5E2WH

Anti-tau at8 fab with triply phosphorylated tau peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
208
Chain Sequence
b'DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT8 LIGHT CHAIN
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 208
sequence length 214
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH01
4M48L 2DQTL 3N85L 4XNUL 5A3IC 1RIVL 3QQ3A 3WNLA 4Y1AE 3U36A 2BNRA 2HT4D 4X7EC 3GB7A 2J2ZA 2VXVH 5HYEA 1FGVH 2XKUA 5BQ7B 4I3RL 3MJ6A 1A4JA 1G1CA 1G7HB 1UCBL 4LSUL 3BUTA 2B0SH 2MQ0A 1NBYB 2BOBA 5HYIA 3HZYB 5EU6A 5I75B 1K4DA 4WO4D 3CFEB 3D3VE 4KTYA 5ANMB 4OTXL 4YHYB 2FDBP 4LF3A 4ELMB 4OCXH 3QEHB 1FAKT 4ODSH 5LBSL 2DQFB 2V2TA 5GRUH 3O2WL 5KW9L 3U7YL 2F8VA 4HUMB 1YECH 3P9MB 3AGVA 3WFCH 2FBJL 4R7NA 4MVBC 3P4LA 1L7TL 1KACB 3EFFB 4XPHL 5ALBL 4HWEH 2EYRA 4K23H 5IHUH 2A6DA 1HH6B 4YIQA 2F5AH 4TNVK 5D2NA 3CVHB 5HY9A 4FTVD 1SEQH 4J3VA 3MLRH 4N1HB 3QXAB 3UO1H 1LDSA 4HCRL 1N6QH 5DURB 1GRWA 4XXDA 2H3NB 2EDEA 4P23C 4YWGH 4XTRD 3WO3B 2ZUXA 3QIWC 3RVXD 3HLAB 3MO1B 1OB1A 3PUCA 2ATPB 4N0UA 4KXZH 3KXFD 4UIMB 3MUHL 3MRIA 3V5HB 5L88L 3QUXD 3JVGC 5GGUB 5CSZA 3CXDH 2JB6B 3QHFL 4ZD3H 2QBWA 3O6LL 5DRZB 4F7CA 4MDJB 4PJ5E 3V52H 1FV1A 2C1PB 4W4NA 2BVYA 4OIAA 4KROB 1YN7A 4NOBA 4G43A 1A6WL 2FX7L 3FQWB 5D6DA 3DWTA 4DN3H 5SV4A 4HLJA 2O61A 3R1GH 1VACB 4WU7B 4Y4KC 2VNCA 1I8IB 5E2TL 4YFDB 3ROOB 5ICZB 4BZ2L 4XPBH 5FM5M 5LGHL 1BJ1J 4F2MA 1I3GL 5HHMD 2F8XC 1ZHLA 3BN3B 5DMKA 3O9WB 1CTOA 4ZXBA 2WAHA 3QPQD 1MWAB 5CWSB 3D69B 4P2RB 3RY4A 3P40A 1YJDL 4RISH 1YNKH 5DF0A 3MQIA 1H0DB 1QP1A 4O2FA 5SWSA 3NCJL 2K7PA 3PGDA 1I9EA 5E94B 4HG4K 2ITCB 2AVGA 2G9HB 3SGDI 4XVSH 3U0WH 2C5DC 3PGCA 3TV3H 8FABB 3DBXB 1ZGLB 4IRZL 1FYTB 4WY7L 3CPLB 3TC9A 3UROR 5DJDA 3L3GA 2K1MA 2MNUA 1G7QB 1J05A 5D5MF 2IBZX 4GKZA 1J0HA 3D48R 3MRMA 4M9OA 4PRHA 3RGVA 2ESVE 2V5YA 3RDTC 2P8MB 4PRIA 43CAA 4BK4A 3RGHA 3STLB 1C08B 4LCYA 5JOFA 1K6QL 3IDNA 3MNZA 1ETZB 2YC1A 4N0CC 1FORH 4I5BA 4JVPA 4N8VA 3RJDA 3UTQA 3QJHB 3LQAL 4X4ME 2HRLA 5IMLB 2DD8L 3DV6B 2HH0H 4LVHC 4FOMA 4Q7DA 5FF6B 4QTHB 4OZHA 1IAIM 4WUKL 2I24N 2XWJA 4XC3H 2ERJC 1XGTB 3BOVA 5D2LF 3GMQA 3RTQD 4OCWH 2YSSA 1M05A 5TE4H 2QHRH 2QQKH 3SPVA 3OL2A 5GGTA 2FLBT 1IJ9A 4JM4H 4ESKA 5T1DL 1PFCA 1UQSB 3B5TA 4L9LB 4L4TA 3VDCA 1GOHA 4JFYB 2OI9B 3HAEB 4IRJC 4Y4HC 1J86A 1U36A 3C60D 2CIIA 4NHCL 1LO5B 1G0YR 7FABL 1BFOB 2HN7A 4RQQB 1J0KA 3SQOH 4JFDB 2NX5D 2DM7A 4P46A 3PWPB 4HJJH 4P2OB 3B9KB 1PKQA 2V2WA 3SDDA 5DGQA 3ECBB 2Y9RT 3BZ4A 4YHNB 4EQ3A 4RGNE 5CS7A 5IMKB 2XN9E 3DTXB 1AD0B 4PRPB 5JQ6L 2UVFA 2VWEE 3KYNA 3GI9L 4HJ0D 3NFSH 4ONHA 4NKMA 3T77A 5GGRB 4JY6A 1FE8L 1T89C 3IETB 1WCBB 1R3HB 5LWYH 3W2DH 4IRSA 3SEPA 5IW3A 1F4WL 3B6SA 4AT6A 3HE6C 5C0CB 3TP4A 1H3UA 5FYKE 2P5WE 2HMID 4E41E 1A6UH 5C09D 1JGEB 1IGCL 3DX7B 3NA9L 1YJDC 2VZTA 2BVQB 2D03H 2CJUH 2IBBA 3MBED 4P5TD 4DVRL 1FGNH 1U95B 1TQBB 1VA9A 1TVBA 5I19H 2HFFA 1QSED 5ABDE 1NCWL 4Y5YA 4PJ9A 3U79A 5ENWB 4ZFGL 3F65A 2AJYL 1YNLH 4DVBA 2VN4A 1XGPA 2DTMH 3FB8B 5IVZB 4P23B 3QEGH 1Z3GH 4WI8A 1QO3A 5BRZE 2V7HA 3QIWB 5I18H 2IH3A 3EO1B 3HFML 3K80A 1UWXH 2P5EB 5BW7A 4W6XB 3O41B 4JVUA 3IJYB 3AREA 5JPMA 3MRFA 4XCEA 1FIEA 1T5XB 1JV5B 25C8H 1P69B 2ADGB 2AERT 3UEZA 2BVUA 1PD6A 4JHAH 1G6RL 4X99A 4LCWE 3LQAC 1YMMA 4Y4KB 5E8OA 4Z7OE 1OSZB 4ZPVB 2NY4D 4H8WL 2ZG2A 5DFTA 4LPUA 2X4PB 3STBA 2J6EH 4XBEL 2V5MA 4BFBD 1IAIH 2NY5C 2XG4A 4LBEA 2O5YL 4FZ8H 1JCKA 1OGTA 4GQPH 4WI5A 5DHVA 4C56A 3R8QA 5FA3B 4HDIB 2FNBA 4D3CL 4X6DA 1T83A 2LABA 1BF8A 5IFJB 3EJZD 1MJJB 1IT9L 3ULSB 1WV7T 4UB0L 2CXGA 4XI5C 4IIQA 5E6IA 1RZGA 1IEBA 3MC0A 1VADA 2N4IA 3IFNL 4ZSOA 2MCG1 5IEHA 1VERA 4QHUA 4PG9A 5DC9B 4LP5A 2Q8AH 1ZVSB 4WI6A 2R29L 5K33A 2BVPA 3ZMRA 3LD8C 5D7IA 2VDKH 1FZJB 4JFHE 1HXMB 4IEFB 4L8BA 5DRXB 4ZAKA 1H15B 1C5DB 1MCHA 4IMLB 5DS8B 2NY1C 1MSPA 1LO3H 4R2GD 4S1DC 3D39E 2OR7A 3C5JB 1UVQB 2H8PA 4WVRA 1HHHA 1E27B 3EZJB 3O3AB 1VFBB 5JW4Q 1LEIB 1REIA 4XH2A 2DQDL 2X1OA 3CNKA 1KULA 1JPGB 1A6AB 4BM7A 2CLZA 1SYVB 2E6QA 4G8GB 3TIDA 3X13A 3GSUB 5I1EL 4F33B 3PV6A 4WI7A 4XP5H 4OT1L 4ZODA 5GGVL 3ZSSA 2NXZB 4F9PC 3KWWA 3V5DA 1YY8B 3N1MC 1JWMA 3WN5C 4POYA 2DM3A 2V5RA 3K74B 3RVTD 1AFVL 4Y4HB 4IRJB 4U1KA 4GAYA 5C2UB 1DP0A 1C8PA 5ESQA 2VLRE 1H3PH 1KYOJ 3S37X 5HGBB 1J1OL 4AZ8A 5GRJL 2LQRA 3WUWB 1IAOB 4NKDB 4XMPL 3HZMB 1CGTA 3KYOB 2YD1A 3VXSA 3SHSA 3EW3B 1MPAL 1P4BL 1DFBH 3INUH 1ZLWH 4JGUA 3MV8E 1MHEA 3BDXA 3RIFF 4I48A 4PG2C 2KH2B 4CKVX 2ZUUA 1QPXA 3RX5A 5J1AB 2OR8A 1NUFA 3HRZA 4Z0BL 4ZUVB 1RJZB 1ZT7B 3KPPB 5DT1H 3MPCA 1CK0L 2VAAA 1RUQL 4HKZB 1KJ3L 4MXWL 1IC7L 3VW3L 1YYLL 3MJGX 3WFBH 3JUYA 3I84A 2GSGA 2RFXA 2GFBA 3HE6B 5I1CL 4P2RD 3H9HA 4H8WC 5C8JA 5C2BH 2IAND 1A5FL 5HSFA 5C9JA 5FUCE 4Q97A 5DVOA 2VLMD 2WBJD 2VLJE 3L5JA 4CJ0A 1KJ2H 3PDOA 4FXKB 4KRNA 3ZYZA 2PYEA 1MFEL 3ARBC 4XCNB 1YYMH 4KI5F 5LXGH 3OR7A 2UUDH 4Z7VF 3RBSA 3QWRD 4O02H 5C0NC 3ZDYE 4ODUB 3HI5H 1M6OA 1T7WA 4KTDH 3GMLA 1DBMH 4WUUB 2XTJC 3MROB 3C2AH 1FYTD 4Z0XB 3DUSB 2H32B 4JDTH 3QI9A 4HGMA 5EFIB 4QY8B 4OI7A 1T1YB 1MCFA 4M93C 2WLYA 4P5MA 5C3LD 4K3EH 4PJDE 5CBEB 1Q0YH 5SWZE 3DIFB 4Y4FD 1T20B 2O93L 3VXMA 1CE6A 5F1SA 5T3ZD 4QKXB 5AD0B 2VMFA 4W81A 4YHIB 4OCRH 3BD3A 3U83A 3T2NH 4O5LL 2XZZA 1MAJA 1D3CA 3AS3A 3ESUF 2DQGL 4PJ7E 1EPFA 3RHWK 2D9QB 1ZT1A 4FFVC 1ORQA 4M7JL 4KI5D 3H8NA 4GXVL 3T4YB 2O26U 1MCWW 3DXAB 1ZTXH 2VXSH 2Y07H 4BFIB 3WLBB 5I1DB 3UJTL 2XPGB 4KDTA 1MIMH 3CDYA 4G7YH 4XXCA 5FB8B 4U6YA 1JNLL 1OQXA 4MNQA 2VISA 3O2DA 2R9HD 2ZCHL 5INCB 4GKOA 3WS3A 5HYQB 3TYFB 1UM5H 3SCMA 4CW1B 1QRKA 2VLKA 1X5ZA 3OWEA 3PWPD 2RQ8A 4M62H 3B2VL 1N7MH 1OAZH 3B9KD 5D7LB 1AH1A 3VFMA 3ES6A 2YKLH 2CDFB 3EYSL 2XA3A 1MF2H 4PJEF 1RJYB 5T5FL 1NGPL 5KSAA 2HJKA 1JF1B 3LD8B 1D5BA 2YWZA 5GS0H 5E70A 1P5VA 1IGIH 2R0KL 5I76B 4NWTL 3SGEI 2GTWA 1BWWA 1U6AL 3KPMB 1A22B 2NXYD 2C7UA 5D7JB 5GGTL 2NY1B 3SBWA 3BE1L 5B4MD 1R3KB 3BDYH 4TPRH 4RDQF 1ZHBB 3QSKB 5T3XL 5L2KE 4UTAL 2P47B 1QZ1A 5TGBA 4DKAA 2ATKB 5D1QD 5ID0B 4F3FB 5D2NC 1ZLUH 5C0CD 3STZB 3GSRA 3NMEA 4MQSB 3LMJL 3SE9L 3BPLC 3LS4L 4JO3H 3NCFB 1YZZA 2RR3A 4PRNB 5H94B 1TZIA 4PJGF 5D96C 3VGFA 2XT1B 1CR9L 4GKNA 3G6DL 2HRPH 2NY0C 1ZLVH 5D93B 4YPGA 5FDYA 2DL2A 4U6XB 5IVXE 3ULUL 4BQ9A 3CC5A 3A6BH 5A40E 3BQUC 3KPRD 4OCSL 3RPIB 4X4YB 4WEUD 1GSMA 4JFQA 4PGDA 4OV5B 2AXHA 4HUVB 1TCMA 3QIWD 4WNQA 4NCDA 4P3DA 5DD3H 2YD4A 4R90H 3S96B 5D6DC 4H20L 5TJWK 5MEQA 3BH9B 5JHLH 1C16B 4XPGL 1EO5A 3CLFH 4FG6C 3O11A 4XWOC 4Z7UA 3CIQA 4Q6YA 4NBXB 4CJ1A 2CDGA 2YA1A 5MERB 4ZXBC 2X1QA 1HK6A 1K85A 2X7LA 2RAMA 4BZ1H 4PS4L 3D5OF 3WFHA 4KH2A 1FAIL 5GXBB 5IROA 3EDJA 4V1DB 4YXKL 1EFQA 2FJFB 3U9PH 4OD1H 4QOKB 4X98A 2R56L 3QFJB 1IZKA 2AAVA 2X1XR 4NQCA 1G6RB 3MGTB 2QR0A 1MI5D 2EO9A 1VEOA 1I3VA 2IPTH 3OAUL 3QUYA 2P7TA 3QPXL 5CCKL 2BNQB 2VDML 4G8EB 4OV6F 5E8PB 3IFOB 3UTTA 1AI1H 1GZPB 2AJZA 3HA0A 2VDNH 3FT2A 1Q9OA 3ARBB 3MODH 3NACH 3R06A 1VKXB 2F54E 3RGVC 3U0PA 1KPUA 1NC2B 2AJVH 3MACL 2NMSA 1ZSDB 2C3VB 5FO9A 5I0ZA 1FH5H 5IW1A 4D0BB 1N4XL 3N1FC 4IMKA 3IRPX 1NPUA 3QXDB 4MAYD 2XTJB 5DMGD 5GRVL 2BJML 3WUZA 1EBPA 2X05A 1FZKA 2AABL 1HH9B 4LNRB 3QNXB 2PTTB 2VKXA 3BHBB 3RWHA 5E5UB 3D9AL 4M93B 1UZ8B 4JG0L 4TVPL 3C5ZD 1C1EH 1CD1B 5DD1H 2IWGA 4L4JA 4M5YL 3RDTD 3TCLA 2JIXD 3RWGA 1KOAA 4FQLL 2DB8A 3FN9A 1T0MA 4R6UA 3S35H 4U1HB 4RNRB 1QR4A 5GGSY 1UH3A 5D6CA 5SX5K 4OI8A 4DGIL 2AQ1A 1U8NA 4P3CH 1IVLA 3BAEL 4YHLL 4CN1A 2X4TA 5EZIH 1GCFA 5I71C 1QQDA 2HKHL 4P46C 3WDJA 1KENL 4G6ML 2VO5A 1UWXK 1JPTL 4M6MH 3SDDC 4Q6IA 4UV7L 3U36B 4JFED 2BNRB 5I73C 4MA8H 4WDIA 1LDPH 3GB7B 1LGVA 4ODVH 1T80A 3ULUC 2F19H 4XHJC 1ZXQA 4PR5B 1A4JB 1BFTA 4X6BA 1AO7D 3DUHA 4ONFH 4HJGA 4JR9H 4J8RA 2BOBB 3CK0L 5E2UH 4B0MM 4Q9RL 5EU6B 4H26A 4R8WH 4WHCA 5E2VL 1K4DB 4RAUA 4L1HA 2CLRA 35C8H 3O8XA 4P3WA 4RZCA 1OT1A 4U1LA 3VD9A 3V6ZA 4LF3B 2WWMD 4IRSC 4Z76A 1N64H 2YA0A 1J8HE 2V2TB 1FVCA 1F3JA 2XQBL 4WIQA 2OM5A 3Q48A 3FB7B 4IJ3C 3H0TA 2C3WA 5CILH 3SOBH 1GPOL 2YD8A 5KOMC 4R7NB 5FAAA 3EOAA 1U3YA 1N3NA 3NIFF 2EYRB 2FD6H 2FO4A 3MRJA 5F71A 3KPSE 4EDWH 1G9NL 2A6DB 1FIGL 2EEDA 4FS0A 5J13C 3HE6D 3LHPH 5D2NB 5F6HJ 4Y5YC 4PJ9C 4JFZH 4V2CB 4D9RE 4JHWH 1HINH 3BPLB 2VN7A 4XXDB 5FIEA 3VJ6A 2X4SA 5D96B 2OR9L 3CMOH 3SKJH 1MCOH 4ODHH 1YEFH 1BP3B 1OB1B 2NY0B 5CD5C 4N0UB 2BP3A 2NY6D 1S9WA 2X41A 5CZKA 1CFNA 4LOUC 3MRIB 2HFEA 5BW7C 3C2SA 5CSZB 3T09A 3BQUB 3AREC 5ITBL 4WUUD 4F7CB 3OXRA 4UQ3A 1FV1B 1DANT 3RU8H 3MCLH 1YN7B 4G43B 4AY0A 4P4KB 1RFDH 2HJLA 2O61B 5ETUB 1YEKH 5F1NA 5J06A 3O6FB 2B20A 4B5EA 5E9DD 2DQIL 3QCTH 3RUGE 3U46A 4F2MB 1ZHLB 3WBDA 4CN6A 5DMKB 4KJQD 1RHFA 4ZXBB 2R69H 2IMMA 2QSTA 1JI2A 4KHXH 1RIHH 4MD4A 3UJJL 4LSRL 1ZLSH 5SWSB 4R4NC 1JNNH 2MHAB 3PGDB 1RK0A 1T83C 3G9AB 4OM0L 3DI3B 1CN4A 3MOBL 3Q6GL 2B1HH 1EBAA 3MYZA 4G42A 4LLMB 5IESH 3MJ8A 1NCUA 4IIQC 5E6IC 5EZLA 5CLWA 1JIBA 2VZ3A 3DROA 1MHCA 3PGCB 4Y1AA 1ZLWK 4JO4H 5EH1A 1VFAA 3PQYE 3IDXH 1B4JH 4M00A 5DJDB 3L3GB 1AY1L 4OGZA 5B3JF 1J05B 3VXRA 4GKZB 3VGGA 1U41A 4OLZL 3MRMB 1S7UA 3X3GL 4PRHB 3RGVB 4XI5D 5F7DA 4ZAKC 1KTKE 5D7LD 4PRIB 1WFUA 43CAB 4KQ3H 4LCYB 5JOFB 1H5BA 3D3VA 4FNLH 3IDNB 3MNZB 1NCCH 5D72H 2R0WH 2YC1B 1JNJA 1MQ8A 1WQVT 3IU3A 4I5BB 5HDLA 4GOSA 1M71B 4N8VB 3UTQB 3CMGA 2AJ3A 4GW5A 1EGJH 15C8L 4NQXA 3KS0J 4UINH 5F7MC 4CU6A 5I1AA 4YHKH 3RFZC 3HUJF 1BQLH 4OZHB 4YGVA 2XWJB 1P4IH 4YQXL 1ITCA 2YSSB 1M05B 5IEKA 3O2DL 1OTSC 3MZGB 4AIZB 3VD7A 2BVOA 1KPRA 2JJUA 3FT4A 4R4FH 3SPVB 4JRYE 5GISH 1IFHH 3BYTA 3BKMH 1JGDA 1F90L 4L4TB 3TPUA 5D70L 2OJZL 4U1JA 3MTRA 1G9NC 4JFPA 4XP1H 1SJVA 2CIIB 3VH8A 2HN7B 3LPWA 2AXFA 5I71B 4P46B 1PZ5A 4F57H 1XFPA 4GMTL 1PKQB 4G6KL 2V2WB 3QUMA 3AFLA 1RZ7L 3GHEH 3BZ4B 1QFWI 4I8DA 5I73B 3ARRA 3IAQA 3T65A 4GKSA 3EYQC 4N1CA 4ZDHA 3KYNB 4PJ5A 5EC1A 4TSCH 4LLUA 4ONHB 1WLHA 1NH6A 4NKMB 5JIIA 1LD9A 3T77B 3VXPA 2DLFH 4JY6B 3W0WE 2E27L 1KFAH 2IFFL 1HSAA 4CNIA 2ZSVA 5FHBH 1WWBX 4IRSB 4CVUA 3B6SB 4M5ZH 1KCRL 3QRGL 4OCMC 3C8KA 4E9LA 4YDKH 1NAKL 1ZGLM 1ACYL 2X44D 3HC0B 4IJ3B 1QFOA 4NKIH 4N5UA 1TETL 4JO2L 4H0IA 4TNWK 2NW2A 4XPFL 5I0DA 1A2YA 1CDHA 1MAMH 1EHAA 1TVBB 3TZVA 5J13B 5C0AD 1WFTA 2R2BA 3MUZ1 2HG5A 2JLLA 4Y5YB 4N0YH 5ICYA 4PJ9B 2BNQD 3FB5A 1YPZB 3V6OE 4IDJH 3MA9H 1EIBA 2YN5A 3NCMA 2Z9TA 4DVBB 1XGPB 2CR6A 5EO1A 1JGLL 3QI9C 3QNYA 4S0TD 4YUEL 2WUCL 2V7HB 3QCUL 2KL6A 5FCSH 3L1OH 3ARBD 2IF7A 3FB6A 2IH3B 4NUGH 1NC2D 4K3DH 4OGYL 2X40A 1CS6A 2ESVA 3AU1A 4OM1H 2DYPA 1VGKA 5IBLD 3QUKA 5HYJE 3OSKA 3LRHA 2JF1A 4XCEB 3S34L 3ZZ1A 3S98A 3I3BA 4X4MA 4MQXC 1OM3H 4H5SA 4ZFOA 3SE3A 4YFLI 4X99B 5DQ9A 4EIZC 5E8OB 2W0PA 1AKJA 3CVHH 2EXWC 5C07D 1NJ9A 5EUKB 5GGRY 1DSFL 1ZLVK 4PJFF 4AIXA 3BP6A 1V8HA 4KDTC 4XXCC 4N68A 4MNGE 4LBEB 3UXFA 1OGTB 4C56B 5DHVB 5CSBA 3VCLA 4KUZH 5F3HA 2C26A 4X6DB 4NGHH 4JN1H 4RGMC 3VU2A 1U9KA 4NIKB 3VI4E 4OZIA 3MLUL 4ZOBA 1XF2A 2WW8A 4IIQB 3TBTA 5E6IB 1RZGB 5GZND 1IEBB 2QHLA 4ZS6D 5ERWA 1VADB 1PSKL 5DJ0A 2ED7A 5IEHB 3CCHA 4QHUB 4LCUA 4PG9B 1XH3A 1B2WL 1Q72L 1MCSA 1UJTA 1GGCL 2XN9A 3F62A 3BJ91 4MAUH 2BVPB 4HUWA 1DDHA 1F4YL 5KSAC 4QRRE 5D7IB 3VG0H 3VGAC 5DYOA 6FABH 1HCFX 5IMOA 5I30L 2J8UA 4LQ1A 4FQ2L 4L8BB 2DS4A 1MWAH 4ZAKB 4JQVA 4KK6C 3SBWC 3DECA 5EUOE 3MLPA 4L29A 3U1SH 4CL7A 2CXKA 3TWCH 3O0RL 2H8PB 1HHHB 4UDUB 1MRDH 1FLTX 4MA1C 2P5WA 4E41A 3SJVE 3GJEA 1QLEH 5L2JB 4PUBL 2D0FA 2CLZB 3GSVA 4XAWH 4Z18A 3MV9E 1OLZA 1T66C 1I1AA 4YX2L 3VFRA 3CFIC 5FM4A 3ZE0F 5BOZG 4UILL 3DVIA 3X13B 4D9LL 3PV6B 4LPYA 4I4WA 4PJXF 4PJAF 2F5BH 3KWWB 3V5DB 1JWMB 1KUMA 3OZ9L 4U0RC 3LRGA 5BO1H 1UYWH 4XNQA 4U1KB 4GAYB 4OSUH 5ESQB 3SE4A 3IU4L 4NQUA 2OMNA 3UYRL 5BRZA 2A1WH 3K1DA 5FXCH 5JMOC 3U7WH 3BEVA 4F15C 1T2QL 4YXHH 3VXSB 1TJIH 4KKBD 3ZHLA 5BVPH 1FVEA 1UG9A 3O81A 3KPQA 4TTDC 2V17L 1OL0A 3PWVA 4HHAA 1U3ZA 1NCTA 4I48B 1I7RA 3WNKA 3V4PL 1VESA 4GH7B 4Z8FH 4RWYL 4JB9H 2CUIA 5IROC 4JO1H 3HRZB 1LEKA 2NY7H 3K2UL 1LK3L 3FN3A 5HHNA 4XWOD 5FEBA 4ORGA 4LCWA 5D1ZA 2VAAB 2J88H 3V79C 1RD6A 1F97A 3MRGA 5EZJA 5CINL 4JQIL 4ZXBD 2GSGB 2RFXB 5HBBA 2E7MA 2GFBB 5I74C 5KSUA 1B0RA 1KPVA 2OK0L 3QUYC 3H9HB 5C8JB 3BEWA 3DV4B 5JO5A 3IKKA 5C9JB 3QDJE 1V7MH 1A4KA 1MFBL 5SWSD 1K4CA 2WUBH 4JAMA 4Z7WA 2UY7A 3DO3A 2PYEB 5F97E 4MX7A 4LLVA 1D5XA 3L5HA 3GSOA 3UC0H 3OR7B 1I3RA 3F7YA 4NJAH 4U2ZA 5DO2C 1F02I 1DUYA 1NFIA 1M6OB 4DCQA 4IMKC 3HTLX 2R1YA 5DZOA 3GMLB 1DBKH 2R0LL 1HEZA 1DUZA 1D9KD 2IG2L 4N1EA 3OB0H 1QSFD 3QI9B 3DRQA 3SDYH 1NEZA 3BT2H 4F7PA 1VGEL 2CQVA 2NY2C 2MMXA 1CT8A 4P5MB 4PRHD 5DK3A 1RU9H 3ZYJA 4BFGA 1MJ7H 3UDWA 5T3ZE 4EEEA 1YEIH 1F4AA 3VXMB 1QR1A 4M8QA 2BNUA 3O3DA 2CLVA 2NTFA 3D39A 3WXWL 5EO0A 5F96H 2V2XA 4X7SL 4QCIA 3S4SG 4NQVA 2YD6A 1A7NL 1ZT1B 4PD4K 1ORQB 2AV7A 4Z7VE 2UYLA 2P4AB 3PHSA 3KHQA 5JW3L 5F9JA 4ZO8A 5I8EA 2Y36H 3S3PA 3I2CL 1L4IA 5GS1A 4Q6IC 1OCWL 3DX8A 4EI5D 4MNQB 2VISB 2V6HA 2VDPL 5IKCA 1AE6H 1T4KA 4L4VE 4XNXH 4HXAH 3OKNA 4IS6A 2FL5A 3HKFA 3WS3B 2CRMA 4U2YA 4K2UL 3RI5K 4LAJH 1CI5A 4RGMB 1A6VL 2VLKB 4P46D 4X5XB 1CLOH 1MFDL 4JJHA 1EJOH 4GMSH 3ES6B 3SDDD 4JFFD 3VFMB 2Q87A 3O8XC 5E99H 3L3JB 2MWCA 5ESAA 2E7HA 3VE0A 4FQCH 4NO2A 1N6UA 3BIBX 3MV8A 4XHJD 1CGVA 5KSAB 1D5BB 2XOTA 4OLWL 3PWUA 3BPOB 3MRRA 3VGAB 1UM6L 4JPWH 1FNSH 1XMWA 2GTWB 2C7UB 4P9ML 4TSAH 4O9HH 4NO0A 4HZLA 4IRSD 5DQDH 4OQTA 5TGBB 4OFDA 2DWDA 5IBUB 3GSRB 1VDGA 3T04D 4WW1A 4MA1B 1LNUB 1BM3H 3QUML 1TZIB 3OKLA 5ELIA 3S8WA 1XGUA 4GKNB 2VLJA 1ULVA 5DD0L 2GK2A 4AL8L 3W9DA 3F8UB 3MLYL 1DCLA 1FDLL 3LSOA 5HGHB 2WQRA 2MPAH 1DQLH 4PJEE 3CFKA 1YC7A 4YPGB 4M48H 2DQTH 2X6MA 1QBLL 3UTPD 3CXHK 1RIVH 3S3JA 4NC1E 3CC5B 5A2JH 5F1IA 2A6KA 2VXVL 4MXVE 5J89A 3GO1H 4I3RH 4JFQB 4PGDB 1R3IL 1FG9C 3ARFB 4NJ9L 1FNEA 1UCBH 4LSUH 3VMOA 4WNQB 1C7SA 4P3DB 3PL6A 1A7PL 5MEQB 4EXPX 4YEFA 3CLEH 1WWAX 4F15B 3OAYH 1TDQA 3O11B 4PJDA 3H2WA 3HG1E 5HHOE 4Z7UB 4OTXH 4V2BA 5H35B 1LE9A 1GJIA 3NA4A 4LARL 1AHWB 1TTGA 1PZUB 2CDGB 3ARED 4QNPF 1CD8A 4KKCC 1TCRA 4I0CC 5LBSH 2X7LB 4OCXL 1ZA6A 4RCAA 3RNKB 3WFHB 4RA3A 4G9FE 3JWOL 1ZEAL 3U7YH 4QRTA 4PJ7A 1BQHG 3Q6FA 4HAFA 5DJ8A 5KS9F 1YMMD 1L7TH 4X98B 4XPHH 4ORZC 4RMQA 1P9MA 5ALBH 4HWEL 4K23L 1PEZA 2COQA 3UCRA 3VWKA 4NQCB 2QR0B 1XZ0A 3HHRB 5HYFA 3TBWB 5I74B 2YR3A 2F5AL 3QUYB 2P7TB 4HMCA 2PN5A 5ECJE 3ZE2F 1S7TA 2D0HA 2VOTA 4C56D 3MLRL 3QQNA 4HCRH 1WFNA 3UTTB 1WFOA 1IQWH 2I07B 4R4ND 1N6QL 4YWGL 3GUTA 2AJZB 4Y8DC 2GAZA 1BJ1H 3BMWA 3FT2B 1Q9OB 3R06B 4QXWA 4Z5RA 3U0PB 1KPUB 5FO9B 5IW1B 5L88H 2E9BA 3DUUB 4PGJA 4D8PA 3QHFH 3S37H 2G2RA 1H5BC 3O6LH 4ZFOL 2ICWA 1MCCA 4OD3L 1FZKB 2F53D 1A6WH 2NY2B 3RWHB 3VD3A 1JPSH 3SGDH 3RAJL 2FRGP 3FRUB 4U7KA 3TCLB 3OKYA 5I1JL 5J1TC 3RWGB 4QF1A 4NZRH 3FZUC 3K4AA 5LGHH 1I3GH 2ZKHL 4XPBL 5AZ2L 1ZK9A 4L8SA 2M26A 3T0EE 1SVCP 1T0MB 5J9PB 3OJDA 5HGDA 1D5ZA 4JPKL 4KXZI 1YJDH 3LEYL 5D6CB 2EE3A 4RISL 4P57A 5JHDE 3NCJH 2CO6B 2VUYA 1NBZA 4L5FL 3VA6A 2OTUA 1U8NB 3TVMA 1R3JA 4JFXA 3HMWL 2X4TB 4B53A 1QQDB 2R15A 1OTSD 4JG1L 2W65A 4PIRF 3WIFA 2H32H 1HWGB 3SO3C 4LLDB 2XY1A 4RMRA 1OAUL 3T8XA 1IKFL 4Q6IB 5FECA 5SWQA 4OLEA 1UEYA 1ZVHA 4WDIB 3FQNA 1OGAE 4IRZH 2DLIA 3HZKA 4Q2ZA 4OF7A 5DJAA 3MOAL 1KEGL 1NL0H 1E6OH 4X6BB 3DMMD 1R0AL 3TBYA 4OUOA 5EDXA 4HJGB 1IE5A 3WNMA 4J8RB 4HLZG 1Q9WA 4H26B 4QRQA 3D85D 4QRSA 1KG0A 4RAUB 4C58B 3TPKA 2ZCLH 2CLRB 3O8XB 4RZCB 2P49B 4U1LB 3G5VA 4P0DA 1BOGA 5JOPD 3V6ZB 5FYKL 3V8CA 4FQPA 4Z76B 3GNMH 4OZGB 1FVCB 2DD8H 4HPOL 1F3JB 2MKWA 2HH0L 2L7JA 4WUKH 3H0TB 5FGRA 4DUWA 1OD7A 2QV2A 4Y19A 3EOAB 2YWYA 3JWOC 1N3NB 5TE4L 1MFNA 4MYWB 2FO4B 2QHRL 4UZGA 3MRJB 4WI2A 4GBXD 1WZMA 1X5JA 4JJ5A 3TZVC 4R26L 2FECL 3U7AA 1Y18A 3L7EA 4BUHA 1Y6NR 1K3ZA 3I6LE 5JW4M 4YBQC 4NHCH 3HS0A 3VJ6B 2X4SB 2OTWA 2X4OA 1KNOA 1MCBA 1KC5L 3VRLE 12E8L 3OR6A 1S9WB 2F54A 3BESR 1CFNB 4L3EE 4YZFF 2HFEB 3QXUA 3O45A 3OXSA 1H3XA 1L9MA 3OXRB 4UQ3B 2FLRT 5J8OA 3QI9D 2P48B 3NIFE 2FECI 1FE8H 2YUZA 1WUNT 2HJLB 3SE3C 1QVOA 1BOYA 5E9DE 5GGVY 5F1NB 3CU1A 4JFOA 3U46B 2NZIA 1X9QA 5D8JL 5E03A 3VXMD 4J3UA 4L3AA 5LWYL 3W2DL 1F4WH 2GJZA 2VITA 4TOYH 3MUJA 1NMAH 4MD4B 4MQXD 1KEML 4G6JL 4NZTL 4UV4L 1IGCH 4XZUA 3NA9H 1RK0B 3ZHKA 4NC0B 1YQVH 3JWNC 4G42B 3MJ8B 1ZANH 5A1AA 2AJXL 4MD5A 5EZLB 5JXEA 4ZFGH 3DROB 1MHCB 5BS0E 4Y1AB 2F58L 1VFAB 2WNGA 4RAHA 3LRSA 2DTML 3IDYC 3LEVH 3A67H 2VWEC 3QEGL 4PJBE 4PGBB 1FNAA 1I1YB 1HXYA 2DMKA 1KGCD 3BPNC 3SCMD 3VXRB 5I18L 4U1GC 5C6TH 3BJLA 1S7UB 4BH8A 4WENB 3HFMH 5F7DB 4KMLB 3ESVF 4WO4A 1K5NA 4OFKA 4JQVC 2A83A 3S9DB 1U58A 1H5BB 3D3VB 4QEGA 1Z6JT 2M2DA 1SM3H 3IU3B 3GIVA 4LPWA 1INEL 1UB6A 3VD4A 3OQ3B 3PXHA 2AJ3B 4GW5B 3KYKH 4X9FA 3TJHC 5KSAD 3WIIL 5LVEA 1J8HA 5C3TA 4NQXB 5J12C 5I1AB 1G6RH 1K8DA 4JHAL 4J3SA 3N50A 1Y6MR 3V0WH 5HDBF 4H8WH 4KK6D 4NO5A 4KPHH 3CSGA 1I1AC 5IEKB 4WHYG 4XBEH 2BVOB 1KPRB 3FT4B 2EC9T 4K8RD 1P7QD 4TVSa 1CBVL 3KPSA 1Z2KA 3I02A 3Q1SH 5F1KC 2O5YH 1JGDB 3T2OA 4Z7NE 4FZ8L 4HAGA 5I8CA 3T08A 2BMKA 3TPUB 1H3VA 1T1WB 4KVNL 4U1JB 2YPLE 1I85A 4JFPB 2DOCA 4UT6L 5KSBB 1DEEA 4D3CH 4U31A 3SE4C 3VH8B 3WFDL 4YBHA 3T0AA 2AXFB 3QH3B 1CFSA 2XQYK 4WEBL 1IT9H 4LSDA 2A6IA 1PZ5B 4UB0H 4BKLA 2LAGB 2HWZH 3KXFA 4LL9A 3SO3B 3QUMB 2LVEA 4I3SL 3MFFA 3C09C 3HUJE 4AEIL 2ICES 3ILPA 3BRFA 3T65B 4POUB 4GKSB 2R29H 1UM4L 4LFHG 4ZDHB 3H9ZA 4PJ5B 5EC1B 4PRBA 3HI6L 3O4OC 2YK1L 4LLUB 1Y0LA 1LD9B 3VXPB 5EB9A 1ZA3A 2HT2D 4OQTL 2IQ9L 1L9NA 5D1ZC 1CF8H 4MB5A 2ZSVB 4S1RH 1LO3L 3RUGA 3NGBC 5DRNA 1CTNA 3IVKA 5LKNA 1VSCA 3C8KB 1RQ5A 2DQCH 3IFLL 2UZXB 5HYSB 2Q1EA 3HC4H 3U4EA 1NANI 1INQA 3PDDA 3CDGA 5DQJA 4X9BA 3PNWA 2WV3A 3NZHL 5IGXL 2NW2B 5LAXA 4M61A 5I1EH 3BUYA 5HVHC 4NQCD 1A2YB 4OT1H 3TZVB 4LPTA 3AS0A 2R2BB 1BVZA 2HG5B 2DRUA 5ICYB 1IARB 4NQDB 3FB5B 1AFVH 4O4YH 4G9DA 3PQYA 5EO1B 4UQ2A 3QNYB 3UAJC 1R5WA 1H3PL 4HGWA 1OP3K 2APBA 4M6OH 1J1OH 5GRJH 4NZUL 5GRWA 3FB6B 5AUMA 3OTTA 2ESVB 2BK8A 3AU1B 3UDWC 1MPAH 2DYPB 5DO2D 1P4BH 4KY1L 1VGKB 1MRFL 3QUKB 4CUCA 1X6LA 3SO5A 5TPWL 1KLFA 3A6OA 1JTPA 4JGMA 4KKNA 4LVNC 4H5SB 4OF5A 4Z0BH 4AEHL 5EO9A 1B0GA 2KQMA 1WBYA 5C07E 1KJVA 4ZQKA 5DQ9B 1CK0H 1U92A 1A6ZA 1RUQH 5DT1L 1AKJB 1KJ3H 5TE6L 1NJ9B 4MXWH 3VFTA 3VW3H 1FFOA 1JPFA 32C2A 1BQHA 3BP6B 1VENA 3HNTH 5DFWH 1IGML 5I1CH 2W9LA 5GS1C 4JRYA 4Z6AT 5C2BL 5D5MA 5I8OL 4U6TA 3VCLB 2DJ4A 5F3HB 4QHKJ 2ADFH 2WLZA 1MFEH 2ITDB 4OZIB 2Y5EA 3ARZA 3G9VA 5HGAA 1F3RB 5FYJE 5LXGL 3OAYK 1XF2B 1NGXA 4FQIL 3TBTB 5K93A 1BF2A 2YD3A 5ERWB 5DJ0B 1X5YA 3CCHB 4LPCA 4RIRA 1T6VN 1TVHB 4X9GA 4LCUB 1DBML 5GS2D 1XH3B 2EDKA 3LN5A 5BXFA 3C2AL 3IDYB 4HUWB 4JDTL 5JW5A 4PJFE 4GRLD 3WXVL 1WAAF 3BPNB 5F88A 1RI8A 4HIXH 4U1GB 5DYOB 5IMOB 2J8UB 1WC7A 1Q0YL 5EIIA 2WWKO 2XRAH 1QNZL 1VHPA 2WIMA 1F11A 2G60L 3IAGC 3O8XD 2D4DA 4L29B 3NPSC 4QGYA 3GEWB 1U42A 2ICWJ 2IPUG 3P9WB 4O5LH 4PB0L 1N0XL 2ICWI 3G6JE 2I9TA 3EIFA 2JJVA 1S78C 5C09A 4UUJB 4YR6A 2P5WB 4M7JH 4E41B 3GJEB 3PWLA 4MZ2A 3RL2A 3GSVB 4OZFG 2HTLC 3CFBA 3F7RA 1ZTXL 3IGAB 1I1AB 4P5TA 4ALAL 3UJTH 1ORSA 2V5SA 1QSEA 3EDDA 1EAPA 4PLJC 4I4WB 4G7YL 3AS1A 3TJEL 1JNLH 3D18A 2RBLA 2ZCHH 2VSDA 3RKDC 1UKTA 3U4AA 3V6OA 4XNQB 4RAVA 3F7QA 3MV7D 1BZQK 2GJ6D 3DVGA 4GRWF 1IL1A 1Z9MA 3PL6C 5BRZB 3BEVB 4JHBA 2VXUL 3BKJL 1DE4A 4XVTH 4U1SA 1J0IA 1FVEB 3EYSH 3C09B 5CLTA 4HS3A 3RP1A 1H3TA 2PW1B 3KPQB 4GUPA 3PWVB 1MF2L 1VEMA 4HHAB 3V4UL 5HYJA 4WTWA 5T5FH 1NGPH 1I7RB 5JNYA 4PLOB 3O4OB 1CDJA 1OTUC 1TTFA 3ZE0E 5GS0L 1PY4A 1LEKB 4NWTH 5CGMA 4PJXE 3L3DA 5GGTH 5HHNB 1GC1H 5TQ2L 4NFBA 3BE1H 4ORGB 4P59L 4LCWB 5D1ZB 1CICA 3GFUA 1P9MC 3T0DA 4LRIA 3BDYL 4TPRL 3F6LA 4YGAB 3GMNA 3NGBB 1JHTA 4UTAH 3VWKC 1SHMA 3MRGB 1LP9F 5EZJB 4LLYA 2YBRA 5KSUB 1B0RB 1KPVB 5T33L 3G04A 5JA9A 3BEWB 3LMJH 4MNGA 3SE9H 2WP3T 3ULVE 2AK4E 3LS4H 1A4KB 3GBNL 1K4CB 3GMMA 4JAMB 4Z7WB 1CR9H 3PXJA 3G6DH 2P45B 1RK1A 3BRGC 4MX7B 2HRPL 4LLVB 1D5XB 4LSSL 1KXQE 5HVHB 1BD2E 3GSOB 4YK4C 2DQUL 3ULUH 4GRMA 1I3RB 1C5CL 3F7YB 1JL8A 4GQ9L 1DUYB 3U0TA 4DCQB 4NN5C 3A6BL 3MNVA 4Y1AD 3ALPA 1HEZB 5DK2A 4GG6F 5DUBA 1CDYA 4LSTL 4B7LA 4DQOL 1UACL 3I6GA 3DRQB 1NEZB 1U8LA 4MA7L 4XAKE 4F7PB 3N1GC 4WEMB 1LE5A 5GRXG 2Q7YA 4H20H 1XF4A 1F42A 1J18A 4M3JA 4XPGH 1UENA 4CBPA 4HIJA 3AUVA 1MCWM 3OX8A 4M8QB 3D3VD 3O3DB 5EUOA 4L8SC 3QEQE 1WCQA 2CLVB 2NTFB 3D39B 5AG8A 1TTUA 5DD5L 2BX5A 5EO0B 1RIUH 5CP3A 1T21B 2V2XB 4FZEL 4PS4H 5ACMA 4QCIB 1FAIH 4LVNB 3GZKA 3D0LA 1RJCA 4YXKH 2DI8A 2V9RA 4NQVB 1BGXL 5E8DH 2AV7B 3U9PL 3TVMC 3JXAA 2UYLB 4LLWA 1TENA 3S88H 5IM7A 2R56H 5F7WC 2P1YA 3JWDL 5I8EB 4MHHG 3NFPA 4MXQC 5GS1B 5GS3A 3QPXH 3DX8B 2VDMH 5IKCB 1T4KB 3OKNB 4IS6B 2FL5B 5E1AA 1CFTA 2DTSA 1JI1A 3IB4A 4QO1A 1X5HA 5DVKA 3SE8L 5CSGA 3T0VA 2KZWA 1SBBA 1JZ6A 4TQEH 3MACH 4PY7A 5KG9B 2P8LA 2AJVL 2VR9A 5KTEL 4OI9A 1FH5L 4M7KL 4HWBA 5ESAB 2LVCA 3VE0B 1B88A 2BJMH 1XIWD 3KAAA 3MV8B 2CKBA 4PJ5D 2AABH 5EIVA 4OLYL 3PWUB 3MRRB 4W4OA 2AGJH 3D9AH 1QOKA 3ALWA 5FO8A 4XBPA 1C1EL 4M5YH 1IKNA 4PFEA 5JQHC 3LVEA 3F7VA 5GS0C 5INDA 2EYTA 3W9EA 1EFXD 3NPSB 4NO0B 1MFCH 3UTSE 1AD9A 2IANA 4PP2A 4DN4H 2DWDB 2OJEA 1RUPL 4WW1B 1CFVL 3V4VL 4DKEL 4HK0A 5DMIL 2WBJA 3BAEH 5I1IH 1MVUB 5IVNA 3OKLB 1XGUB 1MIEL 2VLJB 3SDXF 2HKHH 1WBXA 4D0CA 3W9DB 3LSOB 1KENH 4G6MH 3CFKB 3VWJA 4NRXA 1JPTH 1CFQA 1QBBA 4UV7H 4LP4A 2QL1A 4QTIH 3VA2C 5I9QC 5IJKA 1LDPL 2A6KB 4UOJA 5DXWA 1OAQL 1ADQA 4PBXA 4Y88A 1S3KH 4YBQD 4QWWD 1FNEB 3TNNA 2FJGA 4CMMA 3PL6B 3CK0H 3TN0A 4Q9RH 4TUKL 1IGTA 4Y4FA 2EDDA 4PJDB 2KBGA 1LE9B 1EUUA 5J3HC 1QFWM 1LILA 1TCRB 1NAMA 4PJIE 4Q74A 2QKIB 1ZA6B 2XQBH 1TVDA 4QRTB 4PJ7B 2OZ4A 3Q6FB 2MSPA 5DJ8B 1GPOH 4Z7VA 3BIAX 2ZOKA 1AKJD 2AEQH 2KZ1B 4QHNA 3VWKB 1FIGH 1XZ0B 1JZ7A 2Z35A 4NRYA 5FUOL 4F58H 4K7PX 5JXEC 1JBJA 2ARWA 3BW9B 4ZUTA 3JWDC 1S7TB 4JFZL 3RVUC 4JHWL 4WFGE 2JJTA 4L4VA 2R23A 2PR4H 3TT3L 3GUTB 3NIDF 1W0VA 2GAZB 5F7FA 4XVUC 3L95A 2Z4QA 1P7KA 2D3VA 3FO1A 4YK4B 5EU5B 4WO4C 2VR5A 5B21A 1XCTA 4D8PB 3ZDZF 1UGNA 4NN5B 2G2RB 5ITBH 2ICWB 4RGND 2XN9D 1KYOK 5HPMA 5ADOL 5KVMC 1T5WA 3ZT5A 1GZQB 2IPKA 1DQTA 4HK3N 1RFDL 3VFWA 4YFEA 1TJHL 1D7FA 4QF1B 3UPRA 2DQIH 4XCCH 3IJHA 5KOVC 4HUNB 2C4FU 3OJDB 5HGDB 1D5ZB 2R69L 2X1PA 4CN4A 5I1GL 1ONQA 1Q0XL 1GGUA 4LSRH 1RIHL 4P57B 1MCIA 4N0FA 5FYKD 1ZLSL 5HHVH 1NBZB 1WZKA 1I85C 2CK0L 1UXSA 3FFCE 2P5WD 1P84K 1JNNL 4E41D 1LO2L 2OTUB 4HQQL 3TVMB 1R3JB 4JFXB 4OM0H 2GK0A 3RVXC 3MOBH 3Q6GH 2DLEA 1I1AD 3GJFA 4HULB 3AB0C 2DLTA 2W65B 3WIFB 1FNHA 3GM0A 4HC1H 4PJEA 3ZKSD 3KS0H 3T8XB 5FECB 1CGUA 3MRKA 5SWQB 4Z7OF 5LGKA 3KPRA 3FQNB 3VXTA 1CIDA 4UNVA 1WEJL 4OJFL 3KNBA 3HZKB 3IDXL 4Q2ZB 5C08B 3QR2A 5DJAB 4U33A 3DJ9A 5DHYA 4WW2A 5GQBA 5KN5A 5ALCL 3TBYB 4OLZH 1NDGA 5BRZD 3X3GH 1Q9WB 2UVEA 1E28A 4L8CA 1UEMA 4QRQB 4QRSB 2QSVA 1KG0B 2BHZA 4DKFH 1YNTA 1NGZA 4LDEB 1X6NA 3G5VB 5EZOH 1BOGB 2R0WL 1EHLH 4XBGA 1T0NA 3SDAA 1D6VL 4PJGA 15C8H 5D71H 1GVIA 4H88H 4NM4H 3MLVL 1BQLL 3X3FL 1MCKA 4G7VH 3RVWC 4Y19B 1P4IL 4LCWD 4YQXH 5D1ZD 3O2DH 1A7BA 3ARUA 5DLML 1ROWA 3MRPA 3Q0HA 1MI5A 3RZCD 4JJ5B 4OZFA 1IFHL 1F90H 1JWSA 1Y18B 3ETBF 3L7EB 3J8F7 4Q58C 2X42A 5D70H 5I8KL 3L3HB 4XP1L 3X17A 2A6JA 3HS0B 1FP5A 3NZ8A 2IH1A 4NKQB 4YHOH 5HGGS 4DKDC 4NFDA 2OTWB 3N06B 1QTYT 2X4OB 3LPFA 4I2XA 4G6KH 1RMFL 4RBPH 1RZ7H 2F54B 5DJXB 4FABH 5I9QB 4MAYA 3OXSB 4NNPL 1N5YL 5FO7A 1RZ8A 4KKAD 3BDBA 2C4XA 4HX1A 1TZHA 4XMKH 3MGOA 2DJSA 1YY9C 4KGJA 1R3LA 2Z8RA 3C5ZA 2DLFL 4K8RH 2E27H 3W11D 1QVOB 4PRDA 2QADD 1L6ZA 4D94A 4JFHD 4F9LA 1RZIA 4JFOB 4ISVA 4LCCA 5FHBL 2VXQL 5SV3A 3DVNA 3D39D 2GJZB 1KCRH 3QRGH 4M5ZL 3CX5K 1NAKH 3S36X 1ACYH 3EGSA 3QISA 3WJJA 2UZYB 1GGBL 3KHOA 5JHDA 1RJLB 2BDNL 4XZUB 5E24E 2YN3A 4YZFE 4NKIL 4F37F 2ZJSL 4J6RL 4XPFH 2PXYA 4Q0XH 1DBJL 4C55A 4PP1C 1MAML 3GSQA 2Y06L 4JFEA 4MD5B 2D7QA 4N0YL 4PRPE 5TE7L 3MA9L 2VTFA 3LRSB 1OGAA 4MJ6A 4HJ0C 1IC5L 4YUEH 2WUCH 5HXMA 4S1QL 1HXYB 3KPOA 1AO7A 1P1ZA 1QPPA 3KLAA 2VLRD 4RFOL 4Z78A 4BH8B 4OGYH 4OKVA 4K3DL 4WO4B 1K5NB 1S7VA 1CLZH 2PTUA 4CVZA 2A83B 3QYCA 3UPAA 4PBWD 3GMRA 5MEND 3S34H 3TNMA 3MV8D 2VXTL 3OG6B 3ZDYF 1X7QA 2HMIC 3UBXA 5KVGL 1U8KA 1AP2A 4JQXA 1MQKH 4APQA 1K8DB 1M4KA 4BYHA 3WJLA 1UXWB 4NO5B 3IJSA 4P5TC 1JP5A 5CEXA 4TTGA 2VIRA 1Z5LA 4QHMA 5HDQL 4PJDF 3B3IA 1AXTL 4O58H 3I02B 1MCJA 5I8CB 2BMKB 2I5YL 5JXAL 4C54A 1A9BA 1WT5A 3DGGB 3V6OC 1DEEB 4KUZL 4RMUA 2JJWA 2VL4A 4ZTOL 2HTLD 4BQ6A 5C0GA 5GSRB 2GTZA 3MLUH 4IOFD 1CFSB 4PJ7F 2A6IB 4HWBL 4BKLB 1VPOH 3KXFB 3U6RA 2VC2L 3BPCA 2P5EE 2Z91A 1NDMA 3BP4A 3F12A 4PLJD 2CKBL 4MDIA 3MFFB 4OCLC 3DX9B 4OFYD 3ILPB 3RKDD 1B2WH 3UTZA 3HN3A 4LASH 5HDBE 1F4YH 4PRBB 1Y0LB 3ARDD 1ZA3B 3PL6D 2XNAB 4PGCB 3WL9A 6FABL 3KDMA 2N1KA 1G9MH 4KI1A 5E9DA 4WGWB 2D7OA 1CICC 5SWZD 4PREA 4LRIC 1TLKA 2R2EA 5DRNB 3U1SL 3IVKB 5EU4A 1X5XA 1S8DB 2DQEL 3KGRA 1OTUD 2L0DA 3WFZA 3QQ4A 1L0XA 1FL3A 3U4EB 1INQB 5TQ0L 3M07A 1JGVL 3CDGB 4C4KT 1QLEL 2J1KA 5DQJB 5C6PB 3PNWB 3C5SA 4ODXA 2A77H 4XWGL 2VLLA 3EJZC 3NCYS 1RY7B 5LAXB 4M61B 2EDWA 4UILH 5GS2H 3BUYB 1FFNA 5BZWA 1ADQL 3FONA 3O3EA 1EK3A 1QKZL 4UOW1 4L1DA 5AWNL 5GRVK 1X5IA 2V7NA 5BS0A 1GGYA 3H9SE 5DSCA 2VH5L 4G9DB 3G6AA 4OGXL 4UQ2B 5JW4R 4HGWB 3QO1A 1MUJA 2QQNL 1I75A 5B38G 5T3ZL 2WANA 3TH4T 2OX5A 1T2QH 1FFPA 2CIKB 1NAML 5AUMB 1NFDF 3SKOA 5ISZE 3ZTNL 1EERB 1NLBH 4R2GC 5BVPL 4CVWA 1V3KA 3OF6A 1I4FA 2V17H 4AJ0A 4XC1H 3C87A 5DRWA 4F8TA 4PB9L 2OZ4L 1RZFH 5C86A 4EDXA 5IVXF 4RWYH 4JVWA 1CXIA 1M7IB 4KHTL 3B9DA 4JO1L 5EO9B 1B0GB 3UTOA 1WBYB 1ITBB 1KJVB 4ZQKB 1U92B 1A6ZB 3IDIA 3WE6A 4LHUG 3E6HA 3FFDA 4HUUA 2FHBA 3VFTB 3E8UL 1DJSA 1FFOB 32C2B 1BQHB 5MEOA 4JQIH 3DETC 1WWCA 2OK0H 5L2KD 4JRYB 5E8NA 2O5ZL 1EEYA 5D5MB 3QXVA 1MFBH 1QRND 3S5LG 3MXWL 4U6HA 2YPLA 3IDJA 1CFBA 2XIDA 4P2CG 4LVOC 5FOJA 5HGAB 1UA6H 3QXTA 3PGFH 2BOCA 3ME0A 3UC0L 4ONGH 4NJAL 4QXTA 4MD0B 4RIRB 2IG2H 3HUJA 3B2UC 1I1CA 3GSWA 2Q86B 1AR1C 5IB1A 4DWHA 5BXFB 3MRDA 4NBYB 3RIAK 1VGEH 5JW5B 3BT2L 5D2LB 4W4OC 1MNUL 3QWQB 2XKNA 1A3QA 3O4LE 1WC7B 1IKNC 5EIIB 1H8OA 1BVLA 4RMVA 4FFZL 1RU9L 3OAZH 1DQML 2EDFA 1AIFA 1F11B 5AAWA 1YEIL 4GRWH 1D6EA 3WXWH 5BV7L 4X7SH 5F96L 1ZKAA 2I9TB 4RGOL 3P4OA 5E2WL 5C09B 3MLWL 5EOQH 3RX7A 4BH7A 2IC2A 1XF5A 2D31A 4YR6B 4AYFA 1ZT4A 3PWLB 2WBJC 3G5YB 3RL2B 5JW3H 3GK8L 1EV2E 4F7MA 4WHTA 4P5TB 4Y89A 1NBVL 3K2MC 5LCVL 3VWJC 1WIPA 2Y36L 1ORSB 1CXHA 1QSEB 1EAPB 1QUNA 5C0AA 1OCWH 3K0WA 1JTTA 5LJYH 3K4ZA 3D18B 4WWID 2VDPH 5IJKC 1GIGL 2XA8L 1AE6L 4OCYH 4PRAB 4RAVB 4KJPD 1A6VH 1FNLA 1IL1B 1U0QA 3LPGA 3PHQA 2E9WA 3TN0C 4UU9B 1CLOL 1MFDH 4Y4FC 1DE4B 2F54D 4J12A 5ADPL 1EJOL 4U1SB 4Q9QL 2F74A 2AXJA 4HS3B 5DFVC 3I3DA 2D7PA 4GUPB 5EBWA 5CJOL 4FQCL 5HYJB 4JM2F 1BWMA 1J7VR 4ZNEA 5JNYB 4OLWH 3U9UB 2R1WA 1L6XA 3RWDA 5K9JL 1FNSL 4HKBA 4KI5C 3DXAE 5C07A 1CICB 4LEOA 4S11A 2A73B 3GMNB 3WIHH 4O9HL 1JHTB 3DSNA 4LLYB 2YBRB 2LU4A 3VXQA 2PO6D 3G04B 3DO7A 2R9HC 2AK1H 2AJUH 3OG4B 2JJTC 5DJ2A 3GMMB 1YDPA 3DGCR 1KB9J 5ID1A 5DD0H 2ZUYA 1RK1B 3MLYH 1FDLH 5FV2A 5KANG 5CZVL 1DQLL 4FFYL 2XZQH 4JM2D 1G7LA 4GRMB 4RMWA 3UZQA 2RCSL 3U0TB 5JXED 4JZOA 3MNVB 3I75A 4MLIA 4AMKL 3RVUD 2DIBA 3NCYP 5DK2B 1WJ3A 2AKRA 5DUBB 1U3JA 1R3IH 4KUCF 4NJ9H 3GO1L 4OF0A 3I6GB 4DUXA 3V8OA 1U8LB 1J0YA 1LE5B 3SKNA 3UZVB 2Q7YB 4XVUD 1LP9E 1A7PH 4PJFA 1RAMA 1A21A 1XF4B 4MB3A 5KVEL 3CLEL 4HIJB 2NXYC 4NN7C 1FZOA 3MLZL 4EUPG 5B4MC 4R2GB 4LARH 4L3CA 3OX8B 1CXEA 1BPVA 5EUOB 5C0FA 2AXGA 2YHGA 5D1QC 1J8HD 4QT5A 3JWOH 1ZEAH 3D0LB 4PY8J 5BV7C 2BRQA 3NBNA 2YXMA 4LLWB 5IM7B 4JGJA 3TYGH 3EYVA 1NQBA 4GG6E 5B39G 2YMXL 2RB8A 4U1NA 1OWWA 3NFPB 4RBPK 4NOFA 5IWLA 2E8ZA 3KPSD 3QFDA 4KUCD 3RUGF 3EBAA 5IHBA 1IQWL 4D9RD 5E1AB 5T1LA 1CFTB 4W70A 4LVOB 2ZPKL 1KCUL 3SGJA 4GLRI 1S9XA 1T2XA 1JMZA 4PY7B 5DJ6A 2P8LB 5F3BA 1FLRH 3ROLA 2HJFA 1EZVY 3S37L 3EOTH 3BO8A 5F6IC 5BMFL 3SDAC 4FQ1L 4XCFH 4OD3H 4PYGA 4V1DE 5E6YA 1AJ7H 1GH7A 1T7XA 5FO8B 4TRPH 1JPSL 4XBPB 3RAJH 4OFVA 5I1JH 4QOKE 2CRYA 2FWOA 3QFJE 3TH2T 4PJXA 4PJAA 5T1KD 4NZRL 1U8IA 5BOPA 3F7VB 4U1MA 2VQ1A 5INDB 2ZKHH 3LKRA 4H0HB 5AZ2H 2APVA 1K3IA 3W9EB 5CFHA 5E8EA 3B8SA 3HAEG 4JPKH 1FYHB 2XG5A 3P0VL 1AD9B 3LEYH 1T0PB 2IANB 4PP2B 2OJEB 3O3BA 1QBMH 1KELH 3TA3D 3ARYA 4L5FH 4OF3A 4HK0B 4U7MA 2WBJB 4XGZA 3UBXI 2QQQA 3HMWH 3RVWD 2R8SL 3OJMB 4D0CB 4JG1H 2I27N 3VWJB 4J3XA 3CGTA 3UZEA 4NRXB 3GBML 5F8QC 1CFQB 1OAUH 1BD2A 1IKFH 1NCNA 4LNVA 2APTA 1JHKL 5IB5A 5JA8B 2LFGA 5F9DC 3RWJA 1SY6H 1PY9A 4MAYC 4NFCA 4BQCA 1D9KA 4OBSA 5DMGC 2ENYA 1QSFA 4D9QE 3PQYD 3HC3L 3MOAH 1KEGH 4MHHI 1R0AH 3TNNB 2FJGB 5TF0A 1NL0L 4CMMB 1E6OL 3C5ZC 3TN0B 4P2YA 5BZDA 3S7GA 1BFSA 5CBAB 1IGTB 4UNTA 4Y4FB 1A6TA 4F9LC 2ZCLL 2EH8L 1TZGH 1W72A 5FYKH 1BBDL 2A38A 3GNML 4LDOB 4XB8A 3SDXE 4HPOH 1YY9D 4LLQA 3WJJC 4OGAD 5FGCB 3RY5A 3GI8H 4S10A 4Z7VB 4NNYA 3OGCA 2D7MA 1AR2A 5FHAH 2ZOKB 2PUQT 3BZFA 1HSBA 2Y72A 1RULL 3PP3H 1WZ1L 3MUGA 2PXYC 4QHNB 1OQOA 3FQRA 4R26H 2BNRE 3T1WA 4NRYB 4EI5A 4JRYD 3AS2A 4KVCL 4ZUTB 4OB5L 1F6AA 3B43A 3EUUA 4L4VB 2R23B 1FC2D 5F21B 4KRMB 5IG7A 1OY3B 1KC5H 2HTKC 3L95B 5E95B 12E8H 2Z4QB 3ZT6A 1P7KB 5E6ZA 3FO1B 3DX6A 5LQBL 4PP1D 4K94L 3E6FB 2Y4SA 4JFFA 4X4ZA 1A6PA 1XCTB 2V9TA 5B38A 5GGSA 5DEGA 2WWMC 5K9KA 5F7YC 2GI7A 5HPMB 1T5WB 1MHPL 5F9OL 5JORA 2XZAL 3REWB 2IPKB 3MNWB 4ETYA 3TT1L 4JQXC 3VFWB 2Z31A 4APQC 1HYSD 2NXYB 2Y1VA 4NN7B 3W0WD 1V5JA 3UPRB 3WJLC 5GRZA 1V3LA 1YEDA 5D8JH 3FCTA 2VSCA 3IJHB 1YEGH 1OW0A 1BZ9A 3KYMA 3NIDE 4U3XA 3G5ZA 5D1QB 4HV8B 4LHUA 4TOYL 5TDPA 1Q1JL 1NMAL 5JIHA 5TH2A 1KEMH 2AJSL 4O51A 1IZJA 4G6JH 4N0FB 4NZTH 4U4BA 4UV4H 1WT5C 3D2UA 3X12A 1UXSB 5BV7B 1KF9B 3ZDZE 2GK0B 1UADC 4N0UE 3GJFB 1YQVL 1BAFH 3S5LA 3ARWA 2NY6C 4N8CH 4PJEB 1ZANL 2W0KA 2AJXH 5F72S 4CDGC 3HCVA 3QJFA 2OQJA 3MRKB 1J87A 3KPRB 3VXTB 2F58H 3I6KA 3KNBB 2CPCA 4MCYB 2NYYD 3LEVL 3A67L 5DHYB 2P24A 5CJ5A 1MCPL 5D1XA 5KN5B 1NDGB 3LB6C 5C6TL 4G3YH 4L8CB 1CG9A 1P7HL 1YNTB 1UT9A 2OP4H 1EZVX 3BWAA 3NAAH 2DQHL 3VI4F 1WZLA 5F6IB 2J5LC 1INEH 4KJQC 1SM3L 5HYJD 4XBGB 1T0NB 2X09A 4KQ4L 1KIPA 3SDAB 2ZP0T 3WIIH 3KYKL 1IGJA 4PJGB 4PJIA 5C0RL 2ICCA 1CGSL 5HVWA 1OF2A 3B9AA 3S6CA 4KGLA 1I8LA 4EVNA 3V0WL 1CICD 5GZOC 2FCBA 4KPHL 1Z9LA 3MRPB 2DWEA 3WD5L 1MI5B 1CBVH 3U4BL 3SY0A 5L9DH 4OZFB 1DLHA 1JWSB 3A6CH 3PWJA 1WTGT 3JV6A 3Q1SL 2B39A 1MH5A 5EUOF 4WI4A 4KVNH 3WKMH 3MV11 1FPTL 3WUWG 4UT6H 1MHHA 3PIQA 2A6JB 3NZ8B 3WFDH 4FXGA 2IH1B 1DVFD 2F15A 1FCCA 4WEBH 4HK3J 4KZEL 4R7DA 4I2XB 2R2HA 4X8XA 3HI1A 2HWZL 4PRIE 4I3SH 3OAZK 2LU7A 1CIUA 1NANH 1RURH 1EHNA 4AEIH 2FSEA 4MAYB 1X44A 4KZDL 1UM4H 4K94C 5FO7B 1RZ8B 3QEHA 3HI6H 4HX1B 2YK1H 1TZHB 4GXUM 5KS9A 3MGOB 3B9EA 1EO7A 1TITA 1R3LB 2F53A 43C9B 4OZHE 3C5ZB 4QRRD 1KCVL 3IS1X 4PRDB 3RDTB 2JIXB 4OQTH 3T0BA 2IQ9H 4U1IA 1RZIB 1CF8L 4ISVB 4Z9KB 5C0BE 4S1RL 4Y2OA 1TFHA 3H3PH 4G5ZL 1DBAH 3DVNB 2CMRL 1HH6A 4L4TE 1I7ZB 3IFLH 1PX3A 2DQCL 5T3XE 1FL5B 3I50H 3MR9A 3GDBA 2H2PD 3EGSB 4LVHB 3HC4L 1OP5H 4YHML 5JHDB 2IAMA 2BC4A 3FFCA 3SJVD 2ERJB 3NZHH 5IGXH 1A3RL 2EKSA 2ZUWA 2PXYB 3MV9D 5E2JA 5FCUL 1PKQE 3DETD 3GSQB 5HHXL 4M8VA 2IJ0C 4DOHE 4JFEB 1DN2A 2N56A 2VDQH 4LIQE 4X7FC 1NSNL 1RHHB 4O4YL 3VG9C 5DVNA 4MJ6B 4XP4H 3DMMA 3KPOB 1AO7B 1P1ZB 4M6OL 3KLAB 4NZUH 3RZWA 3GHBH 4Z78B 2ZOLA 3D85A 4OKVB 1F3DJ 1DQQA 1S7VB 3ROOA 4WFEE 4KY1H 3OKEA 4CVZB 1MRFH 5MENE 3LKPA 1GL4B 3RHWF 3GMRB 2QJDA 3O9WA 5TPWH 3B2UD 1AR1D 1EEUA 2FBOJ 3TNMB 4EUPA 5IOPA 1X7QB 3UBXB 1U8KB 4HS8L 4AEHH 1AP2B 2J7LA 3BX7C 1EJ6A 4APQB 3L7FB 1IGYA 1ES0A 3TH3T 5TE6H 1MFAL 4YXLL 1O7SA 1R6VA 3IJSB 1G7MA 5LGJA 4GBXA 5CEXB 2VIRB 1Z5LB 3HNTL 4QHMB 1IGMH 3L5XL 3B3IB 1MCEA 1YPZE 2E9IA 1QFUL 5I8OH 4MLSA 2X1WL 5L6YL 5B39A 2PW2A 1A9BB 4AK1A 4E5XA 2JCCF 3QDJD 2X70A 4F8QA 2L7UA 3LAFA 5DWUL 1ZS8A 2ADFL 4JY5L 5C0GB 3TFKC 1G7QA 2GTZB 4K7PH 5JIPA 2NY6B 4NBZB 3VWJD 3U6RB 1T3FA 3BPCB 2Z91B 4FQIH 1NDMB 3F12B 3BP5A 4MDIB 3UMTA 5IBLC 3STLA 1FSKC 1G7IA 4UDTA 4H1LG 5FM8A 3UTZB 4HC1A 1HI6A 1EVUA 1B90A 3WXVH 1QHPA 2FB4L 1RUML 3JV0A 1GGIH 3WL9B 4HIXL 3KDMB 3TN0D 4YE4L 4LFHD 1OWRM 2X9XA 1F8TL 4UOW0 1QNZH 2B2XL 3MBXL 2G60H 2XRAL 5E9DB 4QHLB 3QZWG 4TVPE 5DFVD 1RSFA 1P2CA 2R2EB 2J5LB 5EU4B 4PB0H 2F9BT 1N0XH 2DN7A 3P4MA 4LAQL 3BP7A 3NN8A 4NM8L 3QQ4B 1CDCA 1VFMA 4X6DE 3IDMA 3FHQA 3C5SB 4ODXB 3KJ4C 2VLLB 4ALAH 4XVJL 1FFNB 5BZWB 3FONB 3O3EB 4M6NL 3TJEH 5GZNC 1BLNA 1NC4A 4OLVL 4ZS6C 2NLJA 1F00I 5FKAA 2HLFD 3DTXA 4EIGB 2V7NB 2OL3A 4PRPA 5BS0B 4HD9A 1A1OA 5DSCB 4L4VD 3G6AB 1B6DA 5D7IE 3QB7C 1LO4L 3FQUA 1KXTB 3QO1B 4OLXL 1MUJB 5GGRA 1W72L 4R0LA 4HEME 4YDJA 2VXUH 3BKJH 1FFPB 1P5UA 4JDVA 3SKOB 4XVTL 4RWHA 1I4FB 4S0SD 3V4UH 5DRWB 3H7BA 3P11H 4EDXB 4S2SA 3EHBC 1FG2A 4G6AD 4MXVF 4ZUWB 5TQ2H 4MSWB 4P59H 1GC1L 3WE6B 4WW2F 3E6HB 3FFDB 4HUUB 2BVQA 3ARXA 5MEOB 1P7QA 5IWLC 5T33H 4AM0A 5E8NB 1QRNE 2ED8A 5ENWA 1EEYB 5JW4N 1ODAA 5HHPA 3GBNH 5DI8A 1NFDE 3FB8A 4U6HB 3QBTB 2YPLB 3IDJB 4WFHE 2EIDA 2VZSA 3SGJC 4Q9CA 4LSSH 2RHEA 2ZCKL 5D9SA 3VXSE 2DQUH 2BOCB 4KKBC 1C5CH 4D2NA 4GQ9H 4QXTB 2EZ0C 9CGTA 4X7CC 3RWIA 2G5BB 3WN5B 5A2LH 4N5EC 2VL5B 3HUJB 4LSTH 5IBTL 3GSWB 3WS6A 5IB1B 4JLRA 5CD3A 3VG9B 1C12A 4DQOH 5D7SL 1UACH 1MCQA 3MRDB 4MA7H 3WNNA 3VGHA 4JRXE 1KB5A 2XKNB 2FHCA 2UWEF 2JELL 3GRWA 1BVLB 3CVIL 1AIFB 3PP3K 2DLHA 1B9ZA 3QIUA 1JZ5A 3HG1D 5HHOD 1HOCA 1DQDH 1IM9D 4JDZA 5DD5H 3SDAD 1RIUL 4FZEH 5EBGA 2YUXA 1AQDA 3P4OB 3CXHJ 1HIML 5I17A 3ARPA 4BH7B 1XF5B 1HZHH 1BGXH 2D31B 1H8SA 3H42L 4G9FD 1ZT4B 5E8DL 3P0YL 2PYEE 2Q6WA 3FAXA 3S88L 1IC4L 3SKUD 4F7MB 4WHTB 2XWTA 1AC6A 1W0YT 3JWDH 3WNPA 3HB3D 2ADJA 2B1AL 3WFEH 5F7EL 1BEYL 1Q9LA 5C0AB 5KVDL 2YPVH 2V5TA 3WCYA 3X14A 1D9KC 2DBLL 2NW3A 4P2QD 3H9SA 4Z95L 3BKYL 3RQ3A 3SE8H 3UYPA 3MSPA 3PHQB 2R4SL 2LE9A 4TQEL 1J0JA 5KTEH 1N5AA 2F74B 4M7KH 5DZLA 4HS6B 1FSKB 5ISZA 5EBWB 2W91A 4XPTL 3AM8A 2FR4A 2FX9L 2BXYA 4OLYH 3KLDA 2AGJL 2R1WB 2K7QA 3RWDB 5J7CC 5IMMA 2VR4A 5KJRL 4HIEB 4HKBB 1FN4A 5F9AC 1C7TA 4NQSA 5C07B 1SYVA 1INDH 2QTEA 4LEOB 1KCKA 3CFDA 3GSNA 3GSUA 1MFCL 1E4WL 3PHOA 3T0ED 1GC1C 1FC1A 4MNQE 4EI5C 3VXQB 2GYSA 4XPAL 4DN4L 3DO7B 3QUZD 3CSBA 1RUPH 1GGTA 1O5DT 1CFVH 1YY8A 5EIQA 1JZ3A 3V4VH 4DKEH 5TF1L 1IBGH 2VRAA 5DMIH 4RMSA 2AI0L 5DJ2B 1GOGA 1QACA 5JHDD 1YDPB 4OF6A 5I1IL 5ID1B 1MIEH 3CUPA 3KJ4B 5ITFA 1N59B 2PXYD 3WUWA 2XKSA 2MCPL 1G7LB 1NMBH 3QQ3B 1J0ZA 4UTBL 1BIIA 2YEZA 4JZOB 3HZVA 4QTIL 1OAQH 2ZUQC 1WVZA 2AKRB 1OGAD 3FO0H 4OCNC 1N8ZA 1S3KL 3QAZC 4GRLA 2OBGA 3SKNB 5I1KL 2HTKD 3VI3E 4HIHA 5IVOA 4PJFB 5J1AA 4TUKH 2Z31C 3S35X 2E7BA 4K3JL 5C92A 3O4LA 1X4YA 1FZOB 2WM0A 4LHQB 1PBYA 4L3CB 3O6ML 3WYRA 5MHSE 2JB5L 1OW0C 2L4OA 3VRLF 5C0FB 2AXGB 3T3ME 4HBCL 4JN2A 1HQ4A 1BQUA 2ZWLT 4MA3A 4QT5B 5IHLB 1NCDH 3RNQA 4APQD 5EN2A 3EYVB 5T5NG 2AEQL 2ORBL 1CE1L 4DJMA 4U1NB 3RWEA 4YIQB 4PGZA 3QFDB 5FUOH 4F58L 5HY9B 1HKLL 5F6HI 2B8OT 1WAAA 5A2KH 4P5KA 1KTLA 3TT3H 3ABZA 3MV7A 2GJ6A 2PR4L 3I6LD 3GIZL 2LTQC 3MOQA 3VXNA 5D1XC 5B8CA 2Q7NA 1H3WM 1S9XB 3PV7A 2Y5TA 5DJ6B 2VDOL 4N8VG 4Z7UE 5F3BB 3ROLB 2HJFB 1M7XA 3JUZA 1IM3A 1OOAA 4L3ED 1A3LL 4S1SL 5SX4I 3BO8B 2PKDA 5ADOH 1MELA 3LN4A 2DMCA 4NKOA 4LVEA 3LB6D 1OT2A 2VAJA 4GAJH 4DZ8A 3BN9C 1TJHH 3P3YA 3K3QA 4PJXB 4PJAB 1U8IB 4UAOC 2JE8A 2DBJA 4PJBF 4U1MB 2VQ1B 3LV3A 3LKRB 4JPVH 4XCCL 2VE6A 5E8EB 1NGWA 1UJ3A 1MJ8L 5I1GH 1Q0XH 1UFUA 5FDWA 3O3BB 4JPIA 3O3UN 4PJ8D 1J11A 2CK0H 4O2FB 4R3SA 3MLSH 5CJQL 5HHVL 1LO2H 3QDME 4HQQH 4XGZB 1YEHH 4FQQA 2MJWA 5JDJA 5GZOD 3L3KA 3AMLA 3D87B 2QEJA 1T7VA 4N9GA 3R4DA 4HC1L 1BD2B 4K9EL 1QFPA 4OKDA 1I8KA 2EXYD 2W9EL 5IB5B 3RWJB 3EYUH 2W9DL 3EZ8A 1WEJH 4OJFH 1D9KB 5BS0D 1QSFB 4M6AA 5ALCH 4LSVL 1AGCA 3WLWC 2E8YA 4Z7NF 1A7OH 4H1LA 4ZUSA 5BZDB 1PEWA 1LP9A 1BJ8A 3SDCD 1B4RA 3KPMA 5D7JA 4DKFL 1W72B 3OF6D 5EZOL 1ZHBA 3VDAA 1EHLL 5JR1H 1D6VH 4ELKA 5ID0A 3QZWA 5T1MA 4LLQB 5D71L 4H88L 4TNWF 5AYUL 3MLVH 4NM4L 2IAMC 3X3FH 2XYCA 4NNYB 3OGCB 4G7VL 4NRZA 5ACLA 3GMQB 3BZFB 5DLMH 1FO0H 5CGTA 5FYLE 3MUGB 2UUDK 2OL3L 4PV9A 4GG6A 4XMLL 2ZNXA 4EI5B 4HIIA 5I8KH 1EAJA 3QIBA 3WIHA 5LG1A 1JE6A 1F6AB 3GKWL 3V9FA 2HLAA 2YZ1A 2A74A 2YPLD 3AXLA 4YHOL 4HUVA 3DMMC 3LKNA 1DBBL 1H3GA 4HLZH 4LQFL 1RMFH 2HVJA 3DX6B 1LEGA 3OKKA 3SDDB 4JFFB 2NPLX 4EJ1C 4FABL 4NNPH 5B38B 2XWBA 5GGSB 5HI5C 2ZUQB 5DEGB 1N5YH 2X89A 3K81A 5K9KB 1XIWA 3O9WC 5DTFA 4MQ7A 4OZGE 5C71A 3D0VA 4PG2A 1HWHB 4XMKL 5JORB 3QAZB 3KPNA 4WI9A 1XF3A 1G1YA 4V1DA 3GM8A 5I16A 4K8RL 1SMOA 2Z31B 4K3HA 1YUHA 1YEDB 1EFXA 2VXQH 1NCAL 4GBXC 1BZ9B 1ZHNA 3Q2CA 4X6CF 4AT6B 3H6JA 4LHUB 4ZFFA 5TDPB 4U05A 5TH2B 5C70A 4O51B 4PGEA 1GGBH 3D2UB 2M8XA 3X12B 1S7QA 2BDNH 4M7LT 4Y16A 5DEFA 4MGXA 1MCRA 2ZJSH 4J6RH 3VFOA 4WFFE 3LS5L 4KK8C 3S5LB 1DBJH 1NLDH 4Q0XL 1QBAA 2HFFB 2NNAA 2EDOA 3TESA 4CMHC 2Y06H 3HCVB 3QJFB 2OQJB 4HFUH 5TE7H 2GJJA 3QXDA 4ZO9A 1TQCC 3I6KB 3CDFA 3OKDA 1KB5L 1IC5H 4K9EC 3GRWL 4S1QH 1QO3B 3KPTA 2LTQB 1HH9A 2P24B 3QNXA 2PTTA 3TFKD 4NSKA 4RFOH 5D1XB 4PJCF 4U7SA 1ZV5A 1CG9B 5CP3H 5I1LA 1CLZL 3AREB 5JUEL 5JPMB 1U3HA 4FQXD 2BY0A 1JF6A 3MRFB 3FT3A 1D5IH 1KIPB 2VXTH 1ZLUK 1IGJB 4G6FD 4URTB 5KVGH 3SDXA 5IR1A 1KV3A 3P77A 4NQEE 4WCYL 1OF2B 2VDRH 4K55A 4OAWA 1MQKL 4EVNB 1YMMB 4UAOB 3UPCA 3LIZL 1DANU 4I1NB 4FP8H 4YDIL 1F4XL 2DWEB 1U8MA 5HDQH 2C3HA 1AXTH 3SY0B 2CRZA 1JK8A 4O58L 1DLHB 3PWJB 3JV6B 1MH5B 5C6WH 2I5YH 5JXAH 4MNHA 4LU5H 1MHHB 5EOCL 3PIQB 4ZTOH 4FXGB 4PR5A 5CEZE 3VXRE 5HHQA 3M1BA 1MVFA 3SCMC 3G6JF 1J1XH 2BRRL 4HWBH 1LWRA 4R0LC 4R7DB 1VPOL 2R2HB 2BSTA 2VC2H 3HI1B 3TBSA 2XXCB 2E9JA 2CKBH 4O00A 5FYJD 5J11C 4RA0C 4I3GA 4ZSOB 2EDTA 2FSEB 3AY4A 4LASL 1CGXA 5KS9B 1NKRA 1MCLA 2F53B 1SY6A 1UWGL 3FB7A 4J3OC 3GSNL 1NCBH 1KCSL 5EOCJ 1QA9A 1G9ML 4U1IB 4NDMA 4WHYH 1F6LL 4TUJA 3ET9F 4K8RC 1SJEA 2LV4A 2DQEH 1TQBC 3FHAA 4PBVC 3MR9B 3IDUA 5F70A 1XGYL 4XH2B 3EHBD 5EBLA 3U82B 5KSBE 3VGBA 4X7DC 5TQ0H 1JGVH 2IAMB 1T1XA 2BC4B 2SEBA 3FFCB 3I9GL 4RFEA 4XWGH 2A77L 3DSFH 2EKSB 3TIDB 1ADQH 1X5FA 2J3SA 2WQ8A 1YEJL 1IAKA 1QYGL 3AMKA 5IW6A 1PVHA 3MJ7A 1QKZH 2HKFL 3BQUA 5AWNH 3WEXA 2GUOA 2VH5H 3WS6C 4NZJA 4OGXH 5T1LD 4I0KA 3DMMB 3H7LA 4DGYL 2QQNH 2VZUA 5T3ZH 1V05A 2HT2C 4P4KA 4WV1A 2ZOLB 2YD7A 3D85B 3WHE0 3ULVF 1NAMH 1DQQB 5ETUA 2Y7QA 3ZTNH 3O6FA 3EYOA 5JZ7D 2EZ0D 3OKEB 5FOBA 1NLBL 4JKWA 3QIUC 3LKPB 5BCAA 4N5ED 1AC0A 1G6VK 1MHEB 3HNVL 1V3JA 4IOIA 2O5XL 4PB9H 1I3UA 2OZ4H 2YD9A 4XC1L 4HXBL 1RZFL 4EUPB 1OSPH 5IOPB 4XB7A 4KHTH 2QSCH 1ZAGA 1IGYB 3QDGE 1ES0B 2MHAA 5HI4C 3E8UH 1G7MB 2GSIA 1U91A 5LGJB 4LLMA 3OHXA 4GBXB 3RZCA 3BYYA 1MOEA 2O5ZH 4NQDE 3RI5F 3IXAA 2YRLA 2YS4A 4BQBA 2W92A 3NABL 2YOCA 1L7IL 4ENED 5B39B 2PW2B 4E5XB 1Y6KR 3MXWH 2OSLA 2X70B 3ULVD 2AK4D 3HRPA 1ZS8B 3PDOB 1RZKL 2R4RH 5GGQH 2BSED 1FZMA 2G75A 1IC1A 1UA6L 1T3FB 3PGFL 2FEDD 4LPVA 4CMHB 4ONGL 1BD2D 1OLLA 3BP5B 2A9NH 2WINA 2ARJA 1G7IB 1TQCB 4UDTB 5ESVA 1MCDA 4A6YH 4GG8A 1M71A 3AM8C 1HI6B 4PV8A 2J8HA 1S5IL 1I9RH 2QSQA 1EMTL 3GMOA 5TDNA 1MNUH 1MLCA 4IDLA 4J3WA 4XAKD 4QRPD 5CJ8A 3KVQA 4KAQH 3DVFA 4FFZH 3JV4A 1DQMH 1GAFL 3JTTA 4IHOA 2NY5L 4LKXA 5C1MB 4LMQE 1TNMA 2W0FA 3FRPG 4U49A 1CE6B 5IBUG 2JCCE 5C0BA 4AIZA 1KTRL 1P2CB 5HTSA 5BV7H 1AGBA 2DM2A 3P4MB 1G9MC 2HT3C 3QEQD 2NXZC 3IF1A 4RGOH 5E2WH 4BQ8A 1ND0A 5C9KA 3MLWH 3BP7B 3NN8B 3GJFH 5EOQL 5GRYA 3QQ9C 3BISA 5CIPA 3IDMB 2HA1A 3GK8H 3SGKA 5KSVA 4OZIE 5EBMA 3VGEA 1HKFA 1NBVH 1PG7X 5LCVH 2ED9A 1MREL 4PJHF 2OCFD 5AEAA 4DTGH 1BLNB 1NC4B 4U6YB 3VRJA 2NLJB 1GIGH 2XA8H 5FKAB 3LKSA 2OL3B 5FYKU 4OCYL 1A1OB 1E4XH 3FQUB 4GRLC 3FQXA 1O0VA 2VLRA 3SCMB 2YZ8A 2J8UE 3QO0A 4R0LB 4ZTPL 4X8JA 4YDJB 5ADPH 4JDVB 4Q9QH 3K4DA 5J11B 3ZL4L 1FNFA 3NTCL 1M1SA 5CJOH 4X4XA 2R0ZL 5MENA 3ZKMD 4EXKA 4H25A 3H7BB 1A7QL 1QLFA 2HJKB 4HUXA 1A14H 4S2SB 5CGYC 1WF5A 3HC0A 5K9JH 1FG2B 3FKUS 3IFPA 4X7TA 2Z31D 4OZFH 1XGQA 1U93A 5MEPA 4BK5A 1LVEA 4LEXL 3WIHL 2W0LA 1P7QB 1UC6A 2VDLL 4F7TA 4OF8A 4AM0B 3UTSD 4UNUA 4LHUD 1DEDA 3V2AR 4MCZA 5SX5H 1BJMA 1YPZA 2AK1L 3F58L 5HHPB 1HHIA 2AJUL 3D2UD 5DI8B 2VZOA 4E0RA 5J1SC 3W5MA 3OV6A 5DZNA 4LHJB 4PJIF 3TLRA 3MRBA 4Y5VA 5B8CC 5CZVH 1K8IA 1XT5A 5D9SB 4HSQA 4FFYH 3VFPA 2IADA 2XZQL 5CP7A 2RCSH 1HQRA 1RZKC 3NH7H 2GCYA 4HGKC 3RWIB 3WDHA 4OFYA 4AMKH 1T7YA 4U0RB 3OPZL 5F7NC 4JLRB 1XR8A 5CD3B 1C12B 4RMTA 3KPLA 3ARDA 3RY6A 2XY2A 5D1XD 2BSRA 1KB5B 1A9EA 3L5WA 5KVEH 2XICA 3MLZH 2CDEA 4FQHA 1GOFA 5SWZA 2V9QA 3VRIA 4XP9L 5F1OB 5EUKA 3QIUB 1HOCB 2OTPA 3OB8A 4MJ5A 3BGAA 4JDZB 1UJ3C 3BGFC 4PLKD 3B83A 4GLRH 4GSDL 4XP6L 1AQDB 2X4UA 5I17B 2AQ3A 4QXGL 1TPXC 2RIKA 4O2CA 4Z7WE 4ELMF 5EA0L 4PTUA 1I9JL 3BN9D 1WGOA 3U30C 2Q6WB 3TYGL 1T03H 1KJMA 2XWTB 5EWIH 3MJ9A 2YMXH 2ADJB 5A2FA 4CU7A 4MJ2A 1ZE3C 1Q9LB 2YD2A 3X14B 4P2QE 4ETQA 5IFHL 2UWEE 1TJGL 4NCC1 5IFAH 5KVFL 1ZHKA 2NW3B 4DGVL 4WFGD 3H9SB 1LK2A 5IB4A 1FBIH 1RZJL 2ZPKH 1KCUH 1F13A 4C57C 4KC3B 5ILTH 1RUKH 1SEBA 1FLRL 5D7JC 4M4RA 1N5AB 3UYOD 5ISZB 4ERSL 2DMBA 1Q38A 2UY6A 3ARGA 3EOTL 5BMFH 5I2IA 1YEEL 4FQ1H 5CJXA 2FR4B 4LSPL 4XCFL 1V3MA 4UDUA 1BFVL 3WLWD 1AJ7L 2YUVA 5IMMB 4TRPL 1J9CT 1FN4B 5L2JA 3BRDA 4GAGL 4NQSB 3MMEA 4M7LL 1CLYH 5BJTA 1IQDA 2EH7L 3CFDB 1B3JA 3GSNB 4KDWA 5D93C 1CXLA 4I9WE 5L2KA 3PHOB 3P0VH 4QGTA 1ERNA 2FZ3A 2AEPL 4W6YB 3QIBC 1HNFA 1Q9KA 1QBML 1QRNA 4HPYH 1KELL 4UI2A 1FRGL 5DURD 2IAMD 3LH2H 1R5VA 4ZFZA 2R8SH 1NFDA 3FFCD 2Y25A 3CUPB 5ITFB 2YRZA 4J4PD 5I15L 5GJTL 3GBMH 1I9IL 2PYFA 1HHJA 5H37G 1IEAA 1JHKH