5E2WH

Anti-tau at8 fab with triply phosphorylated tau peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
208
Chain Sequence
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGSLVWGQGTLVTVSAASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords AT8 LIGHT CHAIN
total genus 47
structure length 208
sequence length 214
ec nomenclature
pdb deposition date 2015-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e2wH01
4HS3A 3O3DA 2CJUL 3GBMH 1JIBA 1F4YL 2H8PA 4MD4B 1VERA 1QRND 1F6LL 5EIVA 1UQSA 2PF6A 1TJIH 4M6OL 2EC9T 5DVOA 5I8OL 5I1HL 1EGJL 3OG6B 5BMFL 3DXAD 4YDVB 2VDQH 1U8HB 2DF3A 1KCVH 3GNML 2BVQA 4E41B 3VD5A 5CJ8A 3DSFH 3P77B 3WNOA 1YEJH 3BN3B 4W4OA 4GW5A 4JPKL 1RIVH 3G5XA 3DTXA 4Q6IC 1A1NB 1QHPA 2R1XA 4R7DA 1UYWL 4ODUA 5ESQB 4DTGL 1SJHB 3IDGB 5JO5B 2NY1B 3MRFA 5AZEH 3LN4B 1VEMA 3PGCB 2NXYB 3PL6B 2DWDB 5D4QA 4TVPD 2EDOA 2B1HL 3KLAA 1NGWA 1FC2D 4OZGE 4LP5A 2YRLA 2R0WH 1V7NH 3GSWA 2Y07L 5GJTL 2DQEL 5T1MA 2A77H 3FL7A 4NN5C 2VJXA 1Q9WA 1FLRH 1YZZA 5I1LB 1RHHA 1RMFH 3WFBL 1BQLL 4JQXC 4M62L 2QSVA 3HMXH 2AV7B 3O6KL 2C1OA 5T1LA 4BFBD 5GISL 3DETC 1WZKA 2DL2A 3IDMA 2XN9A 4GBXD 3SDCC 4C4KT 4DN3H 3BKML 4YLQT 2NW2B 5ENWA 5TQ2L 5JPMB 5MHSE 2BVPB 2EECA 3WDJA 2APTA 2N7AA 1UC6A 4XMKL 4XMPH 2NY0D 1FVCB 3FQWB 1U3ZA 1IKNA 1IC4L 4HFWB 4QF1A 5IMOA 3MRPA 4EOWL 3SBWC 2GCYB 3S5LB 2WP3T 3FT3A 5GGSY 3ZMRA 5IWLA 4KMTL 4QNPE 3C60A 3IKCB 2QBWA 1WT5C 1P4IH 2YMXH 5C0JB 3WS3B 3BH8A 4W70A 2VLLA 1A6UL 4FFWC 4UTBH 5D6DC 4EQ2A 1QO3A 3FN0L 4TPRL 3VWKB 5I76A 1NSNL 1CQKA 15C8H 4L9LA 4MS8D 3U4BL 3F6LA 3FQUB 3FT2B 4PJBB 3CU7A 5B38B 4LHUB 5DEGB 3DX6B 1UH4A 5SX5K 4WJ5A 5K9JH 4LIQE 1CF8L 3PABB 4G7YL 3BP6A 3WJJA 4N8VB 2DQUL 3WBDA 7FABH 5KSBA 3T2PA 1CTNA 3P4NB 3QWRD 1WZMA 2EDXA 2HYMA 1Y6KR 4LSSL 3V0AC 3EJZD 3VCLB 1MJ8H 3V6ZB 1CDJA 4JG1L 4G8FB 5IB3B 2J8UF 4JFEE 2XWBB 3H3BC 4TSBH 4LVOB 4XNQB 4NGHH 2PXYC 3L3KB 4ORGB 1MAML 4F3FB 1KSRA 1NGXA 1IJ9A 3AY4A 2BVQB 4XI5D 4E9LA 4PJBA 4JN2A 3D85A 2F19L 1TZHB 5E6YA 4PB0L 3MV9A 1MLBA 2XY1A 2P5WD 5CMAB 2AK1H 1S7VB 4HH8A 5HJ3B 1FVDB 1FG9C 4IM8A 2YA2A 3GSOA 1P7KA 3QUYA 4Q97A 3DX9A 3HG1D 2VIRB 5SWZA 3O3DB 2IAMC 4HPOH 1A4KB 3NAAH 1Q72H 4ONFH 3GSVA 1RIHH 5KVFL 1FNSH 3DGGB 4CL7A 2RGSA 1ZT1B 5I30L 1LP9F 4PJ8C 4AIOA 5J0BA 5DJDA 1OLLA 3S96A 3IB4A 4MB3A 3PNWA 3TBWA 1BQHA 3BXNA 3IDNA 1LO2L 2QSCH 3O6FC 4XPFL 3ELAT 3QO0B 4JY5L 5IEKB 4LLYB 1AGBB 4PBWD 3QPQD 1NMCB 5DYOA 5D2NB 3U79A 3L3DA 4DZ8B 3P4OB 4YQXH 4R7DB 4RMQA 3FFDA 4X6CA 5K9KB 2NYYD 1QBBA 2XFXA 4G9DA 4ZS7H 1PEWA 4YXHH 4OZGA 1SM3H 2F54A 2DQFA 3EO1A 4WFGE 2NZ9D 2VR4A 4FQCH 1GGYA 1TQCB 5IMKB 4J3OC 1TDQA 2BFVH 2W60A 2X09A 4YHZL 1T5WB 4HKJB 2UZYB 4EXPX 1GPOH 3QSKB 2C4FT 5E9DE 4R7NA 5DUBA 4HIJA 3SQBA 4JM2A 1DBBL 1B2WL 2YPLE 3UDWA 5ETUA 3U46A 5IQ9B 1I3GL 3LQAH 3P9MA 5JW4N 3KDMA 4FXGB 3BKCL 2GITB 4X6FA 1P84K 5HHMD 4OV5A 1NDMB 3EO9L 4FQXD 1IBGH 3FAWA 5D7LA 2B7DT 2AKRA 1YNTA 4MNQA 4L1DA 3B8SA 4H1LH 2UWEF 4PRDA 1OW0C 1BGXL 4A6YH 4WO4B 2WBKA 5E5RB 2EYRB 2IGFL 1K6QH 4XB7A 4QGTA 4WI5A 4ZO7A 5BCAA 2NXZB 1HYSD 1XGRB 4PGCA 4QGYA 4P2QB 3KYMB 1OP3K 2VXQH 4GG6F 2FEDC 4YFDB 4WHYG 3VFOA 2BC4B 4X5XA 1JUFA 3E1F1 1JBJA 2BHUA 1UADC 4S0SD 1I3UA 1AXSA 4KJPC 3QNYA 1VEPA 1E4XL 4PJXE 5SX4H 4LU5H 5D71L 1VPOH 3HE7C 1WC7A 2FJHA 3FONA 3H3KA 3NCJH 2AJXL 4D0DA 2XACC 1QPXA 4TTDD 2DQDH 5CEXB 1SVCP 4PJAA 1U93A 2X1WL 1PYWA 4MNHB 2XZQL 4U1IA 4IJ3B 3HR5A 4KQ3L 4N0YH 3RJQB 2V17H 4C56A 4C58B 5FYKU 2EEAA 1CICC 5DHYB 2NY4B 3D39A 4NQEE 5DK2B 3S35L 1MF2H 2X4RB 5FO9A 3TBVA 1K2DB 4NFDA 3GI9H 4WFFE 5D2NA 1KEGL 1QSEA 3TZVD 3UO1L 1N2RB 4GW4B 3BKMH 4G8IB 3L7EA 1FE8L 4JFDE 1Q0XH 4EI5D 1ZHLA 1V5JA 1YEDA 2FB4L 3S7GA 1EEZB 2D31B 5EU4A 5C08E 4QOKB 3RRQA 1OM3H 4ZFGH 2GYSA 2ADFH 1P1ZB 4EOWH 2LV4A 3MV8E 3DI3B 4TSAL 2AEQL 4P59L 5IFAH 2M1KA 2GSGB 1XIWB 4O2EB 4RFNC 1LWRA 4XCNA 2YPVL 4XZUB 2HJLA 1CLZH 3DIFA 1JYVA 1I9IH 3IJSA 3TIDB 2R15A 3O41B 1T1WB 3W9EB 5IHLB 3O3EA 2IH3A 4I9WE 5D9SA 4DCQA 3V7AE 2VDLH 4DTGH 4HUKB 1LEIB 4JEGB 5FECA 2VE6A 1YQ2A 3D85D 3WHXA 4PJDB 2A1WL 2PW2B 3SKJH 4U1SB 1SBSH 3DBXB 4B41A 1KJ3L 3QUZD 4MNQB 1UM5H 4G8IA 3VXRB 3WN5C 4L8DB 4S0TD 4U1NA 4KJPD 4JQVC 3L9RA 1RZGB 5DXWA 4CKVX 5T3ZE 1IGIL 3D6GA 3VXTA 3ROLB 3QNXA 1Y6NR 2EXYC 3UTSE 4N1CA 5T5NG 3GMPB 2QSQA 3ES6B 4F7PA 3QI9D 4MJ5A 4U1MB 1YJDL 4EQ3A 2EDTA 1ACZA 1Q1JL 2RFXB 4OF8A 5FUOH 1MFDH 4URTB 1DUZA 4KV5E 4K3JL 3GJFK 4QRRE 3S37X 3EJZC 2BNRB 5L2KE 2GFBB 5D1XC 4PP1C 2HFEA 3B9KD 5FUCE 3U0WL 1OP5K 3T0BA 3BW9B 1WV7T 1BX2B 4F7MA 2WWKO 1CXLA 3VGDA 2KDGA 5E2TH 1CBVL 2OK0L 1V3LA 1N59A 1IEAB 1LO4L 2Z8SA 3VH8B 2ZCHH 2B1AH 5TDOB 4U1LB 3OKKB 4ZFFA 4P2RD 4GUPA 1LP9A 3GSNL 3QCVH 2JJWA 2LTQB 4JFPB 4NZDA 3MXWL 5BJTB 3H2WA 5JOFA 5KS9A 1TENA 1BQHB 4KAQH 2CXKA 5L0QB 4WCYL 1DBMH 2CKBB 3MGOB 4NM4L 4TQEH 5DMGD 3ZKND 1WLHA 4HK3J 3VFNA 3RWIA 1HE7A 1JP5A 4PJGB 4JHWH 4Q0XH 4P46C 3PL6D 2X2YA 5GS0C 4EBQH 3D3VB 4PG9A 5FDWB 1YYLH 4H20H 2VDKH 3W5NA 2J2ZA 5GXBB 3DMMC 3MJ8A 4XVSL 4MA8H 4Y8AA 1LK2B 4OCWL 4P48A 2NY4D 3HZKB 2MNUA 1JHTA 5IUSA 3MRRA 2IALA 5DMYA 3CFJB 3WEXB 2JE8A 4YUEL 1QLFB 2W60B 1F4AA 4Z77A 1IVLA 3IFPB 5IF0A 3DROB 5IK3A 1J87A 4OLXH 3ARBB 5CKAA 4P9MH 5DA0B 3UC0H 5E56A 1OAZH 4Y5XB 3LPFA 3CFDB 4WFFD 3RVTD 1UVQB 1NFDE 4NQDA 1RD6A 5C7XH 1HH9A 3H9SA 1FCCA 3SO3C 2NY5L 3HC0A 1VESA 1X4XA 5KSBB 2AV1B 2ERJC 3LOWA 4DZBB 1OSZA 1ADQA 3LRHA 1UQSB 5JNYB 2CJUH 3X13A 3NCYP 5H8DA 1A02N 1C5BH 3QIUA 4LEXH 1M7XA 3Q6FB 1E27A 2IJ0C 1RZ8B 3VFTA 3QFJD 3RWJB 1QVOB 4LFHG 4R26L 5C0CD 2HJFB 3BQUD 1EERB 4NWTH 4D94A 4H26B 4PRNA 1D5BB 5CEZL 2FIRT 5I66B 3OJ2C 1RZFH 1JPSH 3E6FB 2I07B 2YPLB 2VB5A 4K7PX 1M05B 4OSUL 1J1PH 3LKRA 4PJ9D 3TZVC 4ENED 1BMGA 3KPLB 4RAUB 5D71H 1EJOL 1AE6H 5JA9A 4OGXH 1MI5E 1NUFA 1DQDH 1I75A 4XCYA 3DVGB 2C3VB 4Y1AD 1OTUD 5FM8A 3KJ4C 4RAVA 3TT3L 3HUJA 4HUMB 1WIOA 1UWEL 3RUGB 5ISZD 2B5IC 4NHUB 3ZTJG 1YYMH 3CZFA 5F70A 4AM0B 2PO6B 3ZYOA 4JFFD 1F8TH 4LEOB 5FO7B 1YEKH 1T0PB 1FO0B 1M7DB 3BH9B 4QXUH 2Y25A 1AJ7H 2A6KA 4O02L 5F71A 2V5RA 4TVPE 4WO4D 3TYGL 1Q0XL 5ISZE 4PJAF 3ALXA 3SHSA 4YGAB 2LAGB 4MD0B 2A74B 3FMGL 3SY0A 3IS1X 1N4XL 3X3FH 1DFBH 3E3QE 3L1OL 4UT6L 2PKDA 2GTWB 3KPRB 3RWFA 5HGAB 1KCUH 4JDVB 3BN9C 2XKNB 4FFZH 4ODSH 4RGOH 1HQ4B 4MA7L 4XGZB 4Y4KB 2EXWC 3S36L 4RGND 2DMKA 3O2DH 4OKVA 5D7SL 5I2IB 3CK0H 5FUZH 4ACPA 4P5TD 2B39A 4IDJL 1N3NB 1KJMB 4KWUA 5MERB 4YEFA 1I7RB 5CAYB 5CEZD 5IJVB 3WSQH 3NFNA 4PGDB 4OF7A 3FQNB 2XA3A 5E2VH 2DYPA 5I18L 3O2DA 1R3KB 3MLYL 1CG9A 1XR8B 4KK8C 4JO4H 4NP4H 2EE2A 4OIBA 4WFHD 5T33L 5SWSE 4NO2A 2X41A 3RZCD 1QSFE 5GRYA 2BMKA 3UTQB 5IVXF 3KAAA 4O9HL 3CFEA 3MFFB 2R2BB 4CUCA 5TGBA 4V1DB 3WIHA 2O5ZH 5D2NC 3EZ8A 1YEHL 1CF8H 4WENB 4F8QA 3TZVB 1I8KB 4TUOB 1XGPB 4HUUA 4PJCF 2OMBA 1JGEB 1IGTA 4G6AC 4QRPB 1JF1B 4J8RB 3RDTC 1A6TB 1OTSC 3K80A 2BSED 3A6BL 4LSQH 3BRFA 1EGJH 5DRNA 1NCCH 3TYFA 2A6IB 4FTVD 3VXQA 2VERN 3KPSB 4L4VD 4J1UA 4NO0D 1I85C 4GJTB 4RAVB 5EU6B 2A73B 1XF5A 2UYLB 3DX9B 4X6DA 3QA3B 4JHZA 5AYQA 1CYGA 4M61B 3MNZB 2Y7QA 2NX5D 2YRZA 3SDDD 3D87B 1G6RA 1HKLL 4XHJD 1VEOA 2CO7B 3MYJB 3HNVH 4WV1A 3DVNB 2QLVB 4J3VA 4X98A 4I0PA 2H6PA 1UGNA 3C2SA 5EU5A 3V5KA 5JTWA 1IM3B 4O58L 5BO1H 4UT9L 2DWEB 1NL0L 2Z31B 2X4PA 1HCFX 4HUUB 1J1OH 1PAMA 1I7UB 3P4NA 5JDJA 2HMIC 4CVZA 5C2BH 2YC1B 4MNGB 5D96C 2I27N 3MRNB 3NTCL 3WFCL 2P44B 1MCDA 1JZ8A 1EO5A 4P23D 3MACH 5HHPB 3MRMB 4MXWH 3E8UH 4GBXA 4KVNH 1LEGB 1TCRB 2ZSWB 4G6ML 1UA6L 1IM3A 2GQHA 1HDMB 3SDYL 3T1FA 4YZFE 5SWQA 5D6DA 4K55A 3P73B 3MBEA 4CN4A 5KVEH 2FJGA 1MCOL 3QG7L 1G9NL 3UTZB 1QNZH 1OAYH 1T03H 2Z92B 2VAAB 4JG0H 2MOVA 2Z8WC 4HCRA 4HIXL 4HZAA 4PTUB 4Z7WB 1JYNA 4HIEB 5KJRH 3FO9A 3IETB 3VFVB 1NANI 5CWSA 5IHUL 4YXLL 2EIZA 4HAGA 1WBXA 3BYTA 5DFTA 1E4XI 1BLNA 4JY5H 1MAKA 5D7IE 1ACYL 4RBPH 1JFQH 3N1MC 4RA3A 2C9AA 5C08A 4EI6B 5C09B 4JLRB 3FO2B 3ALWA 2ZUQC 3UJTL 1SM3L 4OD3H 1WEJH 5CZVH 1OTUC 1KPVB 1JVKA 2JCCA 5F7LB 2NY6B 4XAKD 2GJZA 3U0TB 1WBXB 4P46A 1VFBB 4K7PH 2WBJA 3MRBB 3B2VH 1M7IA 2VISA 2K1MA 4JM2D 2ENSA 5DK0A 4RWHA 3OZ9H 3MJ6A 1MQ8A 2NY7H 1A3LH 2O93L 3ROOB 3T4AB 4F7CA 5I17A 1INDH 3TO2A 1TJGH 3MGAA 2R56L 2VR9A 4N0UA 2NXYD 2MCPL 2VAAA 4X8XA 4ZNCD 4PUBL 3FO2A 4ORGA 1I1AD 1GJIA 5JW3H 5TE4L 4HG4K 2E9WA 1KB5B 5HDOA 3TT3H 5KSAA 3O6ML 5MEQB 3DECA 1YNLL 2YPLA 1RU9L 1UXWA 2OI9B 2VH5H 2ZUWA 1A9EA 4UIKL 1UWXK 3VXSB 3D69A 5D1XB 3ZSTA 43CAA 1FNSL 1BM3L 3Q6GH 1MCQA 5DEFA 3ZHLA 1A7NH 2NR6D 3HTLX 5JW4R 1G9ML 4FQ2H 4H25B 4AZ8A 1DBJH 2H2PC 1H3PH 1RK0A 1DQLL 5IB4A 4XNYH 1UCBH 3G6AA 2CSPA 3NH7H 4K7FB 5IQ7L 5ANME 4PRHE 3PJSA 2CDGA 5CZVL 5GIRA 5HI5C 3RBGA 3ZHKA 4W4NA 1I1AC 4I2XA 3ZDXF 2EE3A 2B4CL 1OT1A 3SE8H 3BSZH 2ICCA 2G60H 4FFVD 4MA7H 4DW2H 4GG8B 3BEWB 2E9BA 2X10A 1H3WM 5J12C 1TIUA 1U2CA 2AI0H 1EAPA 5HHVL 4BH8B 5LAXB 5KVMC 4HLZG 4R7NB 2C4XA 3V4UL 1JRHI 5KZCB 2YK1H 2VDRL 4PJIB 3WSQL 4NRZA 3G5VA 5E6ID 2IH1A 1MNUL 4AEHH 4OZHB 5CCKH 4Y19B 4OLUH 3IDIB 1G9EA 3KWWB 3NPSB 1T20A 3AREB 2QQNH 1AGCB 1YY8A 1S9YB 3BZFA 3VGGA 2BZDA 5E08L 1C08B 3AU1A 3ZE1F 2IC2A 3FQXA 4K3GA 1OWWA 5GRZA 1ZA6B 1RIUH 4LNRB 1AIFA 1R6VA 1CDCA 1HHKB 2AJUL 4NN6C 3G04A 3FJTA 4M7LT 5AD0A 4UDUA 3UPAA 1DEEA 4Z7UA 2HWZL 4Y16C 4QLRA 1TITA 3P0GB 4Q9RH 4FQJH 3WFHB 4YPGA 2FWOB 5JMOC 3RWHB 5K9QG 2A9NL 4JHBA 2Z91A 4QHNA 2LABA 1N8ZA 2IPUG 5T5FL 3U7WL 2Y6SC 2HFTA 4M1DL 5C9JA 4PJ5B 2FNBA 4XWGH 3ROOA 1T7WA 3T4AA 4KK9D 1JMZA 5C07A 3JXAA 5DK0B 1MCFA 4LVNC 4JAMA 5F88B 2LVEA 35C8H 5FIEA 3OBAA 1FORH 3WD5H 5GRWA 4N8VG 4Z0XA 4EI5B 4FABH 1EHXA 1YEIL 5HDQL 4U3HA 2X9YA 2Y5TA 3EO9H 3ETBF 4JY4A 5IGXH 4X7CC 4LQ1A 5E6IB 3PG2A 4EI6A 4UU9B 3UTOA 3NGBB 3WJLA 2X4UA 4P4RA 4UQ2B 2WW8A 5HD8D 5F9JA 4LLVB 2A1WH 5DD0L 5EUOF 3DOSA 1A7RL 3O11B 1JK8A 5T1KA 4OD2B 1A8JH 1M4KA 2DYPB 2XA8L 3IT8D 3CCHA 5IFJB 4JM4H 3ZDZE 3FRPA 4LCUA 1EMTL 3IDXH 4Z7VF 5H94A 1HKFA 2CDGB 4P2QE 3GKWH 1UB5B 1DUYA 4X6CE 5T33H 4YDIL 3OQ3B 2V5YA 3RWGA 4S1RL 3LHPH 1NMBH 1MCJA 2EKSA 5C0RL 4NWUH 3IJHB 4Y5VC 3WDHA 3ABZA 4CVXA 2WUBL 5J11B 3UTSA 3KLHC 3VGAB 1UJ3A 2ADIB 3KR3L 3NA9H 3VU2A 4LSDA 1S3KH 1A3QA 1KJ2L 3CCHB 1NEZA 5A2KH 4ZOBA 2X9WA 4H8WL 4EN3B 2DLEA 3JTTB 1K8DB 2NY0B 1MCRA 1GAFH 1BOYA 4QRRA 3SE9L 5TQ0L 1D5XB 3L3IB 3LEYH 3QJFB 4GO6B 3KPPB 2YZ1A 4DJMA 4UTAH 2B0SL 2EO9A 2IQ9H 1G6RL 4FQHA 4HPYH 3QEHB 1AFVH 1XF5B 5TE6H 4AH2B 3DUHA 1KNOB 5INCA 3E2HC 4G9FE 4HGMA 4KZDL 1VGKB 4LRIC 4ODTL 1C1EL 4M7KH 4FQPA 4LLUA 3DXAB 3EYQD 3DO7B 4UV4H 2QV2A 2EDFA 3V7MA 4D8PB 4YWGL 4KKLD 4HT1L 5ILTL 2R4RH 3NCCB 3GMOA 2QSCL 2WM0A 4U1KB 4OBSA 3ULVC 4IIQC 3W5MA 3I2CL 5IEKA 3MRHB 2IH1B 1IQDA 2Y23A 1DBAH 4Y16A 3V5DA 1YQVH 4ZQKB 2VDKL 5E70A 1CFVH 3PIQB 4QRQA 4QXTA 3WIHL 2CR3A 3ARZA 4LCCC 4JFYA 1K9TA 1KCSL 4HUXA 3OB0H 4ZUSB 5K93A 2Q6WA 5CJQH 2Z4QA 3EYSH 5E8NB 1MSPA 1VGEH 3RJDA 1RZIA 4E42B 3L3GA 4IOFC 2WQRA 4JR9H 4YUEH 4OLYH 4NCC2 2FSEA 4V1DD 5SV4A 1YEGL 1DLHA 3L3JB 2AEPL 4KROC 3KS0H 4Y4FB 3FOMA 4P2RB 1GPOL 1KIUA 4X5WB 5M94B 4OLWL 4BSWB 1J12A 1QFUH 5F1IB 2I25N 1T7VA 3BKJL 2V9TA 5JUEL 4EVNA 3PHOB 4JFQB 1N64H 4O2CA 1JGUL 3BJ91 4UV4L 5D1QD 4ERSH 5HXMA 4XAWH 4NC0B 4PJ8D 2BJML 3QEQA 1G7JA 3LKQA 1N8ZB 3TFKC 2XNAA 4PJHE 3QDME 1YJDC 4CVZB 4Y4FD 5MP6H 4Y16B 1OAKL 2Z8RA 4FQXA 4TOYH 4OF5A 1XZ0B 2NZIA 4LNVA 3VG0L 3RVWD 1NCBH 4X9FA 1OT2A 1RUAH 1ROWA 2G5RA 3G6JF 3QZWA 4RGNC 1Z0NA 1HINL 2Q6WB 2YPKB 4R3SA 4KXZH 3CDGA 1HQ4A 1MQKH 1K3ZA 4KU1A 5DLMH 1AE6L 1KIRB 3U36A 3SCMD 3SN6N 1GXEA 4DVBA 1GGCH 3VXUE 1I3RA 2PTTB 2NLJB 2IAMD 3GM0A 5I6XB 5INCB 3AM8C 1YMHA 3T09A 4XCYB 1L7TL 4PBXA 4KK9C 1KCKA 3TFKD 1A14L 5ICXB 4Q9QH 3I50H 3RVUC 1CICA 4J4PA 1AHWC 3F58H 5GRJL 2F54E 1BAFL 2DQDL 5E8OB 1U41A 3A6CH 3B43A 1RZ7L 3TA3C 5DR5H 1D5IH 1T20B 2YEZB 4PLJC 5IG7B 5D8JL 2VH5L 4YDJB 3WLWC 1JZ7A 5GS0L 2NCMA 3I75B 3UTSB 3GJFA 4JO1H 2FDBP 4EDWL 4UV7H 2E27L 3QYCA 4X6BB 1NCBL 5T1DL 2VE6B 2A77L 1J9CT 3VXSE 2VDQL 3DRTA 3QJHB 2HMID 4QTHA 3LIZL 2A83B 5DMKA 1B0WA 5E4IA 5FUZL 3GMRA 5IESH 2J6EL 3SDXB 2ZG3A 2WK2A 5DJCA 2EEDA 4R2GC 1HXYB 2X6MA 4O5LL 1BFOA 3WL9B 2EEBA 1ND0A 2VABB 3AXLA 3V4VL 3CSBA 3EGSB 5D7LE 4PJDF 4Y2OA 3ZKXC 3OJDB 1FYTD 2D9QB 4RMWA 4ETQA 1ED3B 3AB0B 3PDDA 3QIWC 5BXFB 1FGVH 4D2NA 5D7IA 3GO1H 4NQDD 2YPVH 3PUCA 1R3LA 3JWDH 1I9IL 5H2BB 1CGSH 1PSKL 3EOBB 1RUKL 5IVZA 4I0PB 2H6PB 3GRWL 3FFCB 3GSNB 2DQHH 2OQJA 1S7QB 1S78C 3I3EA 5C86A 2C3XA 5DS8A 3B5GA 4NKDB 2OI9C 4UQ2A 5IB1A 3MREB 2J8UA 3L3OB 2BVOB 3K1KC 3STZA 3SQOL 4S1RH 3DMMB 3FN0H 2A6DA 4I3SL 4R96B 4LKXA 4AIZA 3IAPA 2CR6A 4CW1A 1IE5A 5I0ZA 4Z7VA 5FF6B 3SDXF 4HIIB 4NO5A 5DVLA 3DUUB 3I02B 4PLOB 1VB9A 3U0PA 2W0KA 3H0TA 3CC5A 3OAZK 1GH7A 1WGOA 4M1DH 2X89A 4K23H 4DEPB 3WS3A 1G7HA 2R69H 4PJHA 1GCFA 5FUOL 3RX8A 1Z9MA 2D7TL 4R96A 4NZUH 4YXKL 5I15H 1BF8A 3RBSA 3C60C 3D2UA 1S9KC 4S2SA 1U3HD 1NC2D 5EDXA 5GJSL 1KBGL 3WLWD 5KVEL 4GXVL 2AJZA 1K8DA 4Z7WE 2GI7A 1NFDA 2F5BH 1G0XA 4L8CA 1J8HA 3RWEB 1G9MC 4HGWB 4R90H 4XPAH 2AXHA 4QHKJ 5C71A 3MV8A 2ZG1A 3BPNC 4YHKH 2PXYA 3CDGB 5CUSH 5I19L 3CU1A 1HSBA 4AMKH 4FZEH 2W9DH 3RAJH 3REWB 4MXWL 1DR9A 2AV1A 4Y4HD 1N7MH 3QRGH 4HMCA 2J4WL 4L8DA 4POYA 3JWOH 1V05A 4D0CA 3OXSA 3P3YA 1MREL 3GMRB 1WEJL 4OM0L 4I18B 4HFUL 2W38A 5DJXB 5HVGB 4NYLA 2P7TB 4F80A 1D5ZB 1ZHBA 2DYPD 4X4XB 3A6BH 4L29A 4LPTA 3ZTNL 4JFOB 3O8XD 1T22B 5AG9A 3VXUD 1G0YR 2NY7L 4RSVA 4GFTB 4NZJA 4XVUC 4YDJA 3NFSL 3P9WB 2Z0BA 4Z7UE 2O5ZL 3OMZA 3UCRA 3GKZA 3V7AG 3MCLL 5LQBL 4APQC 1F6AB 5CIPH 2P5WE 5KW9H 2UYLA 5IF0B 5EBGA 3ESUF 2BCKB 4RIRA 1KENH 1TQBB 5D7JC 3TJHC 1CFSB 3TIDA 4Z7VB 4WI9A 4DEPC 4ODXB 4NQVA 4FP8L 4HJJH 4XHJC 3T2OA 4P2RE 4IRZL 3CVHA 1NLDL 4GRLD 1R3IL 4PJFB 4ZO6A 1RHHB 5ALBL 1UCTA 3SKUD 4UDTA 3HMXA 2B4CC 1DQTA 1QFWM 3O3AA 1DQML 3MROB 3QO1B 4IOIB 3C8KB 1FPTL 2CQVA 3AAZA 3C6LA 5F93C 1ORQB 1GOHA 1UZ6E 3M8OH 1B4JH 3ARDA 5L2KD 4R3SB 3CPLB 1OP3H 1WC7B 3BKYH 3LN4A 4XCCH 5E4EB 2VSDA 3LH2H 3MXVL 1F97A 3LMJL 2CO6B 4G7YH 3CD4A 3F62A 3VXSD 2XN9D 3QXUA 5F6IB 5IJVA 1MJUH 1EVUA 1U92A 3UP1A 1FG2B 3T2NH 2AW2A 1E4XH 4YFEA 5EUKB 1NAMA 1PQZB 1RVFL 1FZKB 3IETA 4JFQA 3BZEB 3BKJH 1FJ1B 3IDJB 3NACH 3QPXL 4OCLC 5FV2A 3Q3GA 5I6XC 3CSYA 1U8MA 3WN5A 3WDIA 5IFHH 3G08A 3WFDL 1D5ZA 1WTGT 4KRNA 5ALBH 2A9NH 4JRYB 2IFGA 1ZGLA 3EUUA 4Y4KC 4U1LA 1KCRH 2V6HA 1OAXH 2RCSH 5EUKA 5I1HH 3UTTA 4HC1L 5BRZE 3VXPB 4OI8A 3BZ4B 1V7ML 5DMKB 4HK0A 3NIDE 3LEXB 3CIQA 1OB1B 1SJVA 4NNXA 2XTLA 3IKCA 4QTHB 4TVSa 2HJLB 3DIFB 2X42A 2J8OA 5B39B 5TH2B 5LBSH 4JDTL 5B4MD 2OSLA 5CEYB 3TCLA 4F7CB 4OQTH 3DV6A 1R5WB 4TSCL 1T83C 1WK0A 5GS2H 3OKKA 4OD3L 4XVUD 1A9BB 3P4MB 8CGTA 4J1UB 2BVTA 1RURL 4KKCD 5DMIH 2NNAA 2Q3ZA 5FDWA 4HWBL 3BP5A 2COQA 2XZCL 4OD2A 3K81A 4G8GE 5E5MA 2IAND 3BPCB 4OIAA 3C5JA 1P4BH 3B2VL 1V8HA 5CSGA 4KHXL 1D9KD 4F7EB 4KK5D 4ZPVB 3O3BB 3FQTB 1K4DB 2V7HA 3MRDB 4LF3B 3PP4H 1NGYA 3RTQA 2X4OA 1XZ0A 4JFEA 1U58A 3BIBX 1JE6A 5CEYA 1MWAA 5JOEA 2J8UB 3L3OA 3MREA 5C07E 3U4AA 4PJIA 3C6LB 5B4MC 4OV6F 1CDUA 1J8KA 1PFCA 1CU4H 3ULVE 5GRVL 1D9KB 3BD4A 4P2OB 5EBMA 5ESVB 3DPBA 4E41E 4CMMB 1C5DB 1MFAH 1ZV5A 2IADB 4HD9A 1SEBA 3NCFB 1H15A 4ONGH 2MKLC 4L9DA 2BNUB 1U95B 3TNNB 4KQ4H 4KUZH 3T3ME 1E0OB 3BIAX 1MFDL 4JM4L 4BH7B 4AL8H 1T1ZB 3RL2A 2HH0H 2B2XL 3TPUB 1FJ1A 3VWKC 4KMQA 4AENB 2E7BA 3V52H 4M00A 4L8CB 5BO1L 1C08A 1X6LA 2DBLH 2P8PA 4FZ8L 4LHJB 3TNNA 5K59F 1AXTL 5JR1L 4LLWA 2FZ3A 3ZE2E 1CD9B 5L2KB 2HVKA 2D03L 1J05B 1PKQB 1FDLL 1RUML 1R24A 4P2OA 5EBMB 2WBWB 2Y5TB 3ARWA 1ES0A 4HQQL 4AK1A 1YJDH 3QWQB 1IAOB 4MWFB 5GGTH 3VGAC 2JJSC 1X7QB 4MZ2A 3HNSL 3ULVF 3OKLA 4XT1C 1IAKB 4R4FH 1CK0L 3MV01 2JCCB 3RUGA 4PJEF 4MJIB 1FFRA 4YAQA 2DI7A 2LTQC 4FQHB 2CXGA 2DICA 3J8F7 3PGFL 5IGXL 3VMPA 4NO3A 5JHDB 4J3XA 3RZCB 4P59H 3S35X 1XIWA 4O2EA 3WIIL 1AO7B 5IQ9A 3U46B 2WIMA 1L7IH 1UH2A 3NZHL 3CX2A 5EZOH 4OLZL 4U1JB 1QG3A 3DX7B 3BPCA 3VXSA 3UZEA 5LGHH 1EUUA 3DYPA 2EKJA 1T21B 3O45A 3FO0H 1YC8A 4UAOB 5J9PA 3I2CH 4JKMA 5E03A 1F4WH 4P99A 4UAOC 1UXWB 4MNQE 4WWKC 1YA5A 3L95B 1MEXL 1UJ3B 1TLKA 4KHTL 2KZ1B 3UZQA 4HWUA 1QQDB 4XWOD 1HHGA 3OKDA 4D9LH 2PW2A 3RZCA 1I9JH 3MRNA 4WIQA 4M1CD 3VRIA 3DUSB 1DVFA 4XNZB 4JJHA 4YE4H 3EYSL 4EXKA 2J7LA 5C0AA 3VXTB 2Y4SA 3HRZB 5J1SC 2ZSWA 4LSUH 4FRWA 4XPBH 1N6VA 1JWMA 5CP7B 5C0CB 1HEZB 4WV1C 5A40E 4YXHL 4JFZH 3NFPB 3T2QA 1GIGL 3X3GL 4PLNC 4PLKC 1FO0H 3W82A 1PW3A 1DLHB 2UZXB 4GG8A 3UPCA 2DQEH 5IV2A 4ZG1A 1KJ2A 1ZVHA 5TE4H 1FLRL 3CFIC 1T6WA 3VD7A 3LEYL 1AXIB 4PREB 4E5XA 4Z6AT 3JVGA 3DTXB 4HXAL 3OB8A 1T7XA 3V0VB 1K5NB 2ZSVA 4NKOB 4UIKH 1FZJA 3PDOA 4HZLB 3TA3A 3BQUC 3S36X 2UZIL 3RWCA 3OG4B 3CLFL 1X3DA 1S7UB 4EI5C 1EO7A 4N0FA 1EEUA 5FXCH 5HYQB 1GAFL 1HINH 2KBGA 1CFBA 4CMMA 2OZ4H 3WNKA 2OL3A 3QDMB 4PLKD 2Z91B 2H3NA 4JFPA 4JZOB 4CBPA 1EA9C 4Y0GA 4X7DC 2BNUA 4K3JH 3VXQB 4M5ZL 4U6VH 2WLYA 5C0CA 3CDFA 2GJZB 3T65B 3QFJB 5MEOA 2LU3A 4BZ2H 1SEBB 4FTVA 4JRYD 2JB6B 5F1NB 3T8XB 1JN6A 3GMQB 3HC3H 4GS7B 5HHVH 1U3JA 5ADPH 4YDKH 4P2OC 3RDTA 1QTYT 5FA3B 7CGTA 4FFZL 4ODSL 1H8NA 4RGOL 4BUHA 2VZ3A 2BVYA 2BNRA 2YD7A 3U30C 5BV7B 2X4NB 4JRXA 5DR5L 3QUXD 3BUYB 3VA6A 3MLPA 2W65A 3LCYA 5GS0D 2I60H 4MQ7B 3O6LL 3N1PC 1ONQA 4XC1L 1NGQL 1MJ7L 4NKDA 5HHQA 3OJVC 2E27H 5D96B 4G3YH 2R1WA 4ZOAA 1Q9KA 4PRIA 4QOKD 2BK8A 3UMTA 4PGBB 4MAYD 4PJBF 2FL5A 4LCWA 5FGRA 1WVZA 4MA8L 1BHGA 4QHUA 5EOQL 4XWGL 4K2UL 1IAKA 3T3PE 4K8RL 3BI9X 4G8GB 2NY6C 1RIHL 4JQIH 3PHSA 1E27B 1ADQH 4GMTH 3V6OC 1AGDB 3WFBH 3E3QC 3RGVD 4YHNA 4L3CB 5J13C 3X14B 2DDQH 5FOBA 4XX1G 4O51B 3KXFE 3TP4A 1VDGA 4JRXB 4PRHA 3ZKNC 3QEQD 3ARUA 3EJYC 2PW1A 4WFED 4NP4L 3MCKB 2EDHA 2VLKA 4F33B 4ZTOH 1H15B 2DWDA 2NR6C 1CFTA 3C09B 5EC1B 3ZTJH 5I17B 3DROA 2CLZA 3CH1A 4GT7A 3UXFA 4B0MM 2EDKA 4HXBH 1EBAA 1P7QB 3DSNA 3FFDB 1I8IA 1PGRB 1RUPL 5AZ2L 1UJ3C 1KC5L 2Y07H 5GJTH 4MJ4A 4NQSA 5FK9B 2FO1A 1NCAL 4DKFH 4IRJD 5JZ7D 5EG6C 1QYGL 3QCUH 5DHVA 1WZLA 3PQYE 2CMRH 1T66C 1ZLVH 3L7EB 5E0QA 2YSSB 5MENA 4WNQA 1X5KA 5DHVH 4K8RC 1PKOA 4CU6A 4P9HC 2MQCA 2AGJH 5B3JE 1R5IB 5CILH 3TIEA 1CXIA 3PV7A 5E2JA 5DVKA 2H1PH 3DMMD 2A73A 1S9WA 1VADA 4L4VB 2E9IA 5EU6D 1CS6A 3CJJA 4ODVL 5GGVH 4ZD3L 3E6HB 3LZFH 3GMLA 1QOKA 3PWUB 2C1PA 2E3VA 2HFGL 2EE9A 1IAIM 4WFGD 3G6JA 4MWFA 1PLGH 2E7LA 2YZ8A 4NRXA 4MAUH 5FCUL 1D7FA 5ERWB 3MLSL 1X4YA 3OGCA 3TN0D 1XGUB 5D5MA 3W9DA 4PJGE 4L4TE 3TIEB 2KL6A 5F9WC 4JQXA 1D6EA 1F6AA 3CK0L 2FLBT 4PJ5E 2VKXA 3STZB 4PB0H 4U1IB 4DAGH 1A6UH 1LO3H 4YHYB 2IGFH 4K94L 3GSOB 4NDMB 4KUZL 1MHPH 5AYUL 1C5CL 3H9YA 4XP6H 4ETYA 4JANB 1QD0A 4UT6H 1BVKA 1UENA 5KOMC 3KWWA 4WI3A 4RWYL 1KF9B 4PBVC 1U3HC 4JPIA 4YC2B 3U7YH 3QIUB 2L7UA 4EUPH 3NGBC 4WU5A 5F9AC 3IXTB 2C1OB 5T1LB 4BJLA 4L5FL 4NN5B 3JV6A 3EO0B 1YNTB 4HS8H 4J12A 3MXWH 1TNMA 4GSDH 4GMSH 4JREB 4UDUB 1M71B 4IOIA 5IBUG 1KCSH 1N59B 4S1DC 3TVMD 4XPFH 5F6HJ 3KPTA 1LDSA 4P2QA 3SPVB 5I1AA 4ZUVB 3BE1L 2I9TB 4HMEA 5AZEL 3QCTL 4JDVA 4IEFB 4OZ4A 5JOFB 1A6VL 3HI5H 1QBML 3BH8B 1IKFL 2R56H 1JHKL 1SEQL 4YXLH 3TH3T 3HAEG 5FHBL 1Q94A 1J7VR 4PJXF 1JTOA 2BCKA 3B6SB 1M7DA 2IPKA 3KYNB 1HYRC 2XZAH 3UYPA 2W9LA 5DUMH 2XKUA 4WV1B 4G8GD 5KSUA 2ADFL 1CICB 3CZJA 3KXFA 4XP5H 2XY2A 5JLZA 3FRPG 3FT3B 3LAFA 3QHFL 5A2FA 1PBYA 3ARFA 1N6UA 4OGYL 1RV6X 2H32B 1I3GH 4IMKC 4XBGB 4GSDL 2QEJA 2HP4A 4TTDC 3EO1B 3UYRL 4QRSB 4D9LL 1SMAA 3WFCH 2BXZA 1IGFH 4R4ND 4KUCD 3BZ4A 1DBKH 5JW4Q 4LSPL 3NPZB 2VQ1B 4IIQB 1XH3A 4DW2L 3QFJA 2NY0C 2OX5A 4KK8D 1G7MB 2LU4A 2IFFH 4GKOA 1FYTE 1A2YA 1XF1A 2VXQL 5SWZB 3Q5YA 3GSQB 4Y89A 2O5YH 4Z8FL 1AQDB 2E7MA 4M3KB 1J1OL 1LK3L 3IFLL 3EOAA 4WW1A 4LPXA 1GC1L 1XCTB 1G9NH 4MXVF 1Z5LB 2FIKB 1A1NA 2DQTH 5CGYD 1Z3GL 5C0AD 7FABL 1KLGB 1MH5B 2UUDH 2FEEI 4KKBD 2GTZB 5FUCC 1OHQA 1LO0H 5IFHL 4KMLB 1IC7H 1NFDF 5HHOD 4YHPB 4DQOH 4KVNL 5EO9B 3T4YA 3O3AB 1RUQH 3MV7A 4JO1L 4P5MA 5KSAC 4WDIB 1NFIB 5IROA 1DVFB 5IP4A 2RHEA 4YX2H 3AROA 5GHWH 3D39B 5D5MB 5DK2A 3W9DB 1OD9A 2AI0L 1J5OH 3M17A 5IESL 4Z0XB 1S8DB 4H1LG 5C0FB 1DQMH 1J88A 2BSSB 2VZSA 3U0TA 4QHUB 4ONOA 5F7UA 1DL7L 4KC3B 5I8EA 4JFXA 4DUXA 1ZHLB 2NX5B 3QPQC 1X6NA 4M7ZC 5E2WH 1IQWH 1IQDB 4YHOH 3RVXD 2C3VA 1RURH 4FNLL 1ZWIB 4XH2B 2HVJA 4O2FA 4IDJH 3VWJC 1GSMA 2R4SL 1T0MB 1GGBH 5ID0B 2ZUQB 4H0GA 2BNQB 1YEIH 3V6BR 5D1QC 2VXTL 3FB8A 4HHAB 2GCYA 3S5LA 5KSUB 4XPHH 4LASL 1PYWB 3FQUA 4XPTL 3BX7C 4HGWA 1KN4H 3TVMB 5IVZB 1RU9H 1S7SA 4Q74A 2BVPA 3O6FB 2J88H 2ATPB 4G43B 3Q6FA 3ARED 3P0VH 4EJ1C 5IHZB 4PJ9A 2GEEA 5JNYA 1BOGB 2F58L 1AHWB 3NIFE 4OCXL 1CD1B 1J10A 4I1NB 2APXA 3OAYK 5C09A 2ITCB 4HUWB 4G6JL 1OB1A 4XC3H 3BP4B 5ESAA 2I07A 6CGTA 3TNMB 1OTTC 5HI3D 3EYQC 5F1NA 2JB6A 4FG6D 3ZL4H 5C0GB 1FDLH 1RUMH 1TZGL 2FBOJ 5I71B 3L9RB 4HQQH 4LGPB 1OAXL 2WBJC 2XWTA 3STLB 2G60L 1YPZE 2IWGA 4JRYA 4L4VE 4WUKL 5EOCL 3PGCA 3HNTH 4V1DA 3ULSB 4NC1C 4HIEA 3PWVA 2ZNWA 4N0CD 1RAMA 3CXDL 4MDJB 4JFDB 3CGTA 3HI1B 1D6VH 5LGKA 5CINL 4F15C 3VW3H 3GK8L 1A6AA 2I26N 2PYFB 3MNVB 2P1YA 1NMCC 3S4SB 4OFVA 4P4KB 4C83A 4O9HH 3PGDB 4LRNL 4R97B 3OKOA 1EEYB 4PJAB 2DOCA 1U8OB 3W9EA 2H2PD 3MLRL 5DZLA 2DM2A 4ZUTB 4HUVB 1E28A 1HILB 1I4FA 3U83A 2OS7A 4PJIF 1UXSB 3C5ZC 1KXQE 5J1TC 2OYPA 5GSVA 4M1CC 1ZANL 3U4BH 3MLXL 1IGTB 1F00I 2R29H 5ITBH 3ILQC 4ZQKA 1EJOH 2BVEA 4HJGA 4OCMC 5BS0E 4NQTA 3LV3A 5I74B 4H5SA 1MRFL 1XIWD 4FQJL 1GGIH 2A6IA 4GAGH 2CGRH 3MOAL 1NGYB 3I6KB 3HRZA 4KK5C 1IL1B 2EICA 3QWOA 4HF5L 3LRSB 4N0UE 3RI5K 5KG9A 2J8UE 5C07B 1DDHB 4PJ8A 3HR5B 1S9WB 3MBXL 1XGYH 1Q1JH 2EH8L 1DLFH 2F54D 1QP1A 3HG1A 4L8BA 3QQ3A 4JO2L 3SGEH 4OLZH 2YC1A 4JZJC 1YN6B 5CJBA 4Y88A 4NHCH 1EPFA 4X99A 1I1CA 1WQVT 4LHUA 5C09D 5GZNC 1I85A 4FABL 3MUGB 3AVEA 4PY7B 2PYEA 3GK8H 1AQKH 3CMOH 3K46A 3S37H 1LDPL 2RR3A 5A2IH 3ARRA 1CGTA 2FECI 4IS6B 4GQ9L 1I8LA 3AC0A 1AIFB 3BQUA 3GI8L 4MJ6A 4XCFL 3MBEB 1LE5A 4XP4L 2VZOA 3HCVA 3OWEA 3WUWG 1P84J 4ZPTB 2MWCA 4XNQA 3JWDC 2FYYA 4TNWF 4EUPA 4NO0A 1WWBX 1MOEA 4Y5VB 4TUOA 4U33A 3RTQC 3BPOB 4Z7WA 4JGMA 1KJMA 1N3NA 5MERA 4NQDB 1U8IA 2V9QA 5CMAA 4TQEL 4ODWA 3PDGA 1OSZB 5IFAL 5FCSH 4KPHH 3GMPA 2NY5H 4L9LC 5GGRB 4HH9A 3GSUA 5ACZA 3MBED 4XBPB 4N5ED 1HNFA 1M71A 4O2FB 3ZKXB 3RVVC 3C2AH 2R1XB 4DFHA 4YBQD 2BSRB 2CLRA 1J11A 2NY1D 4YR6B 5HYIA 4QEGA 4NNPH 3KYKL 1NEUA 2CPCA 2ZCKL 1GGCL 2F53A 2R2BA 3CVHL 3KYOB 2PYED 1TMCB 4WI4A 2QJDA 4YDIH 3HAEB 1S7VA 2RB8A 1JHTB 4HS6B 1Y18A 2IPTL 1AGEB 5DRZA 3MMEB 1T1YA 1XGTA 1B0GA 1II4E 3WNNA 3DRQB 2E6QA 4I0PC 3RVXC 4JPWL 1EFXA 3TT1H 4TYUA 2QQQA 5IFJA 3MRIA 4LVNB 4XP4H 3O6LH 3IKKA 2JLLA 1DBBH 4N90E 4OGAC 3T1WA 3Q5OA 4H8WH 1KB5A 1XMWA 3QDJD 4RQQB 4HGKC 3ILPB 1H3PL 5DVNA 3WJJC 2CKBA 1W72H 3T77B 3KPSD 4YFLF 5INDB 3BH9A 5F88A 1QRKA 3TZVA 5T1KD 3NABL 2IPUK 4K9EH 4EI5A 1IKNC 4FQCL 4PJEE 1KPUB 3HPLA 3I3DA 1JZ4A 3GMNB 2XZZA 2HJKA 2W91A 1S5IH 3AY4C 1X9QA 4R4BB 3NMEA 5I0DA 1BJ1H 2VAJA 2Y36L 2AABH 3VMNA 2Y6SD 5J11C 3H42L 3IXAA 2Z35A 3R4DA 1DBKL 1MFBH 1OTSD 4LIQH 3JVGC 3SGKA 5K9JL 5C0BA 1TTFA 4RAUA 3MR9B 2YS4A 3OKEB 1RHFA 3H3PL 1LE5B 2ZOLA 4CJ0A 4L1HA 5D2LE 4JFDD 2PETA 2VZ1A 5ITFB 1BVLA 4NCC1 1BLNB 4LLUB 4L9LB 1T22A 4ZAKC 1YEJL 1MLCA 3BP5B 4OQTA 2I5YH 4RZCB 4PJ7F 3VFUA 4IOFD 4NN6B 3NIFF 5LWYH 1K4CB 2JIXB 2UZIH 2DQJL 4OZHA 3GIZH 4P23B 2XV6B 3ARFB 5GGQL 2R2CA 3TLRA 1LD9A 1NCAH 1BBJA 5GGSA 1TTUA 3FZUD 3BWAB 4NPYB 3BZFB 1WFTA 5CJOH 3QQ3B 3RZCC 4Q9RL 2FJGB 3PWLA 4OLYL 3WO4B 1KJVA 4X5LA 1AXSB 3MRKA 5D7LB 1ZTXL 3VXRA 1D5BA 4HWBA 1T3FB 3F5WB 4ZOEA 4P5TC 5I2IA 4L3CA 3MV9B 4WUKH 3GSUB 5GHWL 3KPRD 2ED7A 2DLGA 5T3XH 1RMFL 2AJSL 4Q6YA 1UJTA 3OKNA 4IBLT 1QHOA 3ZE0E 1JPST 1FFNB 3BWAA 4NPYA 1EHLL 4QHNB 2VO5A 4U3XA 3T3MF 2VLKD 3QNZA 3QQ9C 5CINH 3VW3L 3DURB 3B3IB 3MJ9L 4X9HA 1I1AB 2V2WB 5C0NC 4JFHD 3IFOB 4LBEA 4G7VL 4NO0B 3QUMB 4JN1L 5BVPH 1UEMA 1DUZB 1Q0YL 1E4KC 2DQHL 3KPSA 1FL6B 5IBTL 5ICYA 2VDOL 1A6PA 4M48H 1IM9A 3DX7A 1RULH 4X4ME 2V2TB 5AWNH 2JKXA 4JZNB 5J6HA 3S4SA 2X05A 1ZANH 5K33A 1TQCC 3QR2A 1L4IA 5GRVK 5MENE 3WNMA 4MD5B 2AQ2A 3L5JA 4QRPD 1L6XA 4XNXH 4X0KB 3U0PB 2YMXL 4M6NH 4DZ8A 1P53A 3NPSC 3D39D 2R2HA 2OXHA 2MHAA 4RISH 1OGAD 3VG9B 1PZUB 1RZFL 4A2LA 1HK6A 3OF6D 1ORQA 4AMKL 2D03H 4BFIB 2C7UA 2VLRB 4R4BA 3O4LB 4XNUL 5CJXA 25C8L 1AC0A 1LE9A 4LCIL 3MRLA 5KZCD 4GLRH 5D6CA 2ZPKH 5IBLD 3OAUH 3QUXA 1IAOA 3VMOA 1N2RA 3EYVB 4R4FL 2Y06H 4QXWA 2VISB 1QBLL 3DGCR 4ZUUB 3I6KA 5D9SB 1OAUH 3QISA 2OTUB 2AXGA 4KJYA 3FN9A 1TZGH 4LPVA 3ULUL 1FNEB 1NC2B 1X44A 4JREC 1UCBL 3NH7L 4I3RH 1MCBA 4U31A 5IQ7H 4HX1A 4LCWD 4UNVA 5CSZA 4MX7A 3QDJB 5FK9A 4PJDA 5DDHB 1Q0YH 4RIRB 3ZYZA 4TUJB 1A4JA 3DX8B 2HLAA 3CVIH 5ABDE 5FHBH 1WBYA 3MRGB 2J12B 5F7MC 4L5FH 12E8H 3D18A 3BEWA 4W81A 4P0DA 3VFSA 4J2XA 4ODUB 5ESQA 3MCKA 3O3EB 2ESVB 3ILPA 5GPRA 3DI2B 1CDBA 1QR1B 3GBLA 3NZ8A 4E0RB 5FYLH 2EH7H 1FNFA 3L7FA 5IVXE 2K7PA 2YRPA 4OGZA 3P77A 3SDAC 3CLEH 1RK0B 2EYRA 2CH8A 1Y0LB 3RHWK 4ODHL 1HXMB 5FB8B 3E8UL 5C08D 3C8HA 2C4FU 1ZA3B 2P8MB 4OZFA 1YPZF 2V5SA 4K71B 4ZAKD 2X70B 1JYXA 5FDYA 3IFOA 1MWAB 3LKOB 5F8RC 4NT6B 3EAKA 4KZDH 4WI7A 3BD3A 1QYGH 1C12B 2XPGB 4JCMA 3QIWA 2LQRA 5FO8B 1JNHB 2YR3A 4YPGB 4F7EA 1I1YA 5DF0A 4YDLB 5ILTH 4HFWA 4QF1B 1GC1C 1LO4H 4AEFA 3STBA 1I7TA 1LO3L 1QFUL 5JORA 1UKSA 1KCVL 1J8HB 3RWEA 4KY1H 3C5ZB 1KACB 3W0WE 1JGDA 3HUJB 3GSNH 4PGJA 1LO5A 5MI0C 5DURD 3PWLB 4GQ9H 1LO0L 3OR7B 1KFAL 5DFWH 1M6OB 1U36A 3B9VA 3IRZA 3UJJL 3GM8A 4UINH 2XOTA 2AP2A 3HE6A 3KPLA 3QG6A 4QHMA 5A16B 4CU7A 4B7IA 2YD8A 3W11C 3PWJA 3K2UL 4KI5D 1ZMYA 1CR9L 3BHBA 4X4YA 4GKZA 4P3CL 5IB4B 1AD9B 5JMRA 5LGJB 3M45A 5KSVA 3T65A 2BSSA 4JFFA 5L8JB 1E6JL 1FYTA 2VDMH 3IDXL 5HGHA 1ZLSL 2N4IA 3KPMA 1EO8L 2JELH 1JNHA 1J05A 2LE9A 2ZUTA 3NIDF 3WHE0 1FVEA 4O4YH 5EU6E 4NKIH 1DUYB 4OSUH 1NSNH 1SBBA 4JY4B 1QBMH 4IRJB 2XKSA 2PO6D 4I77H 2DI9A 3BZEA 3D85B 5J6HB 3U1SL 4HCRH 2I9LB 3MUJA 3PDOB 1FVDA 1BM3H 5A43C 2VDNH 4Y4KD 4KKNA 2C7UB 2VLRA 2VYRE 3QDGA 4KDTA 4LLVA 5T5NF 5D2LF 4LLMA 1H3XA 1QFWL 3MV7E 2HRPH 2R2HB 3U9PH 4XGZA 4I4WA 5F3BB 5EZIH 3QUKB 4HBQA 4TSBL 1XF2B 4UINL 2J1KA 5KVDH 1TZHA 5HVFB 1SJXA 5IR1B 5KN5B 4OCYH 2HTKC 3RVTC 1OGAA 2Q7YA 3G6JE 5SWSB 1WAAF 4JHAH 1N6QL 4G8EB 4N5UA 2GT9A 4LKCA 4GAYA 4HH9B 3KPMB 3GJFH 5DEZA 4JG0L 4D9RE 2VUYA 4QNPF 4U6HA 3MYZA 3EOTL 1A4JB 3DX8A 4PFEA 5LJYH 4Y2DB 4PJ5A 1MFNA 2NTFB 4NZTH 4KDWA 1U8NA 1HI6A 4MDJA 3V4VH 1XCQA 2CRIA 3F58L 1AR2A 1S9YA 3TV3L 5I16B 2GFBA 5CSBA 5F7YC 1OL0A 4NKIL 1NBVH 2Z93B 1ORSB 2C3GA 5C1MB 4FXKA 1OPGL 1FV1A 1VHPA 1RZJC 2QTEA 3MLUL 2AJVL 4M4RA 2P47B 3MRDA 5F89A 3TVMA 4WVRA 1I7TB 3HB3D 4P49A 5IVOA 3OR7A 1HQRA 3VXME 1AR1D 5DJYB 1CGVA 1ZA6A 2CKNA 4YO0A 4U6YA 5T1DH 4JO4L 5BZWA 3VD4A 1UZ8B 1F58L 3T2NL 2YUVA 4NZRH 4L3EB 2FO4A 4EBQL 3MV9E 1TFHA 3EW3B 4R9HA 4JRXE 3K8MA 4OZFG 1IGJB 2YUXA 3IRPX 5FGCE 4RRPA 1MFCH 4KKBC 3CX5K 4LDEB 1ZT4A 1KPUA 5ISZA 3MA9L 4A6YA 5D7JB 3O9WC 3PWPD 4L4VA 1JNLL 1MY7A 1TETH 3MLTA 1FCGA 1IC5L 1Z3GH 4L4JA 3FTGA 2P48B 3F5WA 4X9BA 5JOPE 4Z95L 1MUJB 3B4NA 3QH3A 1CN4A 3V4PH 4Q7DA 4LLDB 4UZGA 1XGRA 2Z9TA 2OZ4A 1RVFH 4ZO8A 5SV3A 4MXVE 3JSSA 2FHCA 4JO2H 4BQ8A 2X4UB 1F3DJ 2XNAB 1CZ8L 4OM1L 5F7DA 5J3HD 3C6SB 1FFNA 3NACL 5H35A 8FABB 5E00A 4DAGL 2F9BT 5HYQA 4GXVH 1GOGA 3HC4L 2FHFA 1MCSA 1TJHH 3QXTA 1EK3A 1UACH 2C3WA 1E28B 2UVEA 1HYSC 1BJMA 2B1HH 4GAJH 3CMGA 1FNLA 5F7FA 4GRLC 5F1IA 1PQZA 5IIEB 3KJ6L 3LN5B 5IBTH 1T2XA 4MX7B 1FNAA 1JMXA 5E8PB 3QXAB 1XGQB 4ZSOA 5LKNA 1HN1A 3ECBA 2FRGP 1KIQA 1HH6B 1IEHA 1VSCA 2HG5B 1P69B 1WBYB 1QSFB 1DANT 4X6CB 5K9KA 4NQXA 1WWWX 3ARVA 1BVZA 4JB9H 2X1QA 5IWLC 4L3ED 5GISH 4YNYA 3TC9A 4KRPD 3D18B 1J18A 2GJJA 4Z76B 1BZ9A 4KVCL 1F4HA 1CBVH 4X6DF 2OK0H 2VLRE 1FYTB 4Y5YB 3M1BB 5CD5C 5T3ZH 4H26A 4PRNB 2P4AB 5MHSD 4KDTC 5EO0B 4N68A 2C1PB 3OPZH 3F7QA 5EBLA 1FSKB 4TNVK 5M7QA 2XZCH 1JPTH 4GW4A 4Z0BL 1AR1C 3R0MA 3B9KB 5GS1B 1G7MA 1NGPH 5ACMA 1JPGA 3LKPA 4P2YA 3RKPA 3O2WL 2AJUH 1A4KA 4KV5F 1XFPA 3PP3K 3DYMA 3UTSD 4OTXH 4D0BA 2BVOA 2ZZUT 4JKLA 4QHLB 3EYOB 4XC3L 2PO6A 4KQ4L 1A1OB 4OF6A 1S7QA 3EOYG 5IMMA 1R3HA 3P40A 4ZFZA 4MQTB 1VGKA 2A6JB 1G7LB 1NUGA 2J4WH 3SGDH 1LNUA 1IGJA 3PV6A 5IHUH 2R4RL 3NAAL 1CFQA 4Y5VA 6FABL 2VLKB 4F33A 3GNMH 1JI1A 2HT3D 2IBZY 3SKOA 4DZBA 2VITB 4D9QE 2ZOKA 5FA4B 3I9GL 3JUZA 1BZ7B 5GGUB 3V5KB 1ZXQA 5CEZE 1AP2A 4LCYB 4XAWL 2BDNL 3PHQB 2M2DA 4XTRC 3S4SG 1CLCA 4P5TB 4BSJA 1R3HB 4ZFZB 5T3ZL 2HJFA 2HJKB 4FXLA 4G80B 1FNHA 3PP3H 4HF5H 3MUGA 4PY7A 2AXFA 2SEBB 4LSPH 5F72S 2NTSP 2X5PA 9CGTA 3ZYIA 3O0RL 5DEFB 5JXAH 5CIPA 2DQGH 4OUUA 3MRFB 5D70H 4BZ2L 1O7VA 4N8CH 5CLWA 32C2B 4JRWA 3QQ4B 1ZWIA 1CXHA 1A3LL 4MXQC 3N1GC 4C56E 5ITBL 4NT6A 3H42H 2B20A 1MI5A 2FO4B 3VRLF 5J8OA 3CNKA 3NVQA 3KVQA 3LMJH 2OR9H 1OVZA 3NOIA 3ZE1E 4BZ1L 2FD6L 1G9NC 4MDIB 1Q9KB 4PRIB 4GS7C 4Z7WF 2PR4H 3PWNB 1F13A 2JCCF 3HS0B 4TVPL 4IRJA 4KI5F 2WUBH 2FLRT 4NKQB 4PJEB 2HFEB 3GHEH 1QSFD 3RY4A 1KYOK 1LD9B 2GSIB 5EO1B 1RUQL 4RBPK 4NQXB 1YEDB 3HE6C 4XNZC 3MV7B 2G75B 3IFNL 1AGBA 1VFOA 4X9IA 2E7LC 3DVFA 2OL3H 5I1KL 2VL5A 3VXUB 3VH8A 1FG2A 2NY3B 3PQYB 3TA3D 5IOPB 1C5DA 4HJ0D 4JAMB 2JK5B 3CFBB 3B5TA 1Q9WB 4NC2B 1IGYB 1JZ6A 1UH3A 1V3JA 4HUWA 3H0TB 5JW3L 1BP3B 2YD5A 4LCCB 5DI8B 4ODWB 3IU3B 4P9HL 5F7HA 4IMKA 1GZQA 3PWVB 5EA0H 1NGZA 1A2YB 4UIMB 4H1LB 2XQYG 2R4SH 2XWTB 1P6FA 4OF3A 3S5LG 4XC1H 5EIIB 3PWPE 4DVRL 4BQ6A 2DQUH 5GGQH 3LS4L 3MJ8B 4K3EL 3U2SB 4JZNA 4D3CH 1YDPB 1HH6A 4WY7L 1IEBA 3GO1L 2Q8AL 5INDA 5D7KE 5D8JH 3QCVL 1EFXD 2H9GB 4JQVA 4NQVB 1NCDH 5EUOE 1AY1L 1JV5B 1T1YB 1UWGL 3QUYD 3BAEL 1HIMH 1UYWH 4ZUWA 2YBRA 4PD4K 2EIDA 3U48A 4QTIH 4CMHB 4ONHA 4OCSL 2VL4A 3RIFF 5EB9A 2F53D 3QDGE 3ARDC 2YPLD 4WU7A 3I6LD 1U8QB 1MLBB 1LK2A 2K9UA 4U2ZA 4WJ5B 3FB6B 5F8QC 4B5EA 5ANMA 4XNUH 3EGSA 5F1SA 4BFEA 2D2OA 2DDQL 2APVA 1JWMB 1HDMA 5CP7A 3S6CA 2GY5A 4WTXA 4LKCB 4I2XB 4HKZB 5C0AB 3RNQA 3QHZL 4P9HH 3LPGA 4ZS6C 3UJIL 5D7SH 4ZDHA 1BFSA 3FT4B 1QZ1A 3B3IA 5ISZB 3K2MC 5HYJB 5FM4A 3W0WA 4XCNB 2R1YB 3EBAA 4ZTPL 1QLEL 2NMSA 3EYUH 5KBNC 1HI6B 1NBZA 5CS7A 2HT3C 3IDYB 3AUVA 5IKCA 3GJEB 3FO1A 4LAQH 5KS9E 2YWZA 5CHNA 4LRNH 3X17A 3N85H 4BA8A 2A9MH 4LLAA 5CEXA 3KHQA 5DQDL 3MLUH 5KSAD 4U6XA 3U6RB 2YBRB 1KIPB 4F37K 1T6VN 3VFTB 5D2LB 3LPWA 2ZOKB 5FA4A 3PXHA 1EVTC 3C60B 2EDWA 2D4FA 3NCBB 4GG6A 3QXWA 5BZWB 1BOGA 2UUDK 1N5YH 3ET9F 4KVCH 5IEHB 3LDBB 5ADOH 3VA2C 4PJ7B 4V2BA 5C0AE 2VQ1A 1DN0A 5F9OH 3V79C 3IYLW 5EU7C 4RAHA 1RSFA 1CD8A 2JK5A 3CFBA 3OTTA 5D7JD 4WWKD 1T0NA 1M7IB 3RAJL 3HLAA 2IMMA 4F7PB 1ZKAA 4Y2DA 4PGCB 4XXDB 3C08L 5B21A 3KR3H 2VUOA 3RIFK 4NQCA 1GZQB 1NBZB 2HLFD 2HT4C 5HI4D 3SDDB 3DVIA 4NUJB 2GW5A 2KZWA 3AS0A 4FFYH 3O2VH 2HVKB 1MHEA 4AEIL 3MACL 3DV4B 1T7ZA 1DSFL 1W8OA 4L8SC 4LLQB 4XZUA 1UVQA 2VLMD 4DKEH 4JFXB 1G6VK 2OQJB 4KGLA 5E5MB 5F6IC 3HLAB 2PUQT 4LPCA 5IVNA 4LDOB 5J06A 5SWZE 4XP9H 1WZ1L 4U7SA 2DJUA 1EFXB 1P7QA 1U8HA 4J3SA 4LBEB 1BREA 6FABH 4P4RB 1DVFC 5AWNL 3LKSA 2Z8VC 5C2UB 4BQCA 4OD1L 1A64A 1R3KA 3FB7B 5FYJU 4ELKA 5JQ6H 5AZ2H 1X5ZA 2O26U 4RQQA 5MENB 2HG5A 3DARA 3W0WD 3N9GH 1IZJA 4RGMB 5FO9B 5JHLH 4U1GB 3IDYC 3BE1H 3V6FB 2XWBA 2X1PA 4PRID 4BK5A 4JG1H 4P3CH 4ZTOL 3PHQA 5GGRA 3G9AB 4F9PA 5D1QA 4NNYB 5GGUA 3VWKD 5L8KB 1L6ZA 1CD1A 4Q58C 3KLSA 2Q76A 4M7ZB 3G5YA 5F3HB 1HHGB 2YA0A 4WWID 5IW6B 4JVPA 3W0WB 2WINA 2Q86A 2DJ4A 4LPYA 5I1JH 1VGEL 4ODTH 4YQXL 3O6FA 4KRMB 1WSST 3RTQB 1ZHKA 3MA7A 4N0YL 2R8SL 3OXRA 3RGVC 3GMOB 3QJFA 3L1OH 4N5EC 1SY6H 4C56B 1FO0A 4P2OD 4WFHE 2GKIA 3CFCL 1QFWI 4PRIE 3R8QA 5K9OA 2IG2L 5FGSA 1GC1H 4JKKA 2YHGA 3T0EE 4NKMA 35C8L 5EPMA 1BQLH 1X5HA 2BRRH 4XP6L 1P5UA 4WEMB 3UPRB 1BWWA 5DQ9A 1EXUB 4MGXA 2VDPH 1R3IH 4PJ7A 3MZGB 1IZKA 2GK0B 4R8WL 3DBXA 1EGJA 1H0DB 2ESVA 4XHQA 4AG4H 5MP6L 1CE1H 3K8KA 1URLA 3P4LA 3M1BA 2V9RA 3E0GA 4I18C 3AMKA 4TOYL 2BOCB 1X5AA 3EHBD 4UT7L 1ZLUH 5FKAA 5K9OB 5H37H 5EZJA 1DBJL 4Q9BA 3T3PF 5CFHA 3VFMB 4YZFF 5JHDA 5IOPA 4R0LA 3BPOC 3M8OL 2VL5B 3HZMB 4YDKL 5HHPA 5DJZB 4X7EC 5DGRA 5F6HI 1LP9E 3QUYC 3FRUA 4JY6B 3WCYA 4APQB 4DN4L 4X4MA 5DURB 2P8PB 1RZKL 4J7RA 1FNGA 2V7NB 5F7WC 5A3ID 3IU3A 3C60D 3QEQB 5C6PB 1V7MH 1VFAB 1YNLH 1RPQA 3LKSB 4J3TA 4P5MB 1OF2B 5CP3H 5DS8B 4ZS6D 1G7LA 5H94B 1F42A 3RL2B 4NQED 2PCPA 5JO5A 3VWKA 1OARL 4IRSC 4YBLB 4Y5XA 2OR7A 1S7XA 2GJ6A 2Z31C 5IT2L 5ACLA 1BF2A 1DE4A 1JWSB 1U8LB 3QXDA 2EDYA 1FH5H 2BRRL 4OCSH 1QSVA 5E9DD 1VA9A 1E6OL 1QRNB 5GGSB 4RFEB 3VWJD 4J3UA 3SBWA 3GMMB 1F90H 1A7PH 1KULA 1TZIB 2VLJB 4Z78A 3NZHH 1MHHB 3HKFA 1ZEAH 4A6YB 4UT7H 1VENA 4MNHA 4G80A 4QRSA 5C0CE 5D5MF 4LRIA 5HHXL 1O0VA 2XWJB 2XN9B 4JY6A 1TETL 4PJGA 5DJDB 4OFDA 5FGBA 3O4LD 5DSCB 2YK1L 1CWVA 4RCAA 1VFAA 4X83A 3BGFC 3SDDC 2KPNA 1KEGH 2X7LB 4ZXBA 1CQYA 4QRUA 5KVFH 3A6CL 1NUNB 2YN5A 3K3QA 1HQRB 1NGWB 3DXAA 1BD2B 3WO4C 4WHYH 3B6SA 1JF6A 1MLCB 1XF4A 4HCRL 4WW2C 3VFUB 3ZYJA 1YN7B 2FATL 1SYVA 2FL5B 4LCWB 5IJKA 2OTPA 1W0VA 3VRJA 1MFCL 1NCTA 2HRPL 2B2XH 5E9DA 2ICWJ 2NXZD 5JW5A 1ZT7A 2D7QA 5D2LA 3VGFA 3MRJA 3QDMD 4HIXH 5FEBA 5I1AB 1FVCA 5BVJA 1IFHL 2G9HB 5I1DB 4WHTB 1HIML 1NJ9A 4FTVB 3QUXC 2H1PL 3FTGB 5EO0A 4X80L 3OAUL 4KKCC 3LEVH 2P8MA 4IJ3C 2Z93A 4Y4KA 5ETUB 1HZHL 5GZOD 1ES0B 2F5AH 3HE6D 4Y8DC 2XICA 3S98A 4F58L 4I18A 1HXMA 3L3KA 5M95B 5IM7B 2YXFA 1SBSL 4FQIL 3ULUF 4GAYB 3LKPB 1R5IA 2CKBH 4D9RD 3VFWA 2AKRB 3F7YB 3NA9L 4KK6C 5KVDL 3TO4B 1ZLVK 4YFLI 1DP0A 4NQSB 3QEUB 1NANH 2HN7B 1WJ3A 1RJYA 1SQ2N 5DMGC 5BS0B 3HC3L 4AY0A 4KFZC 4PPTA 4LEXL 4GRLB 1IBGL 4PRBB 4RFEA 1QEWA 3SE3A 1HHJB 2ILLA 2NPLX 4HWEL 1EZVX 3HNVL 2X1OA 3MUZ1 2IQAA 4N0FB 3CSGA 5DWUH 3F65A 4KJQD 4NSKA 1O5DT 4YHZH 3P0VL 4F2MA 1UKTA 4M7JH 2Q20A 5E24E 1DQJB 2HFFA 3HRPA 2F58H 2VNCA 1XH3B 2Z35B 3IXAB 1D9KC 2BDNH 5DSCA 5ESVA 3VFGL 4NRXB 4OZIE 1OP5H 5JW4M 3MR9A 1B0RB 1WAAE 3PWPA 4IOSD 4FMFA 3HHRB 2N7BA 2W0LA 4XXCC 5IBLC 2YD4A 3LQZA 4X7SH 2PTUA 5FKPB 1KBGH 1FNGB 2OTWA 4C55A 1UM6H 4JO3L 1ETZA 3QAZB 4WTZG 4Z95H 4Z7OF 1FFOB 1VFMA 2XTJD 4Y1AA 1Q9LB 5J6GB 4PGBA 2Q76B 3TBVB 1I7ZB 3WIHH 4RMRA 1IEAA 4EDWH 2FGWL 4HWNA 4XCFH 3QFDB 3EHBC 5E8OA 4ZAKA 4XMLH 2AJYL 2R0KL 3W39A 4JQIL 3FB8B 4HHAA 4B53A 2GIYA 4KY1L 1EDQA 4MQ7A 1CGUA 3MV9D 3EDFA 1U8OA 4CADB 2PR4L 1IAII 2IBGA 2PXYD 1K5NA 2ZSVB 5I73C 2YSSA 4GMSL 1BIIB 5IHZA 1QA9A 4O5LH 4QWWD 3QP3A 3T0DA 1U91B 5DJ6A 1CD0A 5I30H 1G7QA 2DM4A 3VDCA 1F3DH 1ACYH 5T3XD 4I4WB 4LSSH 3TESA 5E08H 3JV4B 2XTJC 3ARFD 1WIPA 4G5ZH 2R2EA 4KDVA 4G6MH 5B38A 3HC4H 2AXFB 2UWEA 3THMH 3ARDD 1S7RA 3OKYA 5DJCB 1UACL 3F12A 1CLYL 3EJJX 2X70A 1IKFH 3QUMA 4TTGA 3VFOB 1OGAB 2Q7YB 4MA3B 2ZCKH 1KTRL 1AGEA 2O5XL 3TPKA 1QNZL 3QEGL 3RPIA 1MHEB 3U9UA 3KG5A 4U1SA 5KOVC 1GOFA 2AJ3B 3KJ4B 1JZ2A 2XA8H 1L9MA 1S7WB 1MVUA 4PJGF 5I8OH 1SY6A 4NFBA 1T1XA 5JR1H 3ARPA 3F12B 3VD9A 1H3VA 4P3DB 3S37L 1FZJB 4HZLA 4FP8H 4HJJL 3PGDA 4P2QD 1AP2B 2WV3A 4LCYA 4NBZB 3LY6A 2NYYC 1OTTD 4CDGC 4M6AA 1P9MA 2BJMH 1W72A 5FYJE 5EZIL 3QIBC 1FFPA 4MQXC 5GS3A 4X6EB 4ZPTA 5TQ2H 2VXUL 1IAIL 3R1GL 1EXUA 3SE3C 2AEWA 2HKFL 3E6FA 1RZ7H 1RUAL 4IRJC 5E1AB 3MFFA 4K94H 1FIGH 1HEZA 1VFBA 2J5LB 2VWEE 4CDHA 3N50A 3BRDA 4I13B 2MCPH 2DJSA 3MRHA 2R0LH 3HE7D 4S2SB 3BWUC 5EU3B 4V2CB 1BFVL 1JF1A 4J8RA 2WMPA 5L7XH 3QFJE 2R1YA 3VDBA 2DQGL 3BVNB 4PJFE 3P4OA 3TF7C 3FQTA 5HDBE 3HMXL 3O6KH 3ZE0F 3FO0L 3GB7A 1AD0A 3REVA 2IBBA 3UZVB 3ORJA 2CUHA 1QLEH 1YN6A 1N7ML 3QRGL 3RIAF 1AKJA 1DQDL 1INEL 5EO1A 2Z31D 5L6YH 1ZS8A 3L5HA 1UWGH 1CL7H 1OGTA 3RGHA 2FEDD 1NCWL 4JJ5B 1JHLL 3RTQD 5DRZB 2H32A 1XGTB 2CLZB 3CH1B 2R0ZH 2VKWA 4ZXBD 1BJ8A 5HHOE 1IC4H 1FRGL 2ZJSH 1D3CA 5SX5H 4CNIA 3GHEL 1QSFA 1PSKH 5AAMA 1MHCB 5E95B 1A6VH 3HI5L 4M02A 5IR1A 5KN5A 4Y19E 4ZSOB 1RUPH 1GIGH 4OZIF 4WFEE 1VKXA 4W6XB 1HSAB 2FSEB 5EWIH 2GSIA 4I8DA 1U9KA 4L29B 3HG1E 4F57L 3MOQA 4GAFB 3ARYA 2AGJL 5IBUB 2CIKB 1OCWL 3T04D 2YOCA 1I1YB 4OUOA 2AJ3A 2R0LL 4HPOL 4BUGA 3DLQR 3U9UB 4APQA 4TSCH 1AQDA 1S5IL 4ZXBC 1N26A 2DQIH 4LLDA 5DHXB 1AI1L 1YECL 4HK0B 4YEEA 4KJQC 3QIBB 3IU4H 1A6ZA 4HKXA 2BOBB 2V7HB 3RP1A 1OM3L 4ZFGL 5I1EL 4KTEL 5HDQH 2I24N 4M1GL 4YK4B 5HGHB 1KT2A 1OD7A 1BVLB 3IS0X 1P5VA 1PVHA 2FH8A 4DKEL 1KIPA 4M7LH 3RGVA 1J86A 1EHNA 3ZKMC 1AHWA 5EIIA 2EDRA 1U91A 4MA1C 5DJ6B 2MJWA 1NFIA 4TUKH 5J7CC 3TNMA 1KPRB 1K4CA 2JIXA 1DN0B 1FYHB 2IFFL 5C0ND 4MJIA 4YHLL 1B4RA 3VXNA 2Y36H 2P49B 1A1MA 4HAFA 3A6OA 4MLIA 1QLRA 1EIBA 3HI6L 4X98B 3BT2L 3QO1A 3VXMA 1PKQE 1S5HA 4PP2A 3LZFL 5CGYC 5GGVY 1N64L 5IVXB 1Z5LA 2XWJA 4HEPG 1U8KA 4BM7A 1UB6B 5FYKL 5CKGA 1NQBA 3BO8A 3C8DA 3MNZA 5DDHA 1FN4A 3PXJA 5ENWB 5JPMA 3HPLB 5CHNB 5ANMB 1JPFA 5DD5H 2Q86B 5E99H 5EN2A 4NZUL 4YXKH 1LEKA 3SDAB 2GJ6E 3MJ7A 5ALCL 4PJDE 1MAJA 1N0LA 1ZHNB 3VG0H 3QDGD 3LKNA 3HZKA 5C92A 4ZDHB 1DQLH 4R4NC 1FGNL 4LNRA 3ZDZF 4PJ8B 1BVKB 1FZKA 4X7TB 1L0XA 3FFCE 3F7PC 1FQ9C 5IW1B 1UG9A 4NN7C 5T1KB 4YHML 3MC0A 3ARBA 1SEQH 5HGDB 4FA8A 5HYSG 1MH5A 5I71C 1MCIA 2FH6A 3WKMH 1C16A 2QHRL 3LHPL 5MEND 3MCLH 1CDGA 4TPRH 2E9JA 4M5YL 1MCCA 4YHPA 2X44D 3HE7B 4LSTL 3T0VA 1CICD 4X0KA 1N4XH 3X3FL 3L5XH 4PJEA 3KPQA 2EH8H 5ID1A 2H2SC 1ED3A 1JYWA 2N1KA 2D0GA 4NQCB 1ZLWH 5GZND 2OBGA 4JDZA 5DZOA 4BKLB 1MNUH 5CCKL 1WCBA 3D0LA 2X4SB 4ZUVA 2I9TA 2KH2B 1WISA 1PX4A 5D1XD 3K1DA 1A6WH 1LEGA 4HWBH 3ARGC 4P2CG 1CXEA 1KEMH 1KG0A 1YYML 5GIRB 4MLSA 4QWWC 3QUXB 2V5MA 2VTFA 3R0NA 1F8TL 4K7PY 1ZLWK 3ZKMD 32C2A 4IIQA 1QBLH 3X3GH 4FFYL 3S88H 1NC2A 4NNPL 4QXUL 5TF0A 3MLTB 1NBYB 4Z7NE 2CIIB 4LPWA 4MVBD 1F4XL 4R2GD 5HGBB 3SKNB 1T04B 4BZ1H 2VR5A 1DEEB 4Z7UB 1U93B 3VGBA 3K8LA 1MCHA 4JANA 3LN9A 2A0LC 3GGWB 1X5GA 3A67L 2ZG2A 3SDCA 3QIUC 4M6OH 3MLZL 1JNNL 3VI3F 1MJJB 1I9RL 4LF3A 5CGTA 3HNTL 5E8DL 4OJFH 5GRXG 3KYOA 2Y06L 4NSKB 1TVBA 1JGUH 2YUZA 4BFGA 4PJ9B 4LU5L 1MJUL 3C09C 5LCVH 2FBJL 1DSFH 1PD6A 2YD3A 5I66A 1BQHG 1OLZA 2ADGA 2OZ4L 4WI8A 3BGMB 5TDNA 4JVUA 1KIRA 3U36B 1CCZA 1A7NL 2SEBA 1FL5B 1KT2B 3RA7L 2ZKHH 4PY8J 3ZLQC 4Z76A 3O4OC 2WAHA 5CD3A 3SDAD 4S11A 1C5BL 5B39A 4HKXB 3OX8A 3FHAA 3MUY1 2QKIA 4NQUA 2VDLL 1MCNA 4R26H 1J0JA 1S7UA 5FAAA 2NX5A 4QRTA 2O5XH 1CT8B 3X12A 5FYLL 4F15B 1BBDH 2OJZL 2R8SH 2GTZA 3KHOA 3WS6C 3OAYH 3MRGA 3FT2A 3GIVB 4MHHI 2Q8AH 4G8GA 2JJSA 43CAB 1W72L 1JGLH 1ODAA 1BZ9B 2HLAB 4K23L 5BW7A 4N90D 1U8IB 2AEQH 5FHAH 2MTPA 3T77A 1W0YT 5GSRB 5IMLA 2C26A 5SWSD 3F8UB 1B2WH 1KJ2H 2W59A 3GIZL 4QHLA 4LOUC 4U6VL 4GRWE 3JWOC 1QR1A 1EHAA 4PIRF 3NZ8B 4MJ2A 4P5KA 1NBQA 5CP3A 3QCTH 5FA3A 2IMNA 3IVKB 1AGFB 3C87A 2X4SA 2DM7A 4ZUUA 4Z5RB 5E7BA 3UAJC 4OB5H 1Z2KA 4K9EC 1IL1A 3QWOB 4QRQB 4HC1H 2W65B 1QKZH 5D72H 2ENYA 4Y19D 4JFHE 4XB8A 4PRPD 4LSRL 1XIWC 2ZOLB 4KGJA 3EDEA 5D93B 5DTFB 5D93C 3DV4A 5HHOB 1FZOA 2Q8BH 3NN8A 4KHTH 3CH8A 4HT1H 3WXWH 4MB4A 4N9OB 3OGCB 3V8CA 3HZVA 5EOCH 2ZCHL 5HPMA 5D7IF 2EZ0D 1FGVL 1RK1A 1KIQB 4FFVC 2XI9A 3RY5A 4JKPL 3LS5H 2NY3D 3PQYD 5C70A 4P57B 3RY6C 4PRAA 1QQDA 2AK4D 3KLDA 3U4EA 1SJEB 3CDCA 3WLBB 3TN0A 1JGDB 1N0XL 2L7JA 3AFLA 3V5HA 1PX3A 2FYYB 3HE6B 4Q2ZA 5F3BA 1AH1A 1EO8H 1NDGA 3HA0A 3BPLC 3MA9H 3TYFB 5IB2A 2CMRL 5DWUL 1RY7B 5CIPB 4D8PA 4BELD 3HS0A 5B3JF 4R97C 1S8DA 3CUPA 4DKDC 2DL9A 2V2TA 1RK1B 1PG7H 1MFEL 1NAMH 3STLA 1B4JL 3LKOA 3U30B 4Y2DC 3FN3A 2ITDB 4Z8FH 3V8OA 1QLRB 2DBLL 4EN3C 3BKYL 4XCCL 3BEVA 2EC8A 3QBTB 2DTSA 3G6DH 4OCRL 4CU8A 1JNJA 4NJ9H 3MNWA 5E99L 5DC0A 5BV7L 1I1AA 3QWRA 2V2WA 1MELA 1YY9C 1JZ3A 2GUOA 3LSOB 5F9DC 1NBYA 4E5XB 1NMBL 5IW6A 1GL4B 2YD1A 2PTTA 4I2XE 4PS4L 4HIJB 4Y4HC 1RULL 4LQFL 1IC1A 4WTWA 4YHNB 2AEIT 2Q8BL 5JIKA 1NLDH 1CLOH 1SYSB 4O00A 1IC7L 1FGNH 4QT5B 4N9GB 5DRWA 3PV6B 1HILA 2YWYA 4TNWK 2DWEA 5D1ZB 1U6AL 3DNKA 3OL2A 3RVWC 3KDMB 3GSNA 3SKMA 1RZGA 3O11A 2AJVH 4EKXA 3O41A 2VLLB 1RZKC 4K94C 5H37G 4QOKE 2MCG1 3K0WA 4M5YH 1B90A 3BQUB 1MQKL 4RMSA 3D25B 1L7IL 4XRCA 3F6IA 5I9QC 2B4CH 2EH7L 4WUUB 1F58H 2OP4H 5IJKC 2BHZA 4XPGH 2EYTA 3I85A 1JJUA 1MPAL 5F1OB 4DGYL 2NLJA 4F9LA 3D9AL 3JTSB 2WWMC 1UM5L 2A0LD 2BY2A 5BRZD 5IB5B 1F2XK 3V4UH 4LAJH 5KSBF 3ULVL 2PO6C 4I3RL 1FFQA 3HNSH 4D0BB 1UWXH 4H88H 3RI5F 1JI2A 4UOW1 4OM0H 5KVGH 1J0YA 2EDLA 4AEEA 3EIFA 1D5IL 2R23B 3WFHA 4N1HB 5C0BD 4Z7VE 4ZFFB 3L5WA 4NGHL 4LSUL 3QUYB 4IRSA 2MQ3A 4FQQB 2NW3A 3IF1B 1HKLH 4OZFB 5I1CH 1SVZA 1Z9OA 1N5AB 5GRUH 4LDLB 1YMME 2RCSL 1UXSA 3KPOA 4M43L 4XVJL 2AK1L 4ZOCA 1DQJA 4NUGL 3TJEH 5EBWA 4GAJL 3QIWB 3U82B 4ALAH 1S9XA 1QPPA 5C6WH 1A6AB 2BY3A 3GSRA 3ZT5A 1YY9D 3EFDH 4XNMA 3O4LE 4M8QB 2FEEL 5EO9A 3VXPA 4OAWA 3QUMH 2IANA 4UMGA 2DMBA 1XF3A 2DKMA 3K2UH 4QXGL 3CSPA 4ZODA 3TGXA 3QEGH 5EORH 1AGDA 4M6MH 1WBZB 3GJEA 4LVHB 3RX5A 2Y5EA 3RWFB 1YEKL 3FKUS 2D9CA 2PW1B 1FNEA 5DJZA 2FX9H 2DMCA 3PWJB 3QCUL 3J7HA 5E5UB 1MUJA 1F4YH 2BNRD 3QNZB 3WYRA 1Z6JT 3BP6B 4PRPE 2W9EL 4F7TB 5BZDB 5KW9L 1V3KA 2BVUA 1PZ5A 5C8JA 2RIKA 4XP5L 5F9JB 3U1SH 3H7BA 3BN9D 1QLFA 4JM2C 3CFKA 2VXUH 4OF0A 1PKQA 2A6JA 2VQTA 1ZSDB 1Q94B 1CGWA 1EEQA 1ZLUK 3PF2A 4U1JA 2ZP0T 4IRZH 3MGTB 2QQKH 4YBQC 2ZJSL 4I9WD 3SKOB 4CADA 3GBNL 4AJ0A 2DM3A 3BISA 1RI8A 2WLZA 5DJ2A 4PGEA 1W0VB 3VRJB 4AL8L 4PJHB 3WV0A 5KAQG 2P5WA 4QXGH 1BQSA 5J1AB 4K7PL 1CLZL 4QOKA 1MCWM 3MRLB 1G7QB 2VLME 4YK4C 3EOAB 4WW1B 3HFMH 3Q1SH 5F44A 3GMNA 1QVOA 5AUMA 4X6DB 4LHUG 1CDHA 1NC4D 5FF6A 4HIIA 5B3NA 4LOUD 2E7CA 1PDKA 5E4EC 2CRYA 2E6PA 4XVTH 4CMHC 3IAQA 3WXWL 5FO8A 3QUZC 4YHKL 1CL7L 2BSTB 2HTLC 4DVRH 2ARJB 1JPSL 4DK3A 3OKNB 3LIZH 2CDFB 1J8HD 2EXWD 5D1QB 2ICWB 3ARGA 4QYOB 2JB5L 1KJ3H 2DIJA 1A6TA 4HUVA 5TDPA 3WIFB 4KI1A 3KLAB 4PYHA 4G6KH 3AS1A 5C0IA 1FZOB 5C2BL 3FCTA 4XPHL 4J4PC 4OQTL 3QI9C 2B1AL 3FB6A 3TWCL 4L4TB 4PJXA 5DHVB 1PG7W 4JFEB