5E2WH

Anti-tau at8 fab with triply phosphorylated tau peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
208
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords AT8 LIGHT CHAIN
total genus 47
structure length 208
sequence length 214
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH01
1NEZA 2ZUQB 5FCUL 3SGEH 4PGEA 4GKNB 4YDVA 3U9PH 4P4RB 4EN3D 2YR3A 4JG0H 1W0VA 2R4RH 3MTRA 3V8OA 2GHWB 3TWCL 1F4XH 4UDUA 5GGSB 1G6RB 3RZCB 1WZMA 2D0GA 2OM5A 2YD1A 1I8LA 4PPTA 1PSKH 2H41A 2DB8A 3U4EA 3SGEI 1UGNA 2BVQA 3MRBA 1S7SA 3KS0H 5BQ7B 3RUGF 3JBG7 1KENH 1NGZA 4PFEA 4GMSH 1Q1JH 3IU4L 4XCFL 3RX5A 5E8PB 1FGNL 2R1XA 5BS0D 1W0WB 1KJVA 1HIML 2D2OA 4LF3B 3O3AB 4BZYA 1N0XL 4ZD3L 3IKKA 4HLZG 5D1XB 3RY6A 2D7TH 1FVEB 2XWJB 2FGWL 4NNYA 4MQXC 2QSCL 4NQEA 2QBWA 4FQ2L 1FPTL 3P9MB 4UTBL 3TZVC 4NNYB 5JOFB 4D3CH 1U2HA 2OJEB 3VXMB 1DQLH 2I9LB 5ITFB 1EJ6A 2OJEA 4YXHL 5ACMA 1Z2KA 2A6IB 1U8LB 1J0JA 5IB3A 1IE5A 3BT2L 3ZTNH 4K8RL 4NQCE 2X10A 4MAYC 3TJHC 4HMCA 4YDJA 1KIPB 5DRNA 3RRQA 3T2NH 4N9OB 1RHFA 2YRPA 3BKCH 1MEXH 3EYOB 4UINH 5C07E 3V4PH 2W91A 3CDGB 4OCSH 1RZ8A 3BVNA 3C8HA 3UZVB 1QO3A 5AZEL 4MNGB 2DWDA 3GDBA 3B9KA 1LEIB 3M17A 2RGSA 4HKZB 3B3IB 1AGCA 3EO9L 3ARDB 1A8JH 4NZDA 2ZCKH 1MFNA 2B5IC 5JZ7C 3B2UD 4GG8B 5DJCB 2FWOB 4TVPH 5JR1H 4KUCD 3VWJC 4PV9A 2I24N 5L8KB 2Z31C 3VRLE 2C4FU 2DLHA 5C0BA 3FMGH 2N56A 3LEYL 4K94C 4ZFOA 1WWAX 2MKWA 2VTFA 1UA6L 3CXDL 4UBDD 3LIZL 2AEPH 1KTKE 3CDCA 3IDMB 4P5KA 3FFCB 3MLUH 3IXAA 2E9WA 2ED7A 5CSBA 5FK9A 1AP2B 4RMUA 4UZGA 5EO9A 1KXVC 3RWIA 2L0DA 1JL8A 2F58H 1CFVL 3PNWB 3OMZA 3GMMA 3OR6B 4HT1L 3D39D 2GSGA 3IDGB 3QUML 5SX4I 5L88H 5TE4H 3WFEL 3WHE1 4PJ9B 1NGZB 3G04A 3IRPX 1AD9B 3PWUA 2X7LB 1IBGL 3BD4A 4JO2H 1U3JA 1CR9H 2EIDA 4KRPB 3VXPB 1DCLA 5IP4A 1AGBA 2JCCB 1XH3A 4FOMA 5F1KC 3UZQA 4GKZA 4D9QE 5MEND 1BD2A 1J8HE 1Q0XL 3P9MA 3BPOC 4XX1E 3SPVB 1PG7H 4N9GA 5D7KE 5T5NF 2SEBA 5DR5L 3O4OC 1KJ2A 5BRZE 3VW3H 2JJSC 5ENWB 1T89C 35C8L 4YE4H 1KV3A 1H8SA 4XAWL 3UYOD 4UT7L 5EO0A 4HFWB 1EMTH 3LDBC 5ETUB 5FYJD 5IGXH 1F3JA 5BRZB 5ETUA 1HI6A 4BK4A 1W8OA 1NEZG 2QHRH 1TNMA 4AIXA 3QFJE 1RIHL 4Q2ZA 4GOSA 4QOKB 5F1NA 3VXSE 3ZE1E 1X7QA 2FJHB 5CZVH 1R0AH 3W11D 3GJFH 3L6FA 1CFNB 4OLWL 2D0FA 3F6LA 3RTQA 3ARBA 4AIOA 4PRHA 1FNFA 4XMKL 4YXLH 3TNNB 4ZUUB 4JFDD 5IF0A 1H0DB 5HGDA 3VXQA 1JNLH 1MQKL 1ACZA 2DWDB 4NO3A 3FO9A 1YEFH 4HUUA 2H3NA 5FM5M 4ALAH 4DCQA 4QXTA 5F3HA 4CUCA 1BZ9A 2OP4H 3FN0H 4Q6IB 3QI9A 5L6YH 1D6VL 4XVSL 5DJCA 1OWRM 3FO1B 5C0CD 2OMNA 4FQLL 2Y4SA 2EZ0D 4G8FB 1GRWA 2HT4C 3TZVB 4E42B 4KI5C 2IWGA 4XNUH 4L8SA 4K7PL 3FAWA 4F7TB 1SJHB 2W60A 5GZOD 2I26N 1M7IA 1IAIH 5FYKD 1BBJA 4K2UL 5DWUL 3U30B 4G43B 5DK2A 4XPTH 2Q8BL 3WNLA 3V9FA 1BGXL 3GHEL 4LSQH 5HHVH 1R3HA 1OTUD 2HVKB 1I3VA 5EH1A 4R4FL 5E95B 3K1DA 3VFUA 2PXYD 3HG1B 1E4KA 1S7UB 1ACYL 1FC2D 3CSGA 1A5FH 3O2DH 1LK3L 3VFUB 4RMQA 5JQ6H 4JREB 3Q5OA 5C71A 1IEBB 5I1KL 2VDKL 5KVFL 4XNXL 2C3HA 5F8RC 1ZLUH 3IGAB 2OMBA 1K6QH 2VDPH 2VWEC 4ODTL 4FG6C 3UTTB 3REVA 4KKNA 3VXMA 1WICA 2VDQH 1AHWB 3TIDA 4K3DL 4MXWH 3SQBA 4I3RL 3VH8B 3QWRA 2SEBB 4IRZH 2EXWC 5EZIH 2VQTA 1NSNH 1WBYA 3AY4C 4HHAB 2DM2A 4WNQB 2WBJA 4HFWA 4HPOH 3MV9D 1BVZA 1T7YA 1IRAY 3V2AR 1AGEA 1A1NB 1NEUA 1I1AC 2K7QA 3OB0H 3TGXA 4MA7L 3WMSA 1JHTB 1F6LL 3A67L 1Y18A 4LKCA 3P11H 4OFYA 3VWKD 3SGJC 1CD1B 1TJHH 3DI3B 4NM8L 4ERSH 3QEGH 3H9YA 5K59E 2HT3D 3ILPA 3EYOA 1BFTA 1ZWIB 4V2BA 3QQ3B 4BM7A 2DQCH 4WU7A 2FZ3A 1G6VK 3Q5YA 1MRCH 5I18L 1WVZA 1XF3B 2Z92A 5DMGC 4HKZA 4FMKA 1W2KT 2AGJH 1NCDH 2W9DH 1BAFH 4BQ6A 3UPRB 2DQTL 2R0LH 3BZFA 5D2LF 1BZ9B 4ZO6A 1OGAD 5GGTL 3WD5H 2VLJE 2ZUSA 4TSBL 4WEBH 4R97B 2J5LB 4WWKC 3MXWH 5CMAB 4UIKL 4XPGL 4AY0A 3Q5TA 1UM4H 1L7IH 5IFHL 1IQWL 5GIRA 1QYGL 1HK6A 2UZYB 5LXGH 1J18A 2AJVH 1X5GA 1U41A 3IDNA 5HYIA 2HH0L 1IAKB 2Y1VA 5ISZD 1ONQB 1HXMA 5HI4C 3IDYC 3RKDD 3D2UB 3L5JA 4HUXA 2VNCA 2VQ1A 4J3UA 5HHQB 4Z76B 1HXYA 3CXHJ 4XXCC 3GSQB 4LPUA 3FQRA 3SCMA 5BXFA 3F58L 3ZT5A 4EKXA 3TBWA 3QIBD 5CINH 1XF2A 1ITCA 1OM3L 1INDL 1NKOA 5E94A 4GAJL 3QNYB 1XF1A 4HWEH 2DL2A 4MWFB 1K4DA 4P2OC 1JYXA 1R24B 2VRAA 3G5XA 1NGQL 3B9EA 1J1PH 1BJMA 2DQFA 3MO1A 1Z6JT 4OZFG 2Z4QA 2AXGB 2CLZB 4M7KH 1A4KB 4X6FA 5C0JB 3TIEA 4YHPB 3F7YA 3SDYL 4L3EA 3AAZA 1T80A 2LABA 1YEKH 5J1AA 1KJMA 4OSUH 5D1ZC 4ZPTB 4Y4FC 1QD0A 3QEQE 3U46A 5I73C 3GM8A 3CJJA 2G9HA 3HNSH 1FO0H 5KN5A 4K23L 1X7QB 2FJHA 2Q7YA 4KJPD 2NZ9D 4U05A 4FMFA 4P57B 4ONHA 1CXFA 2NLJB 1ZLVK 4MYWB 1X5IA 4JFOA 1UYWL 5F1OB 4HX1A 1WISA 4ZAKD 5TPWH 4DUWA 2P5EE 1VKXB 3JTTB 4LSTH 3DURA 1J12A 3GUTB 4F7CA 2J4WH 2DDQL 1I3GH 3JTTA 5DQ9A 4IMLA 1I9JL 3LRSB 4DFHA 3JVGC 2L7JA 1ZTXL 2B2XH 3ECBA 2F53D 3DUHA 1N64H 1D5IL 3QI9B 3MLYL 4FQCL 2Z8SA 5GJSL 2IFGA 5FGBA 3TZVA 3BEWA 1U8MB 5J11C 2XIDA 4ZQKB 5CEZE 4M62L 1BQHB 1RVFL 5EC2B 5I8EB 3ARPA 3RJQB 4ZYKA 4TSAH 3RIAK 4ZQKA 4PP1C 3BMWA 4U7KA 3PABA 5LAXB 5C09B 1NBVH 4A6YB 4KJWD 2W1NA 1N6QL 3QHFH 1DBAL 1AGFB 5C0BE 2YPVL 1FYTE 4ZTPL 4OQTL 2GJ6A 4ELME 2XTLA 4GRLB 4IOIA 4NYLB 3I6KA 5DLMH 2P24B 3LH2H 3QXAA 4EBQL 5IMKA 1ORQA 2P5WB 1H8NA 5AYUH 3K1KC 1OSZA 2FO1A 3MRNB 4XNQB 1OTSC 1UWEL 1Z9LA 4Z18A 4JHZA 1MCCA 2P8LB 2CR3A 3U79A 3QO0B 3HC0B 4P5TC 1I1AA 3I75A 5D6CA 3VWKC 2YUWA 4UT6L 4OF6A 3D9AH 1FNGB 2W92A 3T8XB 3U83A 1KB5L 3ETBF 3L7FA 3PWNB 1M4KA 3MO1B 4X9IA 3TO2B 5GRJH 2R39A 3QUZB 2OS7A 2ZKHH 4KROD 1T7VA 1P7QD 1TTUA 1QHPA 3H3BC 4Y5YA 3CZFB 5INCA 4TQEL 4YPJA 1KBGL 2I07A 1TENA 5E6IA 4I8DA 5ITBL 5IG7B 3FB6A 3UAJC 1AQDA 2Q3AA 3G6JA 4OF8A 1DQTA 1ZHKB 4HDIA 3RDTA 1IAIM 5AD0A 1IC5L 4N90D 3WN5A 3KG5A 1AQDB 4NM4L 5B38B 5C8JA 3MV9E 2A6KA 2AJSH 4NWUL 4ONHB 2FZ3B 1FIGL 3QIUA 4WWKA 4Z7VA 5B38A 4LNRA 1HHHB 4LHUB 4PJFE 3RGVA 2QADB 4NQUA 4HQQH 4HKJB 3NACH 3SOBL 2X4PA 3EJYD 2X4UB 2FB4H 3PL6C 3HZYA 3S36L 1V3KA 3QI9C 5DJYA 3B9DA 5A40E 3LKSA 5CIPA 5GGTA 1DSFL 3TNMB 4RGNC 4LIQH 4Z7WF 2BNRA 2IAMA 4TULH 2ARJQ 4I18C 3ULUH 1X3DA 4EI5C 1JZ5A 2MOVA 3GIVA 4M3JA 4PJ5D 5L9DL 5JW4N 4XPBH 4CW1A 1UVQA 4G6JH 6FABH 3SO3B 2Y5TA 4JLRA 5KVDL 4EN3B 5ACZB 5IBUB 4LFHG 5EWIH 3VH8G 4KY1H 1RURL 2R0ZL 1IM3B 1KLUB 1TCMA 4S2SB 1NUFA 1J1OL 3UO1H 4ZS6D 2NX5B 5D1ZB 3I6KB 43CAA 1A6AA 1NFDB 5JXAL 2VB5A 4JRYB 4NUJA 2J6EH 3BKJH 5IVNA 2CH8A 1IGCL 3OKMB 5ERWA 2IF7A 5TJWK 1FV1B 1CICA 5IMKB 4ZUTB 4HWBL 5TE7L 4FQJL 3UTQB 4IJ3B 2GIYA 1YNTB 4J4PC 3H9HB 1HH9A 3FQUB 2ORBL 3BE1H 2VXTL 1G9NH 2Z31D 4EQ3A 4ZOCA 1RV6X 1GPOL 3PG2A 5DVNA 2ZSWB 1MFDL 4Y19D 4PREA 4LRIC 1JPSL 1MF2L 4LU5H 2ADGA 4P2OA 2RFXB 4QTIL 3ZE1F 3I9GL 4F2MB 1IGIL 4TUJA 4XP1L 4NT6A 4CVXA 4PYHA 1PG7X 4X99B 2D31A 2XA8H 4L9LB 4KZDL 1F11A 3AXLA 5FHBL 1I7ZB 2FR4A 4N0YH 1NCNA 5J6HA 1L9MA 2VUOA 4PG9A 3GSVB 5CKGA 1A0QL 1EGJH 3KPLB 2NW3A 1Q9KB 1OT1A 4YHNA 3C6LD 4OD1H 3TO4C 4PJHB 2AKRB 5IHUL 2H32H 3EYQC 3W9EB 5HHMB 3TBYB 4V1DD 4M48L 2BRQA 1G9MH 2NY4C 4WWKB 4JG1L 3UX9B 3GMLA 1RUAL 4R97C 2ATPA 2QKIA 4HV8B 1FFRA 1YDPA 3V8CA 3O6LL 1D9KB 4HIHA 4M93C 4NQSB 4Q0XL 1IMHC 4OGAC 4UV4H 5E1AA 1FSKB 1WK0A 5LGHL 4KRLB 1H3WM 3DIFA 5L2KB 4RBPK 2WUCL 5C9JB 3MRFB 4OIIL 4AJ0A 2AP2A 3KPTA 3O0RH 1FORH 4FFWD 4X7SL 1EK3A 4JDZB 4DW2H 5E5MB 3MLXL 5TF1H 3LRGA 4KHTH 5KJRH 3RVXC 1EA9C 1EFXB 1F8TH 3S88L 1BLNA 5FO9B 1P7KA 1ZHLB 3O2VH 1JZ2A 3C9NA 2Y9RT 1JN6B 4PJEB 1S78C 1RIUH 1P7KB 5FV2A 5KZCD 3VGEA 2X09A 1U8OA 3EOTL 4PRAA 2KBGA 4DK6A 3W82A 3QEQD 4GQPH 3CIQA 4XMLH 3N1FC 1OSZB 1XGPB 1ZMYA 1AHWC 4NRZB 3D1MC 1YYML 3PQYE 3QPQC 4UIMA 3X12A 2CIIB 4LVHB 5BVPH 4KKBC 3TYFB 1C7SA 4ORGA 2VN4A 3HPLA 5JOPE 1CGXA 3EDEA 3GBLA 2VWEE 1RZFH 5M94B 3CK0L 2MSPA 5D2NA 3TM6A 5FUZH 4NCC1 4EVNA 3TN0C 1EHAA 7FABL 4JREC 1MHHA 4MJ6B 4HUVB 1LO0L 1NC2D 2DMKA 5MEQA 2WIIB 4JHAL 5GS0C 1NJ9B 3OTTA 3HAEG 5D7IB 3ORJA 3RL1A 3OAYK 1IT9H 4KVNH 2DD8L 4IDJL 4F7MB 5DRWA 3MNZB 2XPGB 3OJDA 2DWEB 8FABA 4TTGA 3KPLA 4S1DC 5DT1H 2VLLB 1NFIB 4DZ8A 1A7QH 3P40A 5DD0L 2VLRE 2JIXD 5DGQA 5DK0A 4NKMB 5IJKC 3QDGA 1ND0B 3OR7B 3MA9L 4UOW1 1QPPA 5KSAA 2HKHH 3D18A 3LKRB 4HK0B 4Y5VC 5F7MC 2R0WH 4MQTB 2HTLC 1U93A 1U36A 5DVMA 1SBSH 5E1AB 1GOHA 4RQQA 3KYNB 3KLAA 5K9OA 3PV7A 4ZXBD 4PJEE 5DRZA 5HHPA 1EHXA 2H1PH 3RWJA 1GVIA 4S11A 3VXRB 3KWWB 3MJ6A 1CT8B 1QRNB 5DDHB 4WHTB 4LQFL 5BZWA 3B3IA 1UWGL 1AY1L 4DN3H 1U8IB 3GZKA 4IRSD 4X7TA 3RA7H 1GJIA 4U7MA 4KTYA 1HOCA 2ADIB 1NAML 1PJ9A 2ATKB 5DMKB 1T20A 1FDLH 5BMFL 1O7VA 1EEQA 5HHXH 5DUPH 4PV9B 3AS2A 4NC2B 3VI3E 3N85H 3BAEH 2AV7A 1MJ8H 4FQIL 4MD0A 3BZEA 1JN6A 1UM6H 4P5MA 5DURB 4F58H 4I3GA 2I9TA 2BSRB 4NUJB 1I4FA 3FQXB 1FZMB 3NIDE 1RK0B 1HQRB 3HFMH 1EAPA 3MLWH 4HBQA 5B3NA 5H2BA 1XGQB 4AMKL 2VC2H 4KPHH 3O4OB 1X5LA 3C60C 3LVEA 1DEDA 1ZT4A 1NGYA 1R3JB 1LD9A 4CNIB 3MRMB 3N1GC 1NUNB 5IKCA 4FQ1L 4QHNA 1R3JA 3BD5A 4I4WA 4ISVA 2NY1C 3SE9L 1HYSC 4KQ3L 2V2WA 5HHXL 3QBTB 4OZHA 5BMFH 3ELAT 4PJ9A 5HPMB 1NFKA 1FFNA 2V2WB 4NC1E 1MHHB 2WWMC 3O3AA 5L0QC 4DN3L 2EZ0C 1NGPH 1WZ1L 5HPMA 1FVEA 2XWJA 5E6IC 4XC3L 1OHQA 5B39B 1ZLVH 3MBXH 3PQYD 2YA2A 4Z7WE 3B5TA 3QDJD 1F13A 1D3CA 1JPTH 5F6IB 2WUBH 5JOFA 5LQBL 5CWSA 3W39A 1DVFB 1BD2B 4O51B 3BDBA 1PBYA 1N5AA 4QY8B 3U7YH 3O9WC 5ICZA 5IEKA 3S8WA 4OZIE 5I8OL 1S5HB 4DZ8B 1IGJB 2BSSB 1GHFL 3QEHB 4P0DA 5BS0E 5ICZB 3O6FD 3HAEH 1MCBA 2LTQC 4EI5D 3MRJB 1G7IA 5DZOA 2IANE 3SDAA 5AZ2L 3L3JA 4GG6B 5D6DC 3FQTB 2CK0L 1CGWA 4H88H 5GSVA 3AU1B 3VD3A 3NPSB 3QIWD 3K4AA 2CJUL 1A7QL 3WLWD 1HE7A 2X1OA 3IKCA 4M1GL 3PHOA 4PG2C 5IM7A 4LCWE 2QSVA 2DD8H 4M9OA 1YY9D 1IC7H 2IMNA 4DKFH 3B9KC 3NFSH 5F93C 1CT8A 5E8NA 4GLRH 2P5WE 3ARDA 1N4XH 4JHAH 3NGBB 4WHYH 2BOCB 3G5YB 5IB4A 1GGBL 1NCCL 3TF7C 1PZ5A 1Y6KR 5ALBL 1CK0H 3QWOB 1LO0H 4Q6IA 2D03L 4U6HA 2PN5A 1K8IB 4ZOAA 2R23A 1T83A 3H9SA 5F7DB 2AK4A 4NQVA 3VXSD 4G8FA 3EO0A 4J23A 3HAEA 4NKDA 1K8IA 2E27H 3QFJD 4ZG1A 3D2UD 1KEMH 2PO6C 5F8QC 5SWQB 4ACPA 5FYLD 5FYJE 4RCAA 1YYMH 4G43A 5DK2B 1H3PH 2EC9U 4P5KB 1HQRA 2GUOA 3O41A 5H2BB 1MHEA 2Y25A 2VZOA 2PR4L 2Y06H 5C0AB 3IDIB 4WO4D 4FQQB 4XMLL 2D9QB 4NO0B 1AP2A 3RPIA 1W0VB 3EOTH 5I9QC 5IKCB 3KR3L 4XWOC 1JTPA 3TVMC 1SYVB 1ZHNB 2H9GB 3F12B 4LLYA 3W5NA 3O2VL 4UQ3A 3RY5A 3T09A 5F7EL 4DKDC 5DD3L 5C6PB 5D7SL 5CEZL 3U4BL 5I1LB 2JJTA 5L2KE 1F8TL 4Y5XA 1SBBA 4PBXA 4LGPB 4CGTA 3ULVC 3MLXH 2R2BB 4QCIB 5JHLH 1PDKA 4X7SH 1FORL 3L5WA 1KJVB 5J0BA 1NJ9A 1A7NH 2NXYD 4X5XA 3VFRB 3WKMH 1A3RH 3BGMA 5TFSH 4YPGB 1CCZA 1O0VA 4FHBD 1M71B 2WUCH 1GYAA 3EYSH 3L7EA 3HUJF 4CJ0A 4P23A 2A38A 4JGUA 1RHHB 3LY6A 4X6DA 5F89A 5DJ0B 5E9DE 4Y2DC 4NQED 3RI5K 4F15B 1NH6A 4JFDE 3MLVH 2E9IA 2VZVA 4Q2ZB 1ZE3C 4WW2B 4L8BB 5T3ZD 2PF6A 1KXTB 4M48H 3NVQA 1VERA 1JUFB 2ZSVA 5IMLA 1YC7A 5TF0A 1S7RA 4JY5H 1G9NC 4RRPG 5C0FA 4OQ1A 4U1HA 4L29B 2QQKH 1XCQB 1A0QH 1EGJL 3IJSA 1PY9A 3PHOB 3BDXA 4FXGB 4N0YL 3ARFD 5FUOH 1E27B 3MREA 1VEOA 5CJBA 4MNGA 3P4MA 4KZDH 2DYPD 2P47B 4BSWA 1OARH 1E27A 3NFPB 5KSBB 3VFNB 1RIVL 2E7CA 2PYEB 1A9EB 1TETH 2YKLL 4XMPL 1F6AB 1ZSDB 4D9QD 3CSPA 5MENE 5JW4R 3MX0A 3PWLA 1AO7A 3DUSA 1I9IL 1JPSH 1A9EA 5HY9B 2PW1A 1MFDH 3UDWC 4POZD 4MAUH 1JIBA 2LAAA 2ZZUT 2RCSH 3BE1L 5I16B 5E03A 2GAZB 4L4VE 3A6CL 3V6ZB 4BH8A 2P5WD 1N3NA 4MNQA 4OGYH 4L3AA 1E28A 1B3JA 4WUUD 2VR4A 4MZ2A 2HT3C 3NN8A 3WNKA 1AFVH 5HI5C 2Q87A 4B7IA 3EIFA 1KPRB 2J6EL 4LCIL 1H15A 5D7JC 2IALA 5GSRB 1A6VL 5FK9B 3ZT7A 1REIA 3T2OA 2VQ1B 2CK2A 1XR9A 5T1DH 4F8QA 5FHAL 5C0EA 5FECB 15C8H 3ZKMD 1S7SB 5E7BA 5KVDH 4XC1H 4G7VL 5I8KL 5I1LA 1I1FA 2NY5C 3EYUH 4K3GA 1JVKA 1QUNA 3SGKC 5AUMB 4XB8A 4RIRB 3QP3A 2P5EA 1QA9B 1KTDA 1A1OA 5E7FA 4TULL 3VXPA 3MUHL 1FZKA 1DUZB 4TNWK 1CGVA 3V4UH 3KPSB 5EOCH 3BH9A 4KRPD 1DQJB 2QTEA 3JZ7A 4NKOB 4GS7C 3TV3H 5EO0B 1NLBH 4N1EA 2FCBA 3MV7A 5GGUA 5CEXA 2FX7H 1MIEL 4KXZH 1GOFA 1KCVH 3WUZA 4C56A 2AJSL 2QADD 3REWA 5D2LB 5FA3B 1A6UH 1MCQA 4RISH 3EDKA 2FIKA 4XCEB 4J3OC 4NZRH 5CGTA 5E70A 3ILPB 5TQ0L 3VXOB 5D6DA 1CIDA 1CF8L 2OR9H 4OZ4A 3RY6C 2FEDC 1KBGH 5A1AA 1U58A 2C3VA 5BCAA 3RWDB 2VDLH 4WHCA 2NY2D 3S96B 3UTSE 1J11A 3IDUA 1YNKL 3UTSB 4L3CA 4UUJA 1VEPA 4XP6H 4PRHD 1J5OL 1JRHH 1KB5H 3MGAA 2VDOH 4UT6H 1XCTA 1U8KB 3MFFA 3RIFF 4OFPA 3AREA 4E42A 5D72L 1E6OL 4I0CC 5T33L 5C0BB 3IDNB 3PHSA 4ONGL 1UZ6F 4X6BB 4NIKB 2M26A 3NCYS 2R2HB 1OP3H 1KXQE 5J56B 5I1EL 3IXAB 2JLLA 4JR9L 3KLHC 5C07A 3VGAB 7CGTA 4IOIB 2JJTC 1C1EL 4H5SB 4LSUL 3Q6FB 4IRSC 3MLPA 2IADB 1OF2B 5DLML 4QHLA 3GSQA 2MQ3A 3FT4B 4K7FB 3RKPA 4KVCH 2C3XA 4ZTPH 3MV11 1ETZB 3U1SL 2GSGB 1DBAH 3QHFL 4XBEL 1K4CA 1RD6A 3SE4C 1OVZA 3I50L 4Y5XB 1E0OB 1NBVL 5FCSH 2GKIA 2P8LA 1T21A 1K4CB 1W8NA 3RZCD 4N8VB 1T21B 1RY7B 2DICA 4ZUVB 4GBXB 2P5EB 4PRDB 3U6RA 1OY3B 3T0DA 1Y0LB 1Q0YH 2AQ2A 1WC7B 2JCCA 1CXKA 4F37K 1ZA3A 2Z4QB 1Q9OB 4FQCH 3NFNA 4O02L 5SWSD 4XPFH 5IHZB 1N64L 3LKPB 5A43C 2FX8L 5GGRB 5E9DA 3MYJA 4Z8FL 2AK1L 2B2XL 3DX8A 5T5NG 4AT6B 1CBVH 3N06B 4KZEL 3P4OB 4YHIB 1I3GL 2YBRA 4WFED 4F33A 5I2IA 3D48R 1AXTL 1YA5A 3I3DA 4UU9B 4V1DB 4L8CA 3VCLA 3JWDC 5CEXB 2UZIL 4L8BA 4I0KA 3QJHA 3AB0C 5TPWL 4UU9A 1UYWH 5I1JL 2JCCF 4JDTH 5IMLB 1I8IB 5I8CB 3BIAX 2CUHA 3GSUB 5HYEA 1GZPB 3JWDH 5CZKA 4K23H 4P3DA 4Y16B 1FO0L 1UJ3C 2YOCA 4LHUA 3AMLA 1YMHA 3S5LG 3U9UA 1CLZL 2ZNWA 4JFZL 4JZOA 1YEKL 2KPNA 2P8PB 1T22B 3BQUC 3RWDA 2O5YL 4DVBA 1FFQA 4HUUB 1XF5B 2P8PA 2PYEE 3B6SA 4KK5C 4XH2A 3GGWB 1CTNA 4M7KL 2ERJC 1EFXD 5D2NC 4NJ9H 4QYOB 5C0IA 1DVFC 3VXTA 2ZCHL 3QCUH 2AS5M 1Z3GL 4H26A 1EO8L 4KUZH 5DMJB 4Y8DC 5DHVB 4LPVA 4GAJH 3MCLH 2Z8RA 1J05A 3KYOA 1LDPH 2R1WB 4WV1B 3OPZL 3V6ZA 5L0QB 4TUOB 1ERNA 3NIFE 3MRRB 1KB9J 2XQBL 4HW6A 2KH2B 4GAYA 1R5IA 5KVGH 1KB5B 3GJEA 3MRRA 4N5EC 5TDPA 1HCFX 4WO4C 4N0UB 2IALB 2EDWA 2NY1B 5D1ZA 3HMXL 5HYQB 4R26H 5KBNC 5LCVH 3OGCA 4Y4HB 1KTRL 4LASH 3HG1A 3O81A 4KV5F 3T0VA 1LEGA 5FA4B 3MRNA 4Z0BL 3L3OB 2X1XR 4YC2B 3PP3K 1FYHB 5C09E 3FHAA 1DDHA 3SY0B 5AUMA 3MRQA 4OLYH 4FA8A 1R5VA 5GRXG 1L7IL 5IFHH 3WEXA 4GUPA 1BVKA 3D3VB 3MXWL 3DV6B 1A1OB 4YUEH 5GHWL 3QXVA 1Y0LA 4U1LA 5F7NC 5TE6H 2LU3A 3MZTA 3REVB 4E0RA 2ESVE 2DQTH 1JZ4A 1F00I 3SCMC 1BJ1J 1MUJA 1FFPB 4YFDB 1GGIH 4ODHL 4P5TD 2F54D 2R15A 4D8PA 3RPKA 1MRCL 1AGEB 1TZGH 1MFEH 3VFGH 4LAJH 3QJHB 2G9HB 2W59A 4ERSL 5DRXA 1SY6H 4NM8H 4Y8AA 3EZ8A 3VFMB 1NCWL 2ARJB 2V9QA 1ZK9A 3I6LD 2OSLB 3C5ZB 4KKAD 3SGDI 4MA7H 1EFQA 3HC3H 4JO3L 4OZ4B 3THMH 2ZWLT 4IOFC 4X9BA 3EFDH 3V0AC 4HX1B 1CLOH 4QOKD 2Z92B 2R29H 4BZ1L 1QKZL 5JW3H 4G8GD 4OF5A 4WTXA 4OLZL 4PRID 1I85A 4PLJD 1NSNL 4RFOH 4ZAKB 2MCG1 4NGHH 4EOWH 3QHTC 4U1GB 2AABH 1I85C 1K6QL 1MREH 1WZKA 3DOSA 4OZGA 1T5WB 1GIGL 4D0CA 4NNPH 5E8OB 2VDKH 5F3BB 5IT2H 1OGTB 4WJ5A 3DXAA 5F9AC 1CDHA 4YHKL 5A2LH 4PGZA 1TVBA 3JWNC 1OGTA 4WJ5B 4WV1A 4OD3H 5JQ6L 1LK3H 3ZDZF 4PUBH 2OI9B 3C2AL 4P2QA 2DLEA 3HLAB 2VH5H 3TZVD 3GSWA 3SJVE 1A4JA 5H35B 5DJAB 1QFHA 3RWGA 1OL0A 4K71C 3P0YH 5B22A 4LVHC 4KJPC 3GHEH 3KPOB 4PJCB 1CDYA 3TBWB 2Q8BH 1CXHA 4G6AC 4K2UH 5SWSE 3L3OA 4RAUA 3DYOA 1IAIL 1I75A 5F9OH 2CIIA 4R2GC 4Z9KB 4RA0C 5E4IA 5EU5B 3MRQB 4U3XA 1G7QB 1KG0A 5DTFA 5ILTL 4D94A 2PETA 5BW7C 3MLSL 4L8DA 3PL6D 3BKML 2DQDL 5DA0B 4RMVA 2FYYB 5EZJB 4FQLH 1RUMH 4WGVB 3JV0A 3SGKA 4NJAH 2EO1A 4TSCH 3EDFA 1JZ6A 1RZGB 1XMWA 3FN0L 5HDBE 4OQTA 5DYOB 3ULUC 3KJ6L 4ALAL 4LP5A 2I5YH 4KK6C 3IAQA 3RGVC 1ULVA 3V0WH 1HKLL 2Q86B 4XP4H 1SEQH 3V0VA 1JZ7A 1U95A 1KPVA 3KLSA 3ILQC 1PVHA 4U6XB 5C9KA 1Q72L 5DRWB 4I13B 2COQA 4XMKH 3QDHA 4YXLL 3EW3B 4I2XA 3QNXA 4NQDA 4BQ9A 4X7FC 4PJHA 1G7MA 5E2VH 4IRJC 3RQ3A 4PJFB 4MA1B 3L5XL 2FJFB 5ICXB 4HCRA 5I30L 2XKNB 5F6HI 3GMOB 4U2ZA 3IFLH 3MV9B 1EEYA 4L8SC 4NKMA 1RIHH 2BOBA 2R0KL 4QRSB 1JE6A 5JQHC 4HV8A 3QIUB 5IGXL 2NY4B 5KSAB 5FOBA 3C60A 3T0AA 5C70A 2AJXL 4XAWH 5I74B 2A83A 5L2KA 35C8H 1MJUL 3STZA 5DR5H 2A83B 3N9GL 1U8QB 3ZYIA 3KJ4B 1P9MC 1UM5H 4WFEE 3EHBD 1U8QA 3MJ8A 3PDGA 4Z0XB 5GGRY 1H5BB 4PJ7A 4G7YH 4HAGA 1A7RL 4JPWL 3TBVB 4YFLF 1ZGLM 1RJZA 4H1LG 3TBVA 4HPYL 1KOAA 5GS0L 3VFSA 1JGUH 2KZWA 3B5HA 5F7KC 5IV2A 3HG1E 4OB5H 5GISL 1WAAF 5T1KA 1I3RB 5C0DB 5I19H 2NW2B 4Y4HA 4ONFH 1U0QA 2FHCA 3S36X 5JOPD 4QRPE 4MJIA 3VXNB 2VXVH 3X14B 5FDYA 2AEPL 5SV3A 3RL2B 4X7DC 1DR9A 5EO1A 4Y5VA 4AENB 1JRHI 5T3XD 4JGMA 5J6GA 1YUHB 2ZOKB 3E2HB 3LEYH 5E99L 4ZTOL 3RFZC 4XWGL 2OZ4H 3P0VH 5AAMA 3HC0A 3WEXB 1YUHA 1BVKB 4G6KL 2BSTA 3DV4B 3UJIL 4HUVA 4K07A 1QFPA 3MV8E 1KCKA 1AR1C 2BC4B 1L6XA 4TRPL 5ESVB 4W70A 1CN4A 2ITCA 4P2YA 1FJ1A 4PJIB 1BFVL 3WS3B 3PDOB 4ZFFA 4Z5RA 2EIEA 4GJTB 4Y5YB 5AZEH 1PKQA 2FBJL 3QUYD 1YPZB 2C9AA 5J6HB 1RZ7H 5E2TH 4O51A 2HLAB 3RWCB 1Z9OA 1PKQB 4JFYA 4QNPE 5EC1A 5JIIA 1P84J 1HINH 1ZHKA 2Q76B 3MRDA 4JFXB 5D1QB 3BSZH 2VLRD 3GRWH 3OAUL 4UILH 3WLBA 3KNBB 5D1QA 1JPST 4FQHA 4RAVA 4JFFD 5T3ZL 1JGEB 5KTEH 2EEBA 3W0WB 3DX7B 3ZTNL 1S9XA 1Y6MR 3AU1A 3HZYB 2HKFH 1MCDA 4YXHH 1FLRL 3F5WA 2CDFA 3ULVE 5I1GL 4M6AA 3STZB 3E6FA 4D3CL 3CH1A 3OSKA 4XBGB 1K5NB 1J7VR 3PV6A 4FQ2H 5BV7B 2QSCH 3FO2A 5EU3B 3LPWA 4QRPA 2AI0H 3M17B 1UB5A 4LLDA 1U8NB 1NDMB 4YAQB 1HIMH 5E08L 5HYJE 2D4DA 2CKBB 1XF4B 1AXSA 1U8NA 1AIFB 4GMSL 1XT5A 3LHPH 1KENL 4JM4H 4W4OC 3HC4H 3BQUD 2WQRA 3MUJA 1NBYA 3LEXA 4GO6B 1OQOA 3FQXA 3TJEH 3VD4A 1IILE 4ZO8A 5DFWH 1IGTA 1ZANL 3QDME 4H1LH 3PP4H 1QNZH 4Y4KB 2NW2A 5I1DA 2XICA 4PJCA 1CICB 2XTJC 4YDIH 1OPGL 1WQVT 5L2JA 5FFLA 1E4XH 3ES6A 4DKEL 4OTXH 3U9PL 5L2JB 3LD8C 4ZS7H 1EPFA 4QHNB 2XG4A 5J6GB 2OX5A 3KPNA 1OAXH 2W38A 1NAMA 4YX2L 1C08A 4ENEC 1LMKA 3HKFA 3HPLB 1ZEAL 5IW6A 4OAWA 4WFFE 3W11C 5D2NB 2BVPB 2BNQB 2CMRH 2EYSA 3C5SB 2Q6WA 2ERJB 2ZP0T 1B4RA 1V3MA 5GRUH 3KPSD 5SWZE 2DMCA 4WU5A 2BJMH 3CFIC 1A2YB 3SDXE 2AQ3A 2AJZB 1IKFL 3O11B 4G8IB 5DEZA 3U7AA 3TJHD 1LWRA 3O6KH 1OAYH 4Y89A 2GCYB 4UAOC 3G6DH 4IDLA 3HE6A 1EGJA 5CJ5A 2A77H 1FH5L 1CLYL 3QNXB 4PG9B 4H1LA 4WEUD 3RWCA 5DFVC 1TJGL 4L5FL 3MRDB 3KAAA 1TPXB 1NFIA 5FYLE 3GMOA 2DTSA 3SDCA 4QXUL 3BIKB 2QSTA 1Z9MA 1LO5B 9CGTA 2BSED 2GITA 3R0NA 1JI1A 3AUVA 1JGEA 2X9XA 4YZFE 3ARBC 4ZFZA 1D9KA 4HIHB 4NQSA 4TPRL 3KPMA 3WL9B 3DVGB 4L5FH 3BP4A 1TJGH 4MB5A 5K93A 3GFUA 3WL9A 1MCPH 2JIXA 2GSIB 4BSVA 4PJHF 3RTQB 4AM0A 1E4WL 5E2WH 2J8UB 1WAAA 4NQXB 1KCUL 2NY3C 3TA3D 2BCKA 1XIWD 3WFBL 2BFVL 1HEZA 1RJZB 5T1LD 4LMQI 5GRUL 3WE6A 2CMRL 2BRRH 1T20B 1ZEAH 2R2EA 3WE6B 1C16B 1Q9WA 2H45A 5HHOD 4M4PA 4OFVA 4C57C 5C0AD 3VXUA 1MI5E 2OR8A 4L4TA 1XEDA 1LNUB 1VFBB 3GBNH 2ZUTA 1GGYA 4IRSB 4R6UA 5T1KB 1NMCB 2Z35A 4ZFOB 4P2QE 2I9TB 3CX5J 4M6NH 1PLGH 3ZE2F 4JANB 4DKEH 1SM3H 2A9ML 2QL1A 4FQQA 5EO1B 1T66D 5JPMA 3GSRB 3ARUA 1ADQA 1YMME 4RGMC 1TQCB 3HE6C 3WKNA 3PP4L 1ZANH 4F37F 5ID1A 3GSRA 4XPAH 3WDHA 3X17A 3KYMA 5GSRA 3IAGC 2EDTA 2AXFA 2J88H 3KPNB 2AXJA 4I0PD 4L9DA 4PJEF 1T6VN 4GBXD 3JV6B 2UYLA 2AXFB 1F4YH 3QQNA 4G3YL 2DAVA 3WN5C 1LE5A 3O8XD 1DTUA 1GC1L 4M7JH 4OGXH 1CQYA 4N8CH 4PLKD 2KZ1B 4MXVE 5BJTA 4BQBA 1RULL 5IK3A 3OAZH 2GFBA 4X5XB 5EZLB 4WI9A 2AJZA 5E8PA 4WTZA 3O4LE 1DE4B 2EXYC 1F5WA 4U49A 2XZZA 1VHPA 2GFBB 5EZLA 1AXIB 4UMGA 3OQ3B 4BELD 1MAJA 4AEHH 1FNHA 3MNZA 4PYGA 5AEAA 3P30H 3HI6L 3TEUA 3QIBC 4CU6A 1FLRH 3NA9L 1WT5C 4E41A 1G7HB 4M1CC 2RBLA 3W9DB 1IC4L 4HKBA 5ITFA 3PQYA 2OTUB 2DM7A 3BUYA 3UTZB 1B6DA 2PXYC 1JNNL 2DIAA 2Y6SD 2UWEE 4PRPD 5T3ZH 3ULUD 2HLFC 3MRJA 4YDJB 5D2LA 5FA3A 1J0ZA 4Z77A 3GRWL 3OAUH 4YHMH 5ICYB 1CDCA 3RWFB 3FT3B 1CD1A 4QHMB 1CE1H 1IQDA 1TZIA 5IFAL 3O6FA 1INEL 4QHMA 1JGVL 4I0PC 1K9TA 5DRZB 1RZ7L 4ZUUA 5CFHA 2YD6A 1A14H 5IF0B 4EZMA 3HE7D 3GK8H 4KRMB 3TC9A 5HYJA 4KAQH 1BFVH 4LLDB 1ODAA 5EUKB 3GBML 4M5YH 2VSDA 5CD3B 2DQHH 1HEZB 2BOCA 3G5YA 1CG9B 1C5DB 2ESVA 4TRPH 3F8UB 1AIFA 3GMNA 5TH2A 4BYHA 2ZOLA 1JF1B 3RNKA 4PJ5E 4JFHE 1DQDH 4MD0B 1EDQA 1ED3A 3JWOH 3P0VL 2VITA 4GT7A 3O8XC 5E99H 4ZTOH 5BOPA 4ODSL 2VXSH 1PGRB 3TVMD 4AIZB 4U1SA 3UTPE 4W81A 1FVCA 2VXVL 4HUMB 3GKWL 1SMAA 1RZIA 1WSST 3Q6FA 1BZQK 4MNHA 4MJ4A 3UAJD 5I19L 2O5ZL 1ZA6A 4HGWB 4OLXL 3D3VD 4K7FA 5GISH 4OB5L 4CAGA 1RPQA 5IOPA 2DBLH 3AS0A 2HFTA 3MLZL 3SKUD 1W72H 4HPYH 2CR6A 5DA4A 1FAIL 3G04B 3IJYB 5IWLA 3VMOA 2FHFA 3MNWA 4G7YL 4FTVA 1PW3A 2Q3ZA 1P1ZA 4MAYD 3N9GH 1YYLL 1UXWA 4OCXH 3D6GA 1MJUH 3RWHA 1VEMA 3DVIA 3GM0A 5B4MC 3TFKC 2B1AL 3FOLB 3C5ZD 1UB6B 5EOCJ 4P9HL 1OLZA 3VG9C 3MV8D 1PEZA 5K9QG 2DF3A 4YZFF 4F3FB 1JHTA 3GB7A 2YWYA 1LK2B 4EDWL 5I30H 1CFNA 4HF5H 3GSUA 1NL0L 4Q9CA 2VLME 4O2CB 2GSIA 1WWWX 1RQ5A 2RHEA 4X9HA 3V79C 1D7FA 2QQQA 4MCZB 5CP7B 4LSSL 3N1QC 2FLRT 1FGVL 1H3GA 3CDGA 2BXYA 4LSVL 4MHHG 5IW3A 1JFQL 4PRHB 4XP4L 4D9RD 2ZG3A 3V0WL 1MIML 1ZV5A 5DQ9B 4DCQB 1KIRB 1P4IL 4NO3B 4G80A 3FO9B 3GGWA 1T2QH 4NUGH 2ESVB 2IPUG 4TSCL 1UACH 5FO8A 3MFFB 1RUML 4I9WE 4NC1C 3BKMH 3VFTB 4NRXA 1TJIH 1VPOL 4D9LL 1KGCE 3QCVL 5ILTH 3SKMB 1YEIL 5DO2D 5DC0A 3AS3A 4JAMA 4NKIH 3F65A 2XZCH 3CLFH 2N4IA 3DYPA 4M9PA 3W2DL 3HI1B 4J7RA 3OKNA 2XNAA 3P4LA 4WY7L 4CADA 5HJ3A 2YD2A 5JMRA 4CMHB 3M07A 4KDTC 1MCNA 5DFVD 1FYTA 1EUUA 5IHLB 1OTTD 1WTLA 2P5WA 2DKSA 3T08A 5JOEA 1U8HA 1QSFA 4N8VA 1CL7I 4YHOH 5JNYB 5GRZA 1MY5A 3QO0A 5LGJA 1DN2A 1XR8B 3L95B 4F57L 3HCVA 3D39A 4UOW0 5KSBE 1YEJH 1I9RL 2DQEL 2VXUH 2WNGA 1C5CL 3WO4C 1FO0B 1M71A 3CZJA 4NGHL 3BD3A 2WBJB 1CGTA 5JW4M 4JY4B 3NPSC 2UUDH 4YGVA 4WHYG 5B21A 4HWUA 1ORSB 1WFNA 2VQUA 3GSNB 4BZ1H 2E5EA 5L8JB 2R29L 5FO7A 4KI1A 1UT9A 4G42A 3WNMA 4IIQA 3QZWB 3EFDL 4BK5A 2V5TA 1VFOA 3QSKB 3RZWA 2FO4A 4RFEB 3TLRA 4HXAH 4R7DB 1NC4D 1IQDB 4M61A 3HUJB 5F7YC 1UQSB 3L6FB 4HH9B 1G7JB 2CXKA 3F7VA 3MV7D 1MFEL 5K9QI 1QTYT 1M7DB 1TZGL 1P84K 4AH2A 1YQ2A 3KXFA 4C56D 4FXKB 4C58B 4X9FA 5D93C 5HGDB 4AH2B 2AAVA 3C6SA 5I1IL 1XF5A 3B6SB 4AG4H 5CEYB 4EQ2A 5C1MB 4WI8A 3KPPB 3H7BA 4GSDL 4KROC 4NWTH 2Q8AH 4RDQF 5D70H 2G60L 5CJOL 3OKLB 3ARBD 3U82B 2GTWB 4F9LC 3STBA 1YQVH 4PJXB 2P8MA 5D7KD 1U8MA 1XGYH 4CBPA 4GQ9L 5HY9A 2VZUA 2VZTA 4J12A 2VLKE 2M1KA 4KJWC 4B50A 2A2QT 4L3EE 4JCMA 5JA9A 1QFUL 4ZO9A 5AWNL 5C09A 3BPCA 1D5ZB 1T6WA 4LLVA 1IAKA 2BZDA 1G9MC 4R8WH 3AS1A 4Y0GA 1I8KA 1DBML 2QV2A 4Y19E 4Z0BH 4O5LL 4X6BA 4HWZB 1U92B 5E8EA 4R96A 3LN4B 3QUMB 3WDJA 3QFJB 3WFHA 4N8PA 4R3SB 3ROOA 1H15B 4R26L 3GIZL 2NX5A 43CAB 5D5MA 4DN4L 4NDMA 3RZCC 2IADA 3MOAH 3RWEA 3P9WB 4HS6A 2W0LA 5TDNA 2VL5B 5KVGL 1LE9B 3DGGA 3BJ91 2XQBH 3MOBL 5EORH 1S8DB 1N8ZB 2B8OT 4RX4D 1HHKA 4NZTH 2N7AA 5B8CB 1QG3A 5JDSA 5AAWA 1CGSH 3B8YA 1FBIH 1EO8H 2VR5A 2ZCHH 3QCUL 3L9RB 1EAJA 4OCYH 4POUB 5DSCA 3S34H 4R4ND 3UTTA 3L9RA 4IBLT 2XTJD 1NUGA 2ZUWA 4L4VA 5IHZA 3BH9B 3WS6A 3BKYH 4JY4A 5E9DB 5JO5B 3QB7C 1QACA 2AJUL 4JFZH 2B4CL 1ZGLA 5FO7B 1BF8A 2QQLH 3BZDA 3K2MC 4V1DE 1MHPL 4OZHF 2YK1H 2HJLA 1A1NA 4MDJA 2OXGA 3MR9A 5GGSY 4F80A 3JWDL 4PJBA 3WNNA 4PJBB 3G08B 4M61B 2H2SC 4MQ7A 5CEZD 3BZ4B 5HI3D 1L9NA 1K8DA 4IHOA 1MCRA 4WU7B 2UZIH 3HRPA 4HKJA 3T0ED 4N90E 4CU7A 1DQML 1KYOJ 2C5DC 3QEUB 4OJFL 4LLQB 1CBVL 4P46D 1KIRA 1B0GA 2AK1H 3OG6B 2FX8H 4M02A 5C3LD 3MRIA 4G6FD 4KDWA 4NN7C 4YDLC 2YWZA 1DL7L 2BY3A 2GTWA 2RAMA 5EUOE 1ZAGA 1OT2A 5E8OA 1S7WB 2QSQA 4WTZG 5DD1H 1DBJL 3BH8B 5C0CE 4Y4KD 1MRFL 5EC2A 2LE9A 4TTDC 1EFXA 2IPUK 4XBEH 4GKSB 4NBZB 4Q9QL 4FXLA 5EU6E 4R96B 1R5IB 5KSVA 1XGUA 1KJ3H 1UZ8A 4QXWA 1C1EH 5GXBB 3MNVA 2NZ9C 5I1EH 5ESQA 3CX5K 5T3XE 3DWTA 2K1MA 1F4AA 1X5XA 3X3FH 5ISZA 5F9WC 4U6YB 4M4RA 1U3HA 3MGOB 4Y1AD 4LLUB 5LVEA 5D72H 1B6UA 4U1KB 1IJ9A 2F5AL 1XR8A 4YDKH 1UWXH 3STLA 2GJJA 5BW7A 2PXYB 3HG1D 3FQNA 3MUGA 3HZMA 4XHJC 5CBEB 3EDJA 1JRHL 4E5XB 3STLB 2X4OB 3B2UC 1MWAL 5D71L 5EZOL 1P4LB 2FEEI 4H25A 5DSCB 2W0FA 5DUBA 1YNKH 1A4KA 1P4LA 5IB5B 1QR1A 4EXKA 2D31B 1QSZA 2B4CC 2RB8A 3L3HB 2RR3A 4DVRL 3PDOA 4ZFFB 3CPLB 5J8OA 3GI8L 1J0IA 4J3WA 2JK5A 1P5UA 4ZODA 3QG7L 5IG7A 1OB1A 2UY7A 4IIQB 4TUKL 3DMMD 1S7QA 1T0NA 3ULVF 5IJKA 5AD0B 5MERA 4DGVH 4LVOC 3Q0HA 4HZAA 1VGEH 3MRHB 3U0PB 5ADOL 1S7XA 5CGYC 1DBBL 2D4FA 4QRQA 4RISL 4XVUD 4WFFD 1T5XB 3GMQA 3ZT6A 3BEVB 2VLMD 2HFFA 1KYOK 4RMRA 2FX7L 4XP5L 4HWNA 1TXKA 2WBWB 3BPLB 3PWPE 3DURB 4I5BA 4X7EC 1NLBL 2D9CA 2JB6A 2V7HA 3TV3L 4JVPA 5EBGA 3TNMA 4IMLB 4D0DA 2WK2A 5T1LB 2EIZA 3SKOA 4XWOD 3V4UL 2XY2A 2YRLA 5EBWB 2GK0B 5IB2B 2EE3A 4QYOA 3PWJB 5C0IB 4PRIB 5EU7E 3U7WL 1L0QA 4KHXH 1ITBB 4CW1B 5I15L 1H3XA 3BDYH 4PRIA 5J12B 4WTWA 2ITDB 4X5WA 4MJ5B 4N0CC 4JKMA 4OZFA 1X9QA 3BPCB 2F53A 2QHLA 5EG6C 5L7XH 1ZVSB 2NCMA 3I02B 3BW9B 4HUWA 2NY6B 4XC1L 1PZUB 1RSFA 3HB3C 1UVQB 4K9EH 15C8L 4GKSA 3PWVB 4FABL 4JLRB 4EN3A 3MRLB 1A6AB 3L3IA 1KULA 2P43B 4JQVA 4R3SA 5I76A 3UYRL 1MFAH 2HTLD 4KV5E 4OZGF 5CSZB 4ZUTA 1FZMA 4P4KD 4KK9C 3K80A 3KHOA 4O2EA 1YJDC 4OCRL 2IQAB 2IFFH 2O5XL 3VJ6B 3H9HA 4Y2OA 2GT9B 3V6OE 3O6FC 5CCKL 2EICA 3A6CH 1N8ZA 2I27N 2CDEA 5FV1L 4JPKL 2NY7H 1YNTA 2XRAL 4HFUH 1X5AA 3NMEA 1V3JA 4M5ZL 4S1DD 4BFIA 5FF6A 4R2GD 3DV4A 5DTFB 2QQNH 1I9IH 2EIBA 3BN9D 5IMOA 1RU9L 3HZMB 4RGNB 3OB0K 2V6HA 1TETL 2YKLH 2HA1A 4C59B 1MCOH 3PL6B 4IRJD 4Z5RB 4UV7L 4XXCA 2Q1EA 5FUOL 4FFYL 1CXIA 1OGAE 2DM3A 4JFYB 4LARH 4LCWB 4MDJB 3GMRB 3RGHA 3R4DA 3ILQD 1JI2A 1R3LA 2QQKL 5KSUA 4FQPA 1EO7A 5F1IB 5BV7L 3ME0A 2A74A 2VLJA 1NUDA 1P9MA 1OTSD 1F4HA 4JQXC 4FQXB 3G08A 4YBLC 2DI7A 5HHOE 2X1PA 4JKPH 5IMMA 3W9EA 1CVRA 2WSKA 3HE7B 5F7HA 3PE9A 4LSRH 3ULVH 3T4YA 3DIFB 5DGRA 3I6LE 1DLHA 4P2RA 5GSVB 1B90A 2XYCA 3F5WB 2BERA 4NO2A 5HVHC 5K9OB 3MMEB 2CPCA 4HC1H 5IBTL 1DLHB 3EYSL 1X4XA 2OLDA 1BD2E 1J8HA 2JF1A 5IM7B 5TFSL 1UB5B 2VOTA 4A6YL 2X4SA 4N8VG 2F54E 1IZKA 1A3RL 1CDGA 1S9WB 3C60D 4W4OA 3EHBC 3VFVB 1H5BA 2I60H 5JMOC 2IEPA 5JHLL 4GAGL 3VWJA 3CH8A 2PO6D 2F53B 3VG0H 3HTLX 1ZT1A 2CRYA 2BNRD 5C08A 4U6HB 5CEZH 1MH5A 3BXNB 5EU6B 2AV7B 4UT9H 3VXUB 3OJMB 3QUYC 2OK0H 3PGDB 3KR3H 5T1MB 2BSRA 5DJAA 5ISZE 4OGAD 2BP3A 5BV7C 2AK4E 1TCRB 5GRVL 5CSZA 1I3RA 5C0DA 1MRDH 1CS6A 4BFGA 1FV1A 5D9SB 1ZT4B 2NX5E 3P73A 3OV6A 1MQ8A 4U6YA 1RZKL 5D9SA 4QEGA 2YEZB 1G6RA 4Z95L 3BP5B 1KEML 1RZJC 5EU5A 3FQUA 4J6RL 1MCIA 1UZ6E 2UUDK 4DWHA 4Y4HD 5HPOA 1EJOH 3KPSE 4P99A 5SWZD 3MUGB 3Q6GL 5JIHA 1B4JL 3SQOH 3OGOE 4KK6D 4JO4L 4JCLA 3GMPA 3MBEA 5FAAA 1MI5D 2D03H 2E7HA 5ALBH 4RNRA 5E4EC 1B2WL 3V4VH 1QFWH 2R2BA 4LFHD 2A6JA 1AQKL 3UTTE 4G8GE 3NFSL 1A6WL 4URTB 4F7MA 1QRNE 1F11B 3AXLB 3V0VB 3O9WD 4X4YA 1QFOA 4P2OD 4PS4L 3SO5A 5HBBA 3K46A 2H6PA 2XQYG 1HSAB 2I9LA 1P2CB 4O00A 2XPGA 3OJDB 2VDRL 3VRJA 4HUNB 1HSAA 2CJUH 1B9ZA 4F9PA 4QF1A 2VLLA 2XKNA 1TTGA 1P7QB 3GMQB 2VDNH 3BUYB 4EIZC 3OJ2C 2F9BT 4GMTL 1ZGLP 3RTQD 2V7HB 1M05B 5J4MA 2R56L 2FD6H 4LVNC 5CILH 1GHFH 2BK8A 4JFDA 3P2TA 1UCTA 2EE2A 5DZLA 3U7YL 2V5RA 3RVUD 1P7HL 5IVXE 3VXRA 3TT3H 5LQBH 4U6VL 3UYPA 2WUBL 2K3TA 4JFPA 3ALXA 3VE0B 1HYRC 4ZUWA 2GJZA 5D7IE 4OI7A 4HS3A 4NHCL 4P2CG 3X11B 4MJ5A 3C5JA 2OL3A 4XNZC 3LZFL 3ZSSA 2W65B 4NQDE 2ICCA 1NFDF 1BF2A 1WIPA 1YNLL 2YA1A 4HUWB 4JQIH 2W65A 3QUXA 4ODUA 4PLJC 4KQ3H 3GI9H 1T03H 5FO9A 3DSFH 1QBLL 1NBYB 1QBMH 3LN5A 4PGEB 2JE8A 3LMJH 1BFOA 1IM9D 1KJ2H 32C2B 1IGTB 1L0YA 3KJ4C 4AIZA 1T2XA 5I1DB 1GH7A 3IDMA 4AMKH 3FB7A 1XGPA 4KQ4L 3MLWL 4WI3A 4RGNE 3INUL 5DI8B 2J2ZA 1GZQB 1QPXA 3X12B 1QBML 1JTTA 3G6JE 4R0LC 2H9GA 5JLZB 3QG6A 3BAEL 3S98A 4NN7B 5D1XD 3NIGF 5DUPL 3V5HB 4Q7DA 3LQZA 4Z7VE 4JQIL 2HG5B 1YN6A 5B39A 2AEQL 3LQZB 3LZFH 4MMZC 1AY1H 3VXMD 3ARSA 3EFFB 1CDJA 2BDNH 4PRBA 4NHCH 3O11A 4G8IA 4LSDA 2UWEB 1A6ZA 1G84A 4YPGA 1XH3B 2YN5A 4U6VH 3RL1B 2W07A 2H1PL 1DUZA 1HCVA 3TT3L 3CFEA 4PB9H 2IH3B 1KJ2B 2DWEA 1E4JA 3D85D 3P77A 1H8OA 1NGWB 3CVIL 4YEEA 1WJ3A 2HKHL 2R56H 4Z78A 3NBNA 1U8PB 4OFYD 3VWKA 5IMMB 1KLFA 4JN2A 3P4NB 3SDAB 3MA9H 4R9HA 5DEGA 2BVUA 3B2VH 5T5FH 2NZIA 1JPFB 2Q20A 3FT3A 3DECA 1YPZF 2WWMD 3EGSB 4YWGH 3MYZA 4PJHE 5GQBA 4N1HB 3PWPA 2HRPL 2D7PA 5HHMD 5J1SC 1RUPL 3BVNB 4PS4H 2C26A 3IF1A 4IDJH 1IT9L 2LVEA 2NY4D 2H32A 5KSAD 1MFBL 1N26A 3LPGA 1IEAB 2IQ9H 1A6WH 4BUGA 1IEAA 3H9ZA 1UKQA 4PB0L 4XHQA 4YAQA 3BYYA 3QQ9D 3V4VL 1B2WH 4X6CB 3H9SB 1BX2B 1E4KC 1FG9C 3WV0A 3SQOL 3Q6GH 5H37H 1EJOL 4DAGL 2R23B 4Z7NF 1KIUA 1Y6NR 3CVHB 3V5DB 1KNOA 4JFQB 5BVPL 4Z95H 2GAZA 2GTZA 1VFBA 1TCRA 4GG6E 1NEZB 3QDMD 1DBKL 3U30C 3F7RA 3ZKXC 4Q6YA 4LLMA 3OKNB 2R2HA 1HSBA 1N0LA 5C6TH 2L4OA 5C0AA 3CLEH 3BGAA 3G5VA 1GZQA 2CDGA 3N50A 5EBLB 3UC0H 3OR6A 2AJ3A 4ISVB 5ANME 5BO1H 1CZ8L 2P7TA 3QG6B 2DQJL 5JW5B 2CGRH 3TBSA 3C5ZC 2BVQB 3MRBB 3FB8A 3JVGA 3GHBL 4WU5B 1UEMA 4DZBA 5TF1L 1YEDB 3DI2B 2BVOA 1FAKT 2I60L 4DZBB 1FNSL 1OTUC 1ZKAA 3ULVD 4ZSOA 3OKKA 3ZKQD 1HNFA 1WC7A 3SPVA 5INDA 5GS1B 4LSPL 3EKCA 4CMMA 1PD6A 3LKPA 4W6WB 3T4AB 4F9LA 5IBTH 5C3TA 1NCBH 2D7MA 4I48B 2XG5A 1CE6B 4QF1B 4TNWF 2O26U 2KDGA 4UV4L 3UBXI 1V7NH 4MSWA 3OKOA 4C54A 1HWGB 3KDMB 1A6TA 2VLKA 1YECL 5H94B 3WO3B 1RUAH 5KS9B 4GLRI 4GW1B 4JG1H 1FL3B 3D0LA 1G9ML 3U48A 5ALCL 1N5YL 3TESA 3QISA 2X4QA 3RVVD 4UDTA 4PJ8B 4QHKJ 3TBTB 3KPMB 5HGAB 4FN0A 5EOTA 4MX7A 4OD1L 2EH8L 4YC2C 5CS7A 4B0MM 4OI8A 2IBBA 3BPOB 3F7VB 4U1JB 5EOTB 2JIXB 3NZHH 4QWWC 1U58B 1U3YA 1CGYA 4LARL 1PYWB 4CN4A 3KXFB 4M03A 4LNVA 5H8DA 4UOJA 3LKOA 4LOUC 3X11A 5DQJA 3LQMA 2BVYA 3FCTB 1F02I 2VDMH 1ZSDA 4OLEA 2XI9A 4XP1H 1IGIH 3I9GH 3O3DA 3ZL4L 1C5DA 3NFPA 3H7LA 4WV1C 1D5BA 4HUKB 4YK4B 1RU9H 4JZJA 5KANI 1U8KA 2QQNL 3LOWA 1AO7B 3DUSB 3ZKSD 3ARGB 4GRLD 4M8VA 3NIGE 4I18A 2XRAH 2O61A 2VXTH 2FIRT 4JPKH 5IEHA 32C2A 1FCGA 4IMKA 2YSSB 4PJGA 4P4RA 4YBLB 5GS2D 3HPJB 5CCKH 2JELH 3EOBB 3H6JA 1I8KB 3NN8B 4N0FB 4FQJH 4HWBH 2IFFL 2O5XH 2VIRB 2I25N 3QFJA 2OXHA 5CBAB 1MJJB 3ULSA 4M6ML 3D2UA 5KW9H 3Q1SH 3BO8A 4QHLB 1MFAL 4B41A 4NDMB 1XGTB 3UO1L 3OGCB 4WUKL 3IFPA 4MLSA 4FABH 3AVEA 1UJ3B 2R0ZH 4WCYH 1XGTA 1N6UA 1DJSA 1U8HB 5GZNC 4KMTH 2WV3A 2HG5A 3AGVA 2OTWB 5L9DH 1I1FB 1AKJB 5DJDB 4MD5A 3D39B 4IMKC 5D5MF 1YN7B 4KHXL 3G5XB 3U7WH 5CGYD 4RIRA 2VZ3A 3MJ9L 2MQCA 1FO0A 3SKJH 4FTVB 3PF2A 3UPAA 3RVTC 2IMMA 5BS0A 4GKZB 1DSFH 3DX8B 3JUYA 4CMMB 4Q9RH 1QSED 4WNQA 4PLKC 1I7RA 1BWMA 3U0TA 3VGHA 1U8LA 4HG4J 3QPXL 4R90H 2XTJE 5A3ID 5JUEL 3PQYB 2Z8VC 2OTUA 4MAYB 2ICEA 1G7PA 4OD2B 3WFCH 2VLKB 5EPMA 4HGMA 4WW2A 1FIGH 3FB5A 4U31A 5BRZA 4RFEA 3GNMH 1Q8MA 4P23D 2ZUUA 2ZSVB 5ADOH 3JSSA 3DTXA 3A6OA 2OSLA 1MHCA 2FLBT 3BPNC 1DEEA 4RGOL 4U1JA 4X8XA 3IF1B 2A1WH 2NY5L 5CP7A 4NCDA 3MFGB 1I7TB 4KC3B 3GI8H 5DFTA 3M45A 1MAMH 2W9EL 3QIWB 3LV3B 4YQXL 1A3LL 1JWMA 1P6FA 4BZ2H 5IQ7H 3QZWG 2M8XA 1JWMB 3AREC 5D5ME 4Z7VF 3D9AL 5FXCH 3ARFA 3M8OH 2LAGB 2X40A 2V2TA 2F5AH 4JFQA 2V2TB 1JMXA 4HXBL 2HFGH 5HDQL 1EERB 2DQIL 3OX8A 4JRXE 1JPGA 3X13A 3TPKA 4Z7OE 4PY8J 5DD6A 1E28B 3AM8C 3SDXA 4EBQH 4CJ1A 4OI9A 3VDBA 3SDDC 1UZ8B 5HHQA 1C5BH 4PIRF 1BOYA 5F96H 5JW5A 1KN4H 4WFHE 3ZHLA 1JV5A 3QRGL 1K3IA 3OAYH 3VD5A 4NSKA 4WUUA 3L3GA 3FB8B 1MFCH 2X9YA 1F3RB 1FCCA 2KUTA 1EZVX 1U91B 4HWBA 2GEEA 4Z7NE 1RVFH 5CD5D 4UTAL 3OG4B 2AEIT 1Q9OA 2VISA 4PJXE 2EXYD 4LCWD 4TYUA 1P1ZB 4PJBF 3O2WL 1D5IH 3C8DA 3VD9A 2R4SH 1ZA3B 4U1NB 4K3HA 5FYKL 3TO2A 3P4OA 3F7YB 4YHIA 3HMWL 4JPVL 1ZTXH 3IDJB 2X1WL 2GJ6E 2PKDA 3CFBB 3KPRA 4ELMA 4N5ED 2DI8A 3VCLB 4FQXD 2J4WL 1JCKA 3KPRB 2HJLB 3K7UA 4FP8L 1TIUA 2YBRB 1DFBH 4F33B 4ODVL 1KUMA 3U2SA 5DRXB 2NQCA 4PJ8A 1FP5A 4QHKI 2ARJA 3RIFK 3NA4A 4Y16A 1Y18B 4MA3A 4GXUM 2BHYA 4BFBD 1BEYH 5KSBF 3FO0H 3IAPA 2A73B 2CD0A 5F72S 4QRSA 3HNSL 4LGRB 5D7JA 2YK1L 1V3LA 1MHPH 1DFBL 5D7JB 2WANA 5IIEB 2WINB 4D0DB 4J4PD 4JPVH 3HMWH 4YHZL 2GK0A 3O2WH 4ONOA 3UPRA 2P4AB 4OCYL 3WNPA 2G5RA 4LGSB 4JZJB 3FO1A 1IGYB 4GAFB 3ARFB 1FBIL 2RJMA 4PGBB 1KEGL 2J6EA 4RGMB 2NTFA 3QO1B 3HNVH 4UTAH 3AREB 5CMAA 4NZTL 3SKNA 5EORL 1NDGA 3MOBH 4JEGB 4QRRB 4E41E 3DO7A 2XFXA 2VABB 5CINL 2LVCA 3QEQA 3T3PE 1WWBX 3BGFB 4PJDE 3QRGH 5C6WH 1QLFA 4BA8A 3MGTA 1J88A 1KN4L 1FL5B 4P49A 4IOFD 4RZCB 5F7WC 4E9LA 5H35A 4EUPA 3KLHD 3QXAB 2X4RA 1T1YA 3GIZH 3I84A 1C5BL 3O4LA 4G9FE 4LPXA 2P45B 3ESVF 2HT2C 3IFPB 5MI0B 4OZGE 3FT4A 4RMSA 3ROLA 1EHNA 3RL2A 4QGTA 4XCNB 2EDNA 3BHBA 1MI5B 4WFGE 4A2MA 1NC2B 3OZ9H 2AJVL 5AWNH 4HXBH 4I3SH 5LXGL 5IROA 5FGCE 1QYGH 1IQWH 3EDDA 5JHDE 1UM4L 1BQSA 5FF6B 5HDOA 4U1LB 3DETC 4WW2C 5IJVB 1K4DB 3M8OL 2XT1B 4XVUC 5GGTH 5J7CC 1URLA 3CFCL 4RFNB 3NCEB 3BRFA 1NFDE 2G60H 1CFTB 3IS0X 2XN9E 2R0LL 4TUJB 4JVWA 4NWTL 2Q8AL 3CVHH 4GSDH 1BAFL 4BZ2L 5IQ7L 2W9DL 2J8UE 2DL9A 2WZPD 2W9EH 4AG4L 1ORSA 4AT6A 2LU7A 1MAML 1QLRA 1FFPA 5I18H 1L0XA 3QNZB 5FKPA 2A1WL 2NY5H 2HAZA 5TQ2L 3J8F7 4DOHB 1OW0C 4L4VD 1YPZE 1CD9B 3QEGL 5KN5B 4PD4K 1JNHA 1PKOA 1A47A 2EDRA 3X3GL 4HXAL 3P11L 3MV9A 4GRWB 5EFIA 2EDQA 2KQMA 3PXJA 1HHHA 3GNML 4P3DB 2C7UA 2G2RA 4ZXBA 1J86A 3CSBA 1GC1C 3WFCL 3D3VE 4HPOL 4O4YL 4K7PY 2X70A 3C6SB 4KU1A 2R9HC 2L7UA 2VO5A 5EZIL 1SJXA 1ZOXA 4I3RH 2VZSA 4XH2B 3T0EB 1C5CH 1XAUA 3MRIB 5FM8A 1I9RH 2YD4A 4OZGB 4KRNA 1YEJL 3SKJL 2VAAA 4JGJA 3A6BL 4ODTH 3IXTA 4GW5A 1FZOA 2VDPL 5GRYA 4F57H 2R2CA 4OBRA 1NPUA 1FZOB 4XNXH 5I1KH 4YHOL 2HVJA 4HIJA 3RHWK 4FZ8L 4HJGA 2F8VA 3WXVH 5CP3H 4PGJA 4Q9BA 4Y4KC 4QRRE 4KMTL 1A5FL 3RDTC 5DHYB 3GSNH 4WCYL 1TQBC 2DTML 1OP5H 3NGBC 1J87A 3QUMA 2HMID 3PGDA 3QHZL 4WUKH 3RWGB 5IHBA 5F7LB 5DHYA 4R4FH 5TDPB 2QR0A 4JFEE 2DS4A 4PJXF 4EUPB 1NCUA 4PRAB 4MQSB 3Q1SL 4M6MH 4WY7H 4Y4KA 3FHQA 1HXYB 1FQ9C 2EECA 1LEGB 1ORQB 5FA4A 5MEOB 4V2CB 3CLFL 2XZCL 3FZUC 5DWUH 1X6NA 1S8DA 2F5BH 5FM4A 1YEIH 3TYFA 3NCMA 4K7PH 3FTGB 1C08B 2Z93A 1VPOH 4D9LH 3G6AB 2CUMA 2Z93B 4OFDA 3H8NA 4W6XB 2OP4L 4NUGL 3ZL4H 1HDMB 1IAOB 5LWYL 1J1XL 4ELMB 3TIEB 1YEFL 2VDML 4U3CA 2FR4B 4K7PX 4YGAB 1IAOA 1MIMH 1BJ8A 5D7IA 5DJ6A 5IVXF 1EV2E 1IC1A 2J8OA 4LSSH 4X8JB 3QNZA 1WIUA 4NNXA 4KJYA 5D1QC 4OLWH 3T65A 1IAMA 2FDBP 1OD9A 2IH1A 1S3KH 2PTTB 4MDIB 4X98A 4XCYA 5MERB 4PR5A 1Q9LA 3T0EC 3T65B 1FNEB 2WP3T 3G6JB 4NO5A 4YO0A 3D25A 3R8BB 3KNBA 3VFMA 4EDWH 4PV8B 3FOMB 4C56E 4N0RA 2F54A 5A2IH 3IFNH 3QQ9C 4EUPG 3MUY1 5EFIB 4GRWE 3BP6A 1N5YH 5ALCH 4HC1A 5FOBB 4X80H 1YECH 5EIIB 2B1AH 2WINA 1S9VB 1PKQE 1SYSA 3KLAB 4YE4L 3CFJA 3C60B 2G75B 1RZJL 5EBMA 2MTPA 4ZAKA 1YYLH 2ENYA 2FHBA 3PV6B 3BWUC 2BMKA 4LVEA 1RK1A 1RJLA 3DRQB 4ELKA 1U3HC 1ZVHA 3HR6A 2BMKB 3E2HC 3VXSA 2X4TA 3BMVA 1BQHA 3MRCA 3MSPA 4JO2L 5I8EA 1DLFH 2NY3D 2UZXB 2MMXA 2VKXA 3NCCB 5F3BA 3O3BB 3GHBH 1NMBL 2ADIA 4M6OH 3PIQA 3QEQB 3WFEH 2DLIA 3QUMH 1BQLH 2FX9L 4Y88A 3S37X 4NO0D 4G6AD 5BO1L 5A16B 4RFNC 4U2YA 3VGDA 4WO4A 1XZ0B 4HS8H 2O5ZH 4RBPH 4Y2DA 1BFOB 3VXNA 4KMQA 3CLEL 2MCPH 4IEFB 5C6TL 4JANA 1NGYB 2CLVB 1DBKH 3BP5A 4P4KB 1QRKA 4JO1H 2CQVA 2DQUH 4EVNB 4J1UB 3QH3B 2NYYC 3S4SB 1PG7W 1I1YB 2EDLA 5JR1L 5MEQB 1I9EA 2A9NH 4J3VA 3BGFC 1TZHA 2P49B 2JJWA 2R1XB 1QR1B 3GBMH 5HD8C 3GJFK 3V95A 1T0MB 1YPZA 4ODXB 5DJZB 1A6ZB 5F71A 2JK5B 3GK8L 1MFBH 4HIXH 4DOHE 2G5BA 1MEXL 1INEH 1RUPH 4NFCA 2F8OA 3VFWA 4IRJB 4NC0B 1CE1L 2HRPH 3MRHA 3ZYJA 3IETA 1P7QA 1MELA 2VLJB 3RKDC 5DK0B 4YHML 3TN0B 3GSXB 4YNYA 2EEAA 4ZXBB 4R0LB 4MD4B 3B2VL 3L3DB 2XXCB 3GSXA 3RGVB 2EYTB 4GG6A 4I5BB 2V9RA 3BT2H 4OZHE 3RDTD 2Y6SC 4BFEA 5F7FA 3U36B 2C1OB 3B9KD 4X4XA 5DJYB 1SQ2N 1SYSB 3E6FB 3HN3A 3WCYA 4HIIB 1TZIB 3EBAA 4PB9L 3P30L 2YPLE 3C8KA 5KOVC 4BJLA 4NQXA 3O2DA 4GW5B 2IAMB 2EDJA 1WV7T 2D7TL 1AO7D 4R4NC 4ZD3H 2ICES 5FYKU 4P2RD 5L2KD 5IB4B 1ZVYA 1KIQA 2AEQH 3IU4H 4XCFH 1OCWL 2EDEA 1Q1JL 4M7JL 4OGXL 3QRFM 1IKNC 1GGUA 1L4IA 3UCRA 2A0LD 2R2EB 5F7DA 3F7PC 4OZIF 5C08B 5C0NC 1F4YL 3TCLA 3RNKB 5BVJA 4P5MB 1CFQB 3LN5B 1BLNB 5EOQL 3UMTA 1M6OA 3MCKA 3G5ZA 1E4XI 1CD0A 1I8MB 4JRYA 1F4XL 2M2DA 3ES6B 3CFKB 3INUH 1ZXQA 4JG0L 1I8MA 3B5GA 4KQ4H 3T3ME 1SM3L 2A9MH 1SMOA 3MRMA 3P9LA 1FVCB 3V7AG 3BX7C 4QT5B 1PLGL 5TDOB 5F1SA 5FCUH 1D9KC 4M93B 1KJ2L 1AKJD 1KSRA 3LMJL 1UH3A 2YEZA 2HJFB 3OXSB 3JV6A 2AJ3B 3ARQA 2BNQA 3ULUF 3QJFB 3HZKA 1T03L 5J3HC 3GI9L 2JB5L 2BRRL 1FFNB 1P69B 1HZHL 3ALPA 1YNLH 2FSEA 4G9FB 3TO4B 5I1AA 1DVFD 1HDMA 4CVXB 1BD2D 1WLHA 3C5SA 2Q6WB 4LF3A 2JJUA 2EDBA 3DX9B 2F8XC 4JN1L 3L5WB 4JM2F 3FONB 4PJIA 4XT1C 1JHLH 1KCUH 1T0MA 3EYFA 5B4MD 3RU8L 1QVOA 5GS1A 4WRLA 4OF0A 4TTDD 3MBED 5EULV 1H3UA 1UCBL 2VE6A 2IH1B 5KSUB 5EU7C 1MCPL 2V5SA 2IAND 1S5HA 1KCSL 3CD4A 3NABH 4ORZC 3RVWD 5C2BL 4QNPF 4JFXA 4TPRH 1A9BB 3P4NA 2HTKD 2RIKA 5JZ7D 1P53A 2YN3A 3TN0A 3QIWC 4GFTB 4GW1A 1A9BA 3BJLA 3E6HA 4JFEB 1JPFA 4GMTH 3CUPA 2DLFH 5D7LE 4UDTB 1VESA 5HGHA 2VDNL 1LEKB 1MY7A 1T1WB 5EIQA 5GZOC 2VLRA 2VN7A 4PJAE 2ZUXA 4IJ3C 4DTGL 3QDJE 2VDRH 4U0RB 5JXEC 3ULUE 1CWVA 3BP4B 3SHSA 2FRGP 4JFFA 1CLYH 4OFIA 1R6VA 2A77L 4NFBA 3RNQB 2YC1A 1S9KC 4YIQB 4OLVL 1ZLSH 1BM3L 3RWJB 1A7PH 3VXSB 3O6KL 1PZ5B 1AQKH 3T3MF 5E5MA 1QFWL 1HH6A 4XTRC 3VFNA 4QXTB 5F3HB 1FHGA 3PIQB 1AXSB 2F19L 1EO5A 2MFNA 3VXRD 2F74B 1CIUA 3KPRE 1V7MH 2VSCA 1FRGL 3CCHB 2ICWI 1BHGA 3CVHA 1MCSA 3QCTL 4WO4B 3O45A 2E7LA 3ZDYF 1KELH 1LNUA 4ZS7L 2GUOB 4OTXL 3WHE0 2NY6D 3QUXD 1OPGH 2IPKA 4X6CE 4EDXA 2FGZA 3LKQB 3P9LB 5FYJL 4YHLL 5C0RL 4EDXB 3HE7C 4HGWA 2QADC 2R69L 3GMMB 3R1GH 3RZCA 3BISA 5FECA 3KHQA 4FQXC 5IWLC 5IW6B 1GAFL 1R3KB 4JM4L 3ZE0F 5GPRA 1OAUL 4K3JL 1NGXB 1YC8A 4MJ6A 2OZ4A 1AO7E 5MP6L 5KS9F 4QKXB 4GAGH 1YEEL 2R1YA 3QXWA 1YN7A 2A6DB 4HKXB 5D7LA 3OKEA 5INDB 3F62A 2NY2C 3EOAA 1P6AB 5CJ8A 2NXZD 3V7MA 4X4YB 4FS0A 4KK8D 4NPYB 4HULB 3MA7B 1HQ4A 1U9KA 4NQEB 1Z0NA 1T3FB 2V2XB 5BS0B 5I1GH 4H1LB 2P42B 3LD8B 5D8JH 1P2CA 1CE6A 1IGFH 2HKFL 5JXED 5F6HJ 3WLWC 1I7RB 4DKAA 5IEKB 1UB6A 1WGOA 3GRWA 4WVRA 4LSRL 4HKBB 2PUQT 3BIKA 3FQWA 5GS2H 2DKMA 1U42A 5FGRA 1F4WH 1AC0A 1NANH 2C3GA 1UEYA 2CKBH 2EYTA 4JKPL 1CDUA 4FTVE 5HGAA 4S1RH 4UILL 3D18B 2YMXL 3O6FB 3DHJA 5K9KB 3FQTA 3MXVL 4O2CA 2DYPB 4XBPA 3QDGD 4X6EB 4ZUSB 1UQSA 3IJSB 5BV7H 5I1CL 1G7JA 4YH6A 5E2TL 5IESH 4GBXC 2ADJA 2ICWA 3FT2A 4PJ8C 2FBJH 5F9JA 4AM0B 3VXQB 1QRNA 5DDHA 1JNJA 1LP9B 4HS3B 4UV7H 2H2PC 3BESR 4NQCA 4G80B 3ARGD 1KIQB 2NY6C 4JRXD 1JF1A 1F6AA 2E8ZA 4NQCB 5DMYA 3EAKA 1I7UB 2DLGA 1CG9A 3UJIH 4MXVF 4JFHD 1R5WB 4X0KA 2CLRA 2XV6B 3CDYA 1XCTB 1Q9WB 1EVUA 4MZ3A 2ARWA 2OZ4L 2FECL 4BKLB 2OCFD 4RA3A 2Z35B 3EOYG 4N0FA 1EAPB 5EN2A 4KTDL 4KK9D 4R7NB 4P3CL 5MHSE 3QIBA 4B5EA 2HMIC 1ZLWH 5ELIA 4M43H 4YR6A 4YJZL 3C2SA 5JHDB 1D5MA 3TH3T 4K3EL 5CGMA 1ZA6B 4U6TA 5FGCB 2VL5A 3Q2CA 5A3IC 1OSPH 4JM2D 1JGUL 4K9EL 3ARXA 1EBAA 5J13B 3TO4A 4CRPA 4HLJA 1IL1B 3G9AB 3NZ8B 3EO1A 1NGXA 4L4JA 2NY0C 4Z6AT 3QNYA 2YD3A 4W6YB 3I6GB 1IL1A 3EFFA 5IK3B 4JPWH 4FNLL 1A7RH 4Y4FA 4GBXA 1RZKC 4L3ED 4ZOEA 3MZGB 4HCRH 3B43A 4Y4FB 3HR5A 5D2NE 4PJ9D 3NFNB 5HVWA 1DQJA 4HJ0C 2AJYH 2V2XA 5D96C 5C0JA 1MVUA 2NXYB 3V6FA 4E41B 1YEGL 4ZPVB 3DVNA 4QTHB 1IGJA 2BSSA 3F6IA 1TVDA 5J1AB 1QSFE 4Z78B 2EH7L 2XKUA 4X6DB 3DUUB 3QXTA 3FQWB 3FOLA 3E6HB 4JFEA 2UWEF 5FYLH 3IFLL 3ARVA 3NH7H 1T1WA 3K0WA 3CSYB 2XQYK 6CGTA 3TBTA 3L5XH 4QOKA 2MPAH 4Z7UF 5F1NB 5K9KA 4DGIL 5E2VL 4RWYL 3ARWA 2QLVB 4MA3B 1QQDA 2YXMA 1VCAA 4C55A 4DGVL 2BY1A 3DPBA 4JHWL 3V7AE 5CIPH 4PRPA 2CO6B 2R8SH 1Q72H 1WIOA 1QO3B 1SEQL 3LB6C 5HYJB 3QEUA 3L1OH 4MB3A 4DVRH 1ZS8B 2I5YL 5DC4B 3LRSA 2XZAH 3UTSA 1HH6B 3OKLA 1MCJA 3KVQA 4XVJL 1ZT7A 1BP3B 4ZFOL 4NP4L 3GMNB 5I74C 1AR2A 4NJAL 5TH2B 3SDXF 5D71H 2DBJA 2AK4B 4NQVB 3ZE0E 3LQAC 1JWUB 5KSAC 3RAJH 5C0ND 3SBWA 4ZXBC 4W68A 3VFTA 1G1CA 4PJDF 4K94L 4YDLB 4LLVB 3SKMA 5LAXA 3HI1A 3W0WE 2YD5A 3X3FL 1KCRL 1DUYA 3EOBA 4MA1C 4X6CF 1V05A 4KK8C 4H5SA 1QLFB 1CDIA 3P0YL 4GRLA 1BZ7A 4NYLA 5JDJA 1F58H 2EEDA 5HYSA 5A2KH 3RWIB 4HS6B 5TDNB 2R9HD 4OIAA 3LCYA 5ESQB 3L3GB 4Q9QH 2OL3H 2FJGB 3NCFB 3T1FA 1MRFH 1AD9A 3PWUB 5E8DH 1YEDA 4NCC2 2NPLX 4LLUA 3F7QA 5DD1L 1GIGH 3D3VA 2E7BA 3FRUB 4PG2A 1MREL 1NQBA 4LEOA 4OM1L 3WSQL 4FFZL 3ARRA 2DOCA 3I3BA 3N1MC 4P4KC 3L95A 3MPCA 3OXRA 1MPAL 1SY6A 3ZKND 1I3UA 4B53A 3QYCA 3CAFA 1FC1A 3GSNA 4X83A 5IB5A 3RWHB 3TIDB 4ODWB 3Q3GA 2MJWA 4G42B 5JW3L 1S7VA 3CPLA 4L8CB 3KYKL 4FTVD 1CLOL 4XNZB 2ZCLH 3JTSA 1DQMH 4LRNL 4MJ2A 2FO4B 2B1HL 1U8JB 3L3KA 4QRTA 1FL3A 5GGUB 3ZKMC 3QIUD 4LAQH 3THML 4P9MH 1MCKA 3N0PB 4HJJH 4X7CC 2Q7YB 1JNHB 1HHIA 4F3FA 1AI1L 1EZVY 3REWB 1QSEA 1NCWH 1JYVA 1HHIB 4P23C 3CMGA 1VSCA 4LKCB 4IHOB 2C7UB 2G2RB 3VFGL 4DEPC 3MV8A 5CHNA 4ZO7A 4LVNB 2YD8A 3E8UL 4PRPB 3TNNA 3ZO0A 3WJJA 4Q74A 1JF5A 1N2RB 2XN9D 1GGIL 1I7TA 4FXKA 3ECBB 1VA9A 2B20A 3E1F1 5H37G 4H8WL 4PJ5A 5LJYH 3O3DB 3IVKA 4PY8I 4HEPG 5TE6L 1ZT7B 5KANG 4QRRD 5MEPA 5FO8B 3IVKB 1KN2H 1S7WA 4YUEL 2P8MB 4OF7A 5EDXA 4TVPE 5A2FA 1X4ZA 5CJXA 1FZJB 2EC9T 1ZVSA 5DUML 4J3SA 4ENED 3RX8A 4BH8B 1OP5K 1D5ZA 1F3DJ 3LAFA 3FKUS 3IDXL 4LASL 5D93B 4HJ0D 5C0BD 5LCVL 4LPYA 4U0QB 4DN4H 3HMXH 1W72B 1NFDA 2X05A 3ROOB 2Z31A 4HUXB 4KI5F 3IDXH 1LP9E 4O5LH 5SX5K 1JMZA 3CU7A 3GSOB 1P4BL 3OPZH 1LDPL 4R8WL 4QLRA 3T1FB 5DUMH 12E8H 4UB0H 3VXUE 4XAKE 3MCLL 1QSFB 3VI4F 1O5DT 1QFUH 5DEFA 1U91A 4BFIB 2P46B 3QUZD 2IGFL 4MWFA 1KN2L 4GQ9H 4PLOB 3QUYB 1YQVL 3TPUA 4XRCB 1N59B 5F21B 5EUOA 3OXRB 5D70L 5JO5A 3O6MH 4YFEA 4RDQG 1BQUA 2P5ED 4U1NA 2LU4A 4LOUD 4L4VB 2XWBA 5EA0H 1EXUB 3RIAF 5SWSB 1FL6B 5IVZA 4U6XA 4Y4HC 1A1MA 2Z0BA 4LCWA 4ZNEA 4V1DA 3U46B 1U8JA 3L3KB 1TQBB 3W0WD 4NQDB 4QXGH 1UENA 2VR9A 2Y23A 3RDTB 1NBQA 5DHVH 3U2SB 5EIVA 3CMOL 1FNEA 5HHNA 4KXZI 3DTXB 1NMAL 4G8GB 5J9PB 5GRVK 1PQZA 1AI1H 5D2LE 4ESKA 4OF3A 1MLBA 4JDTL 1MHCB 4WIQA 5F6IC 5HVHB 5I17A 3NTCH 4MHHI 2Z9TA 2X4UA 2ZCLL 4LRNH 1AXTH 1BMGA 4PJ8D 4ZDHA 3S7GA 2X44D 1GGCL 4KZEH 3EJZC 2LQRA 3EJJX 3LEVL 4QRPD 1AGDA 4OZIA 1TDQA 5FOJA 4AZ8A 4EJ1C 4PJ5B 3PWJA 1MPAH 3K74B 3BQUB 3DRQA 1OAQH 1Q0YL 4JKLA 1LO4L 3OKDB 4NRYA 4OZFB 5I6XC 4J4PA 4P59L 3QI9D 3UBXB 3MJ7B 4Y16C 3VWJB 4ZYKB 5C0CA 3I50H 1IVLA 3HLAA 1MH5B 3GSWB 1KLUA 2OL3L 5C0CB 5LBSH 3UZEA 3ARED 3C9NB 1ONQA 1YY8A 4JPIB