 4N9GA 4TSCL 1P9MA 2VR5A 4TOYL 5KW9L 3DPBA 4XH2A 4C56D 4YC2C 5ESAA 1BJ1H 5DMKB 1HH6A 2OZ4L 2NZ9C 4DZBB 5JUEH 4QHUA 5EOTA 1G7HB 4CJ0A 1YMMD 1CBVL 1P69B 3HE7D 5EUKA 3SOBL 2AQ3A 4JANA 1QYGL 3VXPB 3ZZ1A 2HLAA 1WBYA 3TGXA 3DECA 2BERA 1KIUA 1RUQL 5DEZA 5SWQB 3IDMB 3O4LB 3WV0A 2DYPD 1OAXH 2R0LL 1RIHH 2IANE 4Z77A 1BQLH 3MV7D 3S35H 3O0RH 1FFPA 5ACMA 1CD1A 4D9RD 4Q6IB 5E1AA 1BQUA 1NAMH 1H9VA 5F7HA 1ZHBB 2VLRD 1NAMB 2V2WB 2XACC 3TWCH 5CZVL 3QZWA 3OG6B 5KSAB 2BHZA 2PO6A 4M8QB 2IAMB 3MRGA 1A6VL 1QFWM 3BD3A 5FIEA 3H9HB 3QIUB 4P4KA 4DQOL 3U4EA 3NFPB 4WO4A 4NQTA 4D94A 3ULUD 5GRUL 3SJVB 2BOCB 3SO3B 4PRIB 4PJDB 4JFED 2P24A 4CVXB 1K8DB 1JNLL 1FQ9C 4ODBD 3FL7A 3T3PE 1OAUH 5K9JL 2N7AA 1G7MA 3F7RA 3WIIL 3OPZL 4KTDH 4L9LA 3AU1B 4PY7B 5TF1H 4G9FE 3TBVA 5JXAL 4X7SH 1MCSA 2P8MA 3KPLB 2DKUA 3EO0B 2V9TA 4Z8FH 3LN9A 1CFNA 2WK2A 3FCTA 3Q3GA 2V7NB 3RAJH 1HEZB 5JOFB 4PLKC 4Q9QL 2DBJA 2BJML 2PW1B 4YDJB 1JHLL 4CVZA 2GJJA 3HLAA 2JK5A 2LTQC 1RMFL 1B4JL 2X4RA 1FRGL 4OUUA 1IMHC 4I0CC 3VFMA 5DD6B 2M1KA 1CFVH 3VRIA 3CXHK 5D2NE 4KXZH 2BSSA 3QPQC 4NQSB 5T1DH 3WS6A 4L9LB 1XIWB 1XF4B 3BH8A 4POZC 4U33A 4DN4L 3HNTL 2BHUA 2F54A 5F3HA 5IB4B 3WL9B 1CLOH 3QJFB 3TN0A 1L4IA 3QQ4B 3HI5H 5EU5B 1F3RB 3TO2A 1Q38A 3I6KA 5FUCE 4MA7L 2BDNH 2BSTA 1E4KC 1T0NA 4XX1E 4HIXH 1C7SA 5T5FH 4ZFFA 3DSNA 3V0WH 4KAQH 2MHAB 1CD8A 2E27H 2H32H 3L3DB 4JO1H 3FQXB 3X3FH 4G6AC 4PP2A 1DFBL 3Q6GH 3L3OB 2FH6A 3D18A 5D7IE 4WEUD 3BP7B 3GDBA 4F33A 3EJZC 3MV01 3EFFB 3OKDA 5LXGL 3ARQA 3QUXA 4HAFA 5ENWA 1X7QA 2VR4A 4I4WA 5BVPL 3ZDXE 5IEKA 1F11A 2I9LB 3QUZB 1B0GA 4PGCA 4Z95L 3RTQA 2PYFB 4F58L 3O6LH 5IP4A 2CDFA 4XC1H 4XXCC 3LKOB 4JRYB 3PWLA 4C56E 1KYOK 3QIBD 4E5XB 3KPQB 5DMGC 3RX5A 1HH6B 1MFNA 1D5IH 2H32A 4PTTA 4LL9A 3NIFE 1CF8L 2GEEA 4PJ9D 5EUKB 1C1EH 4G6FB 4G9DB 3IFNL 4AG4H 3CC5B 5DUMH 4XX1G 1HXYB 1PBYA 4GG8A 4KK6D 5J12B 2WWMD 4TRPL 3U6RB 4ZPVA 5MENE 1T4KB 1XZ0A 4IOSD 4UTAL 3TVMB 3I75A 4TSBL 3AREC 3EYVB 3OAUL 5L2KD 3ARSA 4P9HL 5KS9E 4EI5C 3O6FC 3PGCA 4GW1B 3HB3D 5ELIA 2Z8VC 5IMKB 5FECB 1DBAL 4U6HA 1ZA3B 3LVEA 4ALAH 3BISA 4XMPL 3ZDXF 1ETZA 3FT3B 2EDJA 1T80A 3QHZH 2MFNA 3RY6A 3HNSH 3QULA 1CGYA 1XGRB 5D2NC 1J0HA 4J3VA 3RWFB 2P24B 5FYLD 5B39G 1FLRH 2DMCA 3ARDA 2HT2C 4KJPC 5D5ME 3WDJA 4QHMA 3VFWA 3DWTA 4PJIF 5K9QG 2C1OA 2O5ZH 4LAJH 4JPKH 3RX8A 2IGFH 1DEEA 3UTOA 1IQDB 2RGSA 1A0QH 5FA3B 1LO3H 3NACL 5CLWA 2VDMH 5ADPH 3VWJD 5D7JC 3PWPB 4X98B 3UPCA 4XP1H 3WEXB 5C0JB 1JWUB 3TPUA 2EDYA 2NY2D 5GGSB 1JTPA 4OBSA 3VFUB 3V79C 5GS1B 2GYSA 4UINL 1D3CA 4WV1B 2FYYB 4LCUA 5GGRA 1TDQA 3T0DA 4PJ9B 4OZFA 1JWSA 5GS0H 3LS5L 1D5ZB 4NN7B 5DA0B 3C2AL 2O61B 3LPWA 5BJTA 2C3WA 4NQDE 5A1AA 2VDPH 5GGVY 1U42A 4FTVD 4UMGA 1KJ3L 1GIGL 1G7IA 4FQ1H 1DQLH 3FT2B 1CLOL 1INEH 4CMHB 2F74B 1ZGLP 3QDAA 2CDGA 3D6GA 1HCFX 1W8NA 4NQEA 4FQIH 1FL3B 3BQUA 4W6XB 4QF1A 4F7EB 1P9MC 5I75B 2OCFD 3TCXA 5KVDH 1IC7L 3Q5OA 3LEXB 25C8H 4OM0L 4X4ZA 4E9LA 4XPBL 3OR6A 3UJTL 5ESVB 1NC4A 4WTZG 4ZOCA 5DJYA 5C70A 4PJXA 5HYIA 4PJDF 1UM4H 4P5MB 1U8OB 3VXUE 4XNMB 3MLUL 2XZQH 4LSPL 3MNWB 1ZLWH 3LRGA 2EYRB 1CCZA 1RZKC 2EDBA 2R56H 4FQPA 2ORBL 4OCYH 1EFXA 2HH0H 2VQ1B 4XVTL 3UTPE 2A73A 1NQBA 5C07D 1GXEA 3TO2B 1OARH 1LO5A 2DS4A 2VDQL 2GITA 5GGQL 2Q1EA 5K93A 3ARGC 3SDCC 3VGFA 1E4XH 4G8GE 5J0BA 1KEGL 3JV0A 1MCIA 5HDOA 1ZEAH 2C5DC 1OSPL 2H8PA 2IADA 4KRMB 4LDEB 3EDFA 4X4XA 4UDUA 3O9WA 3QEUA 3WDIA 2YPKB 5ITBH 4V1DD 4L9LC 4KKCD 1HXYA 1IGFL 5CSGA 1ROWA 1NBZA 4N90D 2NXZC 5JOEA 4WFFE 2WIIA 4R2GD 4I3RH 1IT9H 5C8JA 3FFDA 3SY0A 3DVFA 4XBEL 1F11B 4NKMA 2AKRA 4PB0H 1M6OA 1U8JA 1X5HA 2Q8BH 2EDLA 4TNVK 1FDLH 2R4SL 3WMSA 2IH3A 1QEWA 2CJUH 3HPJB 1OAKH 3KPRD 3OJVC 1R24A 3ZKND 3QCUH 3C08L 3C5JA 5TE7H 1K3ZA 1T6VN 5HHNA 3Q0HA 5BMFL 5HHQB 2LFGA 1MY5A 5CSZB 1BLNA 3QPXH 4BZ1L 1CGSH 1TZHB 2WP3O 3ARUA 5L0QB 4ODWB 4JQVA 3WNKA 5MHSE 2P5WD 2Z4QA 3RKPA 1QVOA 1OP9A 3PWNB 2CUMA 1HOCA 5MI0C 1OTUD 2WAHA 5JHLH 3ET9F 1FVEA 2EXWC 2DL9A 1QRND 5I16B